(data stored in ACNUC7421 zone)

EMBL: CP000386

ID   CP000386; SV 1; circular; genomic DNA; STD; PRO; 3225748 BP.
XX
AC   CP000386; AAEB02000000-AAEB02000149;
XX
PR   Project:PRJNA10670;
XX
DT   10-JUN-2006 (Rel. 88, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Rubrobacter xylanophilus DSM 9941, complete genome.
XX
KW   .
XX
OS   Rubrobacter xylanophilus DSM 9941
OC   Bacteria; Actinobacteria; Rubrobacteria; Rubrobacterales; Rubrobacteraceae;
OC   Rubrobacter.
XX
RN   [1]
RP   1-3225748
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Munk A.C., Brettin T., Bruce D., Han C., Tapia R., Gilna P., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Lykidis A., da Costa M.S.,
RA   Rainey F.A., Empadinhas N., Jolivet E., Battista J.R., Richardson P.;
RT   "Complete sequence of Rubrobacter xylanophilus DSM 9941";
RL   Unpublished.
XX
RN   [2]
RP   1-3225748
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Munk A.C., Brettin T., Bruce D., Han C., Tapia R., Gilna P., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Lykidis A., da Costa M.S.,
RA   Rainey F.A., Empadinhas N., Jolivet E., Battista J.R., Richardson P.;
RT   ;
RL   Submitted (07-JUN-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 8f60922f548ce5d362a7b3c9ed35474d.
DR   BioSample; SAMN02598258.
DR   CABRI; DSM 9941.
DR   EnsemblGenomes-Gn; EBG00001202553.
DR   EnsemblGenomes-Gn; EBG00001202555.
DR   EnsemblGenomes-Gn; EBG00001202559.
DR   EnsemblGenomes-Gn; EBG00001202561.
DR   EnsemblGenomes-Gn; EBG00001202562.
DR   EnsemblGenomes-Gn; EBG00001202563.
DR   EnsemblGenomes-Gn; EBG00001202564.
DR   EnsemblGenomes-Gn; EBG00001202565.
DR   EnsemblGenomes-Gn; EBG00001202566.
DR   EnsemblGenomes-Gn; EBG00001202568.
DR   EnsemblGenomes-Gn; EBG00001202570.
DR   EnsemblGenomes-Gn; EBG00001202571.
DR   EnsemblGenomes-Gn; EBG00001202572.
DR   EnsemblGenomes-Gn; EBG00001202573.
DR   EnsemblGenomes-Gn; EBG00001202574.
DR   EnsemblGenomes-Gn; EBG00001202576.
DR   EnsemblGenomes-Gn; EBG00001202579.
DR   EnsemblGenomes-Gn; EBG00001202582.
DR   EnsemblGenomes-Gn; EBG00001202584.
DR   EnsemblGenomes-Gn; EBG00001202586.
DR   EnsemblGenomes-Gn; EBG00001202588.
DR   EnsemblGenomes-Gn; EBG00001202590.
DR   EnsemblGenomes-Gn; EBG00001202592.
DR   EnsemblGenomes-Gn; EBG00001202594.
DR   EnsemblGenomes-Gn; EBG00001202596.
DR   EnsemblGenomes-Gn; EBG00001202598.
DR   EnsemblGenomes-Gn; EBG00001202600.
DR   EnsemblGenomes-Gn; EBG00001202602.
DR   EnsemblGenomes-Gn; EBG00001202604.
DR   EnsemblGenomes-Gn; EBG00001202605.
DR   EnsemblGenomes-Gn; EBG00001202607.
DR   EnsemblGenomes-Gn; EBG00001202609.
DR   EnsemblGenomes-Gn; EBG00001202610.
DR   EnsemblGenomes-Gn; EBG00001202611.
DR   EnsemblGenomes-Gn; EBG00001202612.
DR   EnsemblGenomes-Gn; EBG00001202613.
DR   EnsemblGenomes-Gn; EBG00001202614.
DR   EnsemblGenomes-Gn; EBG00001202615.
DR   EnsemblGenomes-Gn; EBG00001202616.
DR   EnsemblGenomes-Gn; EBG00001202618.
DR   EnsemblGenomes-Gn; EBG00001202619.
DR   EnsemblGenomes-Gn; EBG00001202621.
DR   EnsemblGenomes-Gn; EBG00001202622.
DR   EnsemblGenomes-Gn; EBG00001202623.
DR   EnsemblGenomes-Gn; EBG00001202624.
DR   EnsemblGenomes-Gn; EBG00001202625.
DR   EnsemblGenomes-Gn; EBG00001202626.
DR   EnsemblGenomes-Gn; EBG00001202627.
DR   EnsemblGenomes-Gn; EBG00001202629.
DR   EnsemblGenomes-Gn; EBG00001202631.
DR   EnsemblGenomes-Gn; EBG00001202632.
DR   EnsemblGenomes-Gn; EBG00001202633.
DR   EnsemblGenomes-Gn; EBG00001202634.
DR   EnsemblGenomes-Gn; EBG00001202635.
DR   EnsemblGenomes-Gn; EBG00001202636.
DR   EnsemblGenomes-Gn; EBG00001202637.
DR   EnsemblGenomes-Gn; EBG00001202638.
DR   EnsemblGenomes-Gn; EBG00001202639.
DR   EnsemblGenomes-Gn; EBG00001202640.
DR   EnsemblGenomes-Gn; EBG00001202641.
DR   EnsemblGenomes-Gn; EBG00001202643.
DR   EnsemblGenomes-Gn; EBG00001202645.
DR   EnsemblGenomes-Gn; EBG00001202647.
DR   EnsemblGenomes-Gn; EBG00001202649.
DR   EnsemblGenomes-Gn; EBG00001202650.
DR   EnsemblGenomes-Gn; EBG00001202651.
DR   EnsemblGenomes-Gn; EBG00001202652.
DR   EnsemblGenomes-Gn; EBG00001202654.
DR   EnsemblGenomes-Gn; EBG00001202656.
DR   EnsemblGenomes-Gn; EBG00001202657.
DR   EnsemblGenomes-Gn; EBG00001202658.
DR   EnsemblGenomes-Gn; EBG00001202659.
DR   EnsemblGenomes-Gn; EBG00001202660.
DR   EnsemblGenomes-Gn; EBG00001202661.
DR   EnsemblGenomes-Gn; EBG00001202662.
DR   EnsemblGenomes-Gn; EBG00001202663.
DR   EnsemblGenomes-Gn; EBG00001202664.
DR   EnsemblGenomes-Gn; EBG00001202665.
DR   EnsemblGenomes-Gn; EBG00001202667.
DR   EnsemblGenomes-Gn; EBG00001202668.
DR   EnsemblGenomes-Gn; EBG00001202669.
DR   EnsemblGenomes-Gn; EBG00001202670.
DR   EnsemblGenomes-Gn; EBG00001202671.
DR   EnsemblGenomes-Gn; EBG00001202673.
DR   EnsemblGenomes-Gn; EBG00001202675.
DR   EnsemblGenomes-Gn; EBG00001202677.
DR   EnsemblGenomes-Gn; EBG00001202679.
DR   EnsemblGenomes-Gn; EBG00001202681.
DR   EnsemblGenomes-Gn; EBG00001202682.
DR   EnsemblGenomes-Gn; EBG00001202683.
DR   EnsemblGenomes-Gn; EBG00001202684.
DR   EnsemblGenomes-Gn; EBG00001202685.
DR   EnsemblGenomes-Gn; EBG00001202686.
DR   EnsemblGenomes-Gn; EBG00001202688.
DR   EnsemblGenomes-Gn; EBG00001202690.
DR   EnsemblGenomes-Gn; EBG00001202692.
DR   EnsemblGenomes-Gn; EBG00001202693.
DR   EnsemblGenomes-Gn; EBG00001202694.
DR   EnsemblGenomes-Gn; EBG00001202695.
DR   EnsemblGenomes-Gn; EBG00001202696.
DR   EnsemblGenomes-Gn; EBG00001202697.
DR   EnsemblGenomes-Gn; EBG00001202698.
DR   EnsemblGenomes-Gn; EBG00001202700.
DR   EnsemblGenomes-Gn; Rxyl_R0002.
DR   EnsemblGenomes-Gn; Rxyl_R0003.
DR   EnsemblGenomes-Gn; Rxyl_R0005.
DR   EnsemblGenomes-Gn; Rxyl_R0006.
DR   EnsemblGenomes-Gn; Rxyl_R0008.
DR   EnsemblGenomes-Gn; Rxyl_R0010.
DR   EnsemblGenomes-Gn; Rxyl_R0011.
DR   EnsemblGenomes-Gn; Rxyl_R0012.
DR   EnsemblGenomes-Gn; Rxyl_R0013.
DR   EnsemblGenomes-Gn; Rxyl_R0014.
DR   EnsemblGenomes-Gn; Rxyl_R0015.
DR   EnsemblGenomes-Gn; Rxyl_R0016.
DR   EnsemblGenomes-Gn; Rxyl_R0017.
DR   EnsemblGenomes-Gn; Rxyl_R0019.
DR   EnsemblGenomes-Gn; Rxyl_R0020.
DR   EnsemblGenomes-Gn; Rxyl_R0021.
DR   EnsemblGenomes-Gn; Rxyl_R0022.
DR   EnsemblGenomes-Gn; Rxyl_R0023.
DR   EnsemblGenomes-Gn; Rxyl_R0024.
DR   EnsemblGenomes-Gn; Rxyl_R0026.
DR   EnsemblGenomes-Gn; Rxyl_R0027.
DR   EnsemblGenomes-Gn; Rxyl_R0028.
DR   EnsemblGenomes-Gn; Rxyl_R0029.
DR   EnsemblGenomes-Gn; Rxyl_R0030.
DR   EnsemblGenomes-Gn; Rxyl_R0031.
DR   EnsemblGenomes-Gn; Rxyl_R0032.
DR   EnsemblGenomes-Gn; Rxyl_R0033.
DR   EnsemblGenomes-Gn; Rxyl_R0034.
DR   EnsemblGenomes-Gn; Rxyl_R0035.
DR   EnsemblGenomes-Gn; Rxyl_R0036.
DR   EnsemblGenomes-Gn; Rxyl_R0037.
DR   EnsemblGenomes-Gn; Rxyl_R0038.
DR   EnsemblGenomes-Gn; Rxyl_R0040.
DR   EnsemblGenomes-Gn; Rxyl_R0041.
DR   EnsemblGenomes-Gn; Rxyl_R0042.
DR   EnsemblGenomes-Gn; Rxyl_R0043.
DR   EnsemblGenomes-Gn; Rxyl_R0044.
DR   EnsemblGenomes-Gn; Rxyl_R0045.
DR   EnsemblGenomes-Gn; Rxyl_R0046.
DR   EnsemblGenomes-Gn; Rxyl_R0047.
DR   EnsemblGenomes-Gn; Rxyl_R0049.
DR   EnsemblGenomes-Gn; Rxyl_R0050.
DR   EnsemblGenomes-Gn; Rxyl_R0052.
DR   EnsemblGenomes-Gn; Rxyl_R0054.
DR   EnsemblGenomes-Gn; Rxyl_R0056.
DR   EnsemblGenomes-Gn; Rxyl_R0057.
DR   EnsemblGenomes-Gn; Rxyl_R0058.
DR   EnsemblGenomes-Gn; Rxyl_R0059.
DR   EnsemblGenomes-Gn; Rxyl_R0061.
DR   EnsemblGenomes-Gn; Rxyl_R0062.
DR   EnsemblGenomes-Tr; EBT00001573454.
DR   EnsemblGenomes-Tr; EBT00001573455.
DR   EnsemblGenomes-Tr; EBT00001573456.
DR   EnsemblGenomes-Tr; EBT00001573457.
DR   EnsemblGenomes-Tr; EBT00001573459.
DR   EnsemblGenomes-Tr; EBT00001573460.
DR   EnsemblGenomes-Tr; EBT00001573461.
DR   EnsemblGenomes-Tr; EBT00001573462.
DR   EnsemblGenomes-Tr; EBT00001573463.
DR   EnsemblGenomes-Tr; EBT00001573464.
DR   EnsemblGenomes-Tr; EBT00001573467.
DR   EnsemblGenomes-Tr; EBT00001573469.
DR   EnsemblGenomes-Tr; EBT00001573471.
DR   EnsemblGenomes-Tr; EBT00001573473.
DR   EnsemblGenomes-Tr; EBT00001573475.
DR   EnsemblGenomes-Tr; EBT00001573477.
DR   EnsemblGenomes-Tr; EBT00001573478.
DR   EnsemblGenomes-Tr; EBT00001573482.
DR   EnsemblGenomes-Tr; EBT00001573484.
DR   EnsemblGenomes-Tr; EBT00001573485.
DR   EnsemblGenomes-Tr; EBT00001573488.
DR   EnsemblGenomes-Tr; EBT00001573490.
DR   EnsemblGenomes-Tr; EBT00001573492.
DR   EnsemblGenomes-Tr; EBT00001573494.
DR   EnsemblGenomes-Tr; EBT00001573495.
DR   EnsemblGenomes-Tr; EBT00001573497.
DR   EnsemblGenomes-Tr; EBT00001573499.
DR   EnsemblGenomes-Tr; EBT00001573501.
DR   EnsemblGenomes-Tr; EBT00001573504.
DR   EnsemblGenomes-Tr; EBT00001573506.
DR   EnsemblGenomes-Tr; EBT00001573508.
DR   EnsemblGenomes-Tr; EBT00001573509.
DR   EnsemblGenomes-Tr; EBT00001573511.
DR   EnsemblGenomes-Tr; EBT00001573512.
DR   EnsemblGenomes-Tr; EBT00001573515.
DR   EnsemblGenomes-Tr; EBT00001573517.
DR   EnsemblGenomes-Tr; EBT00001573519.
DR   EnsemblGenomes-Tr; EBT00001573523.
DR   EnsemblGenomes-Tr; EBT00001573524.
DR   EnsemblGenomes-Tr; EBT00001573525.
DR   EnsemblGenomes-Tr; EBT00001573526.
DR   EnsemblGenomes-Tr; EBT00001573528.
DR   EnsemblGenomes-Tr; EBT00001573531.
DR   EnsemblGenomes-Tr; EBT00001573533.
DR   EnsemblGenomes-Tr; EBT00001573535.
DR   EnsemblGenomes-Tr; EBT00001573538.
DR   EnsemblGenomes-Tr; EBT00001573540.
DR   EnsemblGenomes-Tr; EBT00001573541.
DR   EnsemblGenomes-Tr; EBT00001573542.
DR   EnsemblGenomes-Tr; EBT00001573544.
DR   EnsemblGenomes-Tr; EBT00001573546.
DR   EnsemblGenomes-Tr; EBT00001573549.
DR   EnsemblGenomes-Tr; EBT00001573552.
DR   EnsemblGenomes-Tr; EBT00001573556.
DR   EnsemblGenomes-Tr; EBT00001573558.
DR   EnsemblGenomes-Tr; EBT00001573559.
DR   EnsemblGenomes-Tr; EBT00001573561.
DR   EnsemblGenomes-Tr; EBT00001573562.
DR   EnsemblGenomes-Tr; EBT00001573566.
DR   EnsemblGenomes-Tr; EBT00001573568.
DR   EnsemblGenomes-Tr; EBT00001573571.
DR   EnsemblGenomes-Tr; EBT00001573574.
DR   EnsemblGenomes-Tr; EBT00001573577.
DR   EnsemblGenomes-Tr; EBT00001573580.
DR   EnsemblGenomes-Tr; EBT00001573581.
DR   EnsemblGenomes-Tr; EBT00001573586.
DR   EnsemblGenomes-Tr; EBT00001573587.
DR   EnsemblGenomes-Tr; EBT00001573589.
DR   EnsemblGenomes-Tr; EBT00001573592.
DR   EnsemblGenomes-Tr; EBT00001573595.
DR   EnsemblGenomes-Tr; EBT00001573597.
DR   EnsemblGenomes-Tr; EBT00001573601.
DR   EnsemblGenomes-Tr; EBT00001573603.
DR   EnsemblGenomes-Tr; EBT00001573606.
DR   EnsemblGenomes-Tr; EBT00001573608.
DR   EnsemblGenomes-Tr; EBT00001573610.
DR   EnsemblGenomes-Tr; EBT00001573613.
DR   EnsemblGenomes-Tr; EBT00001573615.
DR   EnsemblGenomes-Tr; EBT00001573617.
DR   EnsemblGenomes-Tr; EBT00001573618.
DR   EnsemblGenomes-Tr; EBT00001573621.
DR   EnsemblGenomes-Tr; EBT00001573622.
DR   EnsemblGenomes-Tr; EBT00001573623.
DR   EnsemblGenomes-Tr; EBT00001573625.
DR   EnsemblGenomes-Tr; EBT00001573629.
DR   EnsemblGenomes-Tr; EBT00001573630.
DR   EnsemblGenomes-Tr; EBT00001573633.
DR   EnsemblGenomes-Tr; EBT00001573636.
DR   EnsemblGenomes-Tr; EBT00001573637.
DR   EnsemblGenomes-Tr; EBT00001573639.
DR   EnsemblGenomes-Tr; EBT00001573641.
DR   EnsemblGenomes-Tr; EBT00001573644.
DR   EnsemblGenomes-Tr; EBT00001573646.
DR   EnsemblGenomes-Tr; EBT00001573648.
DR   EnsemblGenomes-Tr; EBT00001573650.
DR   EnsemblGenomes-Tr; EBT00001573651.
DR   EnsemblGenomes-Tr; EBT00001573653.
DR   EnsemblGenomes-Tr; EBT00001573655.
DR   EnsemblGenomes-Tr; EBT00001573657.
DR   EnsemblGenomes-Tr; EBT00001573658.
DR   EnsemblGenomes-Tr; EBT00001573660.
DR   EnsemblGenomes-Tr; EBT00001573662.
DR   EnsemblGenomes-Tr; EBT00001573665.
DR   EnsemblGenomes-Tr; Rxyl_R0002-1.
DR   EnsemblGenomes-Tr; Rxyl_R0003-1.
DR   EnsemblGenomes-Tr; Rxyl_R0005-1.
DR   EnsemblGenomes-Tr; Rxyl_R0006-1.
DR   EnsemblGenomes-Tr; Rxyl_R0008-1.
DR   EnsemblGenomes-Tr; Rxyl_R0010-1.
DR   EnsemblGenomes-Tr; Rxyl_R0011-1.
DR   EnsemblGenomes-Tr; Rxyl_R0012-1.
DR   EnsemblGenomes-Tr; Rxyl_R0013-1.
DR   EnsemblGenomes-Tr; Rxyl_R0014-1.
DR   EnsemblGenomes-Tr; Rxyl_R0015-1.
DR   EnsemblGenomes-Tr; Rxyl_R0016-1.
DR   EnsemblGenomes-Tr; Rxyl_R0017-1.
DR   EnsemblGenomes-Tr; Rxyl_R0019-1.
DR   EnsemblGenomes-Tr; Rxyl_R0020-1.
DR   EnsemblGenomes-Tr; Rxyl_R0021-1.
DR   EnsemblGenomes-Tr; Rxyl_R0022-1.
DR   EnsemblGenomes-Tr; Rxyl_R0023-1.
DR   EnsemblGenomes-Tr; Rxyl_R0024-1.
DR   EnsemblGenomes-Tr; Rxyl_R0026-1.
DR   EnsemblGenomes-Tr; Rxyl_R0027-1.
DR   EnsemblGenomes-Tr; Rxyl_R0028-1.
DR   EnsemblGenomes-Tr; Rxyl_R0029-1.
DR   EnsemblGenomes-Tr; Rxyl_R0030-1.
DR   EnsemblGenomes-Tr; Rxyl_R0031-1.
DR   EnsemblGenomes-Tr; Rxyl_R0032-1.
DR   EnsemblGenomes-Tr; Rxyl_R0033-1.
DR   EnsemblGenomes-Tr; Rxyl_R0034-1.
DR   EnsemblGenomes-Tr; Rxyl_R0035-1.
DR   EnsemblGenomes-Tr; Rxyl_R0036-1.
DR   EnsemblGenomes-Tr; Rxyl_R0037-1.
DR   EnsemblGenomes-Tr; Rxyl_R0038-1.
DR   EnsemblGenomes-Tr; Rxyl_R0040-1.
DR   EnsemblGenomes-Tr; Rxyl_R0041-1.
DR   EnsemblGenomes-Tr; Rxyl_R0042-1.
DR   EnsemblGenomes-Tr; Rxyl_R0043-1.
DR   EnsemblGenomes-Tr; Rxyl_R0044-1.
DR   EnsemblGenomes-Tr; Rxyl_R0045-1.
DR   EnsemblGenomes-Tr; Rxyl_R0046-1.
DR   EnsemblGenomes-Tr; Rxyl_R0047-1.
DR   EnsemblGenomes-Tr; Rxyl_R0049-1.
DR   EnsemblGenomes-Tr; Rxyl_R0050-1.
DR   EnsemblGenomes-Tr; Rxyl_R0052-1.
DR   EnsemblGenomes-Tr; Rxyl_R0054-1.
DR   EnsemblGenomes-Tr; Rxyl_R0056-1.
DR   EnsemblGenomes-Tr; Rxyl_R0057-1.
DR   EnsemblGenomes-Tr; Rxyl_R0058-1.
DR   EnsemblGenomes-Tr; Rxyl_R0059-1.
DR   EnsemblGenomes-Tr; Rxyl_R0061-1.
DR   EnsemblGenomes-Tr; Rxyl_R0062-1.
DR   EuropePMC; PMC2605195; 18719892.
DR   EuropePMC; PMC3406152; 22660709.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01315; CRISPR-DR2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000386.
DR   SILVA-SSU; CP000386.
DR   StrainInfo; 154720; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3436081
CC   Source DNA available from John R. Battista (jbattis@lsu.edu)
CC   Bacteria available from DSMZ: DSM 9941
CC   Contacts: John R. Battista (jbattis@lsu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3225748
FT                   /organism="Rubrobacter xylanophilus DSM 9941"
FT                   /strain="DSM 9941"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:266117"
FT   gene            2..1354
FT                   /locus_tag="Rxyl_0001"
FT   CDS_pept        2..1354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: chy:CHY_2710 chromosomal replication
FT                   initiation protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator, DnaA-like Chromosomal replication initiator,
FT                   DnaA; SMART: ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02982"
FT                   /db_xref="GOA:Q1B046"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B046"
FT                   /protein_id="ABG02982.1"
FT                   /translation="MQSRAEEVWNEVLDRVSEHINAPSLKVWFEGTRPVQLYEDGLEIS
FT                   VPNTFAKEYIESRFRPLLEEALDGVLGQEETSIIVSVGGQGRRAGREETSAETGAESVL
FT                   SARTPRSLKAKYTFDSFVIGAGNRFAHAAALAVAENPGVVYNPLFIYGGVGLGKTHLLR
FT                   AVGHYVEDQDPTMRVRYVTCEQFTNDFINSMRDNAPLEFQKRYRENDVLLIDDIQFLEN
FT                   KVETQEAFFHTFNALYEENKQIVIASDRHPKYLQTLENRLVSRFEWGLVTDIQPPDLET
FT                   RIAILRKKAMMDRLEVDDEVLTFIASKVSTNIRELEGALVRILAYASLYGRQVTVALAE
FT                   EVLRDILPDSDYREIPIELIQHEVCRYFGISKEDLVGTSRSKAFAYPRQVAMYLSRELT
FT                   DESLPKIGKAFGGRDHSTVMHATNKIANLINSDRDTFNQIHEITYHIKSKR"
FT   gene            1853..2980
FT                   /locus_tag="Rxyl_0002"
FT   CDS_pept        1853..2980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: chy:CHY_2709 DNA polymerase III, beta subunit;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02983"
FT                   /db_xref="GOA:Q1B045"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B045"
FT                   /protein_id="ABG02983.1"
FT                   /translation="MRAVCNTGVLAGKLALVSRGVSTRSPVQVLSGVLLEAREGRLELS
FT                   ATDMELSIRTRSPAEVEEAGRLVIPARIFSDIVRSLPEGMISIEHDVESGAAVLRSREN
FT                   EYRIRAYAAEDFPALPEFSEEGSFRVSGEALVETVQKVSSSYSRDETRPVLTGILISFE
FT                   DSRLRMVTTDSYRLSIKETELATTFEGKREAIIPARAMQEVGRIFSGSDEEQIEVQLSE
FT                   NQALFRVGDVLLGTKLIAGNFPEYRRLLPAAFEREISVNRDEIVGSLRRVNLFAQRQTP
FT                   PVPVSLVFSEGSVEVVVRSGEVGEAHERIPASSEDDFTISFNPGYLLDGISAVDTEKVV
FT                   FKFNEPLKPGLIVPNGEEEPDFRYLIMPMRDPSRA"
FT   gene            2980..3174
FT                   /locus_tag="Rxyl_0003"
FT   CDS_pept        2980..3174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0003"
FT                   /product="RNA-binding S4"
FT                   /note="PFAM: RNA-binding S4; KEGG: gme:Gmet_0098
FT                   RNA-binding S4"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02984"
FT                   /db_xref="GOA:Q1B044"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B044"
FT                   /protein_id="ABG02984.1"
FT                   /translation="MKVPAGITLGQALKLARVVGSGGEAKLVIRAGEVRVNGEVETRRG
FT                   RRLRAGDVVEVGGERLEAS"
FT   gene            3171..4295
FT                   /locus_tag="Rxyl_0004"
FT   CDS_pept        3171..4295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC protein-like; KEGG: oih:OB0004 DNA repair and
FT                   genetic recombination"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02985"
FT                   /db_xref="GOA:Q1B043"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B043"
FT                   /protein_id="ABG02985.1"
FT                   /translation="MSAHIRAIRLVNFRNYAGATALLSPGLNVLVGENAQGKTNLLEAL
FT                   AFVVSGSSPRTPNDSEVVRWGEGFVRVEARVVDGGHERRLAVGYAPGSRKRLTVDGAPV
FT                   ESLARYAAGVAGVRAVTFFPDDLRVVKGSPSDRRSFLDALLSSLRPAYARAAAEYARAV
FT                   QQRNQLLRRIRDGLSSERTLATWDRKVVELGLVLLEGRAAAAAPLDEHFRASMRALYGP
FT                   QKAAVGYSYSATPERYAQALREAHSADIERGITSVGPHRDDLRILLEGVDLTTYGSQGQ
FT                   QRLATLALKFAARDYIRDATGQDPVLLFDDVMSELDERRRDYLAGCFLESTQAVISTTN
FT                   LRYFEPGALRRARVLGISGGSISQTTKSGVDNGG"
FT   gene            4458..6392
FT                   /locus_tag="Rxyl_0005"
FT   CDS_pept        4458..6392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0005"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: gka:GK0005 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA gyrase, subunit B-like
FT                   ATP-binding region, ATPase-like TOPRIM DNA topoisomerase,
FT                   type IIA, subunit B, region 2; SMART: DNA topoisomerase,
FT                   type IIA, subunit B or-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02986"
FT                   /db_xref="GOA:Q1B042"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B042"
FT                   /protein_id="ABG02986.1"
FT                   /translation="MVARTAAKHSKSDYDASSIQVLEGLEAVKRRPGMYIGSTGPRGLH
FT                   HLVWEIVDNSIDEALAGYCTEISVTVHPDNSVTVSDDGRGMPVGVMEKYGKSAAEVIMT
FT                   TLHAGGKFDGQTYKVSGGLHGVGASVVNALSEWLELEIRRDGHLWTQRYERGFPVTGLE
FT                   RGRKLGKREGTGTTVRFRPDPQIFETVEFSFDTLSRRFRESAFLNKGLRIRLADEREEG
FT                   REVVYRYEGGIKDFVAHINEAKDPVHKTILYFHREEEAGDVEVAMQWNSGYQDSVFTFA
FT                   NNINTHEGGTHLSGFRAALTRTINEYARQKGLLKEKEENLTGDDIREGLAAVISVKLRE
FT                   PQFEGQTKTKLGNTEIKGLVESATNRHLAEFLEENPGQARAIVTKAINASRARLAASKA
FT                   RKAIRKGYLESSTLPGKLADCSSKDPARSELYIVEGDSAGGSAKQGRDRNFQAILPLRG
FT                   KILNVEKANINKVLSNAEIQAMISAIGAGVGDSFNIEEARYHKIVIMTDADVDGSHIRT
FT                   LVLTFLYRNMPELIEAGYVYIAQPPLYKITHNRRDVYVYSDAELQETLRRLRADGSATV
FT                   SRFKGLGEMNPQQLWETTMDPANRTLLQVTIDSAATADELFTALMGDKVEPRKAFIEAN
FT                   AREAKNIDA"
FT   gene            6385..8943
FT                   /locus_tag="Rxyl_0006"
FT   CDS_pept        6385..8943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0006"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A DNA gyrase C-terminal
FT                   repeat, beta-propeller; KEGG: chy:CHY_2704 DNA gyrase, A
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02987"
FT                   /db_xref="GOA:Q1B041"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B041"
FT                   /protein_id="ABG02987.1"
FT                   /translation="MLDTFSGNIQPHSIEDEIRSSFLSYAMSVIVSRALPDVRDGLKPV
FT                   HRRVLYAMHDLGLQPNRPYRKSATVVGEVIGKYHPHGDAAVYDTLVRLAQDFSMRHPLV
FT                   DGQGNFGSVDGDPAAAMRYTEARLTRIATEMLRDINADTVNFVPNFDESQREPEVLPAR
FT                   FPNLLVNGADGIAVGMATKIPPHNLGEVIDATVALIEDPELDDEGLARYIKGPDFPTGG
FT                   IVVGTRGIREAIRTGRGSVRVRAKAHTEQIKGNRTQIVVTELPYQVNKAQLLQKIAELV
FT                   KDRKISDIADLRDESDRGGMRIVIELKREAVPKVVLNNLFKHTQMQQSFGVNLVALVDG
FT                   VPKTLSYKEALRHYIAHQFEVVTRRTRHELGRARARAHILEGLLIALSNLDEVVETIRR
FT                   SRNVETARRNLVKRFRLSERQAQAILDLRLQRLTALERRKVEQDHRDLVEKIEYLEGVL
FT                   ADESKVYGIIREELLEIKAAYADERRTAITAQEGAEFEVEDLIAEEEMVISISHEGYLK
FT                   SVPIGSFRKQGRGGVGVAGMELKEGDYIEHLFITTTHHYMLFFTNRGKVYRLKVHQLPR
FT                   MGRAAKGRHVANLLPLAPGERIAAVISTRDFDEAEYLLFATRRGMVKKTPFRDYNTPLK
FT                   NEGIIAIKLAGGDELIAVRHASDEDEVVFVTRDGKGLRFRQGDVRPMGRATAGVKGITL
FT                   KGDDALLSMDVVSDEAADLFMVTEKGFGKRTAISEFRPQGRGGQGVIAMKVNGERGKIA
FT                   GVQVVRPGLHELVIVSNMGTTIRIDSDSVPRQGRAAQGVRVMNLREGDSVSALAKVVSS
FT                   RGEPGEPDELALDGITEEEAERSATGSRPAPAANGGRKRG"
FT   gene            9127..10590
FT                   /locus_tag="Rxyl_0007"
FT   CDS_pept        9127..10590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0007"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   ade:Adeh_2817 protein of unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02988"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B040"
FT                   /protein_id="ABG02988.1"
FT                   /translation="MEGAHPDLRRGRRGAHGVARVLRLARRDGRPVHRGGRLRPPRGVL
FT                   RRRRPGPLGGGRPGGGDALADGHKAPRPLQCLRRFAGRGPAGPRPLPNRESENTMPEDL
FT                   AIFIDWENIYISTVSEYGAKPNVSAILEKAREYGRIVSATAYADWTDGEFRDAPPTLYS
FT                   NGISPRYISARYFPGGKSQKRRTNSIDVMLAVECVDFLHNHPQVDTYVLVTGDGDFIPL
FT                   VNLLRSRGKVVVVIGVSEATSYHLIESADHFISYASLLEEDRAARDRERRPKGKEIDPF
FT                   RELVRAVEALKKGDKTRVLGQVKQQMIVQMGSFDERDHGFKKFKDFVVEAERRGLVKTV
FT                   DEEFELHVYLPDEKIPEQLGADLASEEPQTDGRREGGAGFDLTEDLTPYELRTVCQSIA
FT                   ELRQPASMVEILSRLRELGERGELELSREEMVEVVEALLDAGYLNPVRERPYKGARADM
FT                   TLYALDTESRQVRNILKEPAEAAAQSASR"
FT   gene            complement(10572..10850)
FT                   /locus_tag="Rxyl_0008"
FT   CDS_pept        complement(10572..10850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02989"
FT                   /db_xref="GOA:Q1B039"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B039"
FT                   /protein_id="ABG02989.1"
FT                   /translation="MGIIAGFLQHVPGVLAFYIPALFGTVLLRERGEGYRLKAGLWFVL
FT                   GFGSIIAVHIMLRSVSVEQVAALVGVSLLQMAVALALARLTVYRLAD"
FT   gene            10952..11329
FT                   /locus_tag="Rxyl_0009"
FT   CDS_pept        10952..11329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02990"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B038"
FT                   /protein_id="ABG02990.1"
FT                   /translation="MGINQRVSLRKFRDDIERWVEEGRSDEWIASALGTSASSVQSFRS
FT                   RNGIYRRSAAPALRDPEDYAAYEGVVERGERIGLWFDPQVQDDPRWKEGWSGAERVEIR
FT                   LTPRKIVLRRRPGASGSGSKV"
FT   gene            11389..11749
FT                   /gene="rnpB"
FT                   /locus_tag="Rxyl_R0001"
FT   misc_RNA        11389..11749
FT                   /gene="rnpB"
FT                   /locus_tag="Rxyl_R0001"
FT                   /product="RNaseP RNA"
FT   gene            11928..12626
FT                   /locus_tag="Rxyl_0010"
FT   CDS_pept        11928..12626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0010"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: sco:SCO5108 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02991"
FT                   /db_xref="GOA:Q1B037"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B037"
FT                   /protein_id="ABG02991.1"
FT                   /translation="MTVAAVLIIFGVYSFTVILLYDGEYREYLSPFYSPQVGLPEWVPG
FT                   FITAPMFVLWIPLGFRATCYYYRKAYYRAFFWDPPACLAGAQKREPRSPESYRGERALF
FT                   VINNVHRYFLYGSWVILAFLWYDTVLTFFPPEGGFQVKVGSLIWLANVVLLSMYSFSCH
FT                   SMRHVVGGNKDCYTCIRGGNARRRLYNAVSRQNAHHPTWAWLSLFSVLFTDIYLRLIAA
FT                   GVIPDLTIIG"
FT   gene            12630..14399
FT                   /locus_tag="Rxyl_0011"
FT   CDS_pept        12630..14399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0011"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein-like FAD dependent oxidoreductase
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: nfa:nfa56020 putative succinate
FT                   dehydrogenase flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02992"
FT                   /db_xref="GOA:Q1B036"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B036"
FT                   /protein_id="ABG02992.1"
FT                   /translation="MAVETNGRREDYEVREHDVLVIGAGGAGLRAAIAAAQRGLSVGVV
FT                   TKSLLGKAHTVMAEGGIAAALGNVDPDDSWEQHFIDTMKSGKFLNNWRKVEIYAKEAPA
FT                   GVIELEQWGALFNRTPEGKISQRPFGGHTYRRLAHVGDRTGLEMIRTLQEKLLATDARV
FT                   YMETTVTKLFKDERGRISGALAYTRESGRFVFFKVKAIIMATGGWGRIYKVTSNSWEGT
FT                   GDGVILAYDAGAELVDMEMVQFHPTGMVWPPGVRGILVTEGVRGEGGILRNSRGERFME
FT                   RYDPERKELSTRDVVARANYTEVQEGRGSPHGGVYLDITHLGREKILKKLPTMYEQFLK
FT                   LADVDITREPMEVFPTVHYNMGGIKVEPESCASTTVPGLFAAGEVAGGLHGANRLGGNS
FT                   LGDLLVFGRRAGEGAAEYIEQSVHAAGAPDEEIQEEIRRVLEPLERPAREGDESPYLLQ
FT                   EELQEAMMEHANLMRDEDSLLKGLEKVLSIKRRLPNVKVGGTRMFNPGWHTAQDIRYLT
FT                   QISEIIIRCALERKEKRGAQWRLDCDELVEEYGKINFVVKKTEQGEVGIERREIPPMPE
FT                   HLAALFREEKAKV"
FT   gene            14396..15214
FT                   /locus_tag="Rxyl_0012"
FT   CDS_pept        14396..15214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0012"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; PFAM: ferredoxin; KEGG:
FT                   mbo:Mb0253c probable succinate dehydrogenase [iron-sulfur
FT                   subunit] (succinic dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02993"
FT                   /db_xref="GOA:Q1B035"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B035"
FT                   /protein_id="ABG02993.1"
FT                   /translation="MSDGNVTSRAHAPVGEEGLGGTGRTAKLKIFRGDASGGEEVEYEI
FT                   PLVEGMVILDAVLYIQAHQANDLAVRWNCKAAHCGSCSAEINGIPRLMCKTRVEEFEGR
FT                   EIHVGPMRAFPVIKDLVSDVSWNYEVSSKITPFTTSQKAPFTMYEEDVERLYEPKKCIE
FT                   CFMCQDVCHVLRTHHKHPEFAGPRFFVRNQWLEMHPMDEADRLGDLKEKNGLGYCNITK
FT                   CCTEVCPVGIKITDNSIIPLKERVADEYYDPARWLMRKIQGRRNGGRNGS"
FT   gene            complement(15245..15317)
FT                   /locus_tag="Rxyl_R0002"
FT                   /note="tRNA-Gly3"
FT   tRNA            complement(15245..15317)
FT                   /locus_tag="Rxyl_R0002"
FT                   /product="tRNA-Gly"
FT   gene            15373..15873
FT                   /locus_tag="Rxyl_0013"
FT   CDS_pept        15373..15873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0013"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: sth:STH2026
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02994"
FT                   /db_xref="GOA:Q1B034"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029401"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B034"
FT                   /protein_id="ABG02994.1"
FT                   /translation="MDGSGYRFCPRCGGGLERRVLKPAEPERLVCGGCGFVFYLGPKLV
FT                   AGAIFELGGGIVLVRRGIEPGYGRWTFPGGFVERGERAEAAAERETLEETGVRVRVDGI
FT                   LGLYTYEGQVPAVAVFAARAVAGEPAPLDETLEVRSFPRDELPWDALAFPSTGHALKDY
FT                   LRR"
FT   gene            complement(15883..16452)
FT                   /locus_tag="Rxyl_0014"
FT   CDS_pept        complement(15883..16452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0014"
FT                   /product="Phosphopantothenoylcysteine decarboxylase"
FT                   /EC_number="4.1.1.36"
FT                   /note="PFAM: flavoprotein; KEGG: ttj:TTHA1560
FT                   DNA/pantothenate metabolism flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02995"
FT                   /db_xref="GOA:Q1B033"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B033"
FT                   /protein_id="ABG02995.1"
FT                   /translation="MGETGAGRVLVAVTGGIAAYKIPGVVRRLREAGFEVEVAATPAAL
FT                   RFIPQETLAVAAGRRVHTDETWWEESGRIEHITLARWAELVLVAPATADAIARAAIGLG
FT                   DDLVSATILAGAKKVLWAPAMNPEMWQSPATARNVATLKGWGHRFVGPEEGAMASAEEE
FT                   PGTGRLAGEEAILAAVREALAEDPSP"
FT   gene            complement(16487..16729)
FT                   /locus_tag="Rxyl_0015"
FT   CDS_pept        complement(16487..16729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0015"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD; KEGG: sth:STH460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02996"
FT                   /db_xref="GOA:Q1B032"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B032"
FT                   /protein_id="ABG02996.1"
FT                   /translation="MEGYLGQTVGKMLFGIRVVRESDGGRPGLRSALIRTALRLVDGFL
FT                   WYLVAFVAVLISDKNQRLGDMAANTLVVRNHSSSS"
FT   gene            17060..17842
FT                   /locus_tag="Rxyl_0016"
FT   CDS_pept        17060..17842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0016"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase
FT                   short-chain dehydrogenase/reductase SDR Male
FT                   sterility-like; KEGG: nmu:Nmul_A1489 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02997"
FT                   /db_xref="GOA:Q1B031"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B031"
FT                   /protein_id="ABG02997.1"
FT                   /translation="MESTLSGKVAVVTGASSGIGAATARELARRGAAVVLAARDAARLE
FT                   ALRREIESSGGRALPVRTDVARRDSVRRMVGEAVEGLGRIDILVNNAGLGLSGRVAEVR
FT                   PEDLRYVFEVNVVGALNCIQEALPHMGPGGRIINVSSVIGKRSIPMVGAYCATKAALNA
FT                   LSDALRVEVAAAGITVTSVYPGTTRTPFRENSRRTGGEKRGWRPRGVPPERVALSIARA
FT                   AERGPRDVYVRPLDRLFVAAVTLLPGAADRVLRAWAKG"
FT   sig_peptide     17060..17134
FT                   /locus_tag="Rxyl_0016"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.916) with cleavage site probability 0.909 at
FT                   residue 25"
FT   gene            17851..18471
FT                   /locus_tag="Rxyl_0017"
FT   CDS_pept        17851..18471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02998"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B030"
FT                   /protein_id="ABG02998.1"
FT                   /translation="MGFEEAALTRLRRYREEADRSLGLISEAEERARAFSERLFSGLER
FT                   VSGLARRAGFEVSAERSEDLLSLRVREVEEAAAAFAVLRGAAAETDEDLMHEELSHYSL
FT                   DPAGYSGRILGWSPAAGEEPCQIFAVYRDGTWKTKGLFVARSRGRVDDPEEAVHGFCLR
FT                   IVGGLIDLAALTGGVGRRWDEGPYSLQDRLRGRPYPVRLRIPR"
FT   gene            complement(18428..18799)
FT                   /locus_tag="Rxyl_0018"
FT   CDS_pept        complement(18428..18799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02999"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B029"
FT                   /protein_id="ABG02999.1"
FT                   /translation="MGPAGIPEVIRLRDARGERPPDAAGAGDFWYDPAVWGLPLSPASR
FT                   VLYAGICAHAGHGEINRQDLRNLLKGQPDEAVAAALRELAEANLLVPAGGDERVMDCEI
FT                   RPVSGLSGGSSAARDRASP"
FT   gene            complement(18805..21246)
FT                   /locus_tag="Rxyl_0019"
FT   CDS_pept        complement(18805..21246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0019"
FT                   /product="beta-lactamase-like protein"
FT                   /note="PFAM: beta-lactamase-like RNA-metabolising
FT                   metallo-beta-lactamase; KEGG: pfu:PF1405 cleavage and
FT                   polyadenylation specifity factor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03000"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B028"
FT                   /protein_id="ABG03000.1"
FT                   /translation="MSDTTPSGGDVRDAQKKPPPQVPPENVPEELLRRRLGRLDTRRAL
FT                   AELCKSVPGLEEALLPPGIQADALTRRSGSSQMLRSVARRIKQDAAAWNAFKTAVVEQI
FT                   PPETGEAVGRLSGDNLDELREAHTTEGLLLAALVSENGVEPGLLDSLVESWEEENRREE
FT                   KKAHQDAKVKELESRLEELKKDNERLSFASRAAKERAESLAEEVRLLTSEREDVSARVR
FT                   EAEERARAALSVRERLDERIAELERRGAQLERALEGERRAYARAAERLEELHAEFERVV
FT                   AERDQIRDALRHARFTDEGFGELLVRAVKNEVEALPDTLDSTARTARLLEFMSRVLQAH
FT                   AELRGGRERRPSPAPAREEEGEESGPAPRAGRPRPATGDALRSVRVKSRPTLAFRALGG
FT                   AGEVGGSSHLLDFGSTRVLVDAGIKPDGRGQLAPDFEEIGPLDGAIITHAHLDHCGALP
FT                   LLVKNHPQLPIYCTPPSAKLIVSALNDHAAMGGGVPGGAPIHEVKKRLVSVPFGKPFEV
FT                   GGATVTLTESGHILGAASVLLRSSSAMVFHTGDICMEDHFSIPPARLPEVSGIDLLIME
FT                   ATLADQRPQPFNESIKKMVRVINETTLERGGTVLIPTYALGQAQEIILGLKYFGKEHGL
FT                   ERDVFIYVDGSVVTTSERLYAEQLRYMKPYLQHTDPRELFFSENIRAVANDDRARERIL
FT                   ANPCAIIASPVTMEGGASAFYRRRLEGSERNAVILPSNAASSYGTHRAIGEGSSWRVER
FT                   VSFAAHCTQEELLGITEKLSPRQIILIHGSRRRISDLAFRLAPKHKIHTPAVGETVRTV
FT                   L"
FT   gene            21291..21647
FT                   /locus_tag="Rxyl_0020"
FT   CDS_pept        21291..21647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03001"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B027"
FT                   /protein_id="ABG03001.1"
FT                   /translation="MSEKILAWQTFPPPAPFIRAAEGCKLAAMAEKKTEVKIRAHSPGR
FT                   YPILILELPSGELRAAYHEAGYDLERTKPVGESWLYENAIGRHSFVEVKPPRELPAGEL
FT                   VDYVRRELLAPGGE"
FT   gene            complement(21654..23654)
FT                   /locus_tag="Rxyl_0021"
FT   CDS_pept        complement(21654..23654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0021"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase PASTA; SMART: Tyrosine protein
FT                   kinase Serine/threonine protein kinase; KEGG: tte:TTE1500
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03002"
FT                   /db_xref="GOA:Q1B026"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B026"
FT                   /protein_id="ABG03002.1"
FT                   /translation="MQQLVDNRYRIVRRLGSGGMADVYLAHDDILDRDVALKVLSSHYA
FT                   ADAEFVERFKREAQSAAALAHPNIVSIYDRGEAEDGTYYIAMEYLPGGTLKDRILRKGA
FT                   LPPKTAAAVALQIAEALKAAHQRGVVHRDIKPHNILITESGDLKVTDFGIARAASSSTM
FT                   TRTGAVLGTAHYISPEQAMGEPVGPPSDLYSLGVVLYEMLTGQLPYDADTPIGIAMKHV
FT                   NGHLRPPREVNPAVPEGLDAITVRLLAKDPKERYQSADELMEDLERFLRGEDPAAAAPT
FT                   AVMGRVGRDETAPTRVQPAVGREGKRRRWPLVALLLAALLALLGLGGYQLLLEDQAGGR
FT                   DAPPRMAVPDLQGMSLEEAQRRYGDDFDIVEGERRDGPREAGTILEQDPPPGERLERGS
FT                   EISVAVASGENEVPAVVDSPADEARSALSEAGFEVKVEERESEEEQEGLVLEQSPEGGS
FT                   TAEVGSTVTIAVGTGVPTVVVPDIPYGYTAEQSRQVLEQAGLRLGSVGYAPNSQVAEGG
FT                   IIDQNPPPGTEVEEGTAVDIVLSSGPPQTEVPDVVGLDVNVAVQRLSGAGLGYALIERQ
FT                   SGEPEGTVLSTSPPAGSTVDQGTQVRVVYSVGRPEPRPEPTTARPPEEQGGPQGGGGQG
FT                   RDRGRDETQSRPAPAAGPGERRPPSGEDEGD"
FT   gene            complement(23672..25186)
FT                   /locus_tag="Rxyl_0022"
FT   CDS_pept        complement(23672..25186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0022"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   KEGG: tte:TTE1967 cell division protein
FT                   FtsI/penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03003"
FT                   /db_xref="GOA:Q1B025"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B025"
FT                   /protein_id="ABG03003.1"
FT                   /translation="MNAHVRRTFYLFVAGFVALIGMLAYWQVYARESLANNPENGLQTR
FT                   RAIESPRGLILARDGETVLARSVKQPSESGNPTYERVYPQGPLYAGVVGYWSTRYGATG
FT                   IEIAENSSLSGTADPATLDELINQISGGPRPGNNVILTIDPQLQRLAYELLAASNTGRG
FT                   SAVAVDPETGEVLALVSHPSYDPNNIDERFRELQQDPSQPLLNRATQGLYPPGSVFKVV
FT                   TAAAALKSGVSPSDVFFDDGTYEQPGYTVTNYGGASYGRVTFAQALALSINTVFARVAV
FT                   EEVGRQMLYATARDFGFGSSYEEFPLEVSASRLGEGNLAQIAFGQDTVLSNVFQMALVA
FT                   ATVANDGTMMEPHLVREVRSPDGIIIERTSPQREREVLDPQTAGTLQQMMVGVVESGSA
FT                   TAAQIPGVEVAGKTGTAEVPPNAPHSWFIAFAPADDPQIAVAVLVENGGDGEKQALPIA
FT                   RQLIASYLDLPSRPRRGPQLPENLPQQLPEELQGLPQRLFGENGRP"
FT   sig_peptide     complement(25094..25186)
FT                   /locus_tag="Rxyl_0022"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.779) with cleavage site probability 0.758 at
FT                   residue 31"
FT   gene            complement(25183..26472)
FT                   /locus_tag="Rxyl_0023"
FT   CDS_pept        complement(25183..26472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0023"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: mbo:Mb0017c probable
FT                   cell division protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03004"
FT                   /db_xref="GOA:Q1B024"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B024"
FT                   /protein_id="ABG03004.1"
FT                   /translation="MTQRATMPMILALLVSTLGFATLIFVQEATSPPLVYGAYYAGTLF
FT                   ALYLAVRLLLPHSDVLLLPIVTLLTGLGLVMIFRLTYDVEGVENLAITQAVWILIGSAA
FT                   LLFIVLFFRNYERLFDYKYLFALAAVVLICLTFTPLGYEVNGARLWVRIGPVNFQPSEF
FT                   ARIALIIFYAGYLAEKRDLLAATSRSVLGVQIPSPKYFGPVALVWAVSLGLLVFERDLG
FT                   SSLLFFAVPLLMLYVATGRLAYVIIGGLMFSGGAFATYLLFDHVRVRVQTWLDPWQNPD
FT                   AEGFQILQSIFNIADGGITGTGLGAGFAQTIPEVHTDFIFSAIASELGLLGATAVLLAF
FT                   LVFVYRGIKISLLAGDEASKLLAYGLTAMFALQTLIIVGGVTRLIPLTGITLPFVSYGG
FT                   SSVVGNFILTGLLLVVSEKAGRRELGKEAR"
FT   sig_peptide     complement(26392..26472)
FT                   /locus_tag="Rxyl_0023"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.702 at
FT                   residue 27"
FT   gene            complement(26479..27624)
FT                   /locus_tag="Rxyl_0024"
FT   CDS_pept        complement(26479..27624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0024"
FT                   /product="protein serine/threonine phosphatases"
FT                   /note="PFAM: protein phosphatase 2C-like; KEGG:
FT                   ade:Adeh_3691 serine/threonine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03005"
FT                   /db_xref="GOA:Q1B023"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B023"
FT                   /protein_id="ABG03005.1"
FT                   /translation="MAMFFLEPFGITDAGRVRQNNEDALLVGEGKDETLFAVADGIGGF
FT                   EAGEVASSIAIEVLRRMEPGDSFEEALEEANRRIRAAARGDERFAGMGTTVVAVRFGQR
FT                   DGRPVAEVAHVGDSRAYLMRGSSLRPVTEDHSLVAELVRSGDLSRAEAAEHPQRNLITR
FT                   ALGAEETVNVDTAVLPVEAGDRVVLCSDGLSDMVPEKRISEILDRHREDPETPARRLLQ
FT                   AALEAGGTDNVTVVVVDVRERREEERERGGTREMPPVAPPPAGRRRSPRPSARDKRRSS
FT                   LSSRLLGRLLRGVIGLVAVAVLLTPAYLWGSSRYFLDVEGGEVVVHRGLPYEVGGVQLN
FT                   EEWRRTGLRLSEVRRPYREPITERRLYTRDEVERVLRDLER"
FT   gene            complement(27627..28094)
FT                   /locus_tag="Rxyl_0025"
FT   CDS_pept        complement(27627..28094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0025"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated; KEGG: fra:Francci3_4431
FT                   FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03006"
FT                   /db_xref="GOA:Q1B022"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B022"
FT                   /protein_id="ABG03006.1"
FT                   /translation="MLELQVPLLAAKALLLLLLFAFVYAVVRRGVGDLRSIPDDEPFRP
FT                   GVPREAPAKRRGVSELMVEESEVLAPGTEFPIGNGTTTIGRSSASDIVLKSDDYVSGRH
FT                   ARLTRHGGLLYVEDLGSTNGTFVNGRKAVGATPLRDGDLVRVGSTTFRYLE"
FT   sig_peptide     complement(28017..28094)
FT                   /locus_tag="Rxyl_0025"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.718) with cleavage site probability 0.689 at
FT                   residue 26"
FT   gene            complement(28099..28941)
FT                   /locus_tag="Rxyl_0026"
FT   CDS_pept        complement(28099..28941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0026"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated; KEGG: tfu:Tfu_3060 FHA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03007"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B021"
FT                   /protein_id="ABG03007.1"
FT                   /translation="MGILKHIEKRMESLVEGVFGRAFRRRIHPVEIAKGLTKQMDEGRM
FT                   VSISRTYAPNDFTIHLSREDAEAISAYEDSLKEELIQYASTHAENKGYHLMTPPKVRFV
FT                   TEESLRFGEFGVTAKLTGGDGPREKGAPSDTSGQTRIFRTQETGRGGFGEGTAAISPED
FT                   ARRHGLAREVVELVVGERSYPLEGRGPWTVGRSQENDIVLPDPNVSRRHARILRAENGF
FT                   VIEDLGSTNGTLLDGAPIDRERIESGDELTFGQTTARFVRRIEAPEETPQGGRSYGRG"
FT   gene            complement(28951..30540)
FT                   /locus_tag="Rxyl_0027"
FT   CDS_pept        complement(28951..30540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0027"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: Tyrosine protein kinase
FT                   Serine/threonine protein kinase; KEGG: nfa:nfa31920
FT                   putative serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03008"
FT                   /db_xref="GOA:Q1B020"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B020"
FT                   /protein_id="ABG03008.1"
FT                   /translation="MAETRYIEGQERYVLAEMVGRGGFATVWRARPANGSPFGRREDVA
FT                   IKVIPVYSAAERSRALREGQIAEGLRHPNIVETIEVIPGEHEVYLVTEFVHGMPLDEAA
FT                   RYYGPAEIVDALAQILEALDYAHSQGIIHRDIKPQNALVDRSGLVKLTDFGVAYRAGDT
FT                   RLTRVGFAVGTPGYIAPEILDGADPSALTDIYAVGATARTLLSRLPDEPPPQLQEFVNR
FT                   ATSPNPAHRPQSAREALRLLTGRRATSPSVRVPSRARLRGRERLPAPLVERGLRATNGA
FT                   LAAGLGYLLAGDLLLLNGAQALSVAAGLGVAGYLLPRLAALGVIVALAVALLQGGTGLG
FT                   LAALVPAAGGLWAAGAGYLLRGADRLPLGPALAIPAALAGLGAGFPLLIGALMRPVAAA
FT                   LSSAAGALLLILYELTLGDGVIPFVGGPFRKMPPDIGPGELLGWMERVLTLYPETLYLG
FT                   LVWAASAAAVSLGERAGRPFLGLGAAAGGGALGYALAVCDTPSLRVDAVISLLLAAIMY
FT                   AVLRYLVARARG"
FT   gene            30643..30726
FT                   /locus_tag="Rxyl_R0003"
FT                   /note="tRNA-Leu1"
FT   tRNA            30643..30726
FT                   /locus_tag="Rxyl_R0003"
FT                   /product="tRNA-Leu"
FT   gene            30831..31817
FT                   /locus_tag="Rxyl_0028"
FT   CDS_pept        30831..31817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03009"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B019"
FT                   /protein_id="ABG03009.1"
FT                   /translation="MRVLPAWLTMLGSLLFLFVVLAFIFLVARGCIATQESTQIRKYVT
FT                   GADSLLSDSSDLGNGQLQPALKRAGGEPGRVSREALSRVADRSEDLYRRALENDEVPPE
FT                   FDDAHHYLVSALGIRAQATARLASAAGGDGGRFQQALAEAVESFRISDGIVRNHYIPAV
FT                   GDALQEAGHGRDRVYLEEPEPFMDYEEVGFEAGGASVPAQDDPNALHGVEIVSVTVAGQ
FT                   PLYPGGNVVLTGSDEPVFSVTVANGGEVPETAVPVEVILNTRAERQARTVTIERIEPGG
FT                   GQATVEVSGFRPGQLNETAEVTVKAGPVEYEDYTQNNTLTGTVTFGM"
FT   sig_peptide     30831..30899
FT                   /locus_tag="Rxyl_0028"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.510 at
FT                   residue 23"
FT   gene            31839..32123
FT                   /locus_tag="Rxyl_0029"
FT   CDS_pept        31839..32123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0029"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory proteins, AsnC/Lrp; KEGG:
FT                   sma:SAV6058 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03010"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B018"
FT                   /protein_id="ABG03010.1"
FT                   /translation="MVTAIVLVTTESERVQEAAQAIIDIEGVTEAYSVTGPYDLVVMVR
FT                   IEDFEKLADIVPGKIAQVPGVARTETMVAFRCYSNYDLDRVWSLGFEEE"
FT   gene            complement(32128..33258)
FT                   /locus_tag="Rxyl_0030"
FT   CDS_pept        complement(32128..33258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0030"
FT                   /product="Enzymatic protein of unknown function"
FT                   /note="TIGRFAM: Enzymatic protein of unknown function;
FT                   PFAM: glutamate--cysteine ligase, GCS2; KEGG: gvi:gll2294
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03011"
FT                   /db_xref="GOA:Q1B017"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1B017"
FT                   /protein_id="ABG03011.1"
FT                   /translation="MPVEFKLGNSGYTLGVEEELCIVDASTGELVPKIEEIMSRLPEDL
FT                   AEAVSYELFQSVLEIKTPVCRTVGEAERVLRELRGRVGSWTAACGASLASAGTHPFSRY
FT                   RDQKVTEHERYRQVIEELRWVATREVIFGQHVHVAVPGPEEAIQAHNRLAEQAPLLLAL
FT                   SANSPYWQGMDTGFESSRVQIFETFPRAGMPPAFPEYAAFEAYVDLMVECGAMDDYTFC
FT                   WWDVRPHPKLGTIELRVLDSQTHLRHAVALTALTQCIVASSLEDEDAPKGPYHRDIALE
FT                   NKWRASRRGLDAAFFDVDERRNVPARDLARAAVERLRPHAQQLGCEEELLGVLEIVEGG
FT                   SGSRRQREIYEKSGDFLDVVAFLIEGTRPALAGEPS"
FT   gene            complement(33290..33895)
FT                   /locus_tag="Rxyl_0031"
FT   CDS_pept        complement(33290..33895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0031"
FT                   /product="Redoxin"
FT                   /note="PFAM: Redoxin Thioredoxin domain; KEGG: sth:STH734
FT                   cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03012"
FT                   /db_xref="GOA:Q1B016"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B016"
FT                   /protein_id="ABG03012.1"
FT                   /translation="MARNTPSGGKKRGAGAPQANRPLVLALAGFTALAIVVIALLAVLS
FT                   ARGGDAGNFTPNDQGLLPVGSQAPDFTTKTVTGERVSLPEGQAAMLVFFATWCPHCQNE
FT                   APTIADFSREYEDLRVMMISVADENWPETDTPQEVRRFVSEYGIQGPAIYDPELGRTYR
FT                   VTGTPTVYVVDANGTIVGAHSGEAPREVYEGWIQEALG"
FT   sig_peptide     complement(33749..33895)
FT                   /locus_tag="Rxyl_0031"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.880) with cleavage site probability 0.790 at
FT                   residue 49"
FT   gene            34015..34470
FT                   /locus_tag="Rxyl_0032"
FT   CDS_pept        34015..34470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0032"
FT                   /product="DoxX"
FT                   /note="PFAM: DoxX; KEGG: fra:Francci3_0914 DoxX"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03013"
FT                   /db_xref="GOA:Q1B015"
FT                   /db_xref="InterPro:IPR009908"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B015"
FT                   /protein_id="ABG03013.1"
FT                   /translation="MLASRVVLGGVFVAAGAAKIPDPGGFAAAIRSYGLALPEWFVSLS
FT                   AHALPYLEVLVGLYLIAGLFTRLAAWAANAMMCVFIAAILQAALRGLEISCGCFGPSSE
FT                   PSNLWLDLLRDLGLLALGLHAALLPPGRFSVDALLGRAATETSRPPG"
FT   gene            complement(34412..35284)
FT                   /locus_tag="Rxyl_0033"
FT   CDS_pept        complement(34412..35284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0033"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: hma:rrnAC2881
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03014"
FT                   /db_xref="GOA:Q1B014"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B014"
FT                   /protein_id="ABG03014.1"
FT                   /translation="MSVRELHLRAGGVGVRCLAAGEGEPAAVLLHGASLDCADLSFGHL
FT                   IGPLSGRRRVYAPDWPGYGGSERPPEAAYDLAYYERFLERLLDALGLERADLVGLSLGG
FT                   GVALSLALREPRRVRRLVLAGSYGLGRRVPWGPLGAALGRSALAARLAYGLMRRSRPAL
FT                   RLGLRNVVCDPAAVTEELLEELARQAALPGAGRAFLAFRRSEVGWRGLRSDLSGDLHRL
FT                   AVPTLLVHGSRDRIVPAGWAVEAHRRIPRSELLILEGCGHWVPRERPEEFSRAVERFLS
FT                   RPDPAGRPR"
FT   gene            complement(35295..37067)
FT                   /locus_tag="Rxyl_0034"
FT   CDS_pept        complement(35295..37067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0034"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM:
FT                   ATP-binding region, ATPase-like DNA mismatch repair
FT                   protein-like; KEGG: sth:STH1748 DNA mismatch repair
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03015"
FT                   /db_xref="GOA:Q1B013"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B013"
FT                   /protein_id="ABG03015.1"
FT                   /translation="MGIKILDPTVAQQVAAGEVVDRPASVVKELVENALDAGASRIEVE
FT                   LAEGGTARILVRDDGSGMDPEDARLCVLRHATSKIRSVEDLESVSTLGFRGEALPSIAS
FT                   VSAFRLITSTGEGPGTRVVVEGGSEARLSPATHPKGTTVLVDRLFYNVPARRAFLKGPR
FT                   AERAAVVETLTHIAVAHPEVSFRVSEGSREYLSLPAAADLLERLAQLHGVARARAMRRV
FT                   EYESGAFRVEGYAALPSLTESSRAHQTVAVNGRWVRGDNLHRGLDDAYRATVPAGRYPP
FT                   VALRISVDPRRVDVNVHPTKQLVRFSDERAAREAVAAAVRSAIEWRPPAPPAAPPRAPA
FT                   RGFAQERLGPPPRVAESRPAYRGSPPPDLRAVREEISRASRALPEPPPAAPEEPPGRGT
FT                   LPDLRELRVIGQLGAGYILLEDPEALWIVDQHVAHERAILDRLRDAGSPAPVQSLLVPE
FT                   VVELSPAEAEVAAESLEELAVYGFEAEPFGPRSLRVTAALASLAERGDVAGALKDALAA
FT                   ISGTEPGHRREDRILATIACHSAVKMGDRLSLQEMESLVRDWLGSRLPATCPHGRSICY
FT                   RMSLSEIGRKMDRH"
FT   gene            37137..37619
FT                   /locus_tag="Rxyl_0035"
FT   CDS_pept        37137..37619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0035"
FT                   /product="biotin carboxyl carrier protein"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl
FT                   carrier protein; PFAM: biotin/lipoyl attachment; KEGG:
FT                   ava:Ava_2314 acetyl-CoA biotin carboxyl carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03016"
FT                   /db_xref="GOA:Q1B012"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B012"
FT                   /protein_id="ABG03016.1"
FT                   /translation="MQEIDEKNRREAAAGPLPLEEVGRLVELLRSSGVGEISVRRGELE
FT                   ISVKALPEARPVQAAPAAPAPAPAAEGGAEEEESGLHAVRSPLVGTFYRAPAPGEEPYV
FT                   EVGDRVSAGQTLCIVEAMKLMNEIPADVSGEVVEVLVQDGQGVEYDQPLFRIRPEG"
FT   gene            37623..39014
FT                   /locus_tag="Rxyl_0036"
FT   CDS_pept        37623..39014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0036"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha / biotin carboxylase"
FT                   /EC_number="6.3.4.14"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase;
FT                   PFAM: phosphoribosylglycinamide synthetase ATP-dependent
FT                   carboxylate-amine ligase-like, ATP-grasp protein of unknown
FT                   function DUF201 Carbamoyl-phosphate synthase L chain,
FT                   ATP-binding Carbamoyl-phosphate synthetase large chain-like
FT                   biotin carboxylase-like; KEGG: hin:HI0972 biotin
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03017"
FT                   /db_xref="GOA:Q1B011"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B011"
FT                   /protein_id="ABG03017.1"
FT                   /translation="MVGKVLVANRGEIALRVIRACRELGLRSVAVYSTADGDSLHRMLA
FT                   DEAVCIGPPQAAGSYLNIPAIISAAELTGADAVHPGYGFLAENARFAEICERVGLTFIG
FT                   PPSGVIARMGDKAAARRAAEEAGVPIAPGSDGPCSGAGEVRRVGAEVGYPLVIKASAGG
FT                   GGKGMRVVRSEEEVEAAFADAGREAGASFGDGSLYVERYLDPLRHVEVQVLADTHGNVV
FT                   AFPERDCSVQRRYQKLVEESPAPGLPPEVREDLLSAARDLAASLGYVGAGTVEFIYSEG
FT                   EFYFIEMNTRLQVEHPVTETVCGVDLVAEQIKVASGEELELPGSALSPRGHAIEFRINA
FT                   EDPKRNFMPQAGPVEFYNPPGGPGVRVDSHLYAGYRVPPHYDSLLAKLIVHGESREAAI
FT                   RRGVRALDEFAVSGIETTIPLHLAVLEDEEFRRGGVPTRFLEERRLSSESGVLRLLRAG
FT                   AASSL"
FT   gene            39047..39886
FT                   /locus_tag="Rxyl_0037"
FT   CDS_pept        39047..39886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0037"
FT                   /product="metal-dependent enzyme-like protein"
FT                   /note="KEGG: sth:STH72 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03018"
FT                   /db_xref="GOA:Q1B010"
FT                   /db_xref="InterPro:IPR010787"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B010"
FT                   /protein_id="ABG03018.1"
FT                   /translation="MHRIRAPGEEALAAGASEERLTFGGMARWDGLDLFGPNYMSVAYR
FT                   RGGKVHVRIEPSRLRPPQSPAVRRLVRLPVVRSFFFWGRLVLQVAGSVWTLLFFAATLG
FT                   ALWLLVSLLEAGRDASGGLLGPLLGLLAEFPILPVLALFFAAMRLTPVGRYHGAEHKAV
FT                   AAYERYGEVTLEKARASSRIHPRCGTNILLYIILAALADPFIGWWGYSVLQFLLISEAW
FT                   FVFGQSRPSVAVGSFLQRYFTTTEPRRAELEVAVESLRRLLRAEEESAGEGAARMPA"
FT   gene            complement(39883..40782)
FT                   /locus_tag="Rxyl_0038"
FT   CDS_pept        complement(39883..40782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0038"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mma:MM3004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03019"
FT                   /db_xref="GOA:Q1B009"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B009"
FT                   /protein_id="ABG03019.1"
FT                   /translation="MSYGELIRDAFRTVWRNRYLWFFGFFVAGSGFSFNVPGGPPGGLP
FT                   DSLRWAGENLALVVAAAALLALVLLLVYLVLGVVSAGGLAWSVAAIERGERPGFSSTFR
FT                   AGLGSFWGVLGQAILLLLIGIGLALAVFVAVGGPFVLLLALTESVAARVVFGVLLGLLG
FT                   VVLLVVLYVPYAVVGQFALRELVVGRRGALDAIGGAFGLFRRNAGKSILVWVINLALSI
FT                   GVGVALAVVFILLGIALFMPAIALGTAGHEAAAVAAGVVAGLVLLPLLLVATGAVGAFF
FT                   HAYWTLAYLRLSGAAPPY"
FT   gene            complement(40779..42215)
FT                   /locus_tag="Rxyl_0039"
FT   CDS_pept        complement(40779..42215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0039"
FT                   /product="protein of unknown function DUF407"
FT                   /note="PFAM: protein of unknown function DUF407; KEGG:
FT                   fra:Francci3_2911 enzymatic protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03020"
FT                   /db_xref="InterPro:IPR016450"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B008"
FT                   /protein_id="ABG03020.1"
FT                   /translation="MPRGIGYNRFSVRFERKLPGPNEVFFPDGSPRPGYGPLLEELEET
FT                   GPARWLERLEKARSLLLEEQRSFGLLGGDRTHPTDWFPRIVAAPDWERLERGIAQRMRA
FT                   LNAFLRRLEAGKEEVVPPEVLESSILYDQDTPNRFGPVPVRQVAFDVVAVEGGAGGWEY
FT                   VVIEENAKMPVGLAPMTRRRALSAGLFFPKTYEGLGVRGLDGWLGRLGEALRAASPRGR
FT                   EATLAVVSGGPGDQFYLDHHIYASEMGALLAEPGELEVDGEGYLVHRPSGRRVDVVYER
FT                   VDEDRLYAEVPGLLRCHLEGRVHVLFAPNSEVVDDKGVYPFIPEMVRRYLGEEPILENA
FT                   RTWSLAIEEDRRYVMRNFERLVVKSRGGYGGKEVMIGPEESAEARERFRRMVESNPVEY
FT                   IAQPPLEFSTHVLCDVEEGEFVLRDSYADYRVLALAPDPQDPDVVEVVPGALARVAAPG
FT                   RRITNISSGGKMKDTWVPGR"
FT   gene            42266..42988
FT                   /locus_tag="Rxyl_0040"
FT   CDS_pept        42266..42988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0040"
FT                   /product="DnaD and phage-associated region"
FT                   /note="PFAM: DnaD and phage-associated region; KEGG:
FT                   ctc:CTC02142 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03021"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="InterPro:IPR034829"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B007"
FT                   /protein_id="ABG03021.1"
FT                   /translation="MDSVRLTPPGERRVRGERARLYIRWMPHLGAEAVALYELLRVLPE
FT                   VGLDEVEVQELAELLRSTPEGVREALKTLEENGFLVRREGWTEVAGPPPAPGRAPAAPE
FT                   RPARDIRVIRAADEGVSADDYFRYMGSLPSPHILEFLNGYCERDGMSPDVVREALRIAS
FT                   ERDARRVGYVRSILERWVERGVKTVEDVERFEQDRRLRLVQHGGAPAERTGEGVQEDGA
FT                   HRRPAARRREDYRWFFGE"
FT   gene            43068..43793
FT                   /locus_tag="Rxyl_0041"
FT   CDS_pept        43068..43793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0041"
FT                   /product="IstB-like ATP-binding protein"
FT                   /note="PFAM: IstB-like ATP-binding protein; SMART: ATPase;
FT                   KEGG: bat:BAS3827 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03022"
FT                   /db_xref="GOA:Q1B006"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B006"
FT                   /protein_id="ABG03022.1"
FT                   /translation="MEFPPALQRKFGRPGEWYYHPCTPECERKNERREWELMRRDARVA
FT                   ALRERSGLSRRMKGYTLSGFNPYVSPAAAKALEKVEAYLKGWEENREQGRGLYFCGGVG
FT                   TGKTHLAVAVMNELIQRRRVPSLFVTVPELLDNLRGAYNDPGRDLDEWMDAVKNAELLL
FT                   LDDLGAEKANEWVRERLFVIINHRYREALPTIFTSNIGPEELPRQLGERTASRIIAMCE
FT                   GVELEGPDYREKLRNERGA"
FT   gene            43790..44395
FT                   /locus_tag="Rxyl_0042"
FT   CDS_pept        43790..44395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03023"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B005"
FT                   /protein_id="ABG03023.1"
FT                   /translation="MREEFLITRQGRQYVLFAGLLDEAHARGLRSIETELLQVPEEANG
FT                   MTAIVRARVEMEDGRTFSGLGDANPQNVGRSIAPHLIRMAETRAKARALRDAVNVGATA
FT                   LEELTDGEESPPVEEARSRRPRPVEEAPPGEGGSEAGRRGGRVRRSQLELLRTLAVEAR
FT                   GENGVERLERHIGKPLSELTREEAEAWIDRLTPAGGRE"
FT   gene            44402..45193
FT                   /locus_tag="Rxyl_0043"
FT   CDS_pept        44402..45193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0043"
FT                   /product="protein of unknown function DUF1624"
FT                   /note="PFAM: protein of unknown function DUF1624; KEGG:
FT                   mma:MM1197 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03024"
FT                   /db_xref="GOA:Q1B004"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B004"
FT                   /protein_id="ABG03024.1"
FT                   /translation="MVRWPPVPLAAAGKGGGRYWDVDAARGVAMGMVVLYHLVFDLDNF
FT                   GGYPIASTSGFWAAFADASAFVFVFLAGLSLTLSYRRAARPTFGKYLRRGLRIFAYGML
FT                   ITLAFRLVDYGYVIFGILHLIGASIVLAYPFLRLRWANLPLGLLVIALGAYVGARDFAA
FT                   GGAAGVLLAPLGVLPEGVMMPDYRPLLPWFGVVLLGVFAGNAAYLPWRERRPPGGPPGP
FT                   AAGALALVGRNTLLIYLVHQPVLLAVLWALGVLAPPGVAGR"
FT   gene            45190..46065
FT                   /locus_tag="Rxyl_0044"
FT   CDS_pept        45190..46065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0044"
FT                   /product="beta-lactamase-like protein"
FT                   /note="PFAM: beta-lactamase-like; KEGG: mta:Moth_1254
FT                   beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03025"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B003"
FT                   /protein_id="ABG03025.1"
FT                   /translation="MRRRALAPALVLVLLLFAACGGVRGGAGPPPSGALSVSFIDVGQG
FT                   DSVLVQAGGEDYLVDAGNPEEGPVVVDFLRERGVDDLEGLVSTSGDADHAGGLADVLEA
FT                   FPVERIYLSGYPKDTLTYAGFLRAVRAEEGADVERVRAGYRTEWGGVRVDVLNPPPGGY
FT                   FSGSNDNSVAVLLTYGRARVLLAGDAERRAEEYMAGGPHTGPLTVLKVNHHGSETSSGP
FT                   LFLSRFRPKVAVIQCGRDNPYGHPDPEVLERLRRVGARVFRTDLHGDVIVTIRRDLVEV
FT                   AVERPARAGA"
FT   sig_peptide     45190..45267
FT                   /locus_tag="Rxyl_0044"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.811 at
FT                   residue 26"
FT   gene            46145..46570
FT                   /locus_tag="Rxyl_0045"
FT   CDS_pept        46145..46570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0045"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: tde:TDE1677 single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03026"
FT                   /db_xref="GOA:Q1B002"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B002"
FT                   /protein_id="ABG03026.1"
FT                   /translation="MVSFNRVILAGNLTRDPELRFTSDGVPVCSFGIAVNRVRSRNEEV
FT                   DFFDVSAWRELGETIANYKKKGDPILIEGRLQYRTWEAQDGTRRSKVDIVADNVQFLGR
FT                   GGDPGEGGGSSGGQGRRGRGAGDEVDINESDFDDIPF"
FT   gene            complement(46567..47430)
FT                   /locus_tag="Rxyl_0046"
FT   CDS_pept        complement(46567..47430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0046"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV1785 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03027"
FT                   /db_xref="GOA:Q1B001"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B001"
FT                   /protein_id="ABG03027.1"
FT                   /translation="MRRVLRLAPLLAALLPLALLWVGALGLREAVLAAAALEGLLALAS
FT                   GGVVLLGFRRMRRKGRGRREAAEKALSAVMPSAAARLVVAEQIVLWCLLRRALGGREPE
FT                   SGEFPYHRRSSLRVLVPLVLLLSPAELGAAHLLVHLLSPWPSLGWALLALEVYALLWLA
FT                   GLCASLSLLPHRLEGDGIRLRYGAHAEVFVPYAEIREVLLHPARPAGKTSLLFPAEGLA
FT                   FSREEGEISIPVGGRTDLSLRLRSPASARGLLRARGPAGCVRFAADEPERLAAELGAAA
FT                   GFLSSL"
FT   sig_peptide     complement(47329..47430)
FT                   /locus_tag="Rxyl_0046"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.907 at
FT                   residue 34"
FT   gene            complement(47427..48221)
FT                   /locus_tag="Rxyl_0047"
FT   CDS_pept        complement(47427..48221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0047"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; KEGG: sma:SAV1786
FT                   putative MerR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03028"
FT                   /db_xref="GOA:Q1B000"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B000"
FT                   /protein_id="ABG03028.1"
FT                   /translation="MGGEKLTIGEAARLLGMTPRAIRHYERLGLLEEPERSAAGYRLYG
FT                   ARELLRLRRIKRLRELGLPLQRIGRLLEGPEAGTGLRPVLEFLLGEVESRLRELEGRRA
FT                   AILEALSRTDPEESAERPLLLRLLEERLGRRMEEMADPDLLEQGRRVWSLLDAFEWPEG
FT                   YREAHEALACHLARHPEALRRLLGLEERLAALAHAPPDSPEVEQLAEEFARYWAEQPSP
FT                   AQDAPAWPENVSGVLYELSLSRLSRAQRRCLELVRERLEARG"
FT   gene            48394..49491
FT                   /locus_tag="Rxyl_0048"
FT   CDS_pept        48394..49491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0048"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="TIGRFAM: transaldolase; PFAM: Transaldolase; KEGG:
FT                   nwi:Nwi_2641 transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03029"
FT                   /db_xref="GOA:Q1AZZ9"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004732"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZZ9"
FT                   /protein_id="ABG03029.1"
FT                   /translation="MNERLKRLQEIGQSVWVDSLSREDVVEGGLRRLVEEGVSGVTSNP
FT                   TIFQQAISGSPLYDEQLRELAGEEEPREVFFRLAREDIRGACDVLMPVYERTGGEDGYV
FT                   SLEVSPDLAYDTEGTVEEAQRLHEMVERPNLLVKIPATREGLPAIEEMISRGRSINVTL
FT                   IFSLGRYREVAGAYIRGLRRLVGSGGDPSRVASVASFFVSRVDTEADRRLEAAGRPELK
FT                   GRLAVANAKLAYQEFKRIFSGPEWERLASAGARVQRPLWASTSTKNPEYSDVKYVEELV
FT                   GPQTVNTMPHSTLRATMDHARVRPTLEEGLEEARKTFALVREAGVDYDDLTRVLEEEGV
FT                   RKFADSFQELLREIEQKGRRLVRQG"
FT   gene            49520..51400
FT                   /locus_tag="Rxyl_0049"
FT   CDS_pept        49520..51400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0049"
FT                   /product="Transketolase-like protein"
FT                   /note="PFAM: Transketolase-like Transketolase, central
FT                   region; KEGG: ana:all4052 transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03030"
FT                   /db_xref="GOA:Q1AZZ8"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZZ8"
FT                   /protein_id="ABG03030.1"
FT                   /translation="MAHVNQKTVDATTLRELAQQLRVDSIRASTTAGSGHPTSSMSAAD
FT                   LMAVLMARYLRYDFDDPENPLNDRLVFSKGHASPLLYSMYKAAGAITDEELLSFRKFGS
FT                   PLQGHPTPALRWVDVATGSLGQGLPIGVGLALAGKHLDRLPYRVWVLCGDSEMAEGSMW
FT                   EAFQHAAHYGLDNLVAVLDMNRLGQTRETMDGWNGDAYAGRARAFGWHAIQIDGHDVEE
FT                   IDRAYAEALEQDKPVLVIARTRKGRGVSFLEDQLGKHGKPVPPEQAEQAIEELGGERSI
FT                   TVEVPRPDRRPQPPVRDGFTGEYRPKRWEVGDSEATRTAYGEGLKALGAAREDVVVMDG
FT                   EVSDSTRAQKFAEAYPDRYFEMFIAEQQMVATAVGMSVRGYVPFASSFAAFLTRAHDFI
FT                   RMAAISGANLRLCGSHAGVSIGPDGPSQMGLEDLAMMRSLHGSTVLYPCDANQTVKLVR
FT                   EMAGLEGISFLRTTRDSTPVIYPADEEFPVGGSKVVRSSEEDAVTVVAAGITVHQALRA
FT                   AEELQGEGIRVRVIDAYSVKPIDARTLISSARQTAGRVVVAEDHWPEGGLGEAVLSAFA
FT                   ENGALDGLRLRHLAVSGMPGSGKPQELLDAAGIGFGDIAGAVRSLLDGRA"
FT   gene            51418..52335
FT                   /locus_tag="Rxyl_0050"
FT   CDS_pept        51418..52335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0050"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase related
FT                   protein; PFAM: 6-phosphogluconate dehydrogenase-like
FT                   6-phosphogluconate dehydrogenase, NAD-binding; KEGG:
FT                   dde:Dde_3470 6-phosphogluconate dehydrogenase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03031"
FT                   /db_xref="GOA:Q1AZZ7"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZZ7"
FT                   /protein_id="ABG03031.1"
FT                   /translation="MEIGIYGLGRMGANMVRRLLRSGEHRVVAGNRSPGPVDEAAKEGA
FT                   EGAYSMQELVDKLEPPRVIWSMVPAGEPTEKTLMGFAELAQEGDILIDGGNSYFRDSVR
FT                   RASALRERGLRFLDAGTSGGIWGLEVGYCLMVGGDRSAFEHVEPALKTLAPPDGYAYLG
FT                   EAGAGHFAKMVHNGVEYAMLQAYAEGFEILKKSPYGYDLRALSSLWNHGSVVRSWLLEL
FT                   AERAFEKDAELQSIRGYVEDSGEGRWTVLEAIEEDVPANAIAGALFARFASRQEDSFAM
FT                   KVIAALRREFGGHAVKEAGPGGGG"
FT   gene            52332..53864
FT                   /locus_tag="Rxyl_0051"
FT   CDS_pept        52332..53864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0051"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="KEGG: syn:slr1843 glucose-6-phosphate
FT                   1-dehydrogenase; TIGRFAM: glucose-6-phosphate
FT                   1-dehydrogenase; PFAM: glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03032"
FT                   /db_xref="GOA:Q1AZZ6"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZZ6"
FT                   /protein_id="ABG03032.1"
FT                   /translation="MSGVREELRDALADERRIPRPPEPAAMVIFGASGDLTARKLVPAL
FT                   YDLAAARRLPMGFAVVGVSRTKMSHEQFRQRLRGSLERHRAGGFSEEVWESFSRSIFYL
FT                   PGDSRRPETYGELRGLLERLDAGRGTGGNRIFYLASSPSLFSPTVERLGEAGMSREGGG
FT                   SYVRLVVEKPFGRDLESARRLNADLLRHFREDQIYRIDHYLGKETVQNILALRFANGIF
FT                   EPVWNQHYVDHVQITVAEDIGIEGRGAFYEEAGALRDIVQNHMMQLLCLTAMEPPVAFD
FT                   AEPVRDEKVKVLSAVRPIPEERVEEVAVRGQYGSGWIWGEEVRAYREEEGVAPDSATET
FT                   YAALKLYVDNWRWAGVPFYVRTGKRLPKKVTEIAIRFKPTPHTPFARAAGAEPNVLVIR
FT                   IQPEEGVSLKIGAKIPGSGFEVGSVNMDLLYGTAFLEEVPEAYQRLLLDLMLGDATLFI
FT                   RADEAEAAWSILDPVLRAWSGAEDVPVYPAGSWGPAEADDLLRRDGRGWRRP"
FT   gene            53861..54931
FT                   /locus_tag="Rxyl_0052"
FT   CDS_pept        53861..54931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0052"
FT                   /product="Glucose-6-P dehydrogenase subunit-like protein"
FT                   /note="KEGG: gvi:glr3179 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03033"
FT                   /db_xref="InterPro:IPR004555"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZZ5"
FT                   /protein_id="ABG03033.1"
FT                   /translation="MIGELRRAGGGGRMSVEEVERELARLRMGEDGRLGLRASVLNLIA
FT                   VTGEETAPRVAEAVSRLAGEHPSRTVLLISDPAGADRMDVRLSAFCTPRGGGTQVCAEQ
FT                   ITIHAEGAPARHLESIAGPLLIPDLPVFLFYTGSFSASSPEFSRIARLADRLIVDSSSW
FT                   DGCGSAFGAVAEVLSRPDLPPAGDLQWATLTPWRTLIAEMFASPERAGELSGIEEVEIR
FT                   HAPDGECRALLLAGWLASSLGWRLEAASGSPPARELRFSGPPGGVRLRMEPAAPGARLA
FT                   RVTLRSPGCEFRVSRNLDRPEARATVSRGGRVVGESTAHVGRFDMSAMLAEELRCRGRD
FT                   AAYERALGAAVEVLGA"
FT   gene            54928..55656
FT                   /locus_tag="Rxyl_0053"
FT   CDS_pept        54928..55656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0053"
FT                   /product="6-phosphogluconolactonase"
FT                   /EC_number="3.1.1.31"
FT                   /note="TIGRFAM: 6-phosphogluconolactonase; PFAM:
FT                   glucosamine/galactosamine-6-phosphate isomerase; KEGG:
FT                   ade:Adeh_1440 6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03034"
FT                   /db_xref="GOA:Q1AZZ4"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZZ4"
FT                   /protein_id="ABG03034.1"
FT                   /translation="MRLRVLEDPAALAAAAAREFAARAAHAVRARGRFAVALAGGSTPK
FT                   AAYELLATEHAGGVDWRRVHFFFGDERPVPPDHPDSNYRMAREALLSRVPAGSVHRMRG
FT                   ELPPGEAARRYEEELRGFFAGERVPRFDLILLGLGEDGHTASLFPHTEALDETTRLAAA
FT                   NPVPELGTTRITLTLPVINAARAVIFLVSGGGKAEALRAVLGGPAGGEDPRRYPAGLVR
FT                   PGGEMLWLVDRPAAALLNGG"
FT   gene            55741..56289
FT                   /locus_tag="Rxyl_0054"
FT   CDS_pept        55741..56289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03035"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZZ3"
FT                   /protein_id="ABG03035.1"
FT                   /translation="MEREASFGRPAQLLAALLAAALMAVTALLPAGAARAAQPGSGLGA
FT                   LPVSGELSDGGSFQGTVSDLRASVDRSGDLVISGVLDGTATLADGTTRQIDDQPFRTTA
FT                   SVQQGEVCDVLFLDLGPIYLDLLGLTVDLSPITLDINAVPGPGNLLGNLLCAITGLLDR
FT                   DAPANALANLLNQVFSLLR"
FT   sig_peptide     55741..55851
FT                   /locus_tag="Rxyl_0054"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.988 at
FT                   residue 37"
FT   gene            complement(56429..57478)
FT                   /locus_tag="Rxyl_0055"
FT   CDS_pept        complement(56429..57478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0055"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase
FT                   short-chain dehydrogenase/reductase SDR 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase polysaccharide
FT                   biosynthesis protein CapD dTDP-4-dehydrorhamnose reductase
FT                   Male sterility-like; KEGG: mlo:mll9007 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03036"
FT                   /db_xref="GOA:Q1AZZ2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZZ2"
FT                   /protein_id="ABG03036.1"
FT                   /translation="MEQQRGKVLITGGAGFLGINLARHLLKKGYAVASLDIAEFDYPER
FT                   DRVEVIRGDIRDAALVERAVREADFVVHAAAALPLYKPEDIYTTDVEGTRNVLEAALRH
FT                   GVRRVVHISSTAVYGIPDHHPIYETDRLEGVGPYGQAKIQAEMICLEYRAKGLVVPILR
FT                   PKSFVGPERLGVFALLYDWAHTGHNFPVLGSGNNRYQLLDVEDLCEAIELCLRLPEERV
FT                   NDTFNIGAKEFSTIKEDYQAVLDAAGHGKRVIGFPAAPAIWALRILDRLGLSPLYKWVY
FT                   ETVSKDSYVSIEKAERQLGFTPRYSNREALLRNFRWYLENLDRFQDASGVSHRVPWKQG
FT                   AIGLLKKVF"
FT   gene            57615..58604
FT                   /locus_tag="Rxyl_0056"
FT   CDS_pept        57615..58604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0056"
FT                   /product="Alcohol dehydrogenase GroES-like protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding Alcohol
FT                   dehydrogenase GroES-like; KEGG: gsu:GSU0573 alcohol
FT                   dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03037"
FT                   /db_xref="GOA:Q1AZZ1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014187"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZZ1"
FT                   /protein_id="ABG03037.1"
FT                   /translation="MRAMVLRAPGGPLRPEELPVPEPGSGEVLVRVRACGVCRTDLHVV
FT                   DGELREPKLPLVVGHQIVGVVERVGEGVERFSPGDRVGVPWLGRTCGRCRYCRTGRENL
FT                   CGEARFTGYQLDGGFAEYARADARFCLPVPEGYPDLQAAPLLCAGLIGYRALRMAGDAE
FT                   RLGLYGFGASAHIILQVARHQGRRVFAFTRDGDEEAQRFARRLGAEWAGGSGQRPPEEL
FT                   DAAIIFAPVGALVPLALRAVARGGTVVCAGIHMSDIPSFPYELLWGERQLRSVANLTRR
FT                   DGEEFLALAPEVPVRTEVRPYPLEGANQALDDLRSGRLTGAAVLVVGR"
FT   gene            58656..59624
FT                   /locus_tag="Rxyl_0057"
FT   CDS_pept        58656..59624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0057"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /note="TIGRFAM: magnesium and cobalt transport protein
FT                   CorA; PFAM: Mg2+ transporter protein, CorA-like; KEGG:
FT                   tfu:Tfu_1428 magnesium and cobalt transport protein CorA"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03038"
FT                   /db_xref="GOA:Q1AZZ0"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZZ0"
FT                   /protein_id="ABG03038.1"
FT                   /translation="MIVDRAIYVDGKRAELSGAAEDTYAACRRRGGMAWIGLYEPDEAE
FT                   FSSVAEEFGLHPLAVEDAVHAHQRPKLEKYGDTYFVVLKTARYVDETETVEFGEIHVFV
FT                   GEDFVVTVRHGEASALRGVRERLEGDRELLRRGPASILYAIMDRVVDDYGPVVDGLEND
FT                   IDEIESEVFGGSPHVSRRIYELSREVVEFHRATRPLAGVLERMLSDGGPPLDVELKRYM
FT                   RDVHDHAIRTNEQIEGFRELISNILNVNLTLVSVEQNDEVKRISAWAAILFAPTVIAGI
FT                   YGMNFDRMPELHWDFGYPFALALMLGVSGVLYALFRRRGWL"
FT   gene            59615..60397
FT                   /locus_tag="Rxyl_0058"
FT   CDS_pept        59615..60397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0058"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /note="PFAM: biotin/lipoate A/B protein ligase; KEGG:
FT                   hma:rrnAC2235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03039"
FT                   /db_xref="GOA:Q1AZY9"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZY9"
FT                   /protein_id="ABG03039.1"
FT                   /translation="MAVRRSSGVELLMPGRLPDAATAYGYARTVFEQVASGERPPTISL
FT                   APSVRHVGVTRRDTRREGFAAAVREAEGMGYPVLVRGAGGGAIAAGPGTFGFSIVRPRG
FT                   GESARGGFRERYEEAAALALGAFRRLGVRAEVGEVRDEFCPGDHSIRVGGWEEGMKLCG
FT                   IAQRVTRRAASVGGIVLVCGEEELARVLERVYAAMGLPFRPGSVGSLRRAGYGGGLEEA
FT                   LEAFAAEAEARYGARRVPLDGRTLGLARRAGPEHRAAL"
FT   gene            60430..61908
FT                   /locus_tag="Rxyl_0059"
FT   CDS_pept        60430..61908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0059"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: afu:AF1005
FT                   putative ABC-2 type transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03040"
FT                   /db_xref="GOA:Q1AZY8"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZY8"
FT                   /protein_id="ABG03040.1"
FT                   /translation="MGYLLRIKAVAAKELWVLVRQPQLLVMLLLGPVVIMVLFALSFRV
FT                   ENYLPWAVVVVEEGSEGEEIFREFRRQFVERTRFQGVLRSVERADRMLREGRTDAVIIL
FT                   PSDPSEAVAEGRQAVLEVHYQSINPLAGTAVPNRSNGLVLDLNRAIVREGIATELQNIS
FT                   GTVEEIEAINRQLERVSRAAEALTSERAREITSGLEEALSELEEALEGLEGRRAEEALE
FT                   RVRRARELLGELTSAQEAGARSIEERLGITELQRALDRLSEQVAEVPSGVPPRVLANPF
FT                   RLELENLAPFEPTAVEFYAPATLALLIQHVALSLASLAIVRERVSGAYEYFEVSPLRPG
FT                   GLLAGKFVTYLALVVAVNLAVAGVLAAVLEIPVRGGFALLAAAMAVLAAASVSAGFLLS
FT                   ALSRSQLQAIQVAMLVFIASGFFSGFLFPLRELEQPALAVSYFLPATYGIRALQEVMIL
FT                   GRWPAWGDLLGLAAIFCVSAACARLLLGRRGGAP"
FT   gene            61914..62852
FT                   /locus_tag="Rxyl_0060"
FT   CDS_pept        61914..62852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0060"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   gme:Gmet_0657 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03041"
FT                   /db_xref="GOA:Q1AZY7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZY7"
FT                   /protein_id="ABG03041.1"
FT                   /translation="MIEAEGLGMSFGGEEVLGEIYLSVGEGEIFGLIGPSGAGKSTLTR
FT                   LLTGYLRPSRGSVRVFGRDPCAFGAADRRRIGFMPQGFVLYGGLSVRQNVNFAAGLYGL
FT                   RLGERRRRVREVLEFTELWKDRRKAASRLSGGMQRRLQLAAALVHEPQLLFVDEPTANL
FT                   DPILRRKFWEGFEVLRDMGRTIFVTTQYVGEAELCDRVGLLSGGGLAAVGTPEELRRRA
FT                   FGGEAMELTLAGEPGRLGRHLDALEGVGHVVEVREERPGDGAAASTVRLVVEDADTALP
FT                   RAFEALRGAEVLSADLIHPSFDEVFVRLVRG"
FT   gene            62882..64033
FT                   /locus_tag="Rxyl_0061"
FT   CDS_pept        62882..64033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0061"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   bce:BC4385 hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03042"
FT                   /db_xref="GOA:Q1AZY6"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZY6"
FT                   /protein_id="ABG03042.1"
FT                   /translation="MGIWRWSGRKKEGARRAPAASGGRRAPTPIYVSRRTFTALVALAL
FT                   LSLGVVLYLAPIIFEILFGGIALALVLSYPVRALSQVMPRELAILVTVLGLFGLVALAL
FT                   LFLIPLLIEQLTNFVRITPAIAASATEFFGSLDDLLNRRDLPLQLPESFVSDLVRDLFD
FT                   RAQQILEGMIRNLIGFISGAFSFAVGVLGVLFVAIYLLIDVRKVKAAYLRMVPHRYRWD
FT                   ARELWDAFGVSLSRYLGGLLFVVAVQGALSAAALWVLGVPYPILLGAWVSVTAIVPYLG
FT                   PFLGAIPAIIVALIFTTPTTAVLTVIAYIAIQQFEGNFLTPRIQGRALQVHPIIVLLAV
FT                   IGGGQIAGIVGILFAVPVLAILRVFVDFFRVRLRVGPPPRNAA"
FT   gene            complement(64030..65340)
FT                   /locus_tag="Rxyl_0062"
FT   CDS_pept        complement(64030..65340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0062"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: gka:GK2123 ABC transporter (substrate-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03043"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZY5"
FT                   /protein_id="ABG03043.1"
FT                   /translation="MGERRISRRGFLGLGGGALAGAVLLGGCGGGGGGSGEVLFSWGPD
FT                   DTGVLPRLIERFNRENGSGITVRYREMPSDTGQYFDQLRTQFQAGGGDIDVIGGDVIWP
FT                   AQFAANGWIVDLSDRFEDAGRFLEGPMQAMTYEGKVYGVPWYTDAGLLYYRKDLLEKSG
FT                   YSEPPRTWDELREMALRVKQDSGVPAGFVFQGAEYEGGVCDGLEYIWTHGGDVLDPEDP
FT                   TKVLIDSPESVAGLKTERSMVEEGVAPEAVTTYKEDESHGAFLRGDAVFLRNWPYVYAL
FT                   VGDPEQSRIEPGQVGISELPVGGEGQQSYSCLGGWNFFINASSGRQEEAWEFIRWMTEP
FT                   EQLKVNALQGSRLPTRRGLYEDREVLEKVPVARLGKEAIIQNSRPRPVSPYYSDMSLRM
FT                   AEQFSASLKGEVSPEQAVKTLQGELQRLIEEGEAATG"
FT   gene            65491..66288
FT                   /locus_tag="Rxyl_0063"
FT   CDS_pept        65491..66288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0063"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   ava:Ava_C0096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03044"
FT                   /db_xref="GOA:Q1AZY4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZY4"
FT                   /protein_id="ABG03044.1"
FT                   /translation="MSGSVASGAGGGRPGLPGVFAALVAAGVLGSVAVVPYSAGLLARA
FT                   PGVEVSVGALLVAQAVQGLVLTAVAAGLGLWLGGRVGLGAWDVRALIAGGEGRRAVLRG
FT                   LPAALGLGLAAGAVLTAASVAGAPLAEGALGRVEHPPAWQGLLAAFGAGVTEEIWLRLG
FT                   AMSVLAWAGARLLRRERPPGGVFWAAIAISALLFGAGHLPLAAALGGLGGAVVLFVLAA
FT                   NGVVGLLCGWLYWRRGLLAAMAAHFAADVVLHFLAPALGLAAS"
FT   gene            66314..67048
FT                   /locus_tag="Rxyl_0064"
FT   CDS_pept        66314..67048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03045"
FT                   /db_xref="GOA:Q1AZY3"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZY3"
FT                   /protein_id="ABG03045.1"
FT                   /translation="MRALQNAGWIAGWEMRRAWLSYPLSAALLSFFGVVGAHFADEALA
FT                   GPGGAGAAFRVFYLDFFFLAATSLLAGNFFSRDYALSWGDTFSRRLAFLRRLPVSPGEI
FT                   VAGRVLSMLAAAVINVPLFFLALYALSGALGGLLEGTERVWFAGLWFGAALAWGGLYLY
FT                   LETGTSGRVYNLLMFPLIALFAVLAGVAQGVFGLRVVELAAAAAREGGPLAAAGAVLLG
FT                   AAVLAAMARAAARRVGRRELLA"
FT   gene            67084..67470
FT                   /locus_tag="Rxyl_0065"
FT   CDS_pept        67084..67470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0065"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; KEGG: bha:BH1164
FT                   transcriptional regulator (GntR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03046"
FT                   /db_xref="GOA:Q1AZY2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZY2"
FT                   /protein_id="ABG03046.1"
FT                   /translation="MEDPEPMYRQIEGQLRKLILGGHLPPGTRLPPVRALAQDLSCSVI
FT                   TTRRAYQDLEAEGLVRTRQGLGTVVAEIGEEERARHRRSAVLAAFREAVESGLRAGCSP
FT                   GELYEIFEQAVRQQTKRRDEDEAV"
FT   gene            67457..68383
FT                   /locus_tag="Rxyl_0066"
FT   CDS_pept        67457..68383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0066"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   mta:Moth_1164 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03047"
FT                   /db_xref="GOA:Q1AZY1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZY1"
FT                   /protein_id="ABG03047.1"
FT                   /translation="MRRCETAGEGAREAVVSLAGVEKSYPPFRLGPVSLRVEPGYVVAL
FT                   VGPNGGGKSTLFRMLMGLCRPDSGEVRLFGGRYPEDEARIKRRVGYVPERAVGHDEMDA
FT                   RALGRFLSRWYPGWDAGRYGELLDRLGVERKRPFGRLSRGMQRRLLFAAALSCGPELLL
FT                   LDEPTGGVDPLARREMIDEISRFARGEEGPGGGRAVIFATHVMEEVGRAADYVAFLHGG
FT                   RFFGPYEKDRLAESWRRLWVGRPPGAGEAVPGLVAVEQGPPASLLTSSAAQARAALEER
FT                   GIEVLGVRSVPLEEILAHLARGAGASP"
FT   gene            complement(68373..69221)
FT                   /locus_tag="Rxyl_0067"
FT   CDS_pept        complement(68373..69221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0067"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PF00567 probable
FT                   sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03048"
FT                   /db_xref="GOA:Q1AZY0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZY0"
FT                   /protein_id="ABG03048.1"
FT                   /translation="MLGSKARAERLTRAGLYAAYAAITAFFLFPIFWVVSMSLKTVPQL
FT                   FASPPVWFPVPPQFENYAYVLTGTSIGRYLLNSAFIVLMTVIFTLIIATLAAYGFSRFS
FT                   FRYKRPSLLAVLVFQMVSPVVIAIPLYRFFAALGLLNSYATLILVYVAIVLPFTTWFLK
FT                   GYFDTIPYEMDEAAIVDGASRWQVLTRILLPVCAPGIATAAILAAVLSWSQFVVPFILL
FT                   DSRELYPISVGLVDLKNTSDAITLHYLSAASVIAIAPVIAVFVLLQRYIVNALTAGAIK
FT                   G"
FT   gene            complement(69223..70143)
FT                   /locus_tag="Rxyl_0068"
FT   CDS_pept        complement(69223..70143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0068"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PF00566 putative
FT                   sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03049"
FT                   /db_xref="GOA:Q1AZX9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZX9"
FT                   /protein_id="ABG03049.1"
FT                   /translation="MTAAKTRGPGGSWLESLAGSPWPWLLPLAAILLATFVFPIFEIVR
FT                   LSFTNASLVGGGHEYTLGSYASLLTSPYFLDMLTATAVFVFFSVLFQMLLGFLIALAVD
FT                   QGARRGMRASIVTRTAVLSAWAIPGVIIGIIWSILYQQSQVGVLNYLLGLVGVGPVPFL
FT                   SDPEFALASVTVANIWRGTAFSMILIYAGLQTLPDDVLEAARVDGANAWQSLTRVVIPL
FT                   LAPILFINLVIVSIETFNTFDMVLALTGGGPGRATEVIALSIYNQIFQQFDLGPGAATA
FT                   VLLLAVNAVMTVVYIRLLQREEEVA"
FT   gene            complement(70158..71456)
FT                   /locus_tag="Rxyl_0069"
FT   CDS_pept        complement(70158..71456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0069"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: extracellular solute-binding protein, family 1; KEGG:
FT                   ret:RHE_PF00565 putative sugar ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03050"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZX8"
FT                   /protein_id="ABG03050.1"
FT                   /translation="MMQTRLSRREFLRLGGASLAGAALLGAAGCGGGGGGENAIGWQAI
FT                   PSYSTEQNTDQARVEYLEQAISEWEEQNGEYTINPLVTSADVTAAMARLLEQASQDRAP
FT                   DIAQIDGYILPRFYDYVRPLDDYLGDLSLEDWFPFARAVMTDGGSVKGLQFTTDVRVLY
FT                   YRKDLIDSPPASWDELFSAGQRVSGEVQDAFLFPAGRGEATTITTLLPQFWTLGGELVD
FT                   DRGEPVFGEGENRRAMLEALGFIRECVERGITPRRVTEFTLETDINGDAASGQTAMFLG
FT                   GNWQVSLLKEIMGEERFTRQWGVAPIPSHSGEEHATTAGGWAWGVFAENEDKRRAAVDF
FT                   LRAVFVGNQGMARWCNVGGYLPPREPVFEVPAYETDEYTDTFREHLENFARNRPSAESY
FT                   TDISTALQVAVTQVVSGEASPEQALRTAVRTVG"
FT   sig_peptide     complement(71358..71456)
FT                   /locus_tag="Rxyl_0069"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.314 at
FT                   residue 33"
FT   gene            complement(71453..74266)
FT                   /locus_tag="Rxyl_0070"
FT   CDS_pept        complement(71453..74266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0070"
FT                   /product="glycoside hydrolase, family 38"
FT                   /note="PFAM: glycoside hydrolase, family 38 glycosyl
FT                   hydrolases 38-like; KEGG: cpe:CPE1415 putative
FT                   alpha-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03051"
FT                   /db_xref="GOA:Q1AZX7"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="InterPro:IPR041147"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZX7"
FT                   /protein_id="ABG03051.1"
FT                   /translation="MSTAREIAERSEAGREPLNIVVIPHSHWDREWYATFEEFRFYLVR
FT                   FMDELLEVLEKDEAFRSFLLDGQVSLLEDYLQVRPEKLDELRRLVQEGRLDIGPWYVQP
FT                   DEFLVSGEALVRNLLIGDRIGRQFGPVMKQGYVPDTFGHVSQLPQILRGFGIGTFYFMR
FT                   GLAESVDELRSEFWWEAPDGSRVLAHFLSETYSNAAVLGPDPEKISFRHDRLAEPSSYF
FT                   VSYDSLYELRDRLAARAADRTILFMNGSDHVTVQPDFSRYVFALNQAMEDRLFNGRLAD
FT                   FERLVLEENPPLKTYRGELRWARYQPILKGVYSSRMYLKQENERTQQLLEGLAERAAAV
FT                   VYALGGPDYSPFLRYAWKELLKNHAHDSIGGCSADAVHRQMLGRYDTVRRVGQKVVDEA
FT                   LDYIASRVAPEPDAGSIPIVVFNPSPWERGGTVQVEVSLNLDAPLKRRIFDWIGQKEFD
FT                   VERAALLDPDGREVPFSIRGRRLHIEDALYRRKAVRRATVEFLAEKIPPLGYKVYRLVE
FT                   TPEREPTSEEREVPWEVALENERLKVTVEGDMTLTILDKTTGERYAGLNLFVDEADAGD
FT                   EYTFCPPREQRRVLSSEEDWRVEDTGDPHTLLLRGSMLLPKGLAPGRSARSLQTVRCPL
FT                   NVRLRLLPGARRLEISTEFFNRAKDHRLRVVFPAGFPARESVAETAFGTVRRPTRPTDS
FT                   AGWREKDTATYAQRRFVCVEDPETGRGLAVLNKGLPEYEVTPEGEVCLTLLRGVGWLSR
FT                   NDLSTRTGHAGPGLATPEAQCSGRHVFEYAVVPYTGGHREAGIFREAEEYWLPLEAWDV
FT                   HRGERPREGSPAGAPGSFLRVHGKDAVLSTLKKAADRDGLVLRLFNASEEESRAVLNFG
FT                   IPIAAAYRTNLNEEILEELAPKGHRLRVNLRPCGIETVLVKLHRPERWAERIRRTAPER
FT                   TRGRRTG"
FT   gene            complement(74263..74601)
FT                   /locus_tag="Rxyl_0071"
FT   CDS_pept        complement(74263..74601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03052"
FT                   /db_xref="GOA:Q1AZX6"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZX6"
FT                   /protein_id="ABG03052.1"
FT                   /translation="MTSRREEILERLGGSRLFAAVASRVAPPVDRALYRRLGGRTLGAG
FT                   PQTLLLTTRRRSSGRMRTVPLLYVRDGERLAVAASNWGRKVPSRNASHARISPKAREIG
FT                   EASRSMEG"
FT   gene            complement(75249..76313)
FT                   /locus_tag="Rxyl_0072"
FT   CDS_pept        complement(75249..76313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0072"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20 peptidase dimerisation; KEGG:
FT                   ade:Adeh_3828 peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03053"
FT                   /db_xref="GOA:Q1AZX5"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010174"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZX5"
FT                   /protein_id="ABG03053.1"
FT                   /translation="MRERLAENLLWFLERPSVTGAEQRLCDDLEARVGRLPGWKAQRTG
FT                   NNLAVRRAAPDPSRPLILFAGHLDTVPEPEGGIPVRVEGERFYGRGASDMKAGDAVMLA
FT                   LIEELDWERSWAEPAFVFYEREEGPHEENGLEAVFEEMPWVLKAGLALVLEPTAGALEA
FT                   GCAGTAQVEVTFRGRAAHAARPWQGENAISKAGRFLAALHAREPEKVVVEGLDFYDVLT
FT                   PTVARGGSAKNVVPASFWVNVNHRFAPGRGIEHVRSTFEALLGEEASFEIADFAPSGPV
FT                   DLSNPLLRRFLATGIEVRPKQAWTDVARLAERGVAAANFGPGLPAQAHQDDEHAELPLL
FT                   EECYRRLEGFLRSA"
FT   gene            complement(76310..77119)
FT                   /locus_tag="Rxyl_0073"
FT   CDS_pept        complement(76310..77119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0073"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="KEGG: ade:Adeh_3829
FT                   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03054"
FT                   /db_xref="GOA:Q1AZX4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZX4"
FT                   /protein_id="ABG03054.1"
FT                   /translation="MRELIEEAFENRDLLKSSEEHRAAVFETVAALDRGELRVAEKKDG
FT                   GWRSNAWVMQAINLYFVLAEMKTITAGPLEFHDKIPTKKNLAEAGVRVVPPGTIRYGAF
FT                   AEPGVVLMPGYINIGAYVGSGTMVDTWATVGSGAQIGRNVHLSGGVGIGGVLEPPGAMP
FT                   VVIEDGAFIGSRAVVVEGVRVEEEAVLGANVVLTASTPIIDVTGEEEKVYRGRVPARSV
FT                   VVAGTRTREFPAGSYQLQAALIIGRRRASTDRKTSLNEALRQFGVSV"
FT   gene            complement(77177..78394)
FT                   /locus_tag="Rxyl_0074"
FT   CDS_pept        complement(77177..78394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0074"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase aminotransferase, class I and II;
FT                   KEGG: ade:Adeh_3830 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03055"
FT                   /db_xref="GOA:Q1AZX3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019877"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZX3"
FT                   /protein_id="ABG03055.1"
FT                   /translation="MVYFWPAAEENRPLGGLYPVRKADATPLRLNPVLERQGEYPLLRL
FT                   DERRERLKEQGVRLFDFGAGDPREPTDPRIRRALLEAVPEVSQYPSASGTRALREAFCG
FT                   WMERRHGVELDPDAEVLPASGSKEAIFHAHLPFLHHTHERRGVAYGTPGYPVYERGALF
FT                   AGGEALPVRLVREDGFLLPLEAVDPQRTRILWLNYPHNPTGARAPRSYLEEAAAFCREH
FT                   DILLFSDECYNEIYSGDPPPSVLEVSRERTLAFCSLSKRSGMTGYRSAMMAGDAELISA
FT                   LGKLRPSVGVASPSFVQAAAAAAWSDDEHVEERRRTFARKRGLFVEFFRRAGLDFLPTD
FT                   ATFYLWVAVPGGDDEAYALRLLEEGIVVAPGRSFGPGGEGYVRVALVPSLEECEEAVRR
FT                   WEALAA"
FT   gene            78454..79704
FT                   /locus_tag="Rxyl_0075"
FT   CDS_pept        78454..79704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0075"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: gsu:GSU0158
FT                   diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03056"
FT                   /db_xref="GOA:Q1AZX2"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZX2"
FT                   /protein_id="ABG03056.1"
FT                   /translation="MDEFHYRGGVLHCEDVPLHEIARGAGTPAYVYSYAALERAYREVE
FT                   EAFSGLDHLVCFAVKANGNLAVLRALASLGAGADIVSGGELYRAMRAGFDPKKVVFAGV
FT                   GKTEQELKAGLGERILMFNVESAGELEHLERLAHLHGKRARVALRINPGVDPGTHEHIS
FT                   TGNVESKFGIPADEALSLAERAKGFRCVDLIGVHQHIGSQIVKVAPYVESVERSAALVD
FT                   ELRSRGFDIRYLNIGGGLGIRYRDEETPSPAELVEAIRPTLAASGAKILCEMGRYIAGP
FT                   AGALLTGVLYRKRSGERSFIVADAGMNDLIRPSLYGAYHEVLPLDEGADQTRADLVGPV
FT                   CESGDFLARDRDLPDAREGDVLAVMNAGAYGFSMASNYNSRPRPAEVLVREDRWAVVRE
FT                   REHYPDLIRGELVPAFL"
FT   gene            79822..81174
FT                   /locus_tag="Rxyl_0076"
FT   CDS_pept        79822..81174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0076"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter major
FT                   facilitator superfamily MFS_1; KEGG: bja:bll0889 putative
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03057"
FT                   /db_xref="GOA:Q1AZX1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZX1"
FT                   /protein_id="ABG03057.1"
FT                   /translation="MSAGAQGRGLAAGAEAAREGEGLRRVVFGALVGTALEWYDFFIYG
FT                   TAAALVFGRLFFPGFSDLAGTLAAFATFGVAFLVRPLGGFVFGHMGDRIGRRETLIVTT
FT                   LLMGISTGLIGLLPTYEAIGVWAPVLLTLLRVCQGLGAGAEFGGASTLLAEHAPQGRRG
FT                   FYCSFSQMGVQVGLVCGTLAFLLVGLLPDEQLFSWGWRVPFLLGFALIAVALYVRLRIE
FT                   ESPVFRRLESTRQTVRMPILEALRRYPRNFLIGIGAHVCDTALAYFYATYSVSYLTTQL
FT                   GLPRSTALAGVVLYGVIVILLQPVYGALSDRIGRRPINIFSVVFTAAFAFPFFLLLNTE
FT                   STPLIWAALVIATALGWAPMIAVQGAFYSELFGARVRYTGFAASRELGAVLAGFSPFIS
FT                   VALVGMADGAPWLVAGFMILLAFVSFLAFYFSEETKDVDIARADPAYGEGA"
FT   gene            81175..81921
FT                   /locus_tag="Rxyl_0077"
FT   CDS_pept        81175..81921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0077"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bbr:BB1748 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03058"
FT                   /db_xref="GOA:Q1AZX0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZX0"
FT                   /protein_id="ABG03058.1"
FT                   /translation="MGRLAGRRAVVTGAASGIGLAIARRFLREGARVVLGYHGRRPPDP
FT                   LPPGRALARRADVTVAEEVEGLVRLATERWGGLEVMVNNAGVGVAATAPQTSEEDFERV
FT                   LAVNLRGTFLGMKYAIPAIRDSGGGAVINICSNAALVGVPERAAYSAAKGGILALTRAG
FT                   AIDHIHEGVRVNCIAPGTTDTPWIGKITAGYADPEEARRRMRERQPHGRFVRPEEVAAM
FT                   AAYLASDEAASVVGACMVVDGGMSAR"
FT   gene            81997..82953
FT                   /locus_tag="Rxyl_0078"
FT   CDS_pept        81997..82953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0078"
FT                   /product="PfkB"
FT                   /note="PFAM: PfkB; KEGG: bcl:ABC3352
FT                   2-keto-3-deoxygluconate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03059"
FT                   /db_xref="GOA:Q1AZW9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZW9"
FT                   /protein_id="ABG03059.1"
FT                   /translation="MEASGALEVVTLGEALIVMDPVERGPLRHVPGFRKRVGGAELNVA
FT                   VALARLGHRAGWAGSVGDDEFGREVLGFLRAEGVDVSGAVLDPGAPTGLYFKEWRAGGL
FT                   RAHYYRAGSAASRMAPGRLDEGFLLSGRVLHLTGITPALSGGCEELVRRLAGEAGRRGV
FT                   LLSFDANIRWRLFGERDPRKAIEPLLPLADLLFLSDEEAELLLGGSDPRSVERARGRLG
FT                   AGVVVVHSASGSFAAGGEGVVRREGYRVEAVDTVGAGDAFVGGFLAGFLRGWETGACLE
FT                   LANACGACAVAVPGDAASMPAEEEALALLRGRRERER"
FT   gene            82982..83638
FT                   /locus_tag="Rxyl_0079"
FT   CDS_pept        82982..83638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0079"
FT                   /product="2-keto-3-deoxy-phosphogluconate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /note="KEGG: bld:BLi03826
FT                   2-keto-3-deoxygluconate-6-phosphate aldolase; RBL01576;
FT                   TIGRFAM: 2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03060"
FT                   /db_xref="GOA:Q1AZW8"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZW8"
FT                   /protein_id="ABG03060.1"
FT                   /translation="MDGGGALERLGRLGLVAVVRGRSWEDAVEVSEALAEGGVAAIEVA
FT                   YTTPGAGRAIRELARRRGDGILLGAGTLTSPGQAEEAAESGASFLVSPGFDPGLVSAML
FT                   RTGRAALPGVLTPGEVMGALRLGVGALKLFPAGAVGPGYLRALLGPFPGVRFVPTGGVS
FT                   ERNAGEWFGAGAFAVGAGGALAPPRLRDGRHREEVVGLARRFAAAVERAREGARR"
FT   gene            83635..84480
FT                   /locus_tag="Rxyl_0080"
FT   CDS_pept        83635..84480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0080"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bth:BT0130 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03061"
FT                   /db_xref="GOA:Q1AZW7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZW7"
FT                   /protein_id="ABG03061.1"
FT                   /translation="MRRPGGGLEEMFSLDGRVAVVTGGTGVLGGAVAAGLARAGARVGV
FT                   LGRRRGRAEEVAAGLGAEGAEALALRADVLDEGQLRRAREELLGRWGRLDILVNAAGGN
FT                   VPGAVLGSGEDVFRGLRVGAFREALDLNLLGTVLPSLVFGEAMASGGRAEGCIVNVSSM
FT                   AALRPLTRVAGYSAAKAAVENFTRWLAVELSRRYGPGMRVNAVAPGFFLGEQNRGLLIG
FT                   EDGNLTPRGRAVIEHTPMGRFGKPEELAGAVVWLCGPGASFVTGAVVPVDGGFSAFGGV
FT                   "
FT   gene            84572..86173
FT                   /locus_tag="Rxyl_0081"
FT   CDS_pept        84572..86173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0081"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH periplasmic
FT                   binding protein/LacI transcriptional regulator; KEGG:
FT                   mta:Moth_2024 transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03062"
FT                   /db_xref="GOA:Q1AZW6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZW6"
FT                   /protein_id="ABG03062.1"
FT                   /translation="MRQDLLARIRRGEFPPGSLLPSESQICEQYGVSVTTARRAFLELV
FT                   KEGVVRRRAGVGTMVAPRVRRARIAFASIDYTGDAWRHIPSVIGEMFAGIGEHAWRRDA
FT                   VLEIVGVEDEEAEGYLRRVAERRPVDGLLLRVANDIRGEHLDILERAGMPYVLIKRHIP
FT                   GRRMNCVISDDVTGARMATSHLLELGHRRIGFVCGKPHLTLNRERLAGYREALEEHGVG
FT                   FDEGLVRQEEHFTTEMGYRAVRSLLEAPSRPSAVFVASDTMAIGGYEAVWDLGLRIPDD
FT                   VSIVGYDDIQAASALQPPLTTVRTSYYDFGRLAAQLLLDLIEGREVAPQRRVIHPTLVV
FT                   RGSTRRLSPGRGARHRPPREPAPVPSPGRLSGLGLLCSGLDAALRQEVVRACAAEGALP
FT                   LAGEEAPPDVWVQGLSLWQDLGTNLRRALERGRMALRRIKEGGSLVYVASAMSPDPSLG
FT                   GIEHEAVRAGLERVVRVLAGEGAGRGVRVNALLCLADRHELQTERAAQVAGTVAFLASP
FT                   AARGISGETLALDGPP"
FT   gene            complement(86181..86675)
FT                   /locus_tag="Rxyl_0082"
FT   CDS_pept        complement(86181..86675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0082"
FT                   /product="TQO small subunit DoxD"
FT                   /note="PFAM: TQO small subunit DoxD; KEGG: oih:OB3081
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03063"
FT                   /db_xref="GOA:Q1AZW5"
FT                   /db_xref="InterPro:IPR007301"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZW5"
FT                   /protein_id="ABG03063.1"
FT                   /translation="MTWVRVLVGAVWLNGGLEKLLNPDFPREFAASLQAGGFVSAAPAF
FT                   FRVFMQNNVVPNAELVAQVVRAAELAMGVALILGLFTNLAALGSVALSVMILLSQGGVS
FT                   LGTGLGSPQFFTINVVMAALSLIILFSPAAKEASLDAGLSRRRPGLSPLLTNTAGRRRR
FT                   R"
FT   gene            86899..87915
FT                   /locus_tag="Rxyl_0083"
FT   CDS_pept        86899..87915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0083"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: multicopper oxidase, type 2 multicopper oxidase, type
FT                   3; KEGG: nfa:pnf1600 putative copper oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03064"
FT                   /db_xref="GOA:Q1AZW4"
FT                   /db_xref="InterPro:IPR001287"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZW4"
FT                   /protein_id="ABG03064.1"
FT                   /translation="MRGLRRGVSRREFLRAAGVAGALGVSGGLLGARVARGQGGGHGGI
FT                   RGEASGGHGGNRVVGDVDLSRFDPSKFLREFYWGDERKEGGRTVREYELVAEPVEIEVA
FT                   PGVMYPAWAYNGQVPGPTLRAREGDRLRVAFKNGDTHPHTIHFHGFHPANMDGVFELVG
FT                   PGQEFVYEFEAGPFGCHLYHCHTMPLKKHIEKGLYGAFIVDPREGRPEADEMVMVMNGF
FT                   DTDFDGENEVYGVNTVAFHYQRHPVKIKRGELVRIYVVNALEFDLVNSFHIHANFFDYY
FT                   PTGTRLEPSEFTDTKMFAQGERGIMEFRYRFPGRFMFHAHVSEFAELGWMGLFEVEG"
FT   sig_peptide     86899..87012
FT                   /locus_tag="Rxyl_0083"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.920) with cleavage site probability 0.473 at
FT                   residue 38"
FT   gene            87919..89103
FT                   /locus_tag="Rxyl_0084"
FT   CDS_pept        87919..89103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0084"
FT                   /product="putative metal cation transporter"
FT                   /note="KEGG: nfa:pnf1610 putative metal cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03065"
FT                   /db_xref="GOA:Q1AZW3"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZW3"
FT                   /protein_id="ABG03065.1"
FT                   /translation="MGDGKRGAGWVLLGLLPLLGLGALLALVVLKGAGVDREDRPPVEE
FT                   LTVERVALPAPHEIVVYVRNGGPEPVTVSQVAVNEALWDFEAEPERTITPLRSAEITLP
FT                   YSWVEGEAYEIELITSTGATFAAEVPVAVLTPGFSAGTLGRYALIGLYVGVIPVSLGLL
FT                   WYPFLRRMGASGMNFVLALTVGLLVFLVLDTLLDAMEIAGRLPGVFSGVPLVLSAALLA
FT                   LLGLLGTERLFRRGREGAGRLSTSYRIALGIGLHNLGEGLAIGAAFALGEAALGAFLVV
FT                   GFTLHNVTEGVGIAAPVLKGEGPRPAHFAGLALLGGGPAILGTWIGGFAYSNLASSVFL
FT                   AVGAGAILQVVYEVGRLLLEDSVRAGAPVLSAPNLAGFAAGMAVMYATALLVSV"
FT   gene            89169..89648
FT                   /locus_tag="Rxyl_0085"
FT   CDS_pept        89169..89648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0085"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: Rieske [2Fe-2S] region; KEGG: fra:Francci3_0970
FT                   twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03066"
FT                   /db_xref="GOA:Q1AZW2"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZW2"
FT                   /protein_id="ABG03066.1"
FT                   /translation="MEQGSGQISRRSFIRLGTVLGVGAASASVLAACGGGTGGDGAGGG
FT                   SGGGAGAAEGAGRPPSGEGAIVAASEVPRGEAFQFRDAGRPAVLVHLESGEFVAYSAVC
FT                   THQQCTVAYQDGRLACPCHGSVFDPAKGAEVVAGPAPRPLREIPVRLRDGRVYRA"
FT   sig_peptide     89169..89264
FT                   /locus_tag="Rxyl_0085"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.928) with cleavage site probability 0.683 at
FT                   residue 32"
FT   gene            89704..90321
FT                   /locus_tag="Rxyl_0086"
FT   CDS_pept        89704..90321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0086"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ehi:42.t00003 hypothetical protein PROSITE:
FT                   ARG_RICH GLU_RICH LYS_RICH PRO_RICH SER_RICH THR_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03067"
FT                   /db_xref="InterPro:IPR005607"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZW1"
FT                   /protein_id="ABG03067.1"
FT                   /translation="MDPREERIGLYGAAAILDVGAEEVVRLAERGELRSERDEGGVYSF
FT                   SLADVLELARERSAREAEEEIFEGEVIGEEERSSRLPAVPFERYERLLQQGQDFKTRLE
FT                   ERTRQMEEIRQERDAARLEIDRLWEEIERLRLSEFQRELQEKTISTLEEEKKRLEEERE
FT                   RLIEERMKLLEEKSQLAEERTRLEAEIKVLKNRSFWSRLFGG"
FT   gene            complement(90337..91208)
FT                   /pseudo
FT                   /locus_tag="Rxyl_0087"
FT   gene            91359..91835
FT                   /locus_tag="Rxyl_0088"
FT   CDS_pept        91359..91835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0088"
FT                   /product="regulatory protein, MarR"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: ttj:TTHA0953
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03068"
FT                   /db_xref="GOA:Q1AZW0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZW0"
FT                   /protein_id="ABG03068.1"
FT                   /translation="MEEEKLAYIEEFGLFFERVGGSRMVGRVLAALLVSEPPELTAGEL
FT                   AEILRASRGSISTATRTLEQMGMVRRFARPGERRDYFRVRPHAWEETVRRQSAMLSRFV
FT                   ALAERGIELLDPKTPDARRSLEEMRDFYAFWEGEVGRVMELWEREKRGRREVAG"
FT   gene            91874..92797
FT                   /locus_tag="Rxyl_0089"
FT   CDS_pept        91874..92797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0089"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   tma:TM1028 putative ABC-2 type transport system ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03069"
FT                   /db_xref="GOA:Q1AZV9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZV9"
FT                   /protein_id="ABG03069.1"
FT                   /translation="MRREMGAVIETSGLAKSYGKSRGIRGVDLTVREGEVFGFLGPNGA
FT                   GKTTTIRLLMGFLRPSGGSARVFGFDVWRQSVEVRSRVGNLPGEFALEDRLTGEELLRF
FT                   FARLRGVGDLSHARELAERLGAELGRPMRRLSRGNKQKIGLIQAMFHRPPLLILDEPTG
FT                   GLDPLVQEEFLGMVREVKEEGRTVFFSSHNLAEVERVCDRVGIIREGELVAVEPTDALI
FT                   DKSFRHVRVAFGEEPPEKELRRLAGLPGVENFRSEGPGRVSFTVYGGFDAVIKQLARHT
FT                   VAGVDFERPSLEEVFLAYYGGKGDGR"
FT   gene            92794..93615
FT                   /locus_tag="Rxyl_0090"
FT   CDS_pept        92794..93615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0090"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: bld:BLi00348
FT                   putative permease; RBL02584"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03070"
FT                   /db_xref="GOA:Q1AZV8"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZV8"
FT                   /protein_id="ABG03070.1"
FT                   /translation="MSAGAPYAARGTLPALVAHAARMQLRATLVWGVVLGLYSALIVAS
FT                   FPAVEDQSRAIEQLARSYPEAVREAFSLDALTTIEGYLDSQVFSLAPLALAFFPVLSLS
FT                   AAIAGAEERGTLDVLLSNPVPRWQLVAGSFLAAALSLLGVVALLGLLTWGTAALFGVDL
FT                   GAGRAAEASLNLWPICLFFGGLALLCSALFHRRALAVAVPGVLLFGMYLLDVVGRVVDG
FT                   LEDFRRLSAFYYYGSAIRDGVGWSGFVGLALCAALLAVLAALAFRRRDIYA"
FT   gene            93650..94942
FT                   /locus_tag="Rxyl_0091"
FT   CDS_pept        93650..94942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0091"
FT                   /product="protein of unknown function DUF815"
FT                   /note="PFAM: protein of unknown function DUF815; SMART:
FT                   ATPase; KEGG: mta:Moth_2317 protein of unknown function
FT                   DUF815"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03071"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZV7"
FT                   /protein_id="ABG03071.1"
FT                   /translation="MGAVERRELERLLLGARGLALFGGALGAPAGRAFLEVLGHAASGR
FT                   GPELAAAFGRLWRELAAEEELLLPDAWQSRLVRGLLDDENPFSLAAERGAVPPALLEQA
FT                   RRELAVLRGLFELDARRLLAVVEGRVPELRGLWGAWYYPGGADGSSPRREVARKLAAAP
FT                   DWRPCAELLAGHFSRHGAGSAGRHRAFRWEGGALRSVAHPDPVRLRELIGYEREREPLV
FT                   RNTERFLEGLPAHHALLYGLPGTGKSSTVKALLNEYADAGLRLVEVRKEDLAELPRVLG
FT                   ALRGRGMRFVLFVDDLSFEEGEVQYKELKALLEGSVEASPENVRVYATSNRRNIVRESF
FT                   AEREDDVHARDTAQEKLSLAARFGLRLTFPPPDQRLYLEIVRGLARERGLEVPEERLVE
FT                   RALLWDRWQAGRSGRTARQFVDELAAELGRG"
FT   gene            complement(94939..95397)
FT                   /locus_tag="Rxyl_0092"
FT   CDS_pept        complement(94939..95397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0092"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   noc:Noc_1757 response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03072"
FT                   /db_xref="GOA:Q1AZV6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZV6"
FT                   /protein_id="ABG03072.1"
FT                   /translation="MDREYIRDKVILLVEDNPDDQLLTLRALKKHNVMNEVVIANDGAE
FT                   ALDYLFGTGAYAGRDTSVMPQLVLLDLKLPKIDGLEVLRRMRSDDRTRLLPVVVLTSSR
FT                   EQQDLVDSYGLGANSYVRKPINFEQFTRAVEQLKLYWLVLNEAPPPAP"
FT   gene            95843..98413
FT                   /locus_tag="Rxyl_0093"
FT   CDS_pept        95843..98413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0093"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="PFAM: response regulator receiver ATP-binding
FT                   region, ATPase-like PAS fold-3 PAS fold-4 PAS fold; SMART:
FT                   PAS PAC motif; KEGG: sru:SRU_0095 utilizing regulatory
FT                   protein TutC"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03073"
FT                   /db_xref="GOA:Q1AZV5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZV5"
FT                   /protein_id="ABG03073.1"
FT                   /translation="MSGSGRRPLRVLLVEDSEDDALLLLRELRRAGYEPEHEVVYTAGA
FT                   MERALERGRWDIVLSDHSMPAFSSFAALELLRRRGLFEELPFILVSGKIGEEAAAAVMK
FT                   AGAHDYVMKDNLARLGVAIERELQEAEVRRERRRAERRYRLMFEQSPLSIQIFSPDGRM
FT                   VSANRAWRRLWGVEPEQLAGYNVLEDPQLLESGVMPYIRQGFAGRAAVVPPVRYEPDRT
FT                   VPGLSSVPYRWVRAFIYPVVGEEGEVQEVVLIHEDITETRRAWDALQEAERKYRSIFEN
FT                   AVEGIFQSTPEGRLLTANPAMARMLGYGSPEELLASVGSIARLYADPERRDEFRRQVEA
FT                   RGSVSGFELRLRRRDGGTIWASLAGRAVRDPEGRLLGYEGTLEDITGRKRAEEALRQSE
FT                   ELYRSVVEQAQENILLVDLETRRILQSNPAFRRTLGYAEEELRGMTLYDIVAHDRQSID
FT                   RNIERIRRLRRHSPGERRYRRRDGSLAHMEVSVSVISYDGRDAMCVVAHDVTERKRAEE
FT                   ELRESEERYRAVVEQTAEGLFLHDPETRRIVATNRAFRRMFGYTEEELRGMSIYELVED
FT                   SPENVERNIRRTLENPEYCYVGERRYRRKDGSILEVEGSGGVIYYAGRRVICSMVRDIT
FT                   ERKRSERAMREIREAERRRISRELHDGVLQDLTYALQSMQIERRISGRTSEERERQIDA
FT                   LRRAVEGLREAIYELRSEGVADRPLLRSVESLVELHRQRSPHREARLVVAGGFPAGLSG
FT                   PAAAEVARVVQEALANVRRHSGAGRVEVRLSVEDEEVVVEIEDDGRGFDPASSGGGVGL
FT                   VGMRERAQALGGRLEVESRPGEGACVRLRAPLPALSGSPAAPRR"
FT   gene            98490..99158
FT                   /locus_tag="Rxyl_0094"
FT   CDS_pept        98490..99158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0094"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR response regulator
FT                   receiver Sigma-70, region 4 type 2; KEGG: fra:Francci3_1039
FT                   two component transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03074"
FT                   /db_xref="GOA:Q1AZV4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZV4"
FT                   /protein_id="ABG03074.1"
FT                   /translation="MQRVLLVEDHASFRQALALLFDAEPGFEVAGQAGTLKEARRVASG
FT                   REPRPTLGIIDLNLPDGDGSQLIGELREQNPDFAALVLTASVDRADHARAVEAGAAGVL
FT                   HKSADVDEILDAARRLAAGEPLMSPQEVAEMIRLAGRSREEERGLRENAARLTPREREV
FT                   LQALAEGLSNREIAERLHMSVDTERTHMVNILSKLGAHSRLQALVLAARAGVVRLGGDG
FT                   "
FT   gene            complement(99155..99943)
FT                   /locus_tag="Rxyl_0095"
FT   CDS_pept        complement(99155..99943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0095"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase; KEGG: mta:Moth_0888
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03075"
FT                   /db_xref="GOA:Q1AZV3"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZV3"
FT                   /protein_id="ABG03075.1"
FT                   /translation="MTAFTKMHGAGNDFLLFDWEEVEGADLAELARRACDRHFGVGADG
FT                   ILVPAPSASADLRMVYRNADGSPSEMCGNGIRCLARYARDRGIVSGDVLAVETGAGVRK
FT                   VALLEGGRASRVEMGSPAFGAPVALLGHRFVRVSMGNPHAVAFLPAEEAVERLDLRSVG
FT                   PRVERDPAFPGRTNVEFVCVRGPHELRMRIWERGAGETLASGSGSCAAAAAAIREGLAR
FT                   GPVRVILDGGEVEVEWSGREGDPLYMRGPAEYVCEGRLLL"
FT   gene            complement(100363..101145)
FT                   /locus_tag="Rxyl_0096"
FT   CDS_pept        complement(100363..101145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0096"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="PFAM: dihydrodipicolinate reductase; KEGG:
FT                   hch:HCH_01226 dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03076"
FT                   /db_xref="GOA:Q1AZV2"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1AZV2"
FT                   /protein_id="ABG03076.1"
FT                   /translation="MIRVTVAGAAGRMGREVCRAALEDPEVVLAGGVVEPGSPEVGADL
FT                   GELCGAGRAGVAASEEPPPEAGVLVEFTTPEATVEHLSYGLPAVIGTTGLSEEQRAKVE
FT                   EAARGVPIVLAPNMSVGVNLLLGVVRRLSEALGPGYDIEIVEAHHRGKRDAPSGTALLM
FT                   GRAAASGRGRRLEEVAVYGREGVSPRGEGEIGIHALRGGAVVGEHRVIFYGLGEEVEVV
FT                   HRALSRRTFAEGALRAARFAAAAQPGLYSMQDVLSSSP"
FT   gene            complement(101142..102035)
FT                   /locus_tag="Rxyl_0097"
FT   CDS_pept        complement(101142..102035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0097"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="KEGG: aae:aq_1143 dihydrodipicolinate synthase;
FT                   TIGRFAM: dihydrodipicolinate synthase; PFAM:
FT                   dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03077"
FT                   /db_xref="GOA:Q1AZV1"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZV1"
FT                   /protein_id="ABG03077.1"
FT                   /translation="MFSGTLTALITPFRNGEVDVEALEGLVEFQIQQGVSGLVPCGTTG
FT                   ETPCLSEEEDRLVVETVVRVAGGRVPVIAGTGSNSTDMAIRYTRMAEEAGADGSLQVAP
FT                   YYNKPTQEGLYRHFATIAENTSLPIILYNIPSRTGVTISAETTARLAEIPNIVGTKEAT
FT                   HSMDLASDLRRLCGEEFCILSGDDSLTLPIMALGGRGVISVASNVAPAAVSQLTQALLE
FT                   GDYERGRELHYELLPLFRALFIETNPIPVKTAASLLGLCSDEMRLPMQPMRGENLRRLQ
FT                   EVMEEKGHLLPTPEEV"
FT   gene            complement(102028..103296)
FT                   /locus_tag="Rxyl_0098"
FT   CDS_pept        complement(102028..103296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0098"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: deh:cbdb_A1731 aspartate kinase,
FT                   monofunctional class; TIGRFAM: aspartate kinase aspartate
FT                   kinase, monofunctional class; PFAM:
FT                   aspartate/glutamate/uridylate kinase amino acid-binding
FT                   ACT"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03078"
FT                   /db_xref="GOA:Q1AZV0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZV0"
FT                   /protein_id="ABG03078.1"
FT                   /translation="MERRHRQRERPLGIVVQKYGGSSVATAEHIKAVAGKIQRARKAGL
FT                   DLVVVASAMGKTTDRLLRLAGEVSSDPSPREIDQLLATGEEQSVALLAMALHDRGVPAV
FT                   SLTGPQAGMRATGRYGSGVISEIRPGRIRRLLGEGRVVIVAGFQGMNALGDVMTLGRGG
FT                   SDTTAVALAAALGADRCEIYTDVDGVYTADPRIVPGARRIPVISYAEMSEMAWRGAKVM
FT                   HPRAVELGALYGVEIHVLSSFDEESPGTIITGGEKVEHLETRETVAGIVHDTDVARITL
FT                   NGVRTGPGTLSKVFTPLAERGISVDVIVESGIKEGVADIAFTVSRADFAEARSAAGEVA
FT                   RALGGSVEGEEGLAKVSVVGTGMLNRPGYAARMFSALGSEGIPIRMVSTSEIQVTCVIP
FT                   AERVQEAVRRLHRDFELEEREDV"
FT   gene            complement(103337..103846)
FT                   /locus_tag="Rxyl_0099"
FT   CDS_pept        complement(103337..103846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0099"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO6430 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03079"
FT                   /db_xref="GOA:Q1AZU9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZU9"
FT                   /protein_id="ABG03079.1"
FT                   /translation="MFLSVYVLYLTRDLGLGPGAVGLVFALGGVGALPGALAAGPAVRV
FT                   LGRGPMIAVSAVLCGFFGFAIPLAVLFPEIALPMVLAAEFFQWLFLAAYRVGEASLRQE
FT                   ITPDHILGRVNATQRFMVYGAIPLGGLLGGILGELAGVPLTLVVGMAGTLLASLWTLLP
FT                   PVRGVR"
FT   sig_peptide     complement(103730..103846)
FT                   /locus_tag="Rxyl_0099"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.624) with cleavage site probability 0.511 at
FT                   residue 39"
FT   gene            104425..105876
FT                   /locus_tag="Rxyl_0100"
FT   CDS_pept        104425..105876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cef:CE1659 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03080"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZU8"
FT                   /protein_id="ABG03080.1"
FT                   /translation="MRTALLRAALGGRLVLFASALCAVLLLAGSAGAQTPEIDSKRAEV
FT                   QRVQSRISATLQDISRIQSSYEESQARLADLRERIARNRREIEEASRELEAARERVSER
FT                   AEGSYKAGGVMYLDVLLSVRSFSEFAGRSRFVLRALAEDRRIVSRLREARRELEEREAA
FT                   LRESLREQRAVSAGLLQKRRAIERRLEEHRRAYAALDAELKELVRREQERRAREAAEAR
FT                   RRAAAEAAERQAALERRAAAPEEPAAGSPEPAREAAARDLGEASAPAAPTEGAERPKPP
FT                   REAAAVPPASPAPPSEAEAPEPEAPAAESAGPPPSAAEEQYEEPEAPAPEVSRPEVSSA
FT                   DPRVQAILENPNITLTGVARQDLVSGIVDPRVLDVVEFAASEHAISISVFATGHPYGPT
FT                   LDALGYAGYPNSHYFGRAVDIYAVDGAPVSSGNQAAYELAQAIYARFSPAELGSPWTFG
FT                   AGSFSDALHQDHIHVGWAYAANGGL"
FT   sig_peptide     104425..104526
FT                   /locus_tag="Rxyl_0100"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 34"
FT   gene            complement(105879..106856)
FT                   /locus_tag="Rxyl_0101"
FT   CDS_pept        complement(105879..106856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0101"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   hma:rrnAC2913 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03081"
FT                   /db_xref="GOA:Q1AZU7"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZU7"
FT                   /protein_id="ABG03081.1"
FT                   /translation="MGIFLEEGRRRPRALWRLLLQLALFALLAALLTSLFAAAWFVLGP
FT                   QVRLEPGDAGRLASSPELFLLSTLASLLATLLSLWAAGRYLDRRPFRDFGFHIDRGWWL
FT                   DLAFGMLLGALLMSGIFAVQLALGWVEVTGTFVSDLPGVPFRTAILLPLAIFACVGVYE
FT                   EALSRGYQLRNMAEGLNHPALGPVGAVVAAWVLSSLFFGLLHFANPNATLVSTINVSLA
FT                   GLLLGAGYVLTGELAIPIGLHITWNFFQGAVYGFPVSGLQSAGASFLRIEQSGPELWTG
FT                   GPFGPEAGLLDPIAVAVGCLLIALWVRLRHGKVALLPSLAEGPR"
FT   sig_peptide     complement(106737..106856)
FT                   /locus_tag="Rxyl_0101"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.526 at
FT                   residue 40"
FT   gene            complement(106859..107596)
FT                   /pseudo
FT                   /locus_tag="Rxyl_0102"
FT   gene            107722..109641
FT                   /locus_tag="Rxyl_0103"
FT   CDS_pept        107722..109641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0103"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="PFAM: ATP-binding region, ATPase-like histidine
FT                   kinase A-like PAS fold-3 PAS fold-4 PAS fold; SMART: PAS
FT                   PAC motif; KEGG: gsu:GSU2388 sensory box histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03082"
FT                   /db_xref="GOA:Q1AZU6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZU6"
FT                   /protein_id="ABG03082.1"
FT                   /translation="MDPSSLQGYQPLVFYAAAAVAGALLAGLAALLLWRRGRPSRRRDA
FT                   LRAAAFEQAAEGMLLVSGDRVLEANAACAALLGRERGELAGMPLGELLAGGAGGVPLPP
FT                   GKRSWSGTLALRSGGGEPVECEAAASRVLAGGREAVCLALRDVTERRREEEKLRETESR
FT                   YRTLVEQVPAIVYIEDVQTQATLYDSPRIEEILGYPRDLCEREPLYWHRILYPEDRERV
FT                   LEAEREAVERGSFVLEYRVFAADGRVVWVRDEARLLRDESGEPRFWQGVISDITEQRRA
FT                   EDALRESEERYRSLVQLSPDGVAVESEGRFVYLNEAGARLLGASSPQEVLGQPVMERVH
FT                   PDCRENARRRARRLRRGERVELQEERWLRLDGREMDVEVSAAPVQYGGRPSAQLVLRDV
FT                   TGRKRAEREIVRQKAELARSNAELEQFAYLIAHDLRAPLRSMDGFAQILLEDCAPRLGP
FT                   DGREYLARIQRATRKMARMIDELLGLSRLARADIRREPVDLSAMARSIGEELRQGEPDR
FT                   RVEFIVAGGLAAEGDRRLLRVALANLLENAWKFTRRTPRPRIVFGRIERGGERVFFVRD
FT                   NGVGFDMAYAGKLFGPFQRLHAEEEFEGTGIGLAAVARVIERHGGRVWAEGAEGEGATF
FT                   YFTL"
FT   gene            109681..110130
FT                   /locus_tag="Rxyl_0104"
FT   CDS_pept        109681..110130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0104"
FT                   /product="UspA"
FT                   /note="PFAM: UspA; KEGG: bte:BTH_II1567 universal stress
FT                   protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03083"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZU5"
FT                   /protein_id="ABG03083.1"
FT                   /translation="MGAFPTRILLATDGSPDAERAGRVAVDLANSTGSELHVVTVARGL
FT                   DPAYFVHEYYYGFQEALEAFEEEARQVLEEQVRKLEEYGGRVAGAHLLTEQPKDRAIVR
FT                   LSEELGAGLIVMGSRGRGGLRRALMGSVSDSVVRHAHCPVLIVRS"
FT   gene            110258..111226
FT                   /locus_tag="Rxyl_0105"
FT   CDS_pept        110258..111226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0105"
FT                   /product="quinolinate synthetase A"
FT                   /note="TIGRFAM: quinolinate synthetase complex, A subunit;
FT                   PFAM: Quinolinate synthetase A; KEGG: gvi:gll0192
FT                   quinolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03084"
FT                   /db_xref="GOA:Q1AZU4"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZU4"
FT                   /protein_id="ABG03084.1"
FT                   /translation="MRAAGAVVSAVEGLDLFEEIDRLREELGAVILAHYYQEPEIQDIA
FT                   DFIGDSLQLARQAQRTDARVIVFCGVHFMAETAKILNPEKTVVLPDLEAGCSLADSCPP
FT                   ERFAAFLEEHPGHAVVSYVNTSAAVKALSDVICTSSNAEKVIATIPEGTPIVFAPDRHL
FT                   GRYLMERTGRKMVLWPGTCMVHVRFSEKKIRQLKVRHPDAEVLAHPECEEAVLRLADHV
FT                   GSTSSLLRRAVESPARRFIVATEPGIIHQMKKAAPGKEFVRAPGRGPEGSCEACGECPH
FT                   MRRNTLEKLYRCMRDLRPEITLDEELRLRALRPIERMLEIG"
FT   gene            111226..112101
FT                   /locus_tag="Rxyl_0106"
FT   CDS_pept        111226..112101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0106"
FT                   /product="nicotinate-nucleotide pyrophosphorylase
FT                   (carboxylating)"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: gsu:GSU1936 nicotinate-nucleotide
FT                   pyrophosphorylase; TIGRFAM: nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03085"
FT                   /db_xref="GOA:Q1AZU3"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZU3"
FT                   /protein_id="ABG03085.1"
FT                   /translation="MQQRAATLRRPPGALLELARLALREDLGRGDVTSEATVPPGLRAR
FT                   GRFVARRELVVSGLGAAAAVFYEAGGGEVEFVPLAGEGELAGGGAVLAEVAGPARPVLA
FT                   AERVALNLLMRLCGVATLTRRYAAAVEGTGARIADTRKTTPGLRALEKAAVRAGGGVNH
FT                   RSGLDDGVLIKDNHLALAGGVAEAVRRARAAAPHLLRVEVEVESERELREALAAGADAV
FT                   LLDNMSPEEVRRCVRVARRERPGVVVEVSGGVDLGTVRAYAEAGADLVSVGALTHSAPA
FT                   ADISLEVEPC"
FT   gene            112095..113561
FT                   /locus_tag="Rxyl_0107"
FT   CDS_pept        112095..113561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0107"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="KEGG: ade:Adeh_3566 L-aspartate oxidase; TIGRFAM:
FT                   L-aspartate oxidase; PFAM: fumarate reductase/succinate
FT                   dehydrogenase flavoprotein-like HI0933-like protein FAD
FT                   dependent oxidoreductase FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03086"
FT                   /db_xref="GOA:Q1AZU2"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZU2"
FT                   /protein_id="ABG03086.1"
FT                   /translation="MLAADVVVVGSGVAGCAAALAAARRGAEVVLLSKAPDPAETNTRH
FT                   AQGGIVYTGPGDSPEALVRDILAAGGGDRGAAELLAREGPPLVGRLLVEELGVPFDRGE
FT                   GGGLDLALEGAHSVPRILHCADATGEELQRALLRAVRAEPGVALLPGREALRLAVSGGR
FT                   CAGVCVAAGGRAGVLAGRCVVLAAGGLAGLYARTTNPPGATGDGCALALEAGARVRELH
FT                   YVQFHPTAFAGPGGEAFLISEAARGAGGVLRGPGGEEFIRHPAGSLAPRDVISHEICEM
FT                   MARTGSPCAYLDMTHLPEGLLRERFPGAYGRCLRAGVEMSREPVPVSPAAHYSCGGVAT
FT                   DLRGRSSLPGLFAAGEAASTGLHGANRLASTSLLEGLLFGWRAGEAAAEEARRLPPARP
FT                   PEAAADPPERAPGWAGEELGRILWEHAGPVRTVPSLREGLRRLRELREEVGPSSLDGPL
FT                   LVAETLVRQALSEGRSRGCHRLSDLEEVRS"
FT   sig_peptide     112095..112160
FT                   /locus_tag="Rxyl_0107"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.931) with cleavage site probability 0.881 at
FT                   residue 22"
FT   gene            113558..113785
FT                   /locus_tag="Rxyl_0108"
FT   CDS_pept        113558..113785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03087"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZU1"
FT                   /protein_id="ABG03087.1"
FT                   /translation="MTESVFESVAERYERAAGELERAAEHLRATAARFRDRDVPRGCAQ
FT                   ALAAQGRLRGAQRLLDELAALHASRAAPDL"
FT   gene            113800..114957
FT                   /locus_tag="Rxyl_0109"
FT   CDS_pept        113800..114957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0109"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase
FT                   Pyridoxal-dependent decarboxylase; KEGG: ade:Adeh_0592
FT                   aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03088"
FT                   /db_xref="GOA:Q1AZU0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZU0"
FT                   /protein_id="ABG03088.1"
FT                   /translation="MEIYLDYNATTPLDERVLEAMLPYLRERFGNPASAAHPFGWEAQA
FT                   ATELAREELAGAIGASPEEILFTSGATESDNWALKGLLRPGDHLVTAATEHEAVLEAAR
FT                   SLSRAGVRVTVLPVDGRGVVRPEALREALSPETRLVSVMLANNETGTLNPVRELAEVAH
FT                   ERGVPLHTDAAQALGKVPVDVGRLGVDLMSLSAHKCYGPKGVGALYVRRRPHPGVRRVR
FT                   PLPLLDGGGQERGLRSGTLNVPGIVGFGRAAALAAEALPEEARRISSLREALFEGLRAG
FT                   VPGLRLNGHPDLRLPNTLNVSFPGVEVGELLGAVPEVAASAGSACASLRAGPSHVLEAM
FT                   GAVREDWAAVRFSLGRFTTREEVERAAELVVRAWRGLAVSGAPNP"
FT   gene            complement(114954..115706)
FT                   /locus_tag="Rxyl_0110"
FT   CDS_pept        complement(114954..115706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0110"
FT                   /product="high-affinity nickel-transporter"
FT                   /note="PFAM: high-affinity nickel-transporter; KEGG:
FT                   rpa:RPA1656 possible urease accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03089"
FT                   /db_xref="GOA:Q1AZT9"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZT9"
FT                   /protein_id="ABG03089.1"
FT                   /translation="MAEIDAWLEGFMHGSGVLVVLLLSLVLGLRHATDPDHLAAVTTLI
FT                   ASEKERRRTRRAMSMGLCWGLGHGTTLILVGLPLVLLGRHLPEPVQQGAEVAIGGIIVL
FT                   LAARLLLRWRRGMFHAHAHEHDGEVHRHLHSHAGHRSHDHDHASPLHTPLSAYAIGLVH
FT                   GVGGSGGLTLLLLSTIPERAEAAAALLLFAVGTALSMALLSTAFGLAIAGGPVGRNFER
FT                   VAPALGVLGMGFGTWYALGALGVVAYPF"
FT   gene            116061..116546
FT                   /locus_tag="Rxyl_0111"
FT   CDS_pept        116061..116546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0111"
FT                   /product="(2Fe-2S)-binding protein"
FT                   /note="PFAM: ferredoxin [2Fe-2S]-binding; KEGG: sso:SSO2433
FT                   Carbon monoxide dehydrogenase, small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03090"
FT                   /db_xref="GOA:Q1AZT8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZT8"
FT                   /protein_id="ABG03090.1"
FT                   /translation="MRRIRVTVDGRAHEHEVEPRLLLIHYLREVLGIGGAHVGCDTSNC
FT                   GACTVLMDGESVKSCTVLAVQADGHEITTVQGLAGDGGWHPVQKAFHEAHGLQCGYCTP
FT                   GMIMAAVSLLRENPDPSEQEIREGLEGNLCRCTGYENIVRAVQQAAREMRGQAVAAS"
FT   gene            116563..119007
FT                   /locus_tag="Rxyl_0112"
FT   CDS_pept        116563..119007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0112"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase,
FT                   a/b hammerhead aldehyde oxidase and xanthine dehydrogenase,
FT                   molybdopterin binding; KEGG: ape:APE2216 putative carbon
FT                   monoxide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03091"
FT                   /db_xref="GOA:Q1AZT7"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZT7"
FT                   /protein_id="ABG03091.1"
FT                   /translation="MTETAQRYVGGGVLRKEDPALVTGRATWTDNIKLPGMLHFALVRS
FT                   PMAHAKINRIDVSAAREQPGVVAVFTAEDLKDEWAAPIPCGWQVTEDLRVPEHWPLTGD
FT                   KVRYLGDPVAVVVAEDRYAAKDALEFVEVDYEPLDVVTDMQEALKEGAPLVHEELGTNE
FT                   CYTWPMQNGDIDEAFGRADVVVKERYIQQRLIPNAIEPRAVVAQPEPGGSFTVYSSTQV
FT                   PHILKSVLSAICGVPEHRLRVVAPDVGGGFGSKLNVYPEEALALALSRRLGVPVKWVEE
FT                   RSENYLATVHGRDQIQDIEVAATSDGKILGMKVELLADMGAYLQLGTTVVPLLGAFMYP
FT                   GLYDFDAYSFKCTAVYTNKTPTDAYRGAGRPEAAYAVERIVDALARRLGMDPAEVRRKN
FT                   FHPPFDEPRTQPAGIQYDSGNYEMVLDRVMELADYEGLREEQRRRREAGDPVQLGIGFS
FT                   TYTEICGIAPSQVAAALGGGGAGWEAASVRVLSSGKVEVVTGTSPHGQGHVTSWSQIAA
FT                   DALGVSPDDVEVIHGDTDSAPWGRDTYGSRSLPVGGVAVYLAAQKVVEKAKKIAAHMLE
FT                   AAEGDIEFEGGRFSVRGSPDRNVTLQQVAGAAFLAADLPEGMEPGLSAETFFDPPNFTF
FT                   PFGAHICVVEVDTETGKVRIRDYFAVDDCGPVVNPQIVDGQLHGGIAQGVAQALYEEAV
FT                   YDEDGNLVTGSMVDYLVPGAPEVPRYTLERTVTPSPSNPMGVKGVGEAGTIGSPPAVIN
FT                   AVIDALSHLGVTHIDMPATPARVWQAIQEARGREASAGEASRTGRPAQAPDHEEHPGGE
FT                   SL"
FT   gene            119004..119855
FT                   /locus_tag="Rxyl_0113"
FT   CDS_pept        119004..119855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0113"
FT                   /product="molybdopterin dehydrogenase, FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase, FAD-binding CO
FT                   dehydrogenase flavoprotein-like; KEGG: ape:APE2219 292aa
FT                   long hypothetical nicotine dehydrogenase chain A"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03092"
FT                   /db_xref="GOA:Q1AZT6"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZT6"
FT                   /protein_id="ABG03092.1"
FT                   /translation="MIPLKFDYEVAESVDHAIELLGEHGEEAKLLAGGHSLLPIMKLRL
FT                   AAPAVLVDIGRLSDLSYVRDAGDHIAIGALTRHADVEHDRLLQEQCGLLAYTASLVGDP
FT                   QVRHRGTIGGSVAHGDPASDLPSVLLALDADFVVRGSGGERTVAARDFFQDYLQTALAP
FT                   DEVLTEIRVPKLGPNAGWAYQKFNRRAQDWAVVGVAAVVERQNGSISSARVGLTNMGST
FT                   PLRASAVESALSGADAGSVAEAAQSAAEGTSPASDIAASAEFRQHLARVLTRRALEEAL
FT                   SR"
FT   gene            119852..120796
FT                   /locus_tag="Rxyl_0114"
FT   CDS_pept        119852..120796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0114"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities, AAA_5; SMART: ATPase; KEGG: rru:Rru_A0968
FT                   ATPase associated with various cellular activities, AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03093"
FT                   /db_xref="GOA:Q1AZT5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZT5"
FT                   /protein_id="ABG03093.1"
FT                   /translation="MSEPRNGRRGALPPGVSSAGDLRELLRRFDYLADEGLATAIFLAL
FT                   RLGRPLFLEGEAGVGKTEVAKVLSRMLETPLIRLQCYEGIDVYQALYEWDYARQLLHIR
FT                   AAEAFGGAEDRERVERDLYNREFLISRPLLQALEHEGPSPPVLLIDEVDRSDDEFEAFL
FT                   LEILSDFAVTIPELGTIRAERPPVAVLTSNRTREVHDALKRRCLYYYIEHPSFEREVEI
FT                   VRLRVPEAEERLARQVAAAVQRLREMDLYKPPGVAETLDWTEALVALGAKELDERLVQA
FT                   TLGSVLKYHEDQQRVVASGLEELLAGVGRIAGG"
FT   gene            120789..121931
FT                   /locus_tag="Rxyl_0115"
FT   CDS_pept        120789..121931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0115"
FT                   /product="VWA containing CoxE-like protein"
FT                   /note="PFAM: VWA containing CoxE-like; SMART: von
FT                   Willebrand factor, type A; KEGG: mlo:mlr0089 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03094"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZT4"
FT                   /protein_id="ABG03094.1"
FT                   /translation="MVEEEPAPRMLEAAVAFGRVLRGAGLAVGTDRLVGFARALEELDA
FT                   GRREDVYWAGRITLTSRPEDIEVYDRAFEAFWERGEEAPPPPRGGAELRIPEPEDSVMP
FT                   AKESVEADERGEEAVGLRYSPVEVLRKKDFALYSPEEFAELQRMLSDLRLSGALRRTRR
FT                   LEPARRGRHDPRRTMRGAMRTGGETVRHRFRRAKDQPRRVVLLCDVSGSMSPYSRALLR
FT                   FLHAGVISGARLEAFSVGTRLTRITRELSTRDPDRALRQAAGAVRDLSGGTRLGDALKE
FT                   FVDRWGQRGMARGAVVVILSDGWDRGDVALLAEQMRRIRRLAYRVIWVNPLKASPGYRP
FT                   LAAGMAAALPYVDVFLSGHNFESLEELARAVAEAAGDGRR"
FT   gene            121996..122310
FT                   /locus_tag="Rxyl_0116"
FT   CDS_pept        121996..122310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0116"
FT                   /product="predicted sulfurylase small subunit,
FT                   molybdopterin cytosine dinucleotide biosynthesis"
FT                   /note="PFAM: protein of unknown function DUF182; KEGG:
FT                   ade:Adeh_3104 protein of unknown function DUF182"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03095"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZT3"
FT                   /protein_id="ABG03095.1"
FT                   /translation="MNPVVERVARWREEDKRCALATVVKVERSGPLGPGTSMAVSEDGE
FT                   VVGSVSGGCVEPAVYEEAMSAIQTGEPRLLTYGISDEEAFGVGLTCGGVIHIFVERVDW
FT                   "
FT   gene            122313..123113
FT                   /locus_tag="Rxyl_0117"
FT   CDS_pept        122313..123113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0117"
FT                   /product="predicted sulfurylase large subunit,
FT                   molybdopterin cytosine dinucleotide biosynthesis"
FT                   /note="PFAM: protein of unknown function DUF182; KEGG:
FT                   sma:SAV7506 putative xanthine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03096"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZT2"
FT                   /protein_id="ABG03096.1"
FT                   /translation="MGELLDRWRRALEREEPVAVATVVDGPGRGGKLLVTPEEHIGTAG
FT                   DPDLDRAIVEAARGLLEGGRTEMVHLGPRGQRRMDDVSVFIQSFAPPPRMYVFGAIDFA
FT                   SAVARIGKFLGYRVTVCDARPVFATRERFPTADEVVVAWPDEFIKTAPVDRRTVICVLT
FT                   HDPKFDVPVLKEALKTEAGYIGAMGSRRTHEKRAARLREEGVSEEEMARISSPIGLDIG
FT                   ARTPEETAVAIAAEIIALRTGHPGGRLAERSGPIHARPAEEARR"
FT   gene            123110..123733
FT                   /locus_tag="Rxyl_0118"
FT   CDS_pept        123110..123733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0118"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase"
FT                   /note="PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase; KEGG: sco:SCO6244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03097"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZT1"
FT                   /protein_id="ABG03097.1"
FT                   /translation="MSGVFGVLLAAGEGSRFGGGKLLAPFRGRPLVEHALLALREAPLE
FT                   GAVAVVGEGDAEGVRRLCGEHGVRVVENPRWREGQSTSVLAGIGALGPEARAAVVLLGD
FT                   QPLVGAGAVDRLVRAFEEGAKIAAATYAGRVRNPVLFAREVWPLLEEELAGDEGARRVL
FT                   RRHPGLVRRVPCDGVGDPADVDTREDLRRLEERAARGERRLPAR"
FT   gene            123730..124173
FT                   /locus_tag="Rxyl_0119"
FT   CDS_pept        123730..124173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0119"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G; KEGG:
FT                   mtc:MT0384.1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03098"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZT0"
FT                   /protein_id="ABG03098.1"
FT                   /translation="MKLENEFRVSSPVQKVWEALLDLERVTPCLPGAALTEQAGDHYKG
FT                   TMAVKLGPVTARYSGTVRFVETDERARRAVIEAKGRDVRGQGTASATITSTLHEEEGER
FT                   TRVVVRTEMRLTGRVAQFGRGIQQDVASKIMDRFASCLENEVF"
FT   gene            124189..124827
FT                   /locus_tag="Rxyl_0120"
FT   CDS_pept        124189..124827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0120"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G; KEGG:
FT                   mtc:MT0384.1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03099"
FT                   /db_xref="GOA:Q1AZS9"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZS9"
FT                   /protein_id="ABG03099.1"
FT                   /translation="MRIENEFTVGVPVEEAWRALQNLEEVAPCLPGASVEGSEGEEYRG
FT                   TMTVKLGPITARYNGTVRYAEVDEANRRMVLQASGRDARGQGTASATITSTLSGRDGST
FT                   HVRVETDMRLTGRAAQFGRGIQQDVATKMLGQFAECLERKLSGEPEEAAAPQEEEQQVR
FT                   VRRIQQPEPEPLDLGEMGREAVAERLKQAAPAIAAGAALLLLIFWLLRR"
FT   gene            complement(124829..125464)
FT                   /locus_tag="Rxyl_0121"
FT   CDS_pept        complement(124829..125464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0121"
FT                   /product="protein of unknown function DUF305"
FT                   /note="PFAM: protein of unknown function DUF305; KEGG:
FT                   ana:all7633 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03100"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZS8"
FT                   /protein_id="ABG03100.1"
FT                   /translation="MKRAGTLATVVAALLLSACAGAGVQEEPQDGAMHGGGQGEEHAEQ
FT                   MGGGHGAMGGMLAADNYSDRRFIDLMVPHHQGAVHMARVALENAEHREIRRLARNIIRS
FT                   QRAEIEELRDIKRQRYGTSSVPMQMDREQTQMMGMMDPQELAGEEPFDRAFIDAMIPHH
FT                   RSAIEMARVAREQTENPRIRRLAEDIIREQQREIEQMQRWREEWYSEG"
FT   sig_peptide     complement(125396..125464)
FT                   /locus_tag="Rxyl_0121"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.780 at
FT                   residue 23"
FT   gene            complement(125905..126576)
FT                   /locus_tag="Rxyl_0122"
FT   CDS_pept        complement(125905..126576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0122"
FT                   /product="phosphatidylethanolamine N-methyltransferase /
FT                   phosphatidyl-N-methylethanolamine N-methyltransferase"
FT                   /EC_number="2.1.1.17"
FT                   /EC_number="2.1.1.71"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase Methyltransferase
FT                   type 11 Methyltransferase type 12; KEGG: tfu:Tfu_0735
FT                   ubiquinone/menaquinone biosynthesis methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03101"
FT                   /db_xref="GOA:Q1AZS7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZS7"
FT                   /protein_id="ABG03101.1"
FT                   /translation="MRGDPARETERVKRLWDAHARGYDRAIRLAERLLVRDGRRWVCSR
FT                   ASGEVLEVAVGTGLNLPLYPEGVRLTGIDISPAMLARARERAAALGRKAALVEGDAQAL
FT                   PFPDASFDTVVCTLSLCSIPDDRRAVAEMKRVLRPGGRLLLLDHVRSSSRFWRALQRAL
FT                   DPLFVRLAGDHLLRRPLEHVVAEGLRVERAERYAKGMVERVSARRERGSSNAGSRRVED
FT                   G"
FT   gene            complement(126573..127988)
FT                   /locus_tag="Rxyl_0123"
FT   CDS_pept        complement(126573..127988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0123"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: cte:CT0776 NADH dehydrogenase I subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03102"
FT                   /db_xref="GOA:Q1AZS6"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZS6"
FT                   /protein_id="ABG03102.1"
FT                   /translation="MISLLQGMQGMGGGPEMRMARDLALIAPEIAVLLTAVGALVFEML
FT                   RLPKVALPFTVVGLLAATALALPLLGTETTAFMDTFRVGPLGVWAKLALLPATALCALL
FT                   ARAEVRGTDREGTVYALLSFTALGALALAGAGDVMFLVLGVLLSSLGSFALVAYPRDER
FT                   STEAAMKYFVFGSVTGAVMIFGLTHWFGATSSTLLSELGRLEGAPLAAAFGLVAVAAGL
FT                   GYKAAIAPFHFWAPDAYDGAPVSVAAFLSVVPKVGALFGLAQVARDLPAGTGWPLVLAA
FT                   LAALSMTYGNLAALAQENVVRLLAYSSIAQSGYFLLGVVAVGQSDLAVPALVVFAAAYA
FT                   AMNLGAFAVVVRTGRRLGDLAGLGYESPWTGAAMVVFLISLVGIPPLAGFFGKLLLFGA
FT                   AIDAGFVWLAVVGILNSVLSLGVYLRVVVPMYRRQKLVAARPAPVARGVQAAALALTLG
FT                   IGLLAQIFFGGGG"
FT   gene            complement(127985..129448)
FT                   /locus_tag="Rxyl_0124"
FT   CDS_pept        complement(127985..129448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0124"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: gsu:GSU3430 NADH dehydrogenase I, M subunit;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain M; PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03103"
FT                   /db_xref="GOA:Q1AZS5"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZS5"
FT                   /protein_id="ABG03103.1"
FT                   /translation="MIPIVSATLFLPLLGAALLAAWRGAPPRAAHALGIAFSGLALLGA
FT                   AWMWARGASGEGFSQVEEVAWIPSLGVAYRVGVDGISLPLVLMTAVLFFVSLVFSAGIR
FT                   ERARSYVALFLLLETASLGVFVALDAVLFYVFFEVTLVGMYFIISGWGYEDRQRAALMF
FT                   FLYTLLGSLPLLLAILGLYLGSEPNTFDMRELIANPPLTGLAATLALLAMLVTFFVKTP
FT                   VFPLHTWLPAAHVEAPTAGSVILAGVLLKLGTYGLVRFALQMTPDAFRDLAPYVAALAA
FT                   FSALYGAFVALGQSDLKRLVAYTSVNHMGYVVLGVAVAAAATGARAVALDGAVLQMVSH
FT                   GVVTGALFLLVGMLQDRAHTREMGAFGGLLGVVPGLGWAFVLAAFASLGLPGLAHFPAE
FT                   FQIFLGTLRVYPPAVVAVLGIAVTAGLYLRAIQVAFLGEPRGERRKLRDLGARETLAVV
FT                   PLLALTVLIGVVPSLALGVIHATTEALLP"
FT   sig_peptide     complement(129386..129448)
FT                   /locus_tag="Rxyl_0124"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.644 at
FT                   residue 21"
FT   gene            complement(129465..131288)
FT                   /locus_tag="Rxyl_0125"
FT   CDS_pept        complement(129465..131288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0125"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: deh:cbdb_A883 proton-translocating NADH-quinone
FT                   oxidoreductase, L subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03104"
FT                   /db_xref="GOA:Q1AZS4"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZS4"
FT                   /protein_id="ABG03104.1"
FT                   /translation="MILAATAILAPLAAAALILALRRLPAALALAGTGAGLAASAATLL
FT                   RVAGGASLSATLPGLPGLPLRLLAEPLTALLSAVVAVVGFFVVVYAVGYMEGEGGRVRF
FT                   FAGMSFFVAAMQALVLAGDWVLLLAAWELIGLSSYLLIGHRHEREGVPQAATRAFLYTR
FT                   TADLGLYAAIFVLVAHAGTSEISPTLQTGGTAATAAGLLLLVAAMGKSAQTPLQGWLQD
FT                   AMVGPTPVSALLHSATLVAAGAILMIRTSPLLPPAVLLLAGLAGGATALLAGLVALAER
FT                   DLKRLLAASTSAQYGLMLLAVGAGSPVAALVHLAAHAAIKSALFLGSGVFQHARGSTRL
FT                   DRLEGAGRARPRTFLGFAVAGLALAGVPPLSGYFTKDAILAAAFGSPYAPLLAPLALAG
FT                   TLLTGAYVARALGLLWRGAGAGGPVKGARWMGAGLAALALLAAALGLAVPPIGELLARQ
FT                   ELPEGALATVAGLAATLGGLALGWLVPEDRMLGPLRAPAERGFRPGGGLDALVARPALA
FT                   LGRAAARFDDGVVHAAVLSAGRAALAVAAASRLTDERGIDALVLSLARGTRRLGGRARE
FT                   LQTGLVHRELLLAAGGAALMLVVLTIGAAGT"
FT   sig_peptide     complement(131193..131288)
FT                   /locus_tag="Rxyl_0125"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.626 at
FT                   residue 32"
FT   gene            complement(131285..131590)
FT                   /locus_tag="Rxyl_0126"
FT   CDS_pept        complement(131285..131590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0126"
FT                   /product="NADH-ubiquinone oxidoreductase, chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase, chain 4L;
FT                   KEGG: noc:Noc_0477 NADH-ubiquinone oxidoreductase, chain
FT                   4L"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03105"
FT                   /db_xref="GOA:Q1AZS3"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZS3"
FT                   /protein_id="ABG03105.1"
FT                   /translation="MALYVALAVGAVLFGVGLYGALSQTNLVMIMMGVELMLGAAMVNL
FT                   VAFWRFLHPETYAGQMFVLVVMTVMALEMAVGFGVGTARFRAKGSVEMEEARELRG"
FT   sig_peptide     complement(131528..131590)
FT                   /locus_tag="Rxyl_0126"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.845) with cleavage site probability 0.618 at
FT                   residue 21"
FT   gene            complement(131590..132096)
FT                   /locus_tag="Rxyl_0127"
FT   CDS_pept        complement(131590..132096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0127"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 6"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 6; KEGG: reu:Reut_A0970 NADH dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03106"
FT                   /db_xref="GOA:Q1AZS2"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZS2"
FT                   /protein_id="ABG03106.1"
FT                   /translation="MSAQALFTGFFGVAAVWFGVVVFRTSSMVRSALALLFSQAAIGAM
FT                   FLAMQAEFLGVLQVMMMATEMSIMAIFMVMYMMDPGGLGEMEMTHQKRASIAAGALAAL
FT                   AAAGVAALTDWGPAAAAPPAAEQTERLGAEMLGRSMLIFETAGVTILTAMIAATAVAIE
FT                   RRRRR"
FT   gene            complement(132093..133004)
FT                   /locus_tag="Rxyl_0128"
FT   CDS_pept        complement(132093..133004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0128"
FT                   /product="respiratory-chain NADH dehydrogenase, subunit 1"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase, subunit
FT                   1; KEGG: pca:Pcar_0210 NADH dehydrogenase I, H subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03107"
FT                   /db_xref="GOA:Q1AZS1"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZS1"
FT                   /protein_id="ABG03107.1"
FT                   /translation="MGDGAVSALAVLAALLAGAYLVAVLEGWSATGRLRPAGPAVSAAA
FT                   LLGRESVVPRRPDRVLFEAAPLLLLVSAVLAAAVLPLSPRLVVADLATGALFVNAALAY
FT                   VMVALLMAGWGPDAAYAMVAGWRFLGQLLGYSMPIVMAIAAIAMRAESLRNTEVVASQA
FT                   ALPNALYQPVGFAVFFLAAMCLAFLPPFDLPTAPGELAGGVEAEYAGARLAVMRLGRMV
FT                   LVVALSAAVTVFYLGGWLGPALPPWAWSAIKTLAVAAAMLLAGRYVPRLREAQVLAWWW
FT                   KLGIPLALLNIFWVGVVLLVAE"
FT   sig_peptide     complement(132933..133004)
FT                   /locus_tag="Rxyl_0128"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.968) with cleavage site probability 0.420 at
FT                   residue 24"
FT   gene            complement(132986..134608)
FT                   /locus_tag="Rxyl_0129"
FT   CDS_pept        complement(132986..134608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0129"
FT                   /product="Ni Fe-hydrogenase III large subunit-like protein"
FT                   /note="KEGG: mhu:Mhun_1745 NADH-ubiquinone oxidoreductase,
FT                   chain 49kDa"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03108"
FT                   /db_xref="GOA:Q1AZS0"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZS0"
FT                   /protein_id="ABG03108.1"
FT                   /translation="MISGARQGSPAGLRRLFAAAMARDLRAFVVPGAEVARARGLDVEA
FT                   AGLGMTGVPRHASVLLVVGELPAALRRAAAVVYAQMMRPRAVLAAGAGDLSPLPGADVS
FT                   VGLSQEELEEGVARLRTAFARGAFAPGAAGFEPEMLRARTEYACPMHPEVVQDEPGACP
FT                   KCGMELVSREAADGGSGPHHGGDHGGANGDHGHGGHGHGGMGFMSMVEMTKDLPRSSDG
FT                   LPMEWVEAPFGPLFPGLPGGLFLKLTLDGDTVAEASPSACGWASPGPLTGPADALAERL
FT                   AGIDPLSPASYRVLALRAVEDAAGAGADERTVRARAGALERERAASHLGWLSGFAYLIG
FT                   HRWLARRAAELQLAVLRAEPAGMPGLRAAARSLARRIERTPLLARRLEGIGALPGGTGA
FT                   SGPVARAAGVRTDARCGEGAYRALGFEPVVREGGDALARLRVRLAEIEESLGLAAAAGS
FT                   LDIPAPRAATGASGAGAATVETPRGTATLRVALSDGEVVSAELEGPSARHLALVGRVAE
FT                   QRELADALVGVASLDLSPWETAR"
FT   gene            complement(134605..134967)
FT                   /locus_tag="Rxyl_0130"
FT   CDS_pept        complement(134605..134967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0130"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 3"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 3; KEGG: mta:Moth_0977 NADH-ubiquinone/plastoquinone
FT                   oxidoreductase, chain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03109"
FT                   /db_xref="GOA:Q1AZR9"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZR9"
FT                   /protein_id="ABG03109.1"
FT                   /translation="MSALGQYALLLALAAGTAGLALSVYGIARSLGGARREPGKDVPAT
FT                   AGELSREPVWARYHVRYYGYALLFLAFDMEMAYMYPWAVVYRQEGLVALLDMGVFLAIL
FT                   FLGLLYGWSQGALKRQ"
FT   sig_peptide     complement(134896..134967)
FT                   /locus_tag="Rxyl_0130"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.974) with cleavage site probability 0.376 at
FT                   residue 24"
FT   gene            complement(134964..135176)
FT                   /locus_tag="Rxyl_0131"
FT   CDS_pept        complement(134964..135176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0131"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: gka:GK0903 mercuric ion-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03110"
FT                   /db_xref="GOA:Q1AZR8"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZR8"
FT                   /protein_id="ABG03110.1"
FT                   /translation="MEKRITLRVPDMSCGHCKAAIEGELGRLPVAEASADPQTKAVEVV
FT                   YDEERVDERQIRAAIEEAGYTVEAG"
FT   gene            complement(135187..135513)
FT                   /locus_tag="Rxyl_0132"
FT   CDS_pept        complement(135187..135513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0132"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   cef:CE0406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03111"
FT                   /db_xref="GOA:Q1AZR7"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZR7"
FT                   /protein_id="ABG03111.1"
FT                   /translation="MREEGGVRQGQAHGYIKADHKENLLLRLRRIEGQVRGVQGMVERE
FT                   EYCIDIITQISSLIAASERVAALVLKDHMEHCVRAAIEDGEQADRKIEELTAAVERFLK
FT                   LDRR"
FT   gene            complement(135515..137770)
FT                   /locus_tag="Rxyl_0133"
FT   CDS_pept        complement(135515..137770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0133"
FT                   /product="ATPase, P type cation/copper-transporter"
FT                   /note="TIGRFAM: ATPase, P-type,
FT                   K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter ATPase, P type
FT                   cation/copper-transporter Heavy metal translocating P-type
FT                   ATPase; PFAM: Haloacid dehalogenase-like hydrolase Heavy
FT                   metal transport/detoxification protein E1-E2
FT                   ATPase-associated region; KEGG: ana:alr7635
FT                   cation-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03112"
FT                   /db_xref="GOA:Q1AZR6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZR6"
FT                   /protein_id="ABG03112.1"
FT                   /translation="MGEGARRTSFRVTGMSCAACASRVQKALGRVPGVVEANVNLATER
FT                   ATVEHGPEAGMEELRRAVEKAGYGVALEEDTGEGREREYRGLRRDLLVAGAFTALIVLG
FT                   SLPHMLGLAPPVPMGVLNLVLLALATPVQFWAGRRFYRGAWSALRHGQANMNTLVALGT
FT                   SAAYLYSLAATLAPGLFAGRAGVYFDTSAIIITLVLLGRLLEARARGRTSEAIKKLAGM
FT                   QARTARVVRGGEEADIPVEEVAVGDTVVVRPGEKVPVDGVVIAGRSAVDEAMITGESVP
FT                   AEKGPGDEVIGGTINRTGSFRLRATRVGRDTALARIVRLVEEAQGSKAPIQRLADRISG
FT                   VFVPVVMVVAGLTFLIWWAFGPEPAFTHALLNMVAVLIIACPCAMGLATPTSIMVGTGR
FT                   GAERGILIKGGEALEEAHRTTTVVLDKTGTLTKGEPRLTDVVPAGGLAGEELLRLAAAA
FT                   ESASEHPLGEAVVAGARERGLALPSPEDFEAPTGLGVRATVEGRTVLVGSRSLMRESGV
FT                   QEDGLAPRAEALSREGKTPILVAVDGEPAGLLAVADTIREEAEEAVELLHRMGLEVVMM
FT                   TGDNRFAAEAVAGRLGIDRVLAGVMPQDKAGKVRELQEEGRKVAMVGDGINDAPALAQA
FT                   DVGIAIGTGTDVAMEAADITLVGGDVRGVARAIKLSKATIRNIRQNLFWAFAYNVALIP
FT                   VAAGALYPLFSGGTVPEALRPILGEYGFLNPALAAAAMALSSVTVVSNALRLRRVRL"
FT   gene            complement(138048..138983)
FT                   /locus_tag="Rxyl_0134"
FT   CDS_pept        complement(138048..138983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0134"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: noc:Noc_1260
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03113"
FT                   /db_xref="GOA:Q1AZR5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZR5"
FT                   /protein_id="ABG03113.1"
FT                   /translation="MTRIVHISDLHFGKPAVYERLEALRALLSGMRPAAVAVSGDLTQR
FT                   CANREFEQASSYLRELERTAPCIVVPGNHDIRWLGAVARNLGLAGLFRRKAHEFKYSRY
FT                   RRHICEELNPFLEVPGAVIAGLNTAHGISRGSLTRRLRDLGVIGHVRRQDVERVRRRFE
FT                   QAPPGAARIVMIHHNPIKGQLSGRHGLSNTGWALETLAALGTELILCGHDHQEAIHATE
FT                   RTSPGLVISTAGTISNRVRPGRSSSFNLVDIGEESLRIVTYTWNNTAKDFLPSTERLFP
FT                   RPQRTGRYNLGSMQDDGRDLGHVEQTDPRR"
FT   gene            complement(139026..139823)
FT                   /locus_tag="Rxyl_0135"
FT   CDS_pept        complement(139026..139823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0135"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: ttj:TTHA1738
FT                   probable hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03114"
FT                   /db_xref="GOA:Q1AZR4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZR4"
FT                   /protein_id="ABG03114.1"
FT                   /translation="MSERSNPGVTMSYREMGAGAEDPVILLHAFPLNGRMWEPQVAALA
FT                   GERRVITPDYPGFGRAPRTPAQPDVRYYAEEVRSLLDRLELERVVLGGLSMGGYVAFEC
FT                   LRLFPERIAALVLADTRPDPDTEEMKESRRELARRVAEEGVGVLAQTQPRRLLCERTLE
FT                   ERPEVVERVKGMILESTPGGVVAALGAMRDRPDSTPLLESIRVPTLVIGGEEDAISTPE
FT                   TMGEMAKKIPHSRHVVLPRAGHLSNLENPEGFNAALGELLRSL"
FT   gene            complement(139908..141398)
FT                   /locus_tag="Rxyl_0136"
FT   CDS_pept        complement(139908..141398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0136"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH aminotransferase,
FT                   class I and II; KEGG: mag:amb1376 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03115"
FT                   /db_xref="GOA:Q1AZR3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZR3"
FT                   /protein_id="ABG03115.1"
FT                   /translation="MAGRSGSVLLWVSVDRSSAVPLHRQLYEGLRGAILGGRLSPGARL
FT                   PSTRELAAGLGVSRNTATSAYVQLLAEGYLEGRVGSGTYVARSLPDDLLRARPGPGREA
FT                   AGAGAERALSRRGGLLAATPTTTARDAGAPRAFRPGVPALDRFPFELWRQLASRFWRRP
FT                   PPGLLGYGDPAGYAPLRAEISAYLRAARAVRCSPEQVIVVSGSQQALDLAARVLLDPGD
FT                   AAWVEDPGYMGARAALLGAGARLVPVPVDGEGLDVAAGARLGPDARLVHVTPSHQYPLG
FT                   ATMSLARRLELLGWANRTGAWVLEDDYDSEYRYAGRPLEALQGLDAEGRVIYVGTFSKV
FT                   LFPSLRLGYLVLPPDLVDAFAAARELSDRHPPGPDQGVLARFIAEGHFERHLRRTRKLY
FT                   AERQEALVEAARRHLAGRLEVPPAEAGMHLVGRLPEGTDDREASRRAAALGVEAPPVSA
FT                   FASGACRTPGLVLGYAAFGRDEIEEGVKRLRAALDGPG"
FT   gene            141696..142700
FT                   /locus_tag="Rxyl_0137"
FT   CDS_pept        141696..142700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0137"
FT                   /product="Glutamine-fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: pfu:PF0157
FT                   glucosamine-fructose-6-phosphate aminotransferase
FT                   (isomerizing)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03116"
FT                   /db_xref="GOA:Q1AZR2"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZR2"
FT                   /protein_id="ABG03116.1"
FT                   /translation="MERSDALAERFAAEAAACERLFLVGIGTSHHAARVGEHLFRAYGG
FT                   GLDARAVHSFDFALYGPEVTARDCVVAVSHRGSKRYTAAALRRAREAGSRTALVTGEGA
FT                   TVSVETDAVFETVPQERSSAHTVSYTSAVAVLALLAALAGRLRTGSETLEMGFLREEIP
FT                   AALREALGTEDEARALAGEHVGRRRIWLAGGGPSAVTAEETALKIKETSYLQAEGMPTE
FT                   TMLHGPFQCVEAEDLFVLVAPSGAAQGRTLEVADLAGEVGAPSLVVSDGTAGIPGGASS
FT                   LAVREVPEPFSALACLVPLQLFAYHLALARGTNPDSFRAEDPRFARADVSGRL"
FT   gene            142697..143575
FT                   /locus_tag="Rxyl_0138"
FT   CDS_pept        142697..143575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0138"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: tte:TTE0639 permeases of the
FT                   drug/metabolite transporter (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03117"
FT                   /db_xref="GOA:Q1AZR1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZR1"
FT                   /protein_id="ABG03117.1"
FT                   /translation="MSRVNSATVRLAYTLLLVGVTAVWGWTFVVVQDAIAAYGVLGFLA
FT                   LRFTLASGAMAPFVARRAGLGTLLVGGGIGVVLAAGYLLQTLGLLYTTPTNSGLITGLF
FT                   VVFAPLAARALFGELLSRRVMLAVGLSLLGMVLLAGQSPSGVRVGDALTLGCAAALGAH
FT                   IALLSRYAREHDAGALAFAQMLSMAALFWAMWPLFEPVFAPPPGVWPAIALTGLVASAG
FT                   AFWVQTAVQQRISAARAAVILTMEPVFAALFGYWLAGDRLNPVQLAGAALILSALVVGE
FT                   VLPALRRGKKG"
FT   sig_peptide     142697..142774
FT                   /locus_tag="Rxyl_0138"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.799) with cleavage site probability 0.677 at
FT                   residue 26"
FT   gene            complement(143618..144934)
FT                   /locus_tag="Rxyl_0139"
FT   CDS_pept        complement(143618..144934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0139"
FT                   /product="LigA"
FT                   /note="KEGG: ade:Adeh_0244 LigA"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03118"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZR0"
FT                   /protein_id="ABG03118.1"
FT                   /translation="MGAAMDNARLKRHLAVWAGLLLGMALVVLAGAGEGEAATQLKGSF
FT                   RGNAYGTYANAQAGPVAATLGRSAFIPCPCNGTGGKTLSNSVDSLDAGEVLRAGALRST
FT                   VFTRKTSTSAQVRNTSTVSGLNLLDGLITADAVKAVANTTADARRIRSSAAGSSFVDLR
FT                   VDGRRVADVSPNTRIDLPGLGYVILKNVVPGGNGRSLGKVTVEMITVVVTRQNEFGLPV
FT                   GARIVVAHAYSGFSRNQPEVIVGGQAYAATANAAVGDSLQNRIGKAAFVVIGCEGTGGK
FT                   VRTNNVQALSVGDVLSIGTGRTTAFGGRRDSGTVARTTATVQDLRLLGGLIRADAVKAV
FT                   AQDTFRNGRRTSSTQGTEFARLRVAGLPVPVDVRPNTRLDLPGIGYVVVNEQKIPAANS
FT                   DARTQVNGLRVVVTRNNPLGLPVGAQIVVAHADSRVARF"
FT   sig_peptide     complement(144842..144934)
FT                   /locus_tag="Rxyl_0139"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.785 at
FT                   residue 31"
FT   gene            145174..145704
FT                   /locus_tag="Rxyl_0140"
FT   CDS_pept        145174..145704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0140"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mpa:MAP0794
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03119"
FT                   /db_xref="GOA:Q1AZQ9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZQ9"
FT                   /protein_id="ABG03119.1"
FT                   /translation="MARRLSASRRAQILEAALGMFSERGYEGTPLSAIAEEVGLSKPGI
FT                   VHHFPHKDDILEALFGPVFGEVEALLEGRPGREELLEGYLEIILRNRRLTVLLATDLAI
FT                   LNRPRIGERVCALNLRLRVALAGPGSTLEEEMRAECALGALRSPVVFFPEADPGLVRRV
FT                   ALEAARRVLGAGR"
FT   gene            146058..146702
FT                   /locus_tag="Rxyl_0141"
FT   CDS_pept        146058..146702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0141"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: ape:APE2350
FT                   isochorismatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03120"
FT                   /db_xref="GOA:Q1AZQ8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZQ8"
FT                   /protein_id="ABG03120.1"
FT                   /translation="MARTVEVPEYEVHEEIRVDPARTALVVVDMQNDFVKEGGSLVVPD
FT                   AGATIPAIRRLLELARGSGMKVVFTQDTHSEGDPEWEIWGEHCREGTWGWRIVDELAPR
FT                   EDELVIRKVRYDAFYGTHLDHFLRVWGVDTLVICGTVASICVHYTAASAALRWYKVVIP
FT                   KDATSALHPFDLEASLRQTAFLFAGRITESGGVRAEPQPYRSKLEEAAGER"
FT   gene            146784..147224
FT                   /locus_tag="Rxyl_0142"
FT   CDS_pept        146784..147224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0142"
FT                   /product="OsmC-like protein"
FT                   /note="PFAM: OsmC-like protein; KEGG: sco:SCO6531 putative
FT                   ATP/GTP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03121"
FT                   /db_xref="GOA:Q1AZQ7"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZQ7"
FT                   /protein_id="ABG03121.1"
FT                   /translation="MAAERRAEAVWEGNLVQGSGRFTVGSGAFGEMPVTWASRTEKPDG
FT                   KTSPEELIAAAHASCFAMALSFVLGEGGNPPERLEVSATSTFEEADGGFRISRMQLDVR
FT                   GRVPGLDEEGFRSAVEQAEQGCPVSNALRGNVDISVSARLEG"
FT   gene            complement(147289..148863)
FT                   /locus_tag="Rxyl_0143"
FT   CDS_pept        complement(147289..148863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0143"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   PFAM: Na+/solute symporter; KEGG: gka:GK0928 sodium:solute
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03122"
FT                   /db_xref="GOA:Q1AZQ6"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZQ6"
FT                   /protein_id="ABG03122.1"
FT                   /translation="MSDRAIATIFFVLIIVLTLGITAWAARRNKDTAHHYVAGGEIKGW
FT                   QNGLAISGDYLSAASFLGIAGSIALTGFSGFYLSIGFLVAYLVVLLLVAEPLRNLGKYT
FT                   FADMLAARFNLRSVRSAAALSTIAISTFYMIAQMVGAGALIELLLGLPYVASVVIIGVL
FT                   MTIYIAAGGMVATTWIQIVKAVLLISGTLALSIAVLAQFGFNPVAIFDRVEAELGPEMV
FT                   LPPPPEGFVSGIDVVSLNIALVFGTAGLPHILMRFLTVPDAKTARNSIIVATWIIGLFY
FT                   LMTPIMGYGAALLVGQDVIAEQNPAGNTAAPQLAGELGGPIFLAFISAVAFATIVAVVA
FT                   GLVIAASSAFAHDFYTNVIRGGEASEQEQFRAARIAAVAVSLGAMFLAIFARDFNVSFL
FT                   VALAFAVAASANVPTILFTIFWRRFNTAGAIAGILTGLFSCIVLIILSPNILDVFPLAN
FT                   PAIISMPLGFAACYLGTILTGEAAEREMAEGKQISYDEIYVRANTGITRVEEELREAAA
FT                   AEEPRTT"
FT   sig_peptide     complement(148786..148863)
FT                   /locus_tag="Rxyl_0143"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.943) with cleavage site probability 0.915 at
FT                   residue 26"
FT   gene            complement(148866..149180)
FT                   /locus_tag="Rxyl_0144"
FT   CDS_pept        complement(148866..149180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0144"
FT                   /product="protein of unknown function DUF485"
FT                   /note="PFAM: protein of unknown function DUF485; KEGG:
FT                   oih:OB2443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03123"
FT                   /db_xref="GOA:Q1AZQ5"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZQ5"
FT                   /protein_id="ABG03123.1"
FT                   /translation="MSREEEWVRVERTQAFKELMRQKKAFIIPATIFFVIFYFGLPVLT
FT                   GFTTLLDAQVIGSISLAYLYAFAQFAMTWILMHLYLSRANRWDELVDRARRQAAEGEVS
FT                   "
FT   gene            complement(149450..150319)
FT                   /locus_tag="Rxyl_0145"
FT   CDS_pept        complement(149450..150319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0145"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase, subunit FdhD;
FT                   KEGG: sco:SCO6558 putative protein associated with
FT                   oxidoreductase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03124"
FT                   /db_xref="GOA:Q1AZQ4"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZQ4"
FT                   /protein_id="ABG03124.1"
FT                   /translation="MDVKPRRKGSKTKTRLRAVEDGVARLRSDTLATEEPLEVRLISGG
FT                   ERQTVAVTMRTPGADFELAAGFLFGEGIISSREDIRRISYCTDPEVDAEQLYNIVNVEL
FT                   RPGLGYDPRQLERHFYTTSACGVCGKASLDQLELRGCPVLPPGPEVAPETLYALPEKLR
FT                   EAQGLFEATGGLHAAALFDPQGELLALREDVGRHNATDKLVGWALLEGKLPLSGHIAMV
FT                   SGRSSFEIMQKCLMAGVPVVCAVSAPSSLAVEVARRFGMTLVGFLRDRRFNVYAGAERI
FT                   AAGGKGGA"
FT   gene            complement(150323..152593)
FT                   /locus_tag="Rxyl_0146"
FT   CDS_pept        complement(150323..152593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0146"
FT                   /product="Oxidoreductase alpha (molybdopterin) subunit"
FT                   /note="TIGRFAM: Oxidoreductase alpha (molybdopterin)
FT                   subunit; PFAM: molybdopterin oxidoreductase molydopterin
FT                   dinucleotide-binding region; KEGG: ttj:TTHB197 probable
FT                   formate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03125"
FT                   /db_xref="GOA:Q1AZQ3"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZQ3"
FT                   /protein_id="ABG03125.1"
FT                   /translation="MARSTKKNMEKVRKGWDPSLWAGLKPFGIGEERPNNYAEILRAVW
FT                   ENKDEALYAWRILSRGVCDGCALGVAGLHDWTMDGVHLCNIRLRLLRLNTMPALDTRLL
FT                   ADLASLKQKKSAELKELGRLPYPMIRRRGERGFTRISWERALDEIAGRIRATSPRRTGY
FT                   YMTSRGEPNENYYVAQKAVRAMGTNSIDNAARICHSPSTVSLKATIGAGATTCSYSDWI
FT                   GTDLLVFIGSNPANNQPVTTKYMYYAKKAGTKIAVINSYREPGMERYWIPSNLESALFG
FT                   TKISDRTFLVNVGGDVAFLNGTLKHMIENGWLDRGFIERHTAGFKQMRAALEEQSWEDL
FT                   ERLSGASREEMREFARMVGEASTAVFVWSMGITQHEFGEDNVRAIINLGLTKGFVGRDN
FT                   CGLMPIRGHSGVQGGAEMGAYSTAFPGGLPVNPENARKLGELYGFEVPSEPGLTTPRMI
FT                   DAAHDGELDVLVSLGGNFLEVLPDPDYVREALARVPLRVHVDIVLSNQMLIDPADTVIL
FT                   LPAATRYEIPGGVTQTSTERRIMYSPEIPGRRIGEARPEWEIFMELAKRVRPELADKLH
FT                   FDGTQEIREEIARVVPMYDGIQHLRKSGDQVQYGGPHLCAGWKFDTPDGKAHFSAIALP
FT                   ETGIPEGMFVVTTRRGKQFNSMIHEEKDALTGAVREAVLMSEEDARGLGLANGERVVLR
FT                   SEAGEFEGRVHIAPIKPRTLQVHWPEGNVLIDRRHRSAVADIPDYNALVRVERAGEREP
FT                   AAV"
FT   gene            complement(152969..154141)
FT                   /locus_tag="Rxyl_0147"
FT   CDS_pept        complement(152969..154141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0147"
FT                   /product="Alcohol dehydrogenase GroES-like protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding Alcohol
FT                   dehydrogenase GroES-like; KEGG: sco:SCO4055 alcohol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03126"
FT                   /db_xref="GOA:Q1AZQ2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZQ2"
FT                   /protein_id="ABG03126.1"
FT                   /translation="MRAVVYKGPFEVAVENVEDPKIQDPNDVVVRITSTCICGSDLHMY
FT                   EGRTAAEPGIVFGHENLGIVEEVGPGVVSLRQGDRVVMPFNVACGFCKNCQRGYTGFCL
FT                   TVNQGFAGGAYGYVAMGPYTGGQAEYLRVPFADFNCLKLPEGDEHEADFALLADIFPTG
FT                   YHGTELADVQPGETVAVFGAGPVGLMAAYSAMIRGAERVFVVDRVKERLDKAEEIGCIP
FT                   VNFDEVDPVEYIKEQTPGNRLSTLSVDNDANRGADKGIDAVGYQAHVRGGEREEPAIVL
FT                   NTLIECVRPTGALGVPGLYVPSDPGAPDDASKKGQLLVSIGRMFEKGLRMGTGQCNVKR
FT                   YNAYLRDLIIAGRARPSFVVSHEVPLDQAPEAYEKFDKRIEGYTKVILKP"
FT   gene            complement(154381..154773)
FT                   /locus_tag="Rxyl_0148"
FT   CDS_pept        complement(154381..154773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0148"
FT                   /product="Cupin 2, conserved barrel"
FT                   /note="PFAM: Cupin 2, conserved barrel; KEGG: nwi:Nwi_1500
FT                   cupin region"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03127"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZQ1"
FT                   /protein_id="ABG03127.1"
FT                   /translation="MRRISPKDTKTERGPGEWFTGEVWMDPSPPRTPEAGVFRVLFAPG
FT                   ARTNWHTHPEGQVLYVVSGRGLAQAEGGPVVEMGPGDVVTFAPGEKHWHGAAPDSCMLH
FT                   VAINPAASTDGGTEWLEPVGDEEYPG"
FT   gene            complement(154840..156525)
FT                   /locus_tag="Rxyl_0149"
FT   CDS_pept        complement(154840..156525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0149"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:glr3825 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03128"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZQ0"
FT                   /protein_id="ABG03128.1"
FT                   /translation="MDAPELVLGPLLRFVGPREATVWVETSRPAEVEVRPAGGPPPSRE
FT                   RTFSVAGHHYALVTLRGLEPGSSCGYEVLLDGRRRWPPSGGPFPPPLIRTPDPSSGRLR
FT                   LAFGSCRVSVPHEPPYTLRRGSLKRGGVLRRGFYERDALYALALRMRGQPPGRWPDALL
FT                   MLGDQIYADEVSPQAKEFIRSRRDTSKPPGEQVADFEEYTRLYLEAWRTPAIRWLLSTV
FT                   PSAMIFDDHDVHDDWNTSEAWVRKMRSKPWWEERIVGAFMSYWVYQHLGNLSPAELEED
FT                   PLFAKVRGSRDATQTLRGFARAADRDVAANRWSFRRDFGRVRLVVADSRAGRVLSEGRR
FT                   AMLDEAEWAWIEEQVLSGGFDHLLFATSLPFVLSPGLHHLEAASEAVCGGAWGRAAARA
FT                   GEAVRQALDLEHWSAFGRSFAALSGLLRRAASGEGAPASIAVLSGDVHHGYLAALDLGP
FT                   GARSPAYQAVGSPIRNPLGLPERLALRAAWTRAGAALGRGIARLAGVGEPPVGWRLLHQ
FT                   SPWFDNHISTLSFEGRRATLLVEKTTPEDGKPPKLLPILERRLA"
FT   gene            complement(156568..158163)
FT                   /locus_tag="Rxyl_0150"
FT   CDS_pept        complement(156568..158163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0150"
FT                   /product="anion transporter"
FT                   /note="TIGRFAM: anion transporter; PFAM: sodium/sulphate
FT                   symporter Citrate transporter; KEGG: oih:OB2540
FT                   sodium-dependent transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03129"
FT                   /db_xref="GOA:Q1AZP9"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZP9"
FT                   /protein_id="ABG03129.1"
FT                   /translation="MSESIRPSGTYRTLAEQREVLTPAEERFERARQTIGLFLGPIVFL
FT                   VMYLAPLPLEPNQQTLAAILSFTIVYWLSEAIPIPATAVLALALCVVLNVPGVGVNAED
FT                   SPGDIVYGAFGSDTIFLFIGAFIIAQAMITHGLDRRFAFRILSLPGVSRSTYGVIVAFG
FT                   FIAAAISAFISNTATAAMLLPIGLGMMGALGGFVKEQSGTERDISRLRFGTALMLMISY
FT                   GAGVGGLLTPIGTPPNLIGIGFIEEETDTTITFFSWVVAAFPVCLLMFIALCVILILLN
FT                   RPEVRRLSGAEEYVAEQRRSLGPLSRGERNTLIAFATAVFLWMLPGFVALVLGEESRLY
FT                   SLILSRLDEGTVAILAAALLFVLPVDWSERRFTLNWNEAVRIDWGTIVLFGSGIVLGTL
FT                   LSDTGLAEVMGTGIAEALGFSSLLAISAVSALIAILISETTSNTASATIVVPIVIPIAA
FT                   AAGVNPVIPALCAVFGASFGFMMPVSTPQNAVVYGSGLIPITKMVRSGIAFDIIGLILI
FT                   VLLIPVMARLVGFV"
FT   gene            complement(158244..159074)
FT                   /locus_tag="Rxyl_0151"
FT   CDS_pept        complement(158244..159074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03130"
FT                   /db_xref="GOA:Q1AZP8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZP8"
FT                   /protein_id="ABG03130.1"
FT                   /translation="MEELRSTPSRGGEISVAWEGLAASCASPVRRLGGFLLVGFALFAA
FT                   STTAVILYYNLFGERSFAGQGVAVPHAAFYATMALSAAVAAGGYLVWLLRSLRSYAAFS
FT                   RILSGRGLDPRRPTRDGLSAYSDEQLLALRTRYERALPGPAKERLARTFGFHEDDSFSL
FT                   GPLSARPGTFEMGVLRMEWEARLILRSGEPLPEISWWTEGRHRLLPRKPTELRRLLFAL
FT                   RYTTESVRELKRRYGYRVERWHKTVPEGRLWDAIRDHEEARRIQAALNSRRISG"
FT   gene            159172..159987
FT                   /locus_tag="Rxyl_0152"
FT   CDS_pept        159172..159987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0152"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator common domain; PFAM: cell
FT                   envelope-related transcriptional attenuator; KEGG:
FT                   sth:STH1893 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03131"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZP7"
FT                   /protein_id="ABG03131.1"
FT                   /translation="MGMEVYRSGRRGRGLRAALLLLGGLLLLLAAYVVLPLGTDRVVLL
FT                   GSDARAAEPSRSDTIVVAKAGGGALAVPRDTLVQIPGVGQDKVNAALAHGGPELAVKTL
FT                   EGLTGVPIGNYVVVDFGAVEEIVDALGGVTVEVDEPIQYTLDGRYVSIPAGRQTLDGFE
FT                   ALAYVRYRGGPTADIGRIGRQQEFLRALAAEAASPRKLVRLPLAARAAWANVDTNMNPI
FT                   SAGRLALRMWLFGVGEVELYPGTPQYINGIAYWVPDRAAGARAVEATIA"
FT   gene            complement(159997..160665)
FT                   /locus_tag="Rxyl_0153"
FT   CDS_pept        complement(159997..160665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0153"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE0745 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03132"
FT                   /db_xref="InterPro:IPR018708"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZP6"
FT                   /protein_id="ABG03132.1"
FT                   /translation="MGEIRRVYTRCPLCGQIFRAAHAGSYITVGRDTDLCPRFPGRRFD
FT                   AARLIRSEITMCPRCNFASAEDFRELDLSFDERYDLEERLRGDGLLRIFRANQPPWLAF
FT                   HAAEICGQERRLPARELGDLCLRASWVCRKAGERAFESTFQLRAVRYFMRALDNEELEG
FT                   RRLPVTTYLVGELNRRLGHHREALNWYVNAERTMQAVGRMAWLDRLISRQSKLAREQAA
FT                   "
FT   gene            160730..160963
FT                   /pseudo
FT                   /locus_tag="Rxyl_0154"
FT   gene            161064..162134
FT                   /locus_tag="Rxyl_0155"
FT   CDS_pept        161064..162134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0155"
FT                   /product="basic membrane lipoprotein"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG: sth:STH1236
FT                   sugar ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03133"
FT                   /db_xref="GOA:Q1AZP5"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZP5"
FT                   /protein_id="ABG03133.1"
FT                   /translation="MQAGRLGILSVLAAALLALAAACGGGGGGGEQQGGGGGGGEAEVR
FT                   PAMVTDVGGLGDQSFNDSAYRGLKRAGEEFGVKVEVLESNAPTDYVNNLSQLAESGYSP
FT                   VFAIGFLMTDAVTEVSQQFPDTQFAIVDSVVEQPNVASLVFREQEGSYLAGVVAGLMTQ
FT                   EETPYTNPDDKVVGFLGGQESDLIRKFQAGYEAGVEAACPDCEVLVQYAGTTPEAFNDP
FT                   ARGKEIALQQINEGADIIYHASGATGAGLFEAAREQKIFAIGVDSDQAKLFPDAPILTS
FT                   VVKRVDNAVFQTIEAARGGEFPGGEVQEFGLEDGGLSLAPFYRFDRFVPQKVKDEVDRA
FT                   REGIISGEIKVPEKPQ"
FT   sig_peptide     161064..161126
FT                   /locus_tag="Rxyl_0155"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.609 at
FT                   residue 21"
FT   gene            162147..163703
FT                   /locus_tag="Rxyl_0156"
FT   CDS_pept        162147..163703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0156"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   gka:GK1284 ABC transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03134"
FT                   /db_xref="GOA:Q1AZP4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZP4"
FT                   /protein_id="ABG03134.1"
FT                   /translation="MAEREPTGGQAGTAGEAPVVLEMRGITKTFGAVRANDGISISLRR
FT                   GEVLGILGENGAGKSTLMKILYGLYSPDAGEIFLDGERAEIKDPKDAVERGIGMVHQHF
FT                   TLIPPLTVAENIVLGAEPRRGLAVDLQRAVRETGELCERYGLRVDPRARVADLSVGEQQ
FT                   RVEILKALYREARILVLDEPTAVLTPQETEDLFSTLKELVASGLSIILITHKLGELLGV
FT                   SDRITIIRDGRVVDTVPAARTDERELARLMVGREVLLRVEKEEAEPGGVRLQAEGLVVR
FT                   SSRGTVAVRGVSLEVRGGEILGIAGVDGNGQTELAEALAGTRPAEGGAVRLDGEDVTRL
FT                   GAKARKRRGLAYVPEDRMAKGLVPDFALYENHALKTYDEPPYASRWGWLRPAAMRRRAA
FT                   EALRAFDVRPPDPDLPARSLSGGNQQKAILARELSGDPGVIIAYQPTRGVDVGAIEFIH
FT                   GQLLRQRGEGKAILLISLELEEVRSLSDGILVLCDGRIVGEVGPEATDEELGLLMAGRA
FT                   G"
FT   gene            163700..164812
FT                   /locus_tag="Rxyl_0157"
FT   CDS_pept        163700..164812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0157"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: tte:TTE0459
FT                   uncharacterized ABC-type transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03135"
FT                   /db_xref="GOA:Q1AZP3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZP3"
FT                   /protein_id="ABG03135.1"
FT                   /translation="MSAGRGGLSSALRAALGRAAGALVFPLVAIALALAVGAVIVLATG
FT                   NNPLAAYRALAVGAVGSPAAIGRTLLNATPLIFTGLAVAVAFRAGLFNIGGEGQLYIGA
FT                   ITAAILGVSLGFLGPLAIPVVLLACLLTGFLWGAIPGLLKARFGAHEVITTIMLNFVAI
FT                   NLATYLALKPFRTEGLVPGTDFIDAAARIPTIGLGLGRANYGLFVALVAAAAVYLLLWR
FT                   TTLGFRLRAVGLSPGAANYAGMSIGTSTVLALAIGGAMAGLGGGVEVMGVYGKMSIPFV
FT                   SNLGFNGIGVALLGRNHPAGVVLGALLFGGLASGAQELQFETDVPLDLADVLLAIILLL
FT                   VTATRLVELIFGKRVREMASGTRLDEGLAS"
FT   sig_peptide     163700..163831
FT                   /locus_tag="Rxyl_0157"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.799) with cleavage site probability 0.201 at
FT                   residue 44"
FT   gene            164812..165735
FT                   /locus_tag="Rxyl_0158"
FT   CDS_pept        164812..165735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0158"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: sth:STH1233
FT                   sugar ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03136"
FT                   /db_xref="GOA:Q1AZP2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZP2"
FT                   /protein_id="ABG03136.1"
FT                   /translation="MEELLGGLAPLLASMVRNATPLVFAALGGMFSERSGVVNIGLEGL
FT                   MLISAFAGVAGAFYSGSAWVGLLFALGAGLGFALIHALMSITFEADQIISGTAINLLAL
FT                   GGTGFLMELVFGRSGTSPRVQGFEPVAIPVLSEIPVVGRAFFDQSLLVYLMYAMVPLTY
FT                   LLVFRTPFGLRLRGTGEAPEAVDTAGVSVARMRYYGVALSGLLAALGGVYLSMGILSAF
FT                   TEGMTNGRGFIALAALIFGRWNPVGAAGAAFLFGLAQAFIFQAPQDVIPLEFLQMIPYV
FT                   LTIVVLAGFGGRAVAPAAIGKPYRKE"
FT   sig_peptide     164812..164871
FT                   /locus_tag="Rxyl_0158"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.725) with cleavage site probability 0.540 at
FT                   residue 20"
FT   gene            166077..167603
FT                   /locus_tag="Rxyl_0159"
FT   CDS_pept        166077..167603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0159"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase-like histidine
FT                   kinase, dimerisation and phosphoacceptor region; KEGG:
FT                   sco:SCO5454 two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03137"
FT                   /db_xref="GOA:Q1AZP1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZP1"
FT                   /protein_id="ABG03137.1"
FT                   /translation="MRWRLVLPAGVSAGLLSYVFSVFLISLYAATGAIAGALGVPRQPD
FT                   AERFGLLVADYGMPLLFVLLVVPAALVVGRRTGGAGPLHGALAGLAAAATHQAVGLLFG
FT                   PPDPNELLVYPALGLGGGLLGGARGRAARSGEQALRDANRALAAARSARQVAAALGEHL
FT                   AGLGVTSLCLWSCTGEGPARLLAEWAPGGSAGGPPLDPSALPERPPAPLRVPVSSLPPG
FT                   ERSPLEGRGVGSVLVVPLSPPGGGFRGLLTVASRRRRAFSRSDVRTYAAAAGMAALVLE
FT                   NLRLVERARRAGVLEERQRLAHEIHDTLAQGFTSIVTNLEAAGGALQRDRAALRRHLEQ
FT                   ALAVARESLSEARRLVWALRPEPLEEAPLPEALRRLAARWSSSSGIPARVLVTGEPRAL
FT                   PADPEVTLLRVAQEALANVRKHARAGRVAITLSYIGDRVALDVRDDGVGFDPAAPSPGD
FT                   DGSGFGLRSMRERVGRAGGTLSVESAPGEGTVLSAEVPAAGAAEPVGGAG"
FT   sig_peptide     166077..166166
FT                   /locus_tag="Rxyl_0159"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.860 at
FT                   residue 30"
FT   gene            167600..168238
FT                   /locus_tag="Rxyl_0160"
FT   CDS_pept        167600..168238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0160"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR response regulator
FT                   receiver; KEGG: sco:SCO5455 two-component system response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03138"
FT                   /db_xref="GOA:Q1AZP0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZP0"
FT                   /protein_id="ABG03138.1"
FT                   /translation="MSGEGRVRLLICDDHPVVRAGLRGMLAGEQDLEVAGEAANGREAV
FT                   ELARSLRPDLVLMDLRMPEMDGVAATERILAELSQTRVLVLTTYDSDADILRAVEAGAS
FT                   GYLLKDAPREELFAAIRAAMAGESPLDPAVASRLMRRVRTPPENALSGREIEVLDLVAQ
FT                   GASNREIARQLWISETTVKTHLLHIYEKLGVADRTAAVTAAIKRGIIRL"
FT   gene            complement(168235..168627)
FT                   /locus_tag="Rxyl_0161"
FT   CDS_pept        complement(168235..168627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03139"
FT                   /db_xref="GOA:Q1AZN9"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZN9"
FT                   /protein_id="ABG03139.1"
FT                   /translation="MRKLAVLAALVGLLAWAAPAHAQGASAAGEQYEYGAAGAAGSTMA
FT                   GRDLIIDVTGRLAGEGSGAARGAGSYVSALGGGEAASASAQVPAGAPPAAAGITELPDT
FT                   GGVRVILLPFGAVLLLLAARLIKRSL"
FT   sig_peptide     complement(168559..168627)
FT                   /locus_tag="Rxyl_0161"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 23"
FT   gene            complement(168717..168950)
FT                   /locus_tag="Rxyl_0162"
FT   CDS_pept        complement(168717..168950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0162"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix motif; KEGG: det:DET0884
FT                   transcriptional repressor LexA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03140"
FT                   /db_xref="GOA:Q1AZN8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZN8"
FT                   /protein_id="ABG03140.1"
FT                   /translation="MELPHLRDLRLRAVMSQEELARRSGVARDTISKLETGKRRAYPST
FT                   VRKLAEGLEVEPQALVGEALPAEREGQGEAGF"
FT   gene            169065..169478
FT                   /locus_tag="Rxyl_0163"
FT   CDS_pept        169065..169478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03141"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZN7"
FT                   /protein_id="ABG03141.1"
FT                   /translation="MILTHEYIRHRSGYAFGAGCCWIRIYRGGPGDAPVVICEEVPGSG
FT                   ASVSEMSSQLAAEVIRDHFAGGLPDLPRPLLWIERRPARRGRRERYFLLTFPSYTPKPE
FT                   APGFVRRVTLGPPEREPLAAEEVAALTGGAPVP"
FT   gene            169553..169960
FT                   /locus_tag="Rxyl_0164"
FT   CDS_pept        169553..169960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03142"
FT                   /db_xref="GOA:Q1AZN6"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZN6"
FT                   /protein_id="ABG03142.1"
FT                   /translation="MEPAGSFLRMLLRRPPRPLLGGDEEGPEARVRGPLFPRPVIHALL
FT                   AAFAGFSMLTFDWFGLLLLNSGGVFRQIGALNALRVTAVLMAGIAVPSVLLMVHYRRMY
FT                   TYTSSENVFFAITFSLSFMMGLPCGLVGFFG"
FT   gene            complement(169977..170399)
FT                   /locus_tag="Rxyl_0165"
FT   CDS_pept        complement(169977..170399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0165"
FT                   /product="SUF system FeS assembly protein"
FT                   /note="TIGRFAM: SUF system FeS assembly protein; PFAM:
FT                   nitrogen-fixing NifU-like-like; KEGG: lmf:LMOf2365_2383
FT                   NifU family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03143"
FT                   /db_xref="GOA:Q1AZN5"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZN5"
FT                   /protein_id="ABG03143.1"
FT                   /translation="MMRDLYGQVIMDHYRRPRNRGELEDADLTRHLLNPLCGDEVTVYA
FT                   RFEGDRVAEASFTGRGCSISQASASMMTERLRGKSREEAEAEISRFKRMMTGEEEFPEG
FT                   DDLAALKGVIQYPSRIRCATLAWEAFQQGLEEKGAP"
FT   gene            complement(170396..171622)
FT                   /locus_tag="Rxyl_0166"
FT   CDS_pept        complement(170396..171622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0166"
FT                   /product="cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /note="TIGRFAM: cysteine desulfurases, SufS subfamily;
FT                   PFAM: aminotransferase, class V aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase
FT                   Pyridoxal-dependent decarboxylase; KEGG: gka:GK2993
FT                   cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03144"
FT                   /db_xref="GOA:Q1AZN4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZN4"
FT                   /protein_id="ABG03144.1"
FT                   /translation="MYDVLKVRRDFPILEREVNGRPLVYLDNAATSQKPLQVIRTLSRY
FT                   YERHNANIHRGVHRLAEEATGLYEEARGKVARFIGAPDPRGLVFTRGTTESINLVAHAW
FT                   GRKNLREGDEVVLTEAEHHSNLVPWQLAARDTGARLRFIPVLDDGTLDMEAAEHLIGPR
FT                   TRLVGCVHASNVLGTVNPVERLAELAHEAGALMLVDGAQSAPHLPVDVTSLGCDFFAAS
FT                   GHKMLGPTGVGFLWARPELLEEMEPFLGGGEMIREVRLERSTWNEIPYKFEAGTMNIAQ
FT                   AIGLGAAVDYLGSLGMESVREHERRLGAYAYRRLAGVEGITLYGPAENRTGVVAFNLPE
FT                   VHPHDLSQLLDQEGVAIRSGHHCCQPLMRRLGVVATARASLYLYNTEEEVEALVEAIAR
FT                   AREFFEAPA"
FT   gene            complement(171634..171993)
FT                   /locus_tag="Rxyl_0167"
FT   CDS_pept        complement(171634..171993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0167"
FT                   /product="Rieske (2Fe-2S) region"
FT                   /note="PFAM: Rieske [2Fe-2S] region; KEGG: pol:Bpro_4275
FT                   Rieske (2Fe-2S) region"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03145"
FT                   /db_xref="GOA:Q1AZN3"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZN3"
FT                   /protein_id="ABG03145.1"
FT                   /translation="MAEFHKIARADEVPPGEVKQYTVEGRPVALCNVGGELYAFEDICT
FT                   HQYAHLSEGKLEDALIRCPLHGATFDVRTGEAKSLPAVKPVPTHTVRVEDGFVYVALNP
FT                   KQVKVGRRRRGRGRR"
FT   gene            complement(172002..173363)
FT                   /locus_tag="Rxyl_0168"
FT   CDS_pept        complement(172002..173363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0168"
FT                   /product="Iron-regulated ABC transporter permease protein
FT                   SufD"
FT                   /note="TIGRFAM: FeS assembly protein SufD; PFAM: SufBD;
FT                   KEGG: dra:DR2101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03146"
FT                   /db_xref="GOA:Q1AZN2"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZN2"
FT                   /protein_id="ABG03146.1"
FT                   /translation="MSTNGVPEVLRRKGIGIEAVKALAAFKDEPGWLREKRLAAWRTFE
FT                   EIPMPTMRDEAWRYTDVSDVRFEEYVPYAPSPDVEREGDLPDAVQRLIKEGEENSALLV
FT                   QHNSETTYARTDEALRARGVIFTDLHTALREHGELVRERLFRLVPEGYDKFAALSAAAF
FT                   SGGSFLYVPRGVEVEVPIQSYRWLDVAGSIMPRTLVIVEEGASVTYIDEYASEDGEEPA
FT                   LSNGAVELFVGQGAHLQYVSLQNWARNVVHFNTIRSQAEKDATINSLVVSFGAQLSRTN
FT                   VEAGLTAPGSDSEMLGLYFADEDQLIDHHTLQDHIAPQAHSDLLYKGALRDESLTVFSG
FT                   LIRVEPGAQKTDAYQTNRNLILGTDEAMAVSLPNLEIMADDVKCSHGATTGQVDDLELF
FT                   YLMSRGIPRIEAEKLVVFGFFGEVTSRIPLRGLKEKLDRAIEEKIGLGFEERVA"
FT   gene            complement(173360..173815)
FT                   /locus_tag="Rxyl_0169"
FT   CDS_pept        complement(173360..173815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0169"
FT                   /product="UspA"
FT                   /note="PFAM: UspA; KEGG: tbd:Tbd_2614 universal stress
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03147"
FT                   /db_xref="GOA:Q1AZN1"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZN1"
FT                   /protein_id="ABG03147.1"
FT                   /translation="MFPTKILLATDGSEHARRAARAAVELAQKTGSELHVVHVGPAVTS
FT                   IFAYTELDPARVEEEARKALDEEVRSIEESGGAVAEGHVLLGNPAESIVSLAEEMGAGL
FT                   IVVGSRGLGGLRRALMGSVSESVVRHAHCPVLVVRGDAEDAEGEGDR"
FT   gene            complement(173919..175331)
FT                   /locus_tag="Rxyl_0170"
FT   CDS_pept        complement(173919..175331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0170"
FT                   /product="Iron-regulated ABC transporter membrane component
FT                   SufB"
FT                   /note="TIGRFAM: FeS assembly protein SufB; PFAM: SufBD;
FT                   KEGG: dra:DR2106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03148"
FT                   /db_xref="GOA:Q1AZN0"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZN0"
FT                   /protein_id="ABG03148.1"
FT                   /translation="MPADKTIQELGLEEYKYGFKDPEEYFFKTPRKGLDEEIVTMISLH
FT                   KKEPEWMLEFRLNALKAFQEKPVPTWGADLSELDFDDIYYYIKPVENQGRSWDEVPESI
FT                   KKTFDRLGIPQAEREILAGVGAQYESEVVYHNLKEEWEKQGVVFLDMDGGLREHEDLVR
FT                   EYFGTVIPPDDNKFAALNSAVWSGGSFVYVPPGVHVDIPLQAYFRINAENMGQFERTLI
FT                   IADEGSYVHYIEGCTAPTYTTNSLHSAVVELIAKPNARIRYSTIQNWSHNTYNLVTKRG
FT                   VAYENATIEWVDGNLGSKVTMKYPAVYLMGEGARGEILSVAYAGDGQHQDAGGKVVHVA
FT                   PNTSSLITSKSISKGTGRATYRGLLKVHEGAVNSKSRVECDALLLDEKARTDTYPYIEI
FT                   EEKKVNTEHEATVSKVGEEQLFYLMSRGLSEEEAMAMVVNGFIEPIAKELPLEYAIELN
FT                   RLIQLEMEGSVG"
FT   gene            complement(175342..176094)
FT                   /locus_tag="Rxyl_0171"
FT   CDS_pept        complement(175342..176094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0171"
FT                   /product="FeS assembly ATPase SufC"
FT                   /note="KEGG: lin:lin2510 similar to ABC transporter,
FT                   ATP-binding protein; TIGRFAM: FeS assembly ATPase SufC;
FT                   PFAM: ABC transporter related; SMART: ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03149"
FT                   /db_xref="GOA:Q1AZM9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZM9"
FT                   /protein_id="ABG03149.1"
FT                   /translation="MLKIENLHAEVEGKEILKGLTLEVGRGEIHAIMGPNGSGKSTLAN
FT                   VLMGHPRYEVTEGSVTFEGEDVLELEPDERAKLGMFLAFQYPSEVPGVSVANFLRTAVN
FT                   SVREQEVPPMEMYKLLQEKMRLMDMDPSFAERYLNEGFSGGEKKRNEILQLLVLQPKLA
FT                   ILDETDSGLDIDALQVVARGVNQMRGPEFSAVVITHYQRILRYIEPDFVHVMLDGRIVT
FT                   SGGKELAEELESKGYDWVRQEFGAGTQS"
FT   gene            complement(176347..177174)
FT                   /locus_tag="Rxyl_0172"
FT   CDS_pept        complement(176347..177174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0172"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase Methyltransferase
FT                   type 11 Methyltransferase type 12; KEGG: hch:HCH_03658
FT                   SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03150"
FT                   /db_xref="GOA:Q1AZM8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZM8"
FT                   /protein_id="ABG03150.1"
FT                   /translation="MGTPGERAVGEHYGREGLEERISAALRSAGADPLAPSVEELHAVD
FT                   QLHTRGVRATLELAELAGASPGERVLDVGGGLGGPARILASRFGCRVVVLDVTEEFCRV
FT                   GALLTARAGLGERVLFRHGSALEIPFPDASFDLAWTQHSTMNIPDKDRLYREIHRVLKP
FT                   GGRLAMHEILAGPSGPPRRFPLPWAASPALSHLLPPNRMRASLSRAGLRELAWSDVTPQ
FT                   TAEWLKTRSSGRPSGPPPEAFANLLLSIREGRATAVQALLERPEAQLDGNGSR"
FT   gene            complement(177174..178103)
FT                   /locus_tag="Rxyl_0173"
FT   CDS_pept        complement(177174..178103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0173"
FT                   /product="glycine cleavage T protein (aminomethyl
FT                   transferase)"
FT                   /note="PFAM: glycine cleavage T protein (aminomethyl
FT                   transferase); KEGG: ade:Adeh_2848 LigA"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03151"
FT                   /db_xref="GOA:Q1AZM7"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZM7"
FT                   /protein_id="ABG03151.1"
FT                   /translation="MAAERITHPGYAALREGAALVGHPGAAALRLSGRDPLGLLEAILT
FT                   NSLPGEEDRGAYALLLDPKGRIQADLRVVRHAGEVLVVAGPQSARAVREILRRYAPFSR
FT                   VAVEETGFGVLGLYGPRAAELAGLRSALPEHACARLGALLAVGVAVPVPGVDLIGAPEE
FT                   LQRARERLRSAGAVAATEEEYEAARIAAGVPRFGTDFTPENFPAEAGLLERAVSFEKGC
FT                   YPGQETVARMRYRGHPNRTLRRLLVASGTPPAPPAEILQGDRRAGTLTSVSPLPSEEGV
FT                   VFALGYLRRGADPEGPLSAGGAILRVAG"
FT   gene            178156..178803
FT                   /locus_tag="Rxyl_0174"
FT   CDS_pept        178156..178803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0174"
FT                   /product="HAD-superfamily hydrolase subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase subfamily IA,
FT                   variant 3 HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase-like hydrolase; KEGG:
FT                   sco:SCO0790 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03152"
FT                   /db_xref="GOA:Q1AZM6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZM6"
FT                   /protein_id="ABG03152.1"
FT                   /translation="MARAVVLDVDGTLMDTNYLHVEAWARAFDQVGYRVPRARVHRQIG
FT                   KGSDKLVPEFIPAGDKAAAEEADRLHGELFMQMQRYALPLPGARELVDALSRRGYSVWF
FT                   VTSAKPEELEEYLRLLETEGRLSGIVNSADVENSKPAPDIFELALERAGVSPEETVAVG
FT                   DAVWDVQAARAAGVRTVAVLTGGAFSARELEEAGAEEVYEDCAALLEAGFPE"
FT   gene            178962..179165
FT                   /locus_tag="Rxyl_0175"
FT   CDS_pept        178962..179165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0175"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /note="PFAM: Cold-shock protein, DNA-binding; SMART: Cold
FT                   shock protein; KEGG: neu:NE1731 cold-shock DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03153"
FT                   /db_xref="GOA:Q1AZM5"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZM5"
FT                   /protein_id="ABG03153.1"
FT                   /translation="MAQGTVKWFSDEKGYGFISPDDGSEDLFVHYTGIEGTGFKTLEEG
FT                   ARVSYETTRGRKGMQAVKVSRI"
FT   gene            complement(179239..180393)
FT                   /locus_tag="Rxyl_0176"
FT   CDS_pept        complement(179239..180393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0176"
FT                   /product="protein of unknown function DUF111"
FT                   /note="PFAM: protein of unknown function DUF111; KEGG:
FT                   gsu:GSU0141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03154"
FT                   /db_xref="GOA:Q1AZM4"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZM4"
FT                   /protein_id="ABG03154.1"
FT                   /translation="MGGAAGDMILASLISAGAPAGEVEESVRGLGLPVRLELRRVEISG
FT                   IAALGLRVDAPEEHAHRTFRDIRRLIEGSGLPERAAGRALAAFGLLAAAEGRVHGVPPE
FT                   EVAFHEVGAADSIADIVGACAALELLGAETVSCGPLPMGSGVVEAAHGPLPVPGPATLE
FT                   VLRGCRVRWPEEEREMTTPTGAALLRALTGGEFSDAAPPMVLGAAGYGAGTARLRGAPN
FT                   LLRAVVGRLEGPVGGLEVLEANIDDAPGEVLGAAVERLLEAGAPDAWLEPVVMKRGRGA
FT                   YKLCALARRQDRERLARLMMRETGSLGVRHHGVGRTVAERRLVEVELPYGRCRVKVGSL
FT                   DGEDFAVAPEHADAARLARESGRPLPRVYDDARRAASELLRQSP"
FT   gene            complement(180420..180770)
FT                   /locus_tag="Rxyl_0177"
FT   CDS_pept        complement(180420..180770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03155"
FT                   /db_xref="InterPro:IPR022062"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZM3"
FT                   /protein_id="ABG03155.1"
FT                   /translation="MSEIPERIEREMFEIRSRMAPDVRDLRRHVEPRVVVQQTKEKAKA
FT                   RLKEALGRLGRSVAESARRQARLAREAGRKRNPSVFTDAVKSDPRPMILLAVALAAAAM
FT                   VVRRISGGGSGK"
FT   gene            complement(180767..181216)
FT                   /locus_tag="Rxyl_0178"
FT   CDS_pept        complement(180767..181216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0178"
FT                   /product="protein of unknown function DUF1469"
FT                   /note="PFAM: protein of unknown function DUF1469; KEGG:
FT                   sma:SAV6345 putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03156"
FT                   /db_xref="GOA:Q1AZM2"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZM2"
FT                   /protein_id="ABG03156.1"
FT                   /translation="MTEQRERVAEFERRLEGGEELSDRSVKEIVEALRPQLQELARKQV
FT                   ELAKVELAPVGRQAGLAAGLLVAGAVFLHLFVVFLAVTGIYLLNEVGGLSLWLSALIVS
FT                   GILLVIGGVLAGTGAGRLRGLDPKPRRTISTFQQNVEWLKGQFRS"
FT   gene            181437..182180
FT                   /locus_tag="Rxyl_0179"
FT   CDS_pept        181437..182180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0179"
FT                   /product="uncharacterized MobA-related protein-like
FT                   protein"
FT                   /note="KEGG: mta:Moth_2003 uncharacterized MobA-related
FT                   protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03157"
FT                   /db_xref="InterPro:IPR017587"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZM1"
FT                   /protein_id="ABG03157.1"
FT                   /translation="MKLYPALGISSGDVVAFVGAGGKSSAIIAVAGELVGDGMTAIAVP
FT                   TTKMQVGEAERVGRVVIAGEEGWLGRLKEAVTDSGAAAVGSAYISGGRIGGLGLDEVAP
FT                   LGRIADVVLVEADGARRKPLKGTAEHEPAIPRGTTLVVAVANIGALGRPATEEHIHRPE
FT                   VFSRLTGLSSGQSVTPRAFALALSGGSLARVPSGARSAVLLTGVSPGRSMSDAAVVTRE
FT                   LWRQGISRIVFTSLPSEEPVQVWVP"
FT   gene            182245..183426
FT                   /locus_tag="Rxyl_0180"
FT   CDS_pept        182245..183426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0180"
FT                   /product="Peptidase M20D, amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="KEGG: rsp:RSP_2910 predicted metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase; TIGRFAM: Peptidase
FT                   M20D, amidohydrolase; PFAM: peptidase M20 peptidase
FT                   dimerisation"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03158"
FT                   /db_xref="GOA:Q1AZM0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZM0"
FT                   /protein_id="ABG03158.1"
FT                   /translation="MSTTRKAFGGLLAEAEREHAKRIVALRREIHREPELGFDTARTAA
FT                   KVVASLEGLPLEVREGVAENGVVADLRGATDGPVVGLRADMDALPIREETGLPFASEVE
FT                   GRMHACGHDGHTSMLVGAAHLLSGMRERVEGTVRFLFQPAEEGGGGGRVMVEEGALEGV
FT                   EAVFALHLWPGLPFGVASTAGGPTMAAADAFELTVRGRGGHGAMPHLTADAVVAASHIV
FT                   AALQTLVSRETDPTEPAVLTVGQLEAGSAFNIIPETARLTGTVRTVDEKLRRVMPRRIE
FT                   ELAKGVARAMRADASLEYAFSYPVTRNDPREAGFALEVAAGLFGEEGAVEASRPSMAAE
FT                   DFAFMLEAVPGAYIWLGVGDVPGLHTPRFSFDERVLPRGAALLAALALARLGS"
FT   gene            complement(183423..184004)
FT                   /locus_tag="Rxyl_0181"
FT   CDS_pept        complement(183423..184004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0181"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A0937 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03159"
FT                   /db_xref="GOA:Q1AZL9"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZL9"
FT                   /protein_id="ABG03159.1"
FT                   /translation="MARWPGRGVSPEHFRGALGEVWFAPTRFFRRLDPEGGLLRPALFA
FT                   SAVMYLNLLLETVLQAVWTGELTYALLYAPLLGFVVSIVLAPLLVAGLASLVLVVLDGA
FT                   PSRRRFVPVFRALGYASGIGVVLWVPYGPLVALPYGLLVATVAVREVLGLAWSRAALAT
FT                   LLPLAAALLAVFLLSGPGDAYDLLRNPPGS"
FT   gene            complement(184015..184398)
FT                   /locus_tag="Rxyl_0182"
FT   CDS_pept        complement(184015..184398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0182"
FT                   /product="mannose-6-phosphate isomerase, type II"
FT                   /note="PFAM: mannose-6-phosphate isomerase, type II Cupin
FT                   2, conserved barrel; KEGG: pmm:PMM1196 GDP-mannose
FT                   pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03160"
FT                   /db_xref="GOA:Q1AZL8"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZL8"
FT                   /protein_id="ABG03160.1"
FT                   /translation="MSEEMNSAGQGPPSVKVDKPWGKFEQYTHNLPCTVKIITVAPGGT
FT                   LSRQYHHKRDELWVVLDPGARVELDDQILHPEPEEKVFIPRQTVHRLSCEGERPVRILE
FT                   ISFGEFDEEDIVRLEDVYGRVGP"
FT   gene            complement(184447..185076)
FT                   /locus_tag="Rxyl_0183"
FT   CDS_pept        complement(184447..185076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03161"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZL7"
FT                   /protein_id="ABG03161.1"
FT                   /translation="MCAVMADFPSGRRISVRAAFSRLRDHIAVSRLESLARRALESYGL
FT                   SGRPGLALLRAGPGECLWLVEHGPGVGRYLLRMYLRPPSGERHVRSIVRWQRALRREAG
FT                   LPVPDPILTESGALLHPLPADRGSPGAFRRLAIKHRCGTYGKRENTTMRKPRSVSPFLL
FT                   ALLATASLTLGACAQPEDGSEEGEDESPGLAPGDGEREEGGEEDDD"
FT   gene            complement(185248..186081)
FT                   /locus_tag="Rxyl_0184"
FT   CDS_pept        complement(185248..186081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0184"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: Tyrosine protein kinase
FT                   Serine/threonine protein kinase; KEGG: ade:Adeh_2796
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03162"
FT                   /db_xref="GOA:Q1AZL6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZL6"
FT                   /protein_id="ABG03162.1"
FT                   /translation="MSLRAEGPPPLPAGSEAAPGYRVISHLHRSNHYDVYDVFSEERAC
FT                   RCVAKVPIPREGNGRAVRRLLREGTLLRRLAHPHIVRAYDVIREPRPAVILETLTGETL
FT                   SYLIDTAPRRLPLREVACLGIHLCSAVHYLHRHGILHLDLKPSNIVSERGFAKILDLSI
FT                   ARPPGRARRGGGTLQYMAPEQVRGGGLLGPATDVWGIGAVLFEALTGEMPFNREVEGEE
FT                   DPETYEQLERRAEPVRSHRRVPASLARLVERCLEPDPAQRPAALELMRGLEPFAG"
FT   gene            complement(186078..187913)
FT                   /locus_tag="Rxyl_0185"
FT   CDS_pept        complement(186078..187913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0185"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter, transmembrane region ABC
FT                   transporter related; SMART: ATPase; KEGG: sma:SAV3872
FT                   putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03163"
FT                   /db_xref="GOA:Q1AZL5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZL5"
FT                   /protein_id="ABG03163.1"
FT                   /translation="MGKTWRKRLRLGLGWLAGDMREGGGPVAAAPAMPLREILRRFWPH
FT                   ARPYRRWLVPLLLLAALGPAVETATIWMYKVLVDGVLIPGEFGLLPWVVLAYLGLTLLD
FT                   GAISFLDGYLSEWVGGRFILRLRTGLFRHLQTLSLDFFDRRKLGDTVARISDDVEEIEE
FT                   LLLSGAVSAVTYAFQLLFFVGALFYLEWRLALVSLLVAPLFWLVARRFSRRIKRAAREE
FT                   RRKAGSIGAVAEESLSNAALVQAYNRQEHEVARFHRENEEGFAAQMVAARLSALFSPLV
FT                   NLIELLGALTVVSFGAYLLSRGALTVGGLLAFLVYLGMLYRPIRGFSRLANSFFSAAAA
FT                   AERVAELLQMRPAVRGGALEPGRLRGEVRFREVTFRYPGAAEPALRGVSFEARPGEVVA
FT                   LAGPSGAGKSTVVRLLLRFYDPEGGSISIDGYELRELSLRALRENVAVVLQEAMIFDGT
FT                   VRENIAYGRPGATEREIREAARAADAHEFIERLPQGYDTVVGQKGRLLSGGQRQRIAIA
FT                   RAMLRDAPVLVLDEPAAGLDAGSQERIMKPLRRLMAGRTTIVISHDLLAVREATRIVVL
FT                   EGGRVAGSGTHAELLERGGLYAGLFRRQSPERGAV"
FT   gene            complement(188212..189642)
FT                   /locus_tag="Rxyl_0186"
FT   CDS_pept        complement(188212..189642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0186"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase-like histidine
FT                   kinase A-like; KEGG: gka:GK1689 two-component sensor
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03164"
FT                   /db_xref="GOA:Q1AZL4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZL4"
FT                   /protein_id="ABG03164.1"
FT                   /translation="MRWLRELREQSRYIIIAAVGWLLVAILVVGIVGLLENRNMKSVTD
FT                   RALRYDVELEDDADDLRAAILDLRHYHRNIYFGGPSRTQIENLEGAYRLVLSEISELER
FT                   LGVRDPDAPRPESLRRMAREYYADWRPAIDEYERTGNEDAFADASDLGVARLSRMEEAA
FT                   AELDKLGEQLSARSLQRVEAAATRARVVLLTVVGGLLVAGAGLAYAAVRMVGELRRLYA
FT                   EQRALARRLAELSRARTEFLADASHELRTPLTVLRGNAEVGLQLATEGEVREILQEIVG
FT                   EAGRMARMVEDMLFLARSEAASPPVEPRPVEAAPFLSSLADRAGALARERGARLEAGLS
FT                   AEGRLVLDRGRVEQAVLILVDNAAKYGRPGGRISLLARREAGELVIEVSDDGPGIPEEE
FT                   LPRIFERFYRVDKTRARRLGGAGLGLPIAKTIAEAHGGTLEARSRPGEGTTMTLRLPAA
FT                   PGELGAAPSLEASNPAHD"
FT   gene            189705..190388
FT                   /locus_tag="Rxyl_0187"
FT   CDS_pept        189705..190388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0187"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver transcriptional
FT                   regulatory protein-like; KEGG: gme:Gmet_3383 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03165"
FT                   /db_xref="GOA:Q1AZL3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZL3"
FT                   /protein_id="ABG03165.1"
FT                   /translation="MRVLIVEDEPGIVRMLERGLSAQGYSCLSAEDGETGLRMALEEDV
FT                   DVVLLDIMLPGLDGREVLRRLRLRRPGLPVLMLTARDEVETKVGSLDAGADDYLTKPFA
FT                   FEELLARIRALVRRADQPESTALRAGDLKLDLLSRRVWRAGRQVELSSREFALLEYLMR
FT                   HPRQVLSRQQILSAVWDYAFDPGSNVVDVYVRYLRRKLDRPGEPSLITTVRGAGYRFDP
FT                   PREEA"
FT   gene            190385..191527
FT                   /locus_tag="Rxyl_0188"
FT   CDS_pept        190385..191527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0188"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bcl:ABC0532 glycine/D-amino acid oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03166"
FT                   /db_xref="GOA:Q1AZL2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZL2"
FT                   /protein_id="ABG03166.1"
FT                   /translation="MSRVVVVGAGVVGASAAYHLARAGAEAVLVDGDLPGQATAAGAGI
FT                   VCPALRFGAPEAWRALAFPAVGRYPALVEALASDGEEDVGYAAVGALLVAADGREEAAL
FT                   GEALRSLEELRRAGVAGVGEVRSLSFGEPRELFPFLRDDVPGIYLSGAARVDGRRLRDA
FT                   LERAARRRGARSVRGAASLLLRGGRVRGVRVGGEEIPADAVVAAAGAWTGELCRPAGLR
FT                   VPVYPQRGQIAHLRVPGAQTSRLPIVEGFRTHYMLAFPGGRVVAGATREDGAGFDRRVT
FT                   AGGVHEVLSEALRLAPGLADATLAEVRVGFRPASPDGLPSLGEAVPGLVVATGLGPSGL
FT                   TIGPYAGGLAAELALGGRPALDLEPYAPDRRTTPVPGGGW"
FT   sig_peptide     190385..190456
FT                   /locus_tag="Rxyl_0188"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.855) with cleavage site probability 0.695 at
FT                   residue 24"
FT   gene            191530..192429
FT                   /locus_tag="Rxyl_0189"
FT   CDS_pept        191530..192429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0189"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: gsu:GSU2676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03167"
FT                   /db_xref="GOA:Q1AZL1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZL1"
FT                   /protein_id="ABG03167.1"
FT                   /translation="MPGARAVKRGGRPSARAGRLLILAGAVLWGTTGTAQAFAPPGADP
FT                   LSVGAVRIIVGGLALLAVAALRGELAGQRWPPLPVAVAACGIACYQPLFFAGVLETGVA
FT                   LGTIVAIGSAPVAAGAIGFVFRGERPGRRWAAATALAVLGCALLVGGGGGVSVEAGGIL
FT                   LALGAGFSYGVYATATKELLERLPYTAVMGVAFGLGALLLSPVLLFAAPGWLADPRGAA
FT                   VALELGLVATAAAYLLFARGLSAVPVSTAATLSLAEPLTAGLLGIAVLGERPGAASLAG
FT                   AALLLGGLALAAKGEEEG"
FT   sig_peptide     191530..191643
FT                   /locus_tag="Rxyl_0189"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.967) with cleavage site probability 0.958 at
FT                   residue 38"
FT   gene            complement(192426..192977)
FT                   /locus_tag="Rxyl_0190"
FT   CDS_pept        complement(192426..192977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03168"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZL0"
FT                   /protein_id="ABG03168.1"
FT                   /translation="MRAALITALLAPALLLAGFAVGWVMAGEGWELTRGEERREPSAPE
FT                   PPPATSPRLPARDVSGADIPGLPRYPGSVRVAYVREPQGELVWTEVEYLTEARLERVRE
FT                   FYRDAFRTKGWAVGDVGFSQGAWVYFVMDGEREVILELQPRGRLVEVDMEMTEPAPPAA
FT                   RQPAPPPGDDADDAGDDDED"
FT   sig_peptide     complement(192897..192977)
FT                   /locus_tag="Rxyl_0190"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.682 at
FT                   residue 27"
FT   gene            193158..193526
FT                   /locus_tag="Rxyl_0191"
FT   CDS_pept        193158..193526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0191"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: rba:RB9190 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03169"
FT                   /db_xref="GOA:Q1AZK9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZK9"
FT                   /protein_id="ABG03169.1"
FT                   /translation="MPRLEVEGAGVFEVEEGKRLVLAIEEDAGVDILHRCGSYAKCTTC
FT                   RVEFLEGEPEKMTKAELEVLKKRNLLGQVRLSCQALCDHDMKVRVLMTVSSTGLDGPGP
FT                   KPKPEITPEPEWVEKPGS"
FT   gene            193695..195083
FT                   /locus_tag="Rxyl_0192"
FT   CDS_pept        193695..195083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0192"
FT                   /product="glycine cleavage T protein (aminomethyl
FT                   transferase)"
FT                   /note="PFAM: glycine cleavage T protein (aminomethyl
FT                   transferase); KEGG: nar:Saro_2404 glycine cleavage T
FT                   protein (aminomethyl transferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03170"
FT                   /db_xref="GOA:Q1AZK8"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZK8"
FT                   /protein_id="ABG03170.1"
FT                   /translation="MGRRSEVGGSLEDAIGRAGSAVELLYNSRAGRRPFPVVPAEFSNW
FT                   RDEQRAWRESCALLDQSHHMTDLYVEGPDALRLLSELGVNSFEGFAKDKAKQFVACNPQ
FT                   GYVIGDVILYYLEENRLDLVGRPAVLNWVRYRAEIGGHDVAFEVDENSAVRRGAPPKVY
FT                   RYQVQGPEAAALMREVVEGELPEVRFFNTADVRIGGCRVRALRHGMAGRPGYELSGPWE
FT                   ERERVIGAILEAGENHGLRRAGSLAYSAANLESGWLPAPLPAIYTGEEMKPYRQWLPAD
FT                   GYEATTSLGGSFYSERIEDYYFTPYELGYGRFVKFDHDFVGREALEEMADAPQRRKVTL
FT                   VWEGEDVAGVFGSLFEREGLPAKYIDLPSSWYAMHQYDRVLGDGETVGISTYCGYSYNE
FT                   RAMLSLAVVEEEFCEPGTEVVLLWGEEPNSAKPQVEEHRQVEIRARVQPAPLVEFARTA
FT                   YRSS"
FT   gene            195115..196359
FT                   /locus_tag="Rxyl_0193"
FT   CDS_pept        195115..196359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0193"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bbr:BB1592 putative ABC transport system, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03171"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZK7"
FT                   /protein_id="ABG03171.1"
FT                   /translation="MGASDTMRGRIGRRDFLRLAGGGLAGTLLLGVAGCGGGGGGGQGG
FT                   GSGPIRIGALLTLSGPYATLGESIRNGMETFLRLNDNQIGGREVQVRYEDSEGDPQVAL
FT                   RVYRQLTGQNAVDFLMGPVISTEALALANRLQRDRIILINSNAAANDLSWEQKSDYSYR
FT                   VSQSNYQLGAAGAEYIFRNIGKTAFTIGMDYVAGYEVIEAFRIAYREAGGEVVGSAFSA
FT                   PGTADFATYLTNIRRAEPEVVFSFLSGTDAIRFLQQYDSFGLKGEIPLIGHDQLASPTV
FT                   TDPAGEAAVGVMACSFYYPNLENETNRRFVEAYRKEYDQPPDTIACQGYDTGNIMAKAV
FT                   EEAGSTEPDALIEVLKGISLQSPRGSFTMDPETHNPIQNYYIGENARDGVRIVDTIEDV
FT                   GMPSRPPEGYDPSGG"
FT   gene            196379..197248
FT                   /locus_tag="Rxyl_0194"
FT   CDS_pept        196379..197248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0194"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: bpa:BPP2196
FT                   putative ABC transport system, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03172"
FT                   /db_xref="GOA:Q1AZK6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZK6"
FT                   /protein_id="ABG03172.1"
FT                   /translation="MDLSALAVQVLAGLTYGMLLFMISVGLSVIFGLMGIVNLAHGVFF
FT                   VLGAYIAFSVLGGGAGFLIALVVAMVAMAVLGVLVERLLLFRSYGDELGQVLLTFGLAF
FT                   IIADVIKMIWGNRLQSLPTPSLLDFSVSVGGITFPVYRLVVVLVGCLLALLLWYLESRT
FT                   RIGAIIRAGVDDREMVAALGINVTLVFAGVFAFGAALAGLGGVLGGPVLGMYPDMGFEI
FT                   LVLSLIVVVLGGLGTWKGAFVGGVLVGLVEIFGQAYFPSLSLVIVFLLMAGVLLVRPAG
FT                   LFGRSPAS"
FT   gene            197245..198258
FT                   /locus_tag="Rxyl_0195"
FT   CDS_pept        197245..198258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0195"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: bbr:BB1594
FT                   putative ABC transport system, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03173"
FT                   /db_xref="GOA:Q1AZK5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZK5"
FT                   /protein_id="ABG03173.1"
FT                   /translation="MTRATGTRVPWPGVAALALLVLLLPLALPAFGVGIATEIYVMAIF
FT                   AMSLGLIIGYAGLVSLGHAAFFGAGAYTVALLGERVSNTYVLVAAAVAVAALLACVSGA
FT                   LFFRSTGAYFLMLTLAFAQVLFAAAFQAESVTGGSDGMGVSVAPDLGFGEISGELGLYY
FT                   LMGGSFLLCYVLLRLFVSSPAGRVVRGIMENELRMRALGYNTFSYKLFAYTLAGGVAGF
FT                   AGALYSYFNLYVTPDLLGWVFSGQALIMVIVGGTGTLLGPAVGAAFFIVVRNYVSFYTE
FT                   YWALIMGLIFIFFVLLGRGGIVHLLQAGWRRLLAARAPRRPREGRSAAGSAKERAP"
FT   sig_peptide     197245..197343
FT                   /locus_tag="Rxyl_0195"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.988 at
FT                   residue 33"
FT   gene            198255..199010
FT                   /locus_tag="Rxyl_0196"
FT   CDS_pept        198255..199010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0196"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   bbr:BB1595 putative ABC transport system, ATP-bidning
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03174"
FT                   /db_xref="GOA:Q1AZK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZK4"
FT                   /protein_id="ABG03174.1"
FT                   /translation="MSLLSVEGLGKSFDGLRVLRDVSFAVQPGQRHVIIGPNGAGKTTV
FT                   FKCIIGLLSADSGSITVDGRDVTGLPAHARVSLGMACTFQKTSLFWRLTVEENLHLALL
FT                   ARKPYRFRLWRPLPWHADLRREARELLEEWGLWSRRDHRVGELSYGEQRMLEIVLALAS
FT                   GPRILLLDEPTSGMSPAETARAASLIRELPRSVALLIIEHDMDVVFSVAEHITVLHHGE
FT                   VFLSGPPERVRGDERVREIYFSGGARPHA"
FT   gene            199003..199707
FT                   /locus_tag="Rxyl_0197"
FT   CDS_pept        199003..199707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0197"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   bja:blr1067 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03175"
FT                   /db_xref="GOA:Q1AZK3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZK3"
FT                   /protein_id="ABG03175.1"
FT                   /translation="MLELSEVHTYYGTSHILQGLSFSVPKRSCSVLLGRNGAGKTTTIH
FT                   SIAGLVSPRSGSIRFVGQEIAGERPHRIARMGIGLVPQGRRIFPSLTVEENLTVAGRGP
FT                   SGNGSSSWDLRRVYELFPALRERASNLGNQLSGGEQQMLAIGRALMTNPRLLLMDEPSE
FT                   GLAPAIIERVGETIRRLKESGLSILLVEQHVSLACSVADEVLVMNKGRIVWRGSPEALL
FT                   SDRPLQQRYLGV"
FT   gene            complement(199713..200498)
FT                   /locus_tag="Rxyl_0198"
FT   CDS_pept        complement(199713..200498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0198"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding
FT                   protein"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase, NAD-binding;
FT                   KEGG: mag:amb0253 3-hydroxyisobutyrate dehydrogenase and
FT                   related beta-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03176"
FT                   /db_xref="GOA:Q1AZK2"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015814"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZK2"
FT                   /protein_id="ABG03176.1"
FT                   /translation="MSGGGHLAVLGLGEAGSEISADLAARGRRVLGYDIRPVEPPEGVE
FT                   LAGSPEEAARGADAVLALVPAADAPAAARSVLPVLGPGSLYADCSSASPRQKRELARMV
FT                   GRTGASFVDLTLMGTVPGRGLSTPAFVSGEGAGRLADLLRPLGMPVEEVSGEPGDAAGR
FT                   KLLRSVFVKGMTGAMMEALEAARAAGCEGWLWGNIVSELAGADEALARRLVEGSYRHAR
FT                   RRADEMAAAAELLRGLGVEPRITRAAEARLRELLEGGEA"
FT   gene            complement(200495..201469)
FT                   /locus_tag="Rxyl_0199"
FT   CDS_pept        complement(200495..201469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0199"
FT                   /product="Catechol 2,3-dioxygenase"
FT                   /EC_number="1.13.11.2"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bja:blr3819 metapyrocatechase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03177"
FT                   /db_xref="GOA:Q1AZK1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR017624"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZK1"
FT                   /protein_id="ABG03177.1"
FT                   /translation="MRGGEPVRDVAHLGHVELLTPAFEESLWFFTEVLGMEEVGRRGES
FT                   AYLRAFGDYELSTLKLTAADRAGPGHIAWRATSRAALERRVAALEESGLGEGWVEGDLG
FT                   HGPAYRFADPDGHVMELYFETEKYRPPEGLRPALKNQPQKFTARGVGVRRIDHVNLRAL
FT                   DIDANSAFMRERLGFRLTEEVRLDDGRQGAAWMNVTQKSYDIAYGGIDAAGMGGRLHHV
FT                   AYALDSREYVLRAADIFAEEGVFIEAGPAKHAVQQTFFLYVYEPGGNRVEMISDIKLLL
FT                   DPDPETVTWSQAEREKGQAWRTIMPESFFTYATPLPEEAGRRG"
FT   gene            complement(201466..202092)
FT                   /locus_tag="Rxyl_0200"
FT   CDS_pept        complement(201466..202092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0200"
FT                   /product="Dimethylmenaquinone methyltransferase"
FT                   /note="PFAM: Dimethylmenaquinone methyltransferase; KEGG:
FT                   sme:SMc00502 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03178"
FT                   /db_xref="GOA:Q1AZK0"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZK0"
FT                   /protein_id="ABG03178.1"
FT                   /translation="MKGVCEELARLGVATVYEASGRRGLVDAPLVQVVPGSRAAGPART
FT                   VLCGQDDNLMVHAAMERVRPGEVLVITMPEPAPVALVGELLAVQAKARGAAGVLVDASV
FT                   RDLEELRELGLPVWARWVRVRGATKTEVGKLDAPVEVGGATISPGDVVVLDADGAAVVE
FT                   AGRAEEVLEAARAREEREARLRRRLEAGELSYDLHGLREVVEGGS"
FT   gene            complement(202089..202808)
FT                   /locus_tag="Rxyl_0201"
FT   CDS_pept        complement(202089..202808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yps:YPTB0079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03179"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZJ9"
FT                   /protein_id="ABG03179.1"
FT                   /translation="MAEGRTLLVVGAHSADFVWRAGGAAAINAAAGGRSVVLALSYGER
FT                   GESGELWKRPDQTVENVKRVRHAEAEKAAGALGAEFRCLDLGDYPLRVDEEALMHLVEI
FT                   IRELAPDVIVTHTPEDPFNPDHPTAYQAVRQARLLAAGAGVPSAFPSVRPPALYLFEPH
FT                   QPELCGFVPDTFLDITRVMERKKEAMEAMQAQRYLQQYYLQRAEQRANHARRVSGESGV
FT                   RYAEAFQRVLPRVVGSL"
FT   gene            complement(202808..203749)
FT                   /locus_tag="Rxyl_0202"
FT   CDS_pept        complement(202808..203749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mth:MTH1911 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03180"
FT                   /db_xref="InterPro:IPR016797"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZJ8"
FT                   /protein_id="ABG03180.1"
FT                   /translation="MCSGAGSSGASPSARARELVRGAYDHHVHLGPDVMQRRIDDLGLA
FT                   RRFRELGLSGFTLKSHYVPTAERASVVRAAEGVEVFGAIALNAAVGGMNALAVEIAARE
FT                   GARFVWMPTVSAANEAEILSRSDGGGRKLPFWARLQRELEEQGISTEPVRVVDGTGAVL
FT                   PETREVLRVVAAHDLVLATGHLSRDEIFAVVEAAREEGVRRIVITHPEFPSQDLSADDQ
FT                   ASLVEQGALLERCFAPAYGGKVSWEKMFENIRATGPENSFLSTDLGQPANPPVEDGIAL
FT                   MAERLLEAGFSEEEVRVMAVENTRRLAQGVLV"
FT   gene            complement(203836..204714)
FT                   /locus_tag="Rxyl_0203"
FT   CDS_pept        complement(203836..204714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0203"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG: pfo:Pfl_2856
FT                   polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03181"
FT                   /db_xref="GOA:Q1AZJ7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZJ7"
FT                   /protein_id="ABG03181.1"
FT                   /translation="MDPPQDTRAPSSSWGPDSRRAAISLTFDNLGEAADLERGLWPADR
FT                   PLGHHFSVRRVLPRLLDLLDETGLRATFFVEGLNARLYPEALLEISGRGHEVACHGWRH
FT                   EYWAGLSPAEEARLLERSARELEGLGLRPRGFRPPGGRLNPASLDLLRERGFTYCSPAG
FT                   SGAGTLEGLAVLPFGWRLIDAYHYLPRFGPLRRSDTGSDNPLPPSRLQEALDRALDETL
FT                   RRRGYLSLLFHPFLQEPEDRFRALRETLESLRHLAQEGAAWCAPCREIASWLRENPIPP
FT                   GNPLSLDATET"
FT   gene            204839..205720
FT                   /locus_tag="Rxyl_0204"
FT   CDS_pept        204839..205720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0204"
FT                   /product="5-carboxymethyl-2-hydroxymuconate
FT                   delta-isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   mag:amb2827 2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03182"
FT                   /db_xref="GOA:Q1AZJ6"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZJ6"
FT                   /protein_id="ABG03182.1"
FT                   /translation="MKLATYLDGRPRVGAVVDGGVVDLSGRFGSMLELIEGGGEALEEA
FT                   RAVAAGSGPAARLDEVRLLAPIPQPRRNVFCMGWNYLTHFEEGRGRREGQGEELPEYPT
FT                   FFDKPTTTVIGPHDDIPFDPNFSEKIDYEAELAVVIGRSGRSIPAGEAMDHVFGYTAAN
FT                   DVTARDVQRRHGGQWLKGKGMDGSCPLGPWIVTADEIPDVQNLQVQCRVNGVQKQNSNT
FT                   RFMVFPVARLIEELSLAMTLLPGDVLLTGTPEGVGYARTPPEFLRPGDEVTVYVEGVGE
FT                   ISNRVVEKNLTR"
FT   gene            205837..206664
FT                   /locus_tag="Rxyl_0205"
FT   CDS_pept        205837..206664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0205"
FT                   /product="intradiol ring-cleavage dioxygenase"
FT                   /note="PFAM: intradiol ring-cleavage dioxygenase Catechol
FT                   dioxygenase-like; KEGG: atc:AGR_C_4592 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03183"
FT                   /db_xref="GOA:Q1AZJ5"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZJ5"
FT                   /protein_id="ABG03183.1"
FT                   /translation="MVDSARVVRNERLARILPEALGALHEIIERHRITEREWLAVLDFL
FT                   TEVGRKDEFVLLSDVTRTSVLVDSITHEDGAATPSDVEGPLYRENPPWREKPVKIYEEY
FT                   EGIEEGDVLFVRGRVTSTDGTPLGGAILDVWQTGPTGGYDVWDERQPDYNFRGRFGVEE
FT                   DGSYEFQTMVPKPYTVPTDGPVGRLLEAIGQHPWRPAHIHFKVEAEGHETLTTQIFFPD
FT                   DPYLENDTIGAVKPELVRPLERHEDEEEISRRGLDGPFYTCDFDIKLKPAARG"
FT   gene            206674..208074
FT                   /locus_tag="Rxyl_0206"
FT   CDS_pept        206674..208074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0206"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase Amidohydrolase 3; KEGG:
FT                   reu:Reut_C6231 amidohydrolase:amidohydrolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03184"
FT                   /db_xref="GOA:Q1AZJ4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZJ4"
FT                   /protein_id="ABG03184.1"
FT                   /translation="MAERTLIRGGHVISMDPQIGDIPGGDVLIEGEEIAAVAPSIDASD
FT                   CEVVDASGAIVIPGFIDSHRHTWETVIRGIAPDVTLDGYFQLVLDTLAPAYRPEDVYAG
FT                   NLLGTLEAIDAGVTTLLDWSHINNTPEHADEAIRALAETGIRAVYCYGNPNTSLADWWF
FT                   NSTLKAPEDIRRVRERYFSSEEGLMTLAMGTRGPGFCTPEVVRHDWELARDIGVPISVH
FT                   VGMGPVAGRFRMVEQLHDLGLLGPDITYIHCNHLTDREFRLIAETGGTVSIAPMVEMTM
FT                   GHGMPPTGEVLAHGIRPSLSCDVVTSVPGDPFTQMRFLFAAERVRVHERVFEEELEEMP
FT                   PLLSSRDVLEFATIEGARTVGLADRTGSLIPGKKADVVMLSIERVNAAPVTDPVGTVVC
FT                   SMDSSNVDSVWVNGRALKRNGVLVDADLERARRLAEDSRDYLISRTGRQAHWATPRTTG
FT                   EAAPGAGL"
FT   gene            208090..209073
FT                   /locus_tag="Rxyl_0207"
FT   CDS_pept        208090..209073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0207"
FT                   /product="Alcohol dehydrogenase, zinc-binding protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding Alcohol
FT                   dehydrogenase GroES-like; KEGG: bja:blr2898 putative zinc
FT                   binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03185"
FT                   /db_xref="GOA:Q1AZJ3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZJ3"
FT                   /protein_id="ABG03185.1"
FT                   /translation="MRAVLLERFGEPSELGPAEVPRPKAREGEVLVEVRAAAVNRSDVL
FT                   NARGSFPATTLPRIPGRDFAGVVVEGPEELLGREVWGTGGGELGFTRDGTHAEYVALPA
FT                   GAAVPVPEGLSLEGAAASGLAYLAAAMGILELGELSAGEAVLVTGAAGGVGGAAAGISR
FT                   WKRASLVIGVVKDESERRAAERAGAGVVVDTSREEVPEAVMAATEGRGVDLVLDAVGGP
FT                   LFEPCLSSLAPQGRMVVLTTVGQRRVSFDLFDFYRKELRLLGLMTSRPGAAESGAVLRS
FT                   LLPGFEAGYLHAPAVAGRYPLEEAAEAYARVESGEAAGRVLLVMAP"
FT   gene            209161..209850
FT                   /locus_tag="Rxyl_0208"
FT   CDS_pept        209161..209850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0208"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH GntR-like; KEGG:
FT                   sma:SAV1619 putative GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03186"
FT                   /db_xref="GOA:Q1AZJ2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZJ2"
FT                   /protein_id="ABG03186.1"
FT                   /translation="MRPGKMRRMGRDEKRAGSLSDVAYEKLYGDITGGRLQPNERLIEL
FT                   DIARELGVSRAAVRNALIRLEQEGLVKREPNRGARVRLVSEEEAVEILEARMALECVAV
FT                   RHAALNRTQEDIAGLREILSQMESRLEAGDLLGASDLNGQFHRRLVEISNHATISKLLK
FT                   MLNSQLIRFQYRTILTPGRPASSLAEHRAIFEAVEAGDPERAEQAMRRHLSGVTEALRR
FT                   AAAQEAR"
FT   gene            209961..211313
FT                   /locus_tag="Rxyl_0209"
FT   CDS_pept        209961..211313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0209"
FT                   /product="glycine cleavage T protein (aminomethyl
FT                   transferase)"
FT                   /note="PFAM: glycine cleavage T protein (aminomethyl
FT                   transferase); KEGG: nar:Saro_2861
FT                   vanillate/3-O-methylgallate O-demethylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03187"
FT                   /db_xref="GOA:Q1AZJ1"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZJ1"
FT                   /protein_id="ABG03187.1"
FT                   /translation="MSLEEAVGRAGGPVELLRNARAAPYTFPVTPEFSNWRDEQRAWRE
FT                   SCALLDQSHHMTDLYVEGPDALRLLSELGVNSFEGFAKDKAKQFVACNPRGYVIGDVIL
FT                   YYLEENRLDLVGHPMVLDWVQYHAETGGYGVSLERDENSAVRRGAPPKVYRYQVQGPEA
FT                   AALMREVVEGELPEVRFFNTADVRIGGCRVRALRHGMAGRPGYELSGPWEERERVIGAI
FT                   LEAGENHGLRRAGSLAYSAANLESGWLPAPLPAIYTGEEMKPYRQWLPARRAGSLGGSF
FT                   YSERIEDYYFTPYELGYGHMVKFDHDFVGREALEEMADAPQRRKVTLVWEGEDVAGVFG
FT                   SLFEREGLPAKYIDLPKSRYALFHYDRVEKDGRVVGVSTDCGYSYNERAMLSLAVVEEE
FT                   FCEPGTEVVLLWGEEPNSAKPQVEEHRQVEIRARVQPAPLVEFARTAYRAG"
FT   gene            211342..211923
FT                   /locus_tag="Rxyl_0210"
FT   CDS_pept        211342..211923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa21490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZJ0"
FT                   /protein_id="ABG03188.1"
FT                   /translation="MNRFEEQIYRCMEPVAELLEVTRDPHHRAILENYRLHVHLEGSGQ
FT                   YERIVAPDMMVEDPVYRINWGEPTVIRGREGVLDFYRSAGRYVMWNSEDRIAVADWGLC
FT                   DELTFNFLVTGEILGEFGVEVDDKEAYYHFKTRQAFVWPYDERARLIGEHLYVDETSAV
FT                   VTRVDESEVITPERAAEIHGELLERLEGGR"
FT   gene            complement(211945..212910)
FT                   /locus_tag="Rxyl_0211"
FT   CDS_pept        complement(211945..212910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0211"
FT                   /product="luciferase-like protein"
FT                   /note="PFAM: luciferase-like; KEGG: nfa:nfa43060
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03189"
FT                   /db_xref="GOA:Q1AZI9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019952"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZI9"
FT                   /protein_id="ABG03189.1"
FT                   /translation="MAVKFGVFVPQGWRMDLTEIEDPAEQYEAMTRVARRADELDGYDS
FT                   IWVYDHFHTVPEPTRNTTFECWTITAGLARDTRRVKVGQMVTCNGYRNPALLAKMASTV
FT                   DVMSHGRLLFGLGAGWYEHEWRAYGYGFPDVPVRMRMFREACEIVHRMWTEDGAVFEGE
FT                   HYRIDRPINEPKGLQKPHPPFWIGGGGERVTLRLVARWGDACNVFGDPDTLRHKFGVLR
FT                   RHCEEVGRDYEEITRSTSVNVHLLEEGEDPEKATRRARGGRSYEEYAEQFRVGTPRQIV
FT                   SLLEERAEAGVEYFIVYLPRVAYDHTQLERFAEEVIPALS"
FT   gene            complement(212981..213508)
FT                   /locus_tag="Rxyl_0212"
FT   CDS_pept        complement(212981..213508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0212"
FT                   /product="ATP:cob(I)alamin adenosyltransferase"
FT                   /note="TIGRFAM: ATP; PFAM: regulatory protein GntR, HTH
FT                   cobalamin adenosyltransferase; KEGG: bur:Bcep18194_A3822
FT                   cobalamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03190"
FT                   /db_xref="GOA:Q1AZI8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZI8"
FT                   /protein_id="ABG03190.1"
FT                   /translation="MAESKPPVSTRRGDDGTTTLLGSGRLRKDDLRIAVLGEVDEASSF
FT                   LGLARAEAGEGELGDVILDTQRLLYRIMGDVAMPKEPNTVGEDDLRRVEERLEEWRSRT
FT                   ELPREFVVPGESRLGALLDVARSVVRRAERALVAAGYVEAHPQAVRAVNRLSDLLYILA
FT                   RAADGRSTPSRG"
FT   gene            213621..214961
FT                   /locus_tag="Rxyl_0213"
FT   CDS_pept        213621..214961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0213"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: extracellular solute-binding protein, family 1; KEGG:
FT                   bha:BH1244 putative multiple sugar transport system
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03191"
FT                   /db_xref="GOA:Q1AZI7"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZI7"
FT                   /protein_id="ABG03191.1"
FT                   /translation="MRRREEGGSLVRGRALFSRREFLRLGGAGVAGAALLGVAGCGGGG
FT                   EQGGPVQLVFSHGPEQSGVLREQLDAFNRRHEGEIRVEWREMPAQTEQYFDRLRTQFQA
FT                   GGGDIDTISGDVIWPAQFAANGWIVDLSDRFPESEREKFLDGPINSNVYEGAIYGVPWF
FT                   TDAGMLYYRKDLLQKSGYSEPPRTWDELKEMALRVKQDSGTKFGFVFQGANYEGGVVNG
FT                   LEYIWTHGGDVLDPEDPTKVIIDSPESVAGLKTERSMVEEGVAPEAVVNYAEMESHTAF
FT                   LNGDAVFMRNWPYVFGLFGQFPVKPEQVDVAPLPVDREGRQSTSSLGGWNLFINAASED
FT                   EADAAWTLIEYLAAPEQQKQRALEGGYLPTLEELYEDQEILDKVPVIALGKEAIRNTRP
FT                   RPVSPYYSDMSLRMAEQFNASLKGEVSPEEAVGTLREELQNIVEQGS"
FT   gene            215006..215704
FT                   /locus_tag="Rxyl_0214"
FT   CDS_pept        215006..215704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0214"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sat:SYN_02355 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03192"
FT                   /db_xref="GOA:Q1AZI6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZI6"
FT                   /protein_id="ABG03192.1"
FT                   /translation="MAGKTTSPPEVRPLVAGELRVAAGLHGRGLPHEFLSRLGRRFLER
FT                   YYRAFAESPHAAALAAADPGSGRVCGVLIGAFDVRAHYAFVIRRHGAALAAAVAFAALR
FT                   DPRLLYLLVRTRLVRYLRGVLRSLAYGRAPLPGEREARRVGLLASVVVEEGFRGAGLGR
FT                   ALVAEFERRAWERGVEGLELVTLPDGRGAGPFYERLGWEPAGERVSRSGERYALYVRWP
FT                   GGGPRRRAVG"
FT   gene            215719..217260
FT                   /locus_tag="Rxyl_0215"
FT   CDS_pept        215719..217260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0215"
FT                   /product="Vesicle-fusing ATPase"
FT                   /EC_number="3.6.4.6"
FT                   /note="KEGG: afu:AF1297 cell division control protein 48,
FT                   AAA family (cdc48-1); PFAM: AAA ATPase, central region;
FT                   SMART: ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03193"
FT                   /db_xref="GOA:Q1AZI5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZI5"
FT                   /protein_id="ABG03193.1"
FT                   /translation="MELQVRFPLGASGPLGCASEIAARHPSYRVEGGGDGARVSVRLEL
FT                   PGDWRLLDDFSTLLRGEEVSYAADGTPVPGEELLRGLRCFLRKQRSGKTAREWCTPASL
FT                   GDRQLFPCRQIRVYDNDHLTPNSWYAFGSVGGDGAFRVDKEALTERVLEDLGPCVRCPL
FT                   LDLEAVAETVAALPDRIDPAREAGWRYREGGGGWKVTKAGAAGPSPEEAAAEESRREGL
FT                   LERLARSVRGGGVPVVGGPVGSRNVPDTGYGDVGGMDETIALVREAVELPITHPEIFQR
FT                   LGIRPHKGILFHGPPGTGKTLLARAVARESGAHFIAVSGPEILNKYWGQSEARLRGIFA
FT                   EARAKAPSIILFDEIDSFASARDAMSESFEATLVSQLLSLMDGLNSLGRVCVIATTNRP
FT                   EALDPALRRPGRFDHEIEIGLPDAGARLHILQIHTRRMPTDPDLDLEQIARLTGGYSGA
FT                   DLEALCREAALACMRRTLNLRDFERRITPRQLAALSVTTYDFRTAMKRVGASIRR"
FT   gene            217457..218635
FT                   /locus_tag="Rxyl_0216"
FT   CDS_pept        217457..218635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0216"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcz:BCZK2672 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03194"
FT                   /db_xref="GOA:Q1AZI4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR025559"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR041380"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZI4"
FT                   /protein_id="ABG03194.1"
FT                   /translation="MELRRGREGDRAALARLGALSFGNEVSSWEEYYDPRRNPRLDPDG
FT                   VYVVEEDGAVRATATVLPLEAYVEGRAVEMGGVAAVNTHPAYRRRGYAGALMRLVLARM
FT                   REEGVHLSALWPFAHAFYRAYGWELAGESLSYRLGPAELPASPEQRRVREYRGEDLPRA
FT                   MELYAEEMARHPLAVARSEAHWRAWLRREKNAAAVYEREGRVEGYLLYEMTPWREDREP
FT                   HRTLRVHELVARTPEAREGLLSLLAAQDPLVFGVRLNTPRGEPLHPHLDSSYVRVEVEP
FT                   EFMLRLVDVEGALGLLDLAADPPLVLEVADDGIPENTGAYTVGEGGLARGEEAEARVSL
FT                   DVRQLAQLYAGYLPARELARHGRVRASSPAALELLDALFPPRDPYVSPPDRF"
FT   gene            218740..219744
FT                   /locus_tag="Rxyl_0217"
FT   CDS_pept        218740..219744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0217"
FT                   /product="luciferase-like protein"
FT                   /note="PFAM: luciferase-like; KEGG: sme:SMb20100 putative
FT                   dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03195"
FT                   /db_xref="GOA:Q1AZI3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZI3"
FT                   /protein_id="ABG03195.1"
FT                   /translation="MKITGTVGYAAMFEQFHPTDLLRWSRLAEENGFASVMASDHFHPW
FT                   TPEQGQSAFVWSWLGALGATTSLRFGTGVTPPGFRYHPAVIAQAAATLEAMYPGRFWLG
FT                   LGAGEALNEHIVGRYWPEAPTRLRILMESIEVIRRLFTGKKVKYQGEHVTLESARLYTL
FT                   PETPPPIYVATAGPIQSKRTGKYCDGIITVGASDEKIGMLMERFEEGAREAGKDPSQMP
FT                   RIVQLHVSWAESREEAEENALKEWPNGGMPFPKGDIRNPEDFQAMARFVRPEDFENRVL
FT                   ISADLDEHLEHVQHYIDLGFDEVYVHNVGRNQEEFIRAYGERVIPKLRWPEEG"
FT   gene            219746..220690
FT                   /locus_tag="Rxyl_0218"
FT   CDS_pept        219746..220690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0218"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: bcl:ABC3060 drug/metabolite
FT                   transporter (DMT) superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03196"
FT                   /db_xref="GOA:Q1AZI2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZI2"
FT                   /protein_id="ABG03196.1"
FT                   /translation="MAWRKGGFFGVLLVALGASLWGTDGVLRVPLLEDMSPLSIVFAEH
FT                   LFLAAYSVPAVVIGRRAFRGFGLPQWGALLVIGWGGSALATLLFTAAFAVGNPTVVILL
FT                   QKTQPLFAIALSALLLREPLGWRYWPGFAVAMVGAYLVSFADLSPFRQLPGAEALTAAL
FT                   ALGAALLWGSSTVLGRLVLREVPFHTLTGARLLLALPLLAGIVLAQGTLGQAAQGLAGH
FT                   PGRLALLALLPGLLALLLYYRGLSSTRASYATLAELTFPATAVVLNWAVLGVGIGASQL
FT                   AGFLLLWGAVLYLSHLNARSPSPEGPALEPGRG"
FT   sig_peptide     219746..219814
FT                   /locus_tag="Rxyl_0218"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.936) with cleavage site probability 0.808 at
FT                   residue 23"
FT   gene            221052..222455
FT                   /locus_tag="Rxyl_0219"
FT   CDS_pept        221052..222455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0219"
FT                   /product="dihydropyrimidinase"
FT                   /EC_number="3.5.2.2"
FT                   /note="KEGG: gka:GK1423 dihydropyrimidinase; TIGRFAM:
FT                   D-hydantoinase; PFAM: amidohydrolase Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03197"
FT                   /db_xref="GOA:Q1AZI1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZI1"
FT                   /protein_id="ABG03197.1"
FT                   /translation="MGRLLFTGGTVVTAEGSYRADVLVEDEKVVAVGADLPADGAEEVD
FT                   ARGRLVMPGFIDGHTHMDMPFGGTVTADDWASGTAAALAGGTTTIVDFALQDVEGTLGG
FT                   AVEEWGRKAEGKALVDYGFHVAITNLTEETKAEIPSLKDRGVSSVKIFMAYKGTPLYTA
FT                   DEDLFEAMQIAREAGILVMVHAENGDVIARLQRQALERGDVAPRFHALTRPEEVEAEAT
FT                   NRAIQLAEVAGCPLLVVHVSCAAALEEIHRAHELGQTVYAETCPQYLALSYDDLCREGF
FT                   EGAKYVCSPPLRDAWNQEPLWRGLQIGDLQIFGSDHCSFNYRGQKELGRDDFTKIPNGL
FT                   PGVEERAMVLWTLGVREGKIDENTFVAVLATNQARIHGMYPRKGTLAPGADADIVLWDP
FT                   DLEITATVENRHGNVDYTPYQGMVFRGGPAAVYVRGRLAYRDGEVLAEHGSGRYVERAF
FT                   VPPSARVLA"
FT   gene            222452..223762
FT                   /locus_tag="Rxyl_0220"
FT   CDS_pept        222452..223762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0220"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III; KEGG: sma:SAV1952
FT                   putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03198"
FT                   /db_xref="GOA:Q1AZI0"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZI0"
FT                   /protein_id="ABG03198.1"
FT                   /translation="MRPGELHERHRAALPAWLSLYYERPIELVRGEGFRVWDSEGNEYL
FT                   DFFGGIVTTISGHAVPEIVEAVKEQAERILHSSTLYLIESQVRLAEKLISLSPISGEQK
FT                   VFFVGSGSEANEAALLFATQYRGSSEVIALRGSYHGGSFGTMGITGQSSWRPTPRTALD
FT                   VSYAMPPHRSYSPLYGRFGDPEELARACAEDVRSLIETSTTGRVAAFIAEPIQGVGGFI
FT                   ELPPAYLSRVKEILEEHGVLFVSDEVQTAFGRTGSHFWGIERSGVEPDLITMAKGLGNG
FT                   LAIGAVMGRAEVIDSLSPKLHISTFGGNPVSTAGALANLEYILENDLQRNAEEVGSYLK
FT                   ERLLGLAAEHASVGEVRGRGLMLAVELVREGAPDPQAAAAFMEACRERGVLVGKGGLKG
FT                   NAIRISPPLTVTREAAEEAARVFDEALSSVEAGERVV"
FT   gene            223765..225018
FT                   /locus_tag="Rxyl_0221"
FT   CDS_pept        223765..225018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0221"
FT                   /product="Amidase, hydantoinase/carbamoylase"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: sai:Saci_2132 N-carbamoyl-L-amino acid
FT                   amidohydrolase; TIGRFAM: Amidase,
FT                   hydantoinase/carbamoylase; PFAM: peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03199"
FT                   /db_xref="GOA:Q1AZH9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZH9"
FT                   /protein_id="ABG03199.1"
FT                   /translation="MRQTHGAVDPRRVIAELRELHRLTGGPEGAQRVAWTRTWREAREW
FT                   LEGKLEEIEGVTEIETDEAGNLWATAPGDSERAVLLGGHIDSVPNGGWLDGCLNTLAAV
FT                   EVLRALAPRRRPVTLRLVDWADEEGARFGRSLLGSSACSGSLDPEEVRGLRDRDGVALP
FT                   DALKENGVELDRMKESHRQLESAAAYLELHIEQGPVLERLGLPLGVVLGTFGVERHAVR
FT                   FAGQHAHSGSTPMDARRDAFIAAARAAVEFRDDARRRDDVRATTGFVNVSPGIVTAFNG
FT                   FCEMSLDQRALDAGVLADMLAKAKEASERVAAEEGVSVGWERLWQIEPRPFHPELIELA
FT                   DEAVREVAGSSHRLPSGPLHDAAEMAPLMPTVMLFVKSLRGLSHTKEEDTPEEDIELSV
FT                   RALYRLAEKTLGWAEQRG"
FT   gene            225063..226592
FT                   /locus_tag="Rxyl_0222"
FT   CDS_pept        225063..226592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0222"
FT                   /product="NCS1 nucleoside transporter family"
FT                   /note="TIGRFAM: NCS1 nucleoside transporter family; PFAM:
FT                   permease for cytosine/purines, uracil, thiamine, allantoin;
FT                   KEGG: sco:SCO6417 putative integral membrane transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03200"
FT                   /db_xref="GOA:Q1AZH8"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZH8"
FT                   /protein_id="ABG03200.1"
FT                   /translation="MERDEYRDLAVNDPARLAAIKAEARVSPLYNDDLAPTGPEDRTWT
FT                   TYNIAALWIGMSIVITTYTLASGLMTAGMNWWQALLTISLGNVIVLIPMLLNAHAGTRY
FT                   GIPFPVFVRASFGVRGANFAAIARALVACGWFGIQTWIGGLALDALISAAWPGWAGVAH
FT                   HQFITFFVFWGVQVAIILRGIEGVKILESLAAPLLLAGGFALLVWGFVAGGGVGSVFAR
FT                   SAELQAGQASFWALFPSALAANVGYWITLSLNIPDFTRYAKSQRSQVLGQVIGLPLTMT
FT                   AFSFIGIAVTAATVVVYGEPIWDPVALVSRLAGDLPALLILAMIIIVIAQISTNMAANV
FT                   VSPSFDFSNLAPRYVSFRTGGIITAIIGIISFPWLLYQSAGAYIFTWLVGYGSLLGAIG
FT                   AVMIVDYWIVRRRRLSLPDLYKTDGRYAYSGGWNWRAIAAVAIGVVPVLPGFLKAATTP
FT                   NFAGVFENPTFIESLYNYGLFFTFAVAGLAYLLLSLIPSRAPEVAEEPEAT"
FT   gene            226592..227617
FT                   /locus_tag="Rxyl_0223"
FT   CDS_pept        226592..227617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0223"
FT                   /product="methylenetetrahydromethanopterin reductase"
FT                   /EC_number="1.5.99.11"
FT                   /note="PFAM: luciferase-like; KEGG: sma:SAV1948 putative
FT                   N5,N10-methylene-tetrahydromethanopterin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03201"
FT                   /db_xref="GOA:Q1AZH7"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR022315"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZH7"
FT                   /protein_id="ABG03201.1"
FT                   /translation="MEFGVTFQTDPPAWRVVELTKRAEELGFACAWTFDSHILWQEPYV
FT                   IHSQMLSATERIMVGPFVTNPATRDPSVTASVFATLNEMFGNRTICGIGRGDSAQRVLG
FT                   RKPATLGQVERAMHVIKELAEGREVDYGGTRVRIPWVRGGRLEVWMAGYGPKALSLAGR
FT                   RADGFILQLADPVILEWTASRVREAAAAAGRDPEGLKICVAAPAYVGGDLAHQREQCRW
FT                   FGGMVGNHVADLVARYGEGSEIPTALTDYIKARREYDYSHHGKAGNPTTDFVPDDIVDR
FT                   FCVLGDARDHIVKLRALEKLGVDQFNVYLMHDAMEETLEAYGREIIPALTGAASTPEEG
FT                   P"
FT   gene            227620..228906
FT                   /locus_tag="Rxyl_0224"
FT   CDS_pept        227620..228906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0224"
FT                   /product="N-isopropylammelide isopropylaminohydrolase"
FT                   /EC_number="3.5.99.4"
FT                   /note="PFAM: amidohydrolase Amidohydrolase 3; KEGG:
FT                   bcl:ABC4032 cytosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03202"
FT                   /db_xref="GOA:Q1AZH6"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZH6"
FT                   /protein_id="ABG03202.1"
FT                   /translation="MPGGAYDLVLRGARLGEETVDVGVAGGRIARISPRLEGRAGREIE
FT                   AGGRLLSPPFVESHVHLDTALTAGQPRWNESGTLFEGIRIWSERKGSVTREDVIERATR
FT                   LLRWQAAQGVLHVRTHADVTDPELTGLKALLEVRERVRDWVEVQVVAFPQEGMISYPRG
FT                   AELVEEALRLGADVVGGIPHYEHTREMGVESVREAFRLAGKHDRPVDIHCDETDDPHSR
FT                   FLEVMAAEAVRTGMGERVTASHTTAFGSYDNAYAFKLMGLLGRAGMNFVANPLVNITLQ
FT                   GRYDAYPKRRGITRVKELWRGGLNVSLGYDDVMDPWYPLGTGGMLQPAHMAVHACHMTS
FT                   PEEVVACYEMVTTNAARTLGLEGYGLAEGSRADFVLVDAPDRWDAVRRLAPVVLVVKGG
FT                   EVIAETRPSETRLLGEPVDFWRRGKGVGP"
FT   gene            228998..230713
FT                   /locus_tag="Rxyl_0225"
FT   CDS_pept        228998..230713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0225"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   mta:Moth_0707 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03203"
FT                   /db_xref="GOA:Q1AZH5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZH5"
FT                   /protein_id="ABG03203.1"
FT                   /translation="MQYPLCGMEPAVSIEGLGYRYRGRERPALRGVDLEVAGGEFVVVM
FT                   GHSGAGKSTLCAALNGLVPRFFRGSMEGEVRIRGRPTRGRRVGELAREVGLVFQDFEAQ
FT                   LFSTNVELEVAFGLENFAVEREKMRERVREALRMVRLEGFERRQPATLSGGQKQRLAIA
FT                   SVLAMEPPILCLDEPTTDLDPAGKQEIFEITGELRKREDMTLIVVEHETEETLDADRIV
FT                   VLREGEILADRPARELLRDVKLLEGARVMPLQVPRFFGGRGLGREELPLTPSEGVQEFR
FT                   RRGWRIDPRRHDELLEEDRARERGYGEPLIEAEGLAHRYPNGVAALEGVDLTVRRGEFL
FT                   AVLGQNGSGKTTLVKHFNGLLEPSEGSVRVGGEDTREQGLLGLGQRVGYVFQNPDHQIF
FT                   SDTVFDEVAFGPRIRGLGDGEVRERVEEALAAVGLEGFEEEDPFGLTKGERQRVAVASV
FT                   LSVRPEVLILDEPTTGLDYAEQRSMMELVRRLNEAGSTIIVVTHAMWVVAEYAHRAVVM
FT                   RDGRPVLSGSVREVFARERELRAAALRPPHIVSMSNALGHTALSVEELSRITEG"
FT   gene            230710..231498
FT                   /locus_tag="Rxyl_0226"
FT   CDS_pept        230710..231498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0226"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: mta:Moth_0708
FT                   cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03204"
FT                   /db_xref="GOA:Q1AZH4"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZH4"
FT                   /protein_id="ABG03204.1"
FT                   /translation="MSRMDPYLYLDRDTPVHRLDPRAKMFLLLGAFVLAFLFPDPLYGL
FT                   GVLGLVLCFGHAARSLANLRRIWFILAMIAVMTVLLWSVFGGGRTPLLWFVELEPVLYG
FT                   LGTALRIDNTIIAGMIFLSTTRNEEIATGLVRLGIPYRFAFAVSTALRLVPTIIATGST
FT                   IGQAQRSRGLDLDSGGVIQRVRKRIPLLVPVFVSTIRSTSVFSMALESKGFGVAPRRTY
FT                   FLQLSVRRGDVVAMAVMAVLVAGAVALRLAGYGGVEGFSR"
FT   gene            231513..232361
FT                   /locus_tag="Rxyl_0227"
FT   CDS_pept        231513..232361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0227"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_0709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03205"
FT                   /db_xref="GOA:Q1AZH3"
FT                   /db_xref="InterPro:IPR010387"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZH3"
FT                   /protein_id="ABG03205.1"
FT                   /translation="MREVFTMWRHTQMVVLVALTAAIYAATLIPTQFLPIIPGFTNVRP
FT                   ANVFPFVFGLLFGPAGAWGAAVGNLINDFFGTLGLGSIGGFVGNFFLGFLPYKMWSSFF
FT                   RRGEDIEPNLASRKKLVVFLAIVVLASAVCAVWIAWWNDLLGFVPFAALAAVITVNNAL
FT                   AGLVLGPIFMVLLYPRIRRWGLLWTEIMEPEEVSASRLRLLGNVLMWVGGLGGLIVGFA
FT                   IGLGLYEQGFAAAGFAAGGAGGLGIGLGLLPFLALIVVASFLLGGREQVEAARRAPRRV
FT                   R"
FT   sig_peptide     231513..231590
FT                   /locus_tag="Rxyl_0227"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.798) with cleavage site probability 0.758 at
FT                   residue 26"
FT   gene            232375..233643
FT                   /locus_tag="Rxyl_0228"
FT   CDS_pept        232375..233643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0228"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="PFAM: S-adenosyl-L-homocysteine hydrolase D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD-binding; KEGG:
FT                   sth:STH1697 S-adenosyl-L-homocysteine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03206"
FT                   /db_xref="GOA:Q1AZH2"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZH2"
FT                   /protein_id="ABG03206.1"
FT                   /translation="MRGENSVVKDPALAPEGHRKIEWAAAHSPVLAAVRERYLKDGTFD
FT                   GLGVGVALPVEAKTAYLAAVLAEAGARVAVAAPLPSVVQDDVAAALAERGVAVFATSEG
FT                   APEDADRWMELALEAATAGGEAVLIDDRAGLTRIAHTTRRGLLPRLRGASEETTSGVVR
FT                   LRAMEREGVLELPAIAANDARCKYLFDNRYGTGQSTLAALMQSTNLMLGGKRVVVLGYG
FT                   WCGKGIARYAAGLGARVTVCEVDPVRGLEAYADGFDVLPALRAAEVGEVFVTATGNRRV
FT                   LGEEHFARMRDGALLANAGGVDVEIDVGWLRSAAARVREARRHVEEFVMPDGRRLRLVG
FT                   GGMVVNLTAGDGHPVEIMDLTFAIQALCAYRLAREHAAMRPGVHLLPREIDDEVARLKL
FT                   GAVGMGVDALTEEQRRFLAGWRE"
FT   gene            233750..234748
FT                   /locus_tag="Rxyl_0229"
FT   CDS_pept        233750..234748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0229"
FT                   /product="thioredoxin reductase"
FT                   /note="TIGRFAM: thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase HI0933-like
FT                   protein; KEGG: mpa:MAP4339 thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03207"
FT                   /db_xref="GOA:Q1AZH1"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZH1"
FT                   /protein_id="ABG03207.1"
FT                   /translation="MSEQYDVVVVGSGPAGYTAALYAARANLRTLVFQGFEAGGQLMLT
FT                   TDVENYPGYPEGVTGPEMMEDFERQAARFGAEMRPDNVDRVDFSGRPFRLWAEGQEEPV
FT                   LARAVIVATGAKARWLGLPGEQRLMGRGVSGCATCDGFFFKDKRVAVVGGGDTAMEEAL
FT                   FLSRYASEVVIIHRRDEFRASKIMLGRARKNPKISFITDTVVTDVLGEDAVEGLSLRNV
FT                   KTGEESTLEVEGFFVAIGHDPATEIFRGQLEMDEGGYLLQKEHTMTSVPGVFAAGDVAD
FT                   RRYRQAVTAAGDGCRAAIDAERWLEEQGEAQEAEDPGVWTAGKDRSPAGSG"
FT   gene            complement(235008..236717)
FT                   /locus_tag="Rxyl_0230"
FT   CDS_pept        complement(235008..236717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0230"
FT                   /product="PHP-like protein"
FT                   /note="PFAM: PHP-like; SMART: DNA polymerase X
FT                   Phosphoesterase PHP-like Helix-hairpin-helix DNA-binding,
FT                   class 1; KEGG: mca:MCA1213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03208"
FT                   /db_xref="GOA:Q1AZH0"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR022311"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZH0"
FT                   /protein_id="ABG03208.1"
FT                   /translation="MQNADIARALETIATLLEIRGEEHYRVLAYQRAAESVAASGRPVA
FT                   ELDDPRSLPHVGGTTARVIKDLAQNRTPEILAELSAEIPAGLVELTRLPGVGPRTAGRL
FT                   WRELGVTSVEEVAALGEGSIAALRGFGKKSEESILRAARAHGARERRMLLDEATAFGER
FT                   LLEFVRSHPAAERAEIAGSLRRQKETVGDLDIVAASDDPKALTDAFAAAPFVEEVASHG
FT                   PTGASVVCAGGVEADLRVVSPEAFGSLLHHFTGSQAHNVALRERAVKRGLRISEYGLAG
FT                   AGSDRYEPLRTEEELYARLGLPYIPPELREDTGEIEAAERGELPDPVGVEDIRGDLHVH
FT                   TSYSDGKGTIESMAEAAIALGYEYLVFCDHSQSLRVANGLSPARLAEKMEAVRRADERY
FT                   PEIHLLCGAEVDILRDGSLDYEDAVLAELDFVVASVHTAFRMDEGSMTDRIVRAMHNPH
FT                   VRTIGHPTGRLLNRRDPYAVDVSRLIREAAATNTALELNAYPDRLDLSVPHAREAARAG
FT                   VRLTIDTDAHDERALSFMRFGVSQARRAWVEKESVINCLPWPEFERYLRRGK"
FT   gene            236802..237518
FT                   /locus_tag="Rxyl_0231"
FT   CDS_pept        236802..237518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0231"
FT                   /product="phosphoesterase, PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related; KEGG:
FT                   sat:SYN_02354 phosphatidylglycerophosphatase B -like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03209"
FT                   /db_xref="GOA:Q1AZG9"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZG9"
FT                   /protein_id="ABG03209.1"
FT                   /translation="MLGKLREALPGSSSALFGRMTLAAAVWLAAGLGLSAFVIWAFAGI
FT                   AEEVVEGDTRRFDRAVLLWIHTHFPGWLEGPMRAVTALGYYRVVVPLLAVCVAVFFLKG
FT                   WRLSAVLLAVSTAGGMFLTTVLKAVFQRARPELFQSGYEAGFYSFPSGHATVAVGFYGM
FT                   LTLILAYRARGALRWLVAALGAALVVLIGFSRLYLGVHYPTDVLAGYLSAPLWVVCVGI
FT                   LYVVWLSVRGLRGKGG"
FT   sig_peptide     236802..236873
FT                   /locus_tag="Rxyl_0231"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.976) with cleavage site probability 0.694 at
FT                   residue 24"
FT   gene            237571..238944
FT                   /locus_tag="Rxyl_0232"
FT   CDS_pept        237571..238944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0232"
FT                   /product="phosphoesterase, PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related; KEGG:
FT                   pca:Pcar_1019 uncharacterized membrane-associated
FT                   protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03210"
FT                   /db_xref="GOA:Q1AZG8"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZG8"
FT                   /protein_id="ABG03210.1"
FT                   /translation="MVFLGVMAESAGVPLPGETILLAAGALAQRGVLDPSGVLLFGFLG
FT                   AVAGDQLGYWAGRRGGRRFVLRWGRRVRLTPGRLAAAERFFDRHGGKAVFLARFVAGLR
FT                   VFGALVAGIGRMRWRTFLLFNALGGAVWASAAVLAGYLLGGSLALAERWAGRAGILLAL
FT                   AAVTAALLYLLYRWLRGHRELLEGAAGRLMEGLPGAFLRSGAGRWLARRFSPGEVYGLT
FT                   LTAGLVLAGLFSWAFGGIVEDVVSRDPLVRADVTVLRFVHAHGDPEVTAAVAAFEAAFS
FT                   PELLLPAAALAGLGLLLLAARGRAGFRAALSGAVLLASALGTGLLVGLFKLLFDRSRPP
FT                   ASLQLVPEAGQGFPSGHAMAAFTVGAAVCYAVFLREPGSRLGSWRAKARAAVLWAALVL
FT                   LVGAGRVYTGAHYPSDVLAGWALGGVWSSACITSAEVFRRLRAQKAPPGRGGVKYRPS"
FT   gene            238976..239635
FT                   /locus_tag="Rxyl_0233"
FT   CDS_pept        238976..239635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0233"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH GntR-like; KEGG:
FT                   reu:Reut_B5875 regulatory protein GntR, HTH:GntR,
FT                   C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03211"
FT                   /db_xref="GOA:Q1AZG7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZG7"
FT                   /protein_id="ABG03211.1"
FT                   /translation="MEDLSRPSFAQKIARVLADEIVERRLPPGRKLREQALAERFGTSR
FT                   APIREALYLLGQEGLVERTPRRGAVVKRYSPREVEEVYRIRLTLEEMALRRACDGLGMV
FT                   RRAVAALEPILEDMEASRKDARRYHELNVLFHRTLVEVSGSPVLPPVYTQIEGPLRMFL
FT                   RLSVMSREDVEKSIGDHRRILEAIAGGDAERAARILGAHELDGMNRALEAMREEDR"
FT   gene            complement(239690..241042)
FT                   /locus_tag="Rxyl_0234"
FT   CDS_pept        complement(239690..241042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0234"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter major
FT                   facilitator superfamily MFS_1; KEGG: ypm:YP3897 putative
FT                   metabolite transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03212"
FT                   /db_xref="GOA:Q1AZG6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZG6"
FT                   /protein_id="ABG03212.1"
FT                   /translation="MADQRTVAIASTEPREITARRAVRAACFGFFVDMFDVYLPIAALA
FT                   PAIVYFVPPGLSPEVESTIFFLIFAVTLIGRPVGAIIFGHFGDTIGRRRTTLISVAGFT
FT                   IITLLIALLPGYATWGMGAVALLILLRFLDGLCIGGEYTAANPLAMEYSPKERRGLYGS
FT                   LIHVGYPAALLAISALTALLTSIMPSGSPSSAYSVWGWRIPFFIGVILSAALFVYYLRK
FT                   VPESDLWQSAPKTGAPLKELLKGSNLRRMAQLFVVMSGAWLTLNATVGALPGVGNVLEA
FT                   NSGAVNTGTLIAAAIAVFLYPMLGLLSQRWGRRPTITLIGVLNAFPAAILYIMLVSFGT
FT                   LSNTIFVVLVAAVSLLGLLIWAVHTPYLVESFKTSVRSAGYGIAYSLATIIPGFYSFYL
FT                   LGLSKLMPYAYTPIVLLVLGGLFLSVGALLGPETKDVEFSPIEGDETRSQT"
FT   gene            complement(241058..242137)
FT                   /locus_tag="Rxyl_0235"
FT   CDS_pept        complement(241058..242137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0235"
FT                   /product="Nitrilase"
FT                   /EC_number="3.5.5.1"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: rpa:RPA1563 putative nitrilase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03213"
FT                   /db_xref="GOA:Q1AZG5"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZG5"
FT                   /protein_id="ABG03213.1"
FT                   /translation="MDSQFPKSFRAAAVQASPVHLKPDATVDKLESLVAEAARGGAQLV
FT                   VFSESFIPAFPVWNLVLPPVDQHDLFRRLFLNSVLVPGPITRRLAEIAKRHDVYLSVGV
FT                   TERTNISMGCLYNTNLLFAPTGELLNHRRKLVPTWAEKLTHAWGDASDLRPVQTELGNI
FT                   GVLICGENTNPLARYTLLAQGEQIHIATYPPAWPFRRTGGRQTYNLRKAIEIRSAAHAF
FT                   EGKVFNIVSSGLLDEGIIKDIIAIAPDLEPTLREAPAPASMILGPTGEPLVEPLVGDEG
FT                   IIYADIDVTESIEVKQAHDIVGYYQRFDVFQLTVDQRPQLPINLIRGPETSYDSRMGAE
FT                   TVETAVEEDRASSESTTIR"
FT   gene            complement(242203..243711)
FT                   /locus_tag="Rxyl_0236"
FT   CDS_pept        complement(242203..243711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0236"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: sma:SAV5722
FT                   putative acetyl CoA carboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03214"
FT                   /db_xref="GOA:Q1AZG4"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZG4"
FT                   /protein_id="ABG03214.1"
FT                   /translation="MRRGERFYRFRAKKRGGGRALPGGGRGVASPAAREAIGAVATGFR
FT                   EFGEELVSGDPLGWPGYPEKLARVRERTGEGESVVVGEAQVGKTPVVVVAFDFRFLGGS
FT                   VGEAAGRRIVEAFERARESRRAVVSLVATGGSRMQEGMRSLVQLQRIADACVRAREEGI
FT                   PHISVLRGPVTGGIWASLGSSADYIIGVRGAEVAFAGSRVRGEEATEGEAFTAAGKLRS
FT                   GFVDAEAEPGEVPGLLRSAVELLRPAGGEPPAPPEVPRALGFARPPRDPWVAVMRARSP
FT                   RRPRAEAYLEDYFERRVEISGDRAGGVDAGMLCGFGRRRGRTIAYAAQNGTANTAAGFR
FT                   TARRLLELADRLQLPVLTLIDTPGAGNTAKDEREGVGTAIAELFCTVAGLKVPITSLVI
FT                   GEGGSGGALALAAPDNLWVTPDAYFAVISPEGAAAIVEKDRSRARQVAGRMKLMPQDLV
FT                   ELGVVRGIARPKRRPARAIRTSYDAVRRWVVRGHSSGKEHVTKS"
FT   gene            243982..245066
FT                   /pseudo
FT                   /locus_tag="Rxyl_0237"
FT   gene            245063..246490
FT                   /locus_tag="Rxyl_0238"
FT   CDS_pept        245063..246490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0238"
FT                   /product="Amidase"
FT                   /EC_number="3.5.1.4"
FT                   /note="PFAM: Amidase; KEGG: bbr:BB4983 probable amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03215"
FT                   /db_xref="GOA:Q1AZG3"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZG3"
FT                   /protein_id="ABG03215.1"
FT                   /translation="MSGELCFLPAVELAGLLRRRELSAAELMEAHLSQIERVNPEVNAI
FT                   VTLLPERAMEEARRADAALARGEEVGPLHGLPVAHKDLFWTRGVRTTFGSPIFAGFVPD
FT                   ADALIVERARGAGAISVGKTNTPEFGAGSQTFNEVFGATLNPYDTSRTCGGSSGGAAVA
FT                   LACGMVPLADGSDMGGSLRNPAAFCNVLGLRPSPGRVPSWPSQTSWSPLSVDGPMARTA
FT                   RDAALMLSAIAGPDPRSPISLSEPPGLFAAPLERDFSGVRVAWSPDLGTLPVEGRVAEV
FT                   FRGSLPVLEGLGCEVEEAAPDLSGADEVFKAFRAWHFELAYGELLEEHRQRMKDTVVWN
FT                   IEEGRRLTGPQLGAAERRRTELYHRVLGFMRRYEFLVLPTTQVAPFPVEMPYVTEIEGA
FT                   RMETYIDWMRSCYYISAVGLPAVSVPCGFTGEGLPVGLQIVGRPRDDFGVLQLAHAFEE
FT                   ATGYGRRRPPAAARPLR"
FT   gene            complement(246483..247112)
FT                   /locus_tag="Rxyl_0239"
FT   CDS_pept        complement(246483..247112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0239"
FT                   /product="glutathione S-transferase-like protein"
FT                   /note="PFAM: glutathione S-transferase-like; KEGG:
FT                   pae:PA2813 probable glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03216"
FT                   /db_xref="GOA:Q1AZG2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZG2"
FT                   /protein_id="ABG03216.1"
FT                   /translation="MREMLRVWGRDNSINVQKVLWCCGELGLEHERVDAGGAYGFPEGY
FT                   EEINPNRLVPAIEEDGFVLWESNAIVRYLAARYGAGTLWPEDTRARARADRWMDWQATA
FT                   LWEHLRPVFWGLVRTPPEERDEAAIEEARRKTAGAWAILERHLEGREEYVEGDALTMAD
FT                   IPLGVSARRWFGLDIERPPMPNLEAWYGRLLEREAFRDCVAGIPLT"
FT   gene            complement(247109..247774)
FT                   /locus_tag="Rxyl_0240"
FT   CDS_pept        complement(247109..247774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0240"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH GntR-like; KEGG:
FT                   mta:Moth_0073 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03217"
FT                   /db_xref="GOA:Q1AZG1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZG1"
FT                   /protein_id="ABG03217.1"
FT                   /translation="MEELRRPEPLYRQVYEVLRRRILAGEYGAGEVLQESRAAEELRVS
FT                   RTPVREALRQLEREGLLVARGTERVVADPSREEFVDLYTCRAALEGLVAERAARLAEEE
FT                   ELREMEEALEEARRAVAAGDHGGVLSANTRFHDLMVRSARMPPLERLMDTLRGQILVAR
FT                   RHILSDERIEAEICEEHASILEAIRRRDVGAARERMQRHMQNDIRRGVANFDAAPGEE"
FT   gene            247896..248894
FT                   /locus_tag="Rxyl_0241"
FT   CDS_pept        247896..248894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0241"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: Uncharacterized protein UPF0065; KEGG: bja:blr4371
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03218"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZG0"
FT                   /protein_id="ABG03218.1"
FT                   /translation="MGGGMTRREFLVAGGGALAGALVFGGCAGGGGSGGGGSGWEPSRN
FT                   VVMIVPFEPGGGSDILGRAMAAGLEEVREEVNVSVENRAGGSGAVGYSYLLEQRGDPHF
FT                   LLASETAGVALPITTETPFRWTDFTPVAQIAEDATLLIVRRGSDYRSLQDVVDAAREGR
FT                   VTVGVAGATGLDTIVTSLVEEQTGVEFERVVFESGGEIVAALLGGDIDIASLNPSEVIG
FT                   QLEAGKMRALAVFADERYERGMLAEIPTAREEGVDVSFTQYRGAFAAGGITPEQRQYWE
FT                   RAFVDWTKRQSYRKYIRDNYLISVVRTGEEFEGYLRDYEKTLEKVLGGQSR"
FT   gene            248891..249364
FT                   /locus_tag="Rxyl_0242"
FT   CDS_pept        248891..249364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0242"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: sco:SCO1139 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03219"
FT                   /db_xref="GOA:Q1AZF9"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZF9"
FT                   /protein_id="ABG03219.1"
FT                   /translation="MRGLGGAAPDLVGGLLLAALGAALAAGATGYGVTTAEGRLGPGFM
FT                   PFAVGLLLALFGGLVCVQALWGGRGSGEAGESAGGRSVAAVFALTLLAILLTPVIGFLP
FT                   AFGLLVFALARFVEGEGWVAAALLGTGGAAAAWAVFVLFLQIPLPGGVFVAGG"
FT   sig_peptide     248891..248968
FT                   /locus_tag="Rxyl_0242"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.980) with cleavage site probability 0.826 at
FT                   residue 26"
FT   gene            249368..250894
FT                   /locus_tag="Rxyl_0243"
FT   CDS_pept        249368..250894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0243"
FT                   /product="protein of unknown function DUF112,
FT                   transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112,
FT                   transmembrane; KEGG: bja:bll0952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03220"
FT                   /db_xref="GOA:Q1AZF8"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZF8"
FT                   /protein_id="ABG03220.1"
FT                   /translation="MELLDQILLGFQTALSPVNLAYCFVGVVLGTVIGLLPGLGSATGV
FT                   ALLLPLTLTLEPVTALIMLAGIYYGTQYGATISSVLIATPGDSATVVTTIEGYRLARRG
FT                   RAGPALAVAAIASFLAGTISIVLLMTLAPVFASFALDFGPPEMAALMVLGLAGVIGFTG
FT                   SSRAKGLAMAAFGLALATVGIDPSTGVERFTFGNVQLLGGIGFLEVVIGLFAVAEVMSA
FT                   VRRGGGEPIRTRFRDMLLSREDWRRSRGAIARGGLLGFFLGVLPGAGATLASFFAYDVE
FT                   RRLSRRRDEFGKGAIEGVAGPEAANNAAVNGAFVPTLTLGIPGSGTTAVLLGAFLLFGI
FT                   QPGPLLLEEQPQLVWGLIASFYIGNLLLLLLNLPLAPLFASILRLRYGLLYPLILLLCF
FT                   VGAYAVENRMWGVWIAFAFGVIGYFMKRYGYPAAPVVLGLILGPMLEKALMQTSSMGGG
FT                   DFGIFLQRPIALALFAVAALVVVGPLLARGAGLLLAGRPGSAHGREQKGG"
FT   gene            250900..252087
FT                   /locus_tag="Rxyl_0244"
FT   CDS_pept        250900..252087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0244"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /EC_number="2.8.3.16"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: reu:Reut_A2908 L-carnitine
FT                   dehydratase/bile acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03221"
FT                   /db_xref="GOA:Q1AZF7"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZF7"
FT                   /protein_id="ABG03221.1"
FT                   /translation="MLPLEKIKVLDLTQVMAGPFCCQLLADMGADVTKVEPPGTGDQAR
FT                   RSMGFTMKGEDTAAFLAVNRNKKSVTLNLKDGEAREIFYRLVREADVLVENFRPGVTRK
FT                   LGIDYETLKEINPRLIYASISGFGQTGPYAARAGYDLIAQGMSGVMSVTGEPGRPPVKC
FT                   GVPIGDLSAGLFCAFGVLTAYIARQSTGRGQYIDTSLFEGALALSIWETAELWATGRIP
FT                   QPFGSAHRLTAPYQALRTRDGYINVGANNQRLWKRLCAAIGREELIEDERFATNERRMA
FT                   NREELARELESTLRERTTGEWMEVLLEAGFPAGPIYNYGQVFEDEHTLAREMMVEMEHP
FT                   VEGTVRGLGIPVKLSETPGAVRRAAPLLGEHTRETLRRLGYSEEKIAELEEREAI"
FT   gene            252084..252866
FT                   /locus_tag="Rxyl_0245"
FT   CDS_pept        252084..252866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0245"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   reu:Reut_A2907 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03222"
FT                   /db_xref="GOA:Q1AZF6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZF6"
FT                   /protein_id="ABG03222.1"
FT                   /translation="MRTGTEQLLYERRGARAYITFNRPEARNAMTWEMYEALYECCEEV
FT                   DRDEGVRVVVLRGAGGRAFVAGTDIRQFREFESGEDGIAYERRMERVIGRLEEVGKPTV
FT                   AVVDGYAVGGGLSICAVCDLRVCTPEARFGIPIARTLGNCLSMKNYARLMALVGPARTK
FT                   ALLFTARMFSAEEALAAGLATEVVPREELDGRVEELCSALESHAPITMRVTKEALRRIT
FT                   FAGLPDGSDLVRQTYGSEDFHEGVAAFVEKRSPRWRGR"
FT   gene            252866..253414
FT                   /locus_tag="Rxyl_0246"
FT   CDS_pept        252866..253414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0246"
FT                   /product="carbonic anhydrase/acetyltransferase isoleucine
FT                   patch superfamily-like protein"
FT                   /note="KEGG: tfu:Tfu_0193 similar to carbonic
FT                   anhydrase/acetyltransferase isoleucine patch superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03223"
FT                   /db_xref="GOA:Q1AZF5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZF5"
FT                   /protein_id="ABG03223.1"
FT                   /translation="MEPFFGEVGGLRPRVAPDAFVAPGAVLVGGVRVGARSSVWYGSVL
FT                   RADDEEVVVGEGCNIQDLCLMHADPGYPAVLEDGVSVGHRAIVHGATVREGSLVGMGAV
FT                   LLNGVVLGPGSVVAAGAVVTPGTEIPSGSLVAGVPARVVRPAREADREMIRHTARSYLR
FT                   KSGLHREARPLRREEVEAG"
FT   gene            253411..254559
FT                   /locus_tag="Rxyl_0247"
FT   CDS_pept        253411..254559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0247"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: bur:Bcep18194_A4039 L-carnitine
FT                   dehydratase/bile acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03224"
FT                   /db_xref="GOA:Q1AZF4"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZF4"
FT                   /protein_id="ABG03224.1"
FT                   /translation="MSAGGPLSGILVVDLTRALAGPYATMMLADAGAEVVKVERPGTGD
FT                   DTRGWGPPFVGGPGEEESTYFLSVNRSKKSVVLDLKEPGDLERLKGLIRRADVLAENFR
FT                   PGVMERLGLGPEDLERLNPRLVSLSITGFGEGGPEGHRPGFDQIAQGEGGLMSFTGPVG
FT                   GPPTKVGVPIADILAGMFGAFGVVAALHERERSGRGQRVTSSLLGAIVGIHAFQGTRWL
FT                   IAGEVPRPEGNRHPTIAPYGAYECADGMINIAVGSEGLWRRFAPLVGLDPEDGRFDTNK
FT                   KRVSRVEELEEAMAPALRSAGVEEWMRRLGEAGVPAGRVLSLDEVYASPQVEHLGLVDA
FT                   VEHPRLGEIRLPGWPVGWSRSGRRRPEPPPTLGQHGGEVLGG"
FT   gene            254588..255352
FT                   /locus_tag="Rxyl_0248"
FT   CDS_pept        254588..255352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0248"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   tfu:Tfu_3084 conserved hypothetical membrane permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03225"
FT                   /db_xref="GOA:Q1AZF3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZF3"
FT                   /protein_id="ABG03225.1"
FT                   /translation="MDPTHLLILGAAGLFGGILSGLFGVGGGGVFVPALVYGAGWNIKE
FT                   AVAASLVIIVFSALSGTVRSMRSESPVNWRVAALFSCTVAPSALIGVFVSRFSPDDVVE
FT                   LVFGCFLLSLAYPTFRRGSGRGGRRSLPPALALLGGVGVGTLSGLIGIGGAAMMVPLMM
FT                   LGFGVSPKSAISTSLAITVLLGSVGAAGYILTGFDRLGGLPPLIACAMAGAWLGVRLRD
FT                   RLSEGFLQRAFAAFMVVVAVRVLYDALSGLLA"
FT   gene            255411..256214
FT                   /locus_tag="Rxyl_0249"
FT   CDS_pept        255411..256214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0249"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   cef:CE0317 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03226"
FT                   /db_xref="GOA:Q1AZF2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZF2"
FT                   /protein_id="ABG03226.1"
FT                   /translation="MPPVSFVELFGLDLSHLVLYAAIGTVGGLLSGLIGVGGGVFFVPA
FT                   LVYGAGWNIKEAVAASLVIIVFSALSGTVRNAGSRDPVDWRVAGLLSLAVAPASLIGVF
FT                   VSRFSPDEVVKVAFALIILALAAPTARGGSGPLEGRRKIPRWLVFAAGVLIGALSGLVG
FT                   VGGGVMMVPLMVLGLGLSAKRAVSTSLAVVMFTGLVGASGYIATGFRDPHELLSLPPLI
FT                   AGSMVGAWLGVKVRDPLPDGAIRVGFAGFMVLVSLRTLGGVAGVV"
FT   gene            256248..256841
FT                   /locus_tag="Rxyl_0250"
FT   CDS_pept        256248..256841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0250"
FT                   /product="signal peptidase I. Serine peptidase. MEROPS
FT                   family S26A"
FT                   /EC_number="3.4.21.89"
FT                   /note="KEGG: ana:alr2975 signal peptidase I; TIGRFAM:
FT                   Peptidase S26A, signal peptidase I; PFAM: peptidase S24,
FT                   S26A and S26B"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03227"
FT                   /db_xref="GOA:Q1AZF1"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZF1"
FT                   /protein_id="ABG03227.1"
FT                   /translation="MPMSDQRHYEEELSRRKRRERRRAGSRALGGLVEFAVILAISFVL
FT                   VFGVVRPYIVEAFYIPSESMVPTLMVGDRVLVNKFIYRFTEPHRGDIVVFKSVEGGGED
FT                   LIKRVVGVPGDVLAVRDGRLYVNGEPQREPYVNRKFPDHSFFGPKRVPPRHVFVMGDNR
FT                   ANSRDSRYFGPVPYANLEGRAFLLFWPPDRIRLL"
FT   gene            complement(256838..258289)
FT                   /locus_tag="Rxyl_0251"
FT   CDS_pept        complement(256838..258289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0251"
FT                   /product="amylomaltase or 4-alpha-glucanotransferase.
FT                   Glycosyl Hydrolase family 77"
FT                   /EC_number="2.4.1.25"
FT                   /note="KEGG: syf:Synpcc7942_1019
FT                   4-alpha-glucanotransferase; TIGRFAM:
FT                   4-alpha-glucanotransferase; PFAM: glycoside hydrolase,
FT                   family 77"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03228"
FT                   /db_xref="GOA:Q1AZF0"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZF0"
FT                   /protein_id="ABG03228.1"
FT                   /translation="MRLERSAGILLHPTSLPGPRPSGELGPEALRFARFLQGAGQRLWQ
FT                   VLPLNPTDEGGSPYSSYSAFAGNPLLVSAEWLAEDGLIEGAPREAPAPRVDYRRALAAK
FT                   GRLLREAYSRWRPDEGFERFREERSFWLEDYALFMALRGRLRRPWNRWPAGLATREPGA
FT                   LRSARRELAEEAGFHRFTQYRFFRDWSRVRRAAPGVRIIGDLPIFVSHDSADVWAHRDL
FT                   FLLDERGEPAAVAGVPPDYFSETGQLWGNPLYDWERMRREGYRWWVERARAALALCDAL
FT                   RLDHFRGFAAFWAVPAGERTAAGGRWVEGPGEGLFRVLSKELGGLPFIAEDLGEITPDV
FT                   VRLRERLGLPGMKVLQFAFGSGPENPFLPHNWRQESWVVYTGTHDNDTTAGWWLSAADG
FT                   ERAFARRYLGREYAGVWDFIRLAYASAAGWAVIPMQDVLGLGTEARMNTPGTGEGNWEW
FT                   RLGGEALTPNLAARLGELARTYGRA"
FT   gene            complement(258292..259344)
FT                   /locus_tag="Rxyl_0252"
FT   CDS_pept        complement(258292..259344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0252"
FT                   /product="peptidase M42"
FT                   /note="PFAM: peptidase M20 peptidase M42; KEGG: pho:PH1527
FT                   Frv operon protein FrvX"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03229"
FT                   /db_xref="GOA:Q1AZE9"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZE9"
FT                   /protein_id="ABG03229.1"
FT                   /translation="MPLNEPLLKRLIETPAVSGREERQREIAREVLGSLADEVRTDPLG
FT                   SVIGTKRGREDVRVMVAAHMDEIGFLVRHIDDRGFVRLQTLGGHDPANMVSQRVAIVTS
FT                   GGETLRGALQPARKPPHVAGEEERKRLPRAEEFFVDLGMEAEEVKARVRVGDYATMDRT
FT                   LERVGGCYMGKAMDDRIGLFVMYEALRTLREHEATIHAVATSQEEVGLRGATASGWGLE
FT                   PTAVVALDITLAMDVPGGQEDQQITALGKGAAIKIMDSSLICHPKLVEHFRSIAEREGI
FT                   PHQMEILPRGGTDAGGVQRLHGGIPAITLSIPCRYTHTPNEMVNASDVEACITLLARYL
FT                   EEAHTGNYSL"
FT   gene            259502..259987
FT                   /locus_tag="Rxyl_0253"
FT   CDS_pept        259502..259987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0253"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: bld:BLi00693 phosphoribosylaminoimidazole
FT                   carboxylase I; RBL03724; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03230"
FT                   /db_xref="GOA:Q1AZE8"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZE8"
FT                   /protein_id="ABG03230.1"
FT                   /translation="MAARVGVIMGSASDWETMRHACEVLEELGVPHEKRVVSAHRTPDL
FT                   MFEYASGAAERGIGVIIAGAGGAAHLPGMVASKTVLPVIGVPVKSSSLNGLDSLLSIVQ
FT                   MPGGVPVATVAIGRAGATNAGLLAAQILAVRDPELRRRLEERRERMRRSVLEGGDLS"
FT   gene            259984..261150
FT                   /locus_tag="Rxyl_0254"
FT   CDS_pept        259984..261150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0254"
FT                   /product="phosphoribosylaminoimidazole carboxylase"
FT                   /EC_number="4.1.1.21"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   ATPase subunit; PFAM: phosphoribosylglycinamide synthetase
FT                   ATP-dependent carboxylate-amine ligase-like, ATP-grasp
FT                   protein of unknown function DUF201; KEGG: gka:GK0258
FT                   phosphoribosylaminoimidazole carboxylasecarbon
FT                   dioxide-fixation chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03231"
FT                   /db_xref="GOA:Q1AZE7"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZE7"
FT                   /protein_id="ABG03231.1"
FT                   /translation="MSRTILPGSTVGVLGGGQLGRMLALAGGHMGYRFVVLDPTPNAPA
FT                   GQVSSGQVVAAYDDREAAGRLAASSDVITYEFENVDAGVAGMLEREAYVPQGSRLLHTT
FT                   QHRLREKRAVEEAGVRVAPYEPVRDGEDLRAALRRLGTPCVLKTATGGYDGRGQRVIRS
FT                   EDEAPAALSELSGEGTELVLERFVRFEKELSVIAARTPGGEVRTFPPAENVHVDNILHL
FT                   SIVPARIPREVQEEARRMAVRVAEGLGVVGLVAVEMFWAGGDGLYVNELAPRPHNSGHY
FT                   TIEACATSQFEQHLRAICNLPLGPTDLLTPAVMVNVLGEHLEPLVRALSEGRIAARGGA
FT                   VPKVHLYGKAESRPKRKMGHVTLLAPETGAALRWVEESGLWKAQGGAA"
FT   gene            261195..262205
FT                   /locus_tag="Rxyl_0255"
FT   CDS_pept        261195..262205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0255"
FT                   /product="Alcohol dehydrogenase, zinc-binding protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding Alcohol
FT                   dehydrogenase GroES-like; KEGG: lic:LIC10958 alcohol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03232"
FT                   /db_xref="GOA:Q1AZE6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZE6"
FT                   /protein_id="ABG03232.1"
FT                   /translation="MRAYELRGHGLENLALAERPEPRPGPGQLLVRMRAASLNYRDLLV
FT                   ARGRYGRGGVRLPLVPLSDGAGEVVETGPGATRFGAGDRVAGAFFQRWVDGPLDEEKAA
FT                   SALGGAVDGVLAERVVLEEAGAVRVPDHLSFEEAAALPCAGVTAWVGLFALGRLRPGET
FT                   VLAMGTGGVSIFALQFAKMAGARVILTSSSDEKLERGRELGADETINYRETPDWDLRAR
FT                   ELTGGRGVDHILEVGGAGTLPRSLRAVRDGGHLTLVGLLSGERADLEEAAKNERGVRVD
FT                   SVYVGSLRHFEDMLRDIERARLRPVIDRVFAFEEARQAYEHLQSGRHFGKVVIRV"
FT   gene            complement(263398..263667)
FT                   /locus_tag="Rxyl_0256"
FT   CDS_pept        complement(263398..263667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0256"
FT                   /product="CRISPR-associated protein, Cas2 family"
FT                   /note="PFAM: protein of unknown function DUF196; KEGG:
FT                   tma:TM1796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03233"
FT                   /db_xref="GOA:Q1AZE5"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZE5"
FT                   /protein_id="ABG03233.1"
FT                   /translation="MYVIMVYDVNVKRVVKVLKVGRKYLEHVQNSVLEGELSPAQYKKL
FT                   KHEVEKTIDPEEDTVRFYLLRTTRYLTTEELGLPSRNEPDSSFL"
FT   gene            complement(263671..264666)
FT                   /locus_tag="Rxyl_0257"
FT   CDS_pept        complement(263671..264666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0257"
FT                   /product="CRISPR-associated protein, Cas1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1; PFAM:
FT                   protein of unknown function DUF48; KEGG: chy:CHY_2152
FT                   CRISPR-associated protein Cas1"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03234"
FT                   /db_xref="GOA:Q1AZE4"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019858"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZE4"
FT                   /protein_id="ABG03234.1"
FT                   /translation="MKRPVYIFNAGELQRQQNTLRFTLADGKRRFVPVETTGEIHVFGE
FT                   VSVNTKLLVFLAQNAIPLHVYNYYGYWSGSYMPREQYVSGYLTLKQAEHYLDHEMRLVL
FT                   ARAFVRGAMENMERVLGYYARRGVELDGQLAEIAGKKESLPLALTTEELMAVEGGCRDL
FT                   YYGCWDGIVKSEEFRFEKRTRRPPANRINALVSFGNSLLYVTVLSEIHRTHLDPRIGFL
FT                   HTTNQRRYTLNLDVAEVFKPIIVDRVIFSLLNRGAIQAKHFHKGTEGVFLNESGRKTFI
FT                   EAYETRLKETIKHPKLGRPVSYRRLIRMELYKLEKHLMGDEPYEPFVSRW"
FT   gene            complement(264673..265794)
FT                   /locus_tag="Rxyl_0258"
FT   CDS_pept        complement(264673..265794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0258"
FT                   /product="CRISPR-associated protein APE2256"
FT                   /note="TIGRFAM: CRISPR-associated protein APE2256; KEGG:
FT                   chy:CHY_2123 putative CRISPR-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03235"
FT                   /db_xref="InterPro:IPR013442"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZE3"
FT                   /protein_id="ABG03235.1"
FT                   /translation="MPEREKSRLVLTTCGTSILTNDVDQERRRMINRLANHKEDELTPE
FT                   ERERLDRHIEERWQLLVDASLEQVKRMSAELNGLINYYGGNLTPRPGRPDEHILLTSDT
FT                   YLGRRVGDVLKEWLEERGFNVQVWCPGGLATKSREDFRRAMAELIRRCEGALPFRRDAG
FT                   YHVAFNLTGGFKSVQGFMQVVGMFYADEMFYIFETGSSLITIPRLPIRLETEAIVRDHE
FT                   QPFRRLGNGEVLPVEECREIPEDLLFEVDSDATLSEWGELIWQRGEKALYSEKLLEPLP
FT                   GLRYSPNFRKKVQRLKLSPDRLATLNERLDSLSLTVRGKKPNLSGLDFKQLRSNPKPPS
FT                   THECDVWSDDERRLFGHYEGSTFIVDDIERGLH"
FT   gene            complement(265787..267004)
FT                   /locus_tag="Rxyl_0259"
FT   CDS_pept        complement(265787..267004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0259"
FT                   /product="CRISPR-associated protein, Cmr6 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, TM1791; PFAM:
FT                   protein of unknown function DUF324; KEGG: tma:TM1791
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03236"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR010172"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZE2"
FT                   /protein_id="ABG03236.1"
FT                   /translation="MMLPLYKKAGEAKLEGAGNAGLWYDKFCNKWRREPAKHGNKEAWT
FT                   LEAFNQDGKTVNPKLAWIKTVTGGRVGDRRQLEEASGRIFDLLESRGGHPLFYRLESDF
FT                   VSGLGREHPVENGFAWHPTLGTPYLPGSSVKGLVRAWAEQWADPKPPKEDIKRIFGSES
FT                   KDDRDFRVGSVVFLDALPAEPVRLKADVMTPHYAPYYQGEEPPADWHSPNPIPFLVVAQ
FT                   GASFVFGVLPRRAGHAGDCDTVRGWLKEALEWIGAGAKTAVGYGRFAVDVKAQKRLERE
FT                   RKERKARQRELEEEERRKREVEEQARGKSPLYREILQASSEEKWREDKGAFAREGVAEG
FT                   WMDRIEADPQQDAVELFDGFMRQHYGDVLKDPDAKKGKKGRLKHKPRPRELAKRWLRIL
FT                   QEQKDA"
FT   gene            complement(267001..267426)
FT                   /locus_tag="Rxyl_0260"
FT   CDS_pept        complement(267001..267426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0260"
FT                   /product="CRISPR-associated protein, Cmr5 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, TM1791.1; KEGG:
FT                   afu:AF1862 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03237"
FT                   /db_xref="InterPro:IPR010160"
FT                   /db_xref="InterPro:IPR023101"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZE1"
FT                   /protein_id="ABG03237.1"
FT                   /translation="MAEERTLEQRRAAHALAAIQELQRAGRGGYGNYKSYVSSLPATIL
FT                   TNGLGQAAATLLAGAKLNSKNRNADNRAREKLYDHLSSWLCGGDEESPYQKKGDLLENI
FT                   TRNDQDCYIRAQAEALEYLSWLKRFAEAFLEGSKGEK"
FT   gene            complement(267426..268226)
FT                   /locus_tag="Rxyl_0261"
FT   CDS_pept        complement(267426..268226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0261"
FT                   /product="CRISPR-associated protein, Cmr4 family"
FT                   /note="TIGRFAM: CRISPR-associated RAMP Cmr4; PFAM: protein
FT                   of unknown function DUF324; KEGG: pfu:PF1126 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03238"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR013410"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZE0"
FT                   /protein_id="ABG03238.1"
FT                   /translation="MKMSIVGMLAETFVHPGTGQNVGAIDLPVAREAATGYPFITGSSL
FT                   KGALLDDYREHDSEGAERIFGKQDSAGNLLVSDARLLLLPVRSLSSAYRWVTCPHILER
FT                   LRRDLKRGRREAAFEVPRVENKSALGHPGNGRLFLEERSFDVQGNVPEDVIGAVSSLIP
FT                   HEETRGRLAGQLTILSDDDFSWFARYGLAVQARNVLDPKTKKTKQGGLWYEETLPPDTL
FT                   MYAVLAERNGGGDIERVREKIGTHLQVGGNETVGQGWFALGWEA"
FT   gene            complement(268235..269317)
FT                   /locus_tag="Rxyl_0262"
FT   CDS_pept        complement(268235..269317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0262"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tth:TT_P0116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03239"
FT                   /db_xref="InterPro:IPR019117"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZD9"
FT                   /protein_id="ABG03239.1"
FT                   /translation="MKYYGIEALDTLFFGDGSPFDAGETGQIEVTGVFPPSPTTVVGAL
FT                   RAAFARELGWRCGDWPENVKAKLGDGQRLGPLRFAGPYVTRGGEPLFPAPLYLMKSGER
FT                   FTTRLRPRDTPLETDMGEVRLPEVVPVEDDSGKEAKGFKPLADAYLTKSGTERALRWEL
FT                   PQEEEVVKVSDLWEGEGRLGIRRDPEKRTTQEDALYLASHVRPRRGVALAMGVAGYEGP
FT                   APGLMTLGGESRMAYLEPCEISLPEAPELEPDGGRLRYTVTLLTPMRPQDEGWQRPGGG
FT                   LAGLPGEVVSACVGKPVLIGGWDTERKRPLDLEPHLPAGSTWFMETEAGEVDRVLEMHA
FT                   GHIGAKTEWGYGQILIGRWR"
FT   gene            complement(269314..271203)
FT                   /locus_tag="Rxyl_0263"
FT   CDS_pept        complement(269314..271203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0263"
FT                   /product="CRISPR-associated protein, Cmr2 family"
FT                   /note="TIGRFAM: CRISPR-associated protein Crm2; KEGG:
FT                   tte:TTE2639 predicted hydrolase of the HD superfamily
FT                   (permuted catalytic motifs)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03240"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR013407"
FT                   /db_xref="InterPro:IPR024615"
FT                   /db_xref="InterPro:IPR038242"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZD8"
FT                   /protein_id="ABG03240.1"
FT                   /translation="MKKQSLHFTLGPVQGFVGQARRTRDLWAGSFLLSYLAGQAMKAVL
FT                   EGGGEIVFPEIGTRERPTDPLLAAILKRPISENPRPEIGSLPNRFKAGVQDGFDPERCE
FT                   EAVREAWKRIASSVWERYVEPVAAYGKGTKEIWERQVEGFWEMSWVIGEDPGDRSDQRW
FT                   LDLRKNWRTHHPPSEPGDKCTLMGSWQELSGYVRAREREAQDRFWDELRKKAGTLNLGE
FT                   HERLCAIALIKRLFPEVAKETIGWELNARTWPSTPYMAAVPWIEEARNKPEAKKHLELV
FT                   RSSGARSSAFGEYNTNLACPKNEKDFARLDGNFFHRAALENERATPDLSPQERKGLLEN
FT                   LKALNEAVGHPASTFYALLLMDGDRLGSLLQNKDIEPELISRALAEFTAEVEGIIGDHC
FT                   GRTVYAGGDDVLALLPVDRALQAAAELRCRFRRAFGSVFGDRRPVDKDGKTLKTTISAG
FT                   LVYATYNTPLRAVMQEAHRLLDEVAKDENGRDSIAASVLAGSGRTVQWVSAWDEGPGDE
FT                   QMITSTLTGLAEDLEEEFAGRFFYNVRERFDVLTGDGDRLIEDLDAQALLVAEYLKSRE
FT                   RDGDRREAEKTIERLLKVCRRRKGGEAPDEGTLDVSGAMLVRFLATKGRGVER"
FT   gene            complement(271200..272342)
FT                   /locus_tag="Rxyl_0264"
FT   CDS_pept        complement(271200..272342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0264"
FT                   /product="CRISPR-associated protein, Cmr1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein TM1795
FT                   family-like; PFAM: protein of unknown function DUF324;
FT                   KEGG: ttj:TTHB162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03241"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR007522"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZD7"
FT                   /protein_id="ABG03241.1"
FT                   /translation="MEQIEATFRVVTPMFMSGADQSRAELRMPSIKGALRFWWRALAWG
FT                   RHGDLKKIREEEARLFGSTDEGQSKILISVAEANTSLLPAGTSVNSGLAYLGYGITEYR
FT                   SQAGTATSREAIKPDSRFVLRIALKEGDKAHKDSVLEALWFMSHFGGLGSRSRRGFGSV
FT                   IVSEMKGAEHPEIPSSTNELKKQIERKLKGLGIEQTSLPDYSAFSRQTRVVVWPLHTTS
FT                   WEQALRKVGERLNAYRSSRQEKNFLDDRDLIRDYAFEESRPAQAPRRSSFGLPHNYYFI
FT                   DAKTAVPISGPSRERDRRASPLFIHFHRLANEDMVAVLSLIPARFLPEGSKVRIGPAEK
FT                   REGGRKHILAEQIKADPPGDFEPVEQFLSSLSGEASEIKA"
FT   gene            complement(272345..274057)
FT                   /locus_tag="Rxyl_0265"
FT   CDS_pept        complement(272345..274057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0265"
FT                   /product="CRISPR-associated protein, Csx2 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, TM1812
FT                   CRISPR-associated protein DxTHG; KEGG: tma:TM1812
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03242"
FT                   /db_xref="InterPro:IPR011742"
FT                   /db_xref="InterPro:IPR013383"
FT                   /db_xref="InterPro:IPR019016"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZD6"
FT                   /protein_id="ABG03242.1"
FT                   /translation="MNKLICTLGTGRYDEVTYVFGDREKRTSMAPVAVGCCAAAGGELE
FT                   LVALLTQRADETHGEELRAEAEALGWRYSPVRIPVGRSEEELWEIFGRVGEHVEEGDDL
FT                   VLDLTHGFRHIPALLLLSAVQYYTVRREADLLGIYYGAYEARMEDDRRPILDLTPLIDL
FT                   PEWSYGVRLLRDYQLPGPLGRMLEDLQRRSHQQRREQRFTRLQEVARPLGSLEAPLVSG
FT                   LPLEAGIEASRVLEGARKAEGELNRLLPMQEPWEELKAQLEAWGVSEHAKTDVPLTLEE
FT                   LRRQARLVEGYLEVQNLRAAATLMREIAVSAVVLHAGDTDRWLELKERQRAERELGVQG
FT                   RMEEGRSPGLREVLPGARRELARLWNRITDRRNALAHAGMRENVVKFDSEDLRELHEKI
FT                   KDNLENPTFWQTSVGGVGEERWLVSPLGMSPGALYTALLKERPDHLLVITSREAEGRLD
FT                   EILAAAGRQDLRVHRLHLGDPFNGFEEAREKGKEALSQHARLWVSSREVVVNRTGGTTC
FT                   LGWAAERLEAALRKDLGLRPRTIACVDRRSVEEQRENPYVEGEVIDIGEQEEE"
FT   gene            complement(274071..274559)
FT                   /locus_tag="Rxyl_0266"
FT   CDS_pept        complement(274071..274559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0266"
FT                   /product="CRISPR-associated exonuclease, Cas4 family"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas4; PFAM:
FT                   protein of unknown function DUF83; KEGG: tte:TTE2659 RecB
FT                   family exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03243"
FT                   /db_xref="GOA:Q1AZD5"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZD5"
FT                   /protein_id="ABG03243.1"
FT                   /translation="MITGTLVWYHAICPRQAWLMAHQMEPEREFELLAEGRLNQQEHYE
FT                   RSMKELSLPGMRLDRVRREGGRIIVSEVKKSTRYLPAARLQLGYYLLRLREEGVEASGE
FT                   ILVPKERFREGVELTQELEESVRDVLGELEGLLERSLPPPAARIPYCRKCAYAEFCWS"
FT   gene            complement(274556..277021)
FT                   /locus_tag="Rxyl_0267"
FT   CDS_pept        complement(274556..277021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0267"
FT                   /product="CRISPR-associated helicase, Cas3 family"
FT                   /note="TIGRFAM: CRISPR-associated helicase Cas3, core;
FT                   KEGG: chy:CHY_2154 CRISPR-associated helicase Cas3"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03244"
FT                   /db_xref="GOA:Q1AZD4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZD4"
FT                   /protein_id="ABG03244.1"
FT                   /translation="MRFLARPGEPLRDHLAAVAGAAERGVLDAHVPDRERLATLARLCG
FT                   LTHDFGKYTTYFQDRLPPKSLEPSPKAYGHHAFVSALLGAFVTRARHPEDGEAQLLVYL
FT                   AIHRHHGNLVTPSEILPREKHLEDAPRFGELSAGLRREYAAAEAQLENLRGEHREQVVS
FT                   EMEELGLPEAKEFIAQRRWWEALPELRSFYRRLLREGDPGATRRYWRLLLLFSALIDAD
FT                   KHVSAGVPAAEQGTRIEPALVEEHVRGLKRPAGTPTAPAARRLAEIRHEVREEAAGRTE
FT                   DAPLRELYPAVLSLTAPTGSGKTLTALEVALRLRERVAEELGHRPRVIYALPFVNIIEQ
FT                   NAGVIEEVLRRRAHLAQNLPDHLLRSHHLAPLSEGDDENTEVEERLLPAEAWEQEIVVT
FT                   TFVSLFESLVTNRNRPLKRLHNIAGSVVVLDEVQSIPYEQWRLVGHVLTTLVRDLGCTV
FT                   IQMTATRPRILPEARELLSAPERHFRGLSRTRIIPRPEVKTLDDLASFVEERRSGGGSL
FT                   LVVLNTISDSVELYRKLGERLGLRGYREYGRVPGPPEIFYLSTNITPWQRSRRVRLLKR
FT                   CLGRGLRPLVVSTQVVEAGVDLDFDEVIRDQGPLDSIVQVAGRCNRGGASPEPAPVHVV
FT                   FLEDGRGRARAETVYGRVLPLISREMLREEVEEPELHALVERYFAAVEERKSDDLSLAY
FT                   LDALRELEFDRREDGSTTVSRYRHIQEELETRPVLVGIHGGAENAIAHLASLYSEKDTA
FT                   RGRLRAAFRRVAPFTITPTTNRLRKNLPPEHPEIPEHFYLSRAEVFSDDSTFYDMETGY
FT                   RWEQEAMLL"
FT   gene            complement(277018..277794)
FT                   /locus_tag="Rxyl_0268"
FT   CDS_pept        complement(277018..277794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0268"
FT                   /product="CRISPR-associated protein, Cas5h family"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas5; KEGG:
FT                   chy:CHY_2155 CRISPR-associated protein Cas5, Hmari subtype"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03245"
FT                   /db_xref="GOA:Q1AZD3"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZD3"
FT                   /protein_id="ABG03245.1"
FT                   /translation="MGQNPLLIFDLCGAYGMFRKFYTNSSSLSYPFPPRTTLAGLIAGM
FT                   MGCERDSYAEDLSLERCQIAVSVITPVRRVMQQVNYVMTEGHVWTKNTGGFDGSSGPIQ
FT                   VPVEWVFPEVGHRELRYRVYATHEDRGWLKRLAEILEGGVPIYPPYLGMSECPGRVEHV
FT                   ATLEGWGLGHREDELPVRTVLPSEAVSGPPRLEEGVQIVKERIPLALDERRRLIAAADV
FT                   LYNRAGPHITARLRAPVFEAAYPGAEGGREFGVFLR"
FT   gene            complement(277798..278742)
FT                   /locus_tag="Rxyl_0269"
FT   CDS_pept        complement(277798..278742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0269"
FT                   /product="CRISPR-associated protein, Csh2 family"
FT                   /note="TIGRFAM: CRISPR-associated protein Csh2; PFAM:
FT                   CRISPR-associated protein TM1801; KEGG: chy:CHY_2156
FT                   CRISPR-associated protein, Csh2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03246"
FT                   /db_xref="GOA:Q1AZD2"
FT                   /db_xref="InterPro:IPR006482"
FT                   /db_xref="InterPro:IPR013419"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZD2"
FT                   /protein_id="ABG03246.1"
FT                   /translation="MAIHDGDILYLYDAKLTNPNGDPDDENRPRMDEATGRNLVSDVRL
FT                   KRYLRDYWLNAGEDIWVRRTEQEETTSAKQRMSVLLEDYNRENGTNLNERQARQSREFK
FT                   DWLLGRLRDVRLFGATMPMENTSVTFTGPVQFSWGYSLNRVEINNSATISSHFAGRENE
FT                   YGTFGKDWRVHYSLLAFYGIVSRNRARHTRLTEDDLAALDDALVRAIPQEATTRSKIGQ
FT                   TPRLYLRVEYEDGSPLRLGDLREDLSLDPADGKTPDTLRDIRDFTIGFDRVLERVRTSE
FT                   GGILRARLWTHPELGDAFERRLRGVLGDRLETL"
FT   gene            complement(278756..280768)
FT                   /locus_tag="Rxyl_0270"
FT   CDS_pept        complement(278756..280768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0270"
FT                   /product="CRISPR-associated protein, Csh1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein Csh1-like; KEGG:
FT                   chy:CHY_2157 CRISPR-associated protein, Csh1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03247"
FT                   /db_xref="InterPro:IPR013389"
FT                   /db_xref="InterPro:IPR013420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZD1"
FT                   /protein_id="ABG03247.1"
FT                   /translation="MIESIYQIGRAILEEGGGRRTVLESLADSPPADGKGKSYIAILKL
FT                   DTARWKLGVELRELGGEKNTAARYLWLGNAPAAMDDQDRLTTNNLVYLVSQTIPNLLME
FT                   GRLDPASALYGKLKRLKDELYLDLGEPSELGTKGGGAYRRYRYFWDVGRLGIEGPGLEE
FT                   LRQEVREGLRPGNVPQKVARALQSHFRQEIPERGVLFTLELDGELLVDDPAYQEYLERS
FT                   LIGRVFEGAREEGVCHLSGRKGPVTTDITRFRFKYYITDKVGFASGATKKGFGSNFALS
FT                   REAYTALLVGERFVRRELGFVFAGARGYMIPDLYTVEVPKGLPGALQRVLRGIRSRTLF
FT                   TLGRVQEEDLDEELEDFRREHLASGYMINLLFYRQKQAKFEVLGLIQDIPSYRLEELRS
FT                   QGRRTGRLWEELYGSEARDLTLQQIYYLIPVRKSGDDMLTKEILAFYHALISGGLIDRK
FT                   GLIDGFLELIRAYRFRNTAAYQVSAPEEGQEDLAVTRYVAQTSLLLAFLRDLDQLKEEE
FT                   VDQGYLDCLSLDEEEKEYLRRLRYDKQQTALYLLGALVAEIANAQWRLGPEGRGGEKTI
FT                   LNKLNYQGMTLPRIQRLATELFDKLRQYRYTDRSGERRPLLQGRNESIFAQAQELLTEE
FT                   WGSWRLTPPENVYYLLSGYSHRTFRAMTARERQTA"
FT   gene            complement(280765..281538)
FT                   /locus_tag="Rxyl_0271"
FT   CDS_pept        complement(280765..281538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0271"
FT                   /product="CRISPR-associated protein, Cas6 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, TM1814; PFAM:
FT                   protein of unknown function DUF57; KEGG: tte:TTE2664
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03248"
FT                   /db_xref="GOA:Q1AZD0"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZD0"
FT                   /protein_id="ABG03248.1"
FT                   /translation="MRLKIVLSGERGHLHLPLQYNSAVQGFIYANLSRTLADRLHNRGH
FT                   TYGQRRFKLFTFSRLFGRREAGEGGISFRGPVRLYLGSAEAEVLGSLAEHLLRRPETRL
FT                   GKTRCLVEEVGVEPEPEVEDGRPLLVRALSPITAYTTLATPEGRKKTYYYSPQEEEWGV
FT                   AILENIKRKVAALGWAADAEEDLREAYVRPRRVRSSDQKVLRFKGTVVKGWMGLYELKM
FT                   PEPYFRLAYDTGLGSKNSQGFGMIALPHPTEGRKR"
FT   gene            complement(281664..282434)
FT                   /locus_tag="Rxyl_0272"
FT   CDS_pept        complement(281664..282434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0272"
FT                   /product="CDP-diacylglycerol-choline
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.24"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   pae:PA3857 phosphatidylcholine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03249"
FT                   /db_xref="GOA:Q1AZC9"
FT                   /db_xref="InterPro:IPR026027"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZC9"
FT                   /protein_id="ABG03249.1"
FT                   /translation="MRERPEDTPYRGPGRRWFRLRAVAVHLYTASGVVLALLILAAAFE
FT                   GDAARALWLMLAALVIDSTDGLLARRFRVKEALPFFDGALLDNIVDYITYVFAPMVLLW
FT                   SGGYLPPGTPGLVLAALPLLASSYQFCHVDAKTEDHFFLGFPSYFNVVAFYAIVLELEP
FT                   AVLAGLLVVCCALVFVPLRYIYPTRTAAFRWLSLPLTALWLVGYAAILLQLPEPSPVLL
FT                   GLSVLYLCYYFGLSLYLSLKHLEARRLEQQEALE"
FT   gene            complement(282524..284209)
FT                   /locus_tag="Rxyl_0273"
FT   CDS_pept        complement(282524..284209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE0034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03250"
FT                   /db_xref="InterPro:IPR019195"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZC8"
FT                   /protein_id="ABG03250.1"
FT                   /translation="MNRLLSILDRIDRRGYGAYKDLQGSYDLGAFTLFVDRVQRDPFAP
FT                   PSLVRVRTKSNRFPSGLYGNPVRRVAFEDFLTRAVEAAVRRVVRGNRGSGGSGRVEIQH
FT                   PSQAVLPRTSMVVTGDYVEARMAVGLPARGRTVDARAARAVLLEELPEVVRRSLVPGGI
FT                   DEGAARRHVETVEDARHLRGLLPELGLVAFVADGAILPRESGASDRPLRQAAVPFQSPE
FT                   ELRVTVELPNRGELSGMGIPEGVTLVAGGGFHGKSTLLEALSRSVYDHIPGDGRELVVT
FT                   REDAVKIRAEDGRSVAGVDISGMIGDLPGGRSTSDFSTPNASGSTSQAANIAEALEIGT
FT                   SLLLVDEDTSATNFMIRDERMRELVRKEPISPFIDLVRPLHATLGVSTIVVVGGVGDYL
FT                   DVADRVILMEDYRPSDATPRAVEVRRKFPPRAPLGEARVRPPEDRRLRSSSIDLRRGKR
FT                   ETARGKGLSTIELGRERVDLTYLEQLVEPGQTEAIARIVGDFVAGTGSRGVRSVVEKAL
FT                   ASIERDGLDSLGSFRGHPGQMSLPRAHEVAGAINRIRSLEASTG"
FT   gene            complement(284307..284513)
FT                   /pseudo
FT                   /locus_tag="Rxyl_0274"
FT   gene            complement(284515..285507)
FT                   /locus_tag="Rxyl_0275"
FT   CDS_pept        complement(284515..285507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0275"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: tte:TTE1453 tryptophanyl-tRNA synthetase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase, class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03251"
FT                   /db_xref="GOA:Q1AZC7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZC7"
FT                   /protein_id="ABG03251.1"
FT                   /translation="MDQRQRVFSGIQPSGNLHIGNYVGAIKNWVAIQERYENYFCIVDL
FT                   HALTVPQDPKELRRKIREVAAIYLASGLDPQRCVIFRQSHVSAHAELTWLLNCIARFGE
FT                   LSRMTQFKDKARKEGTESASVGLFDYPVLMASDILLYNAHLVPVGDDQRQHLELTRTLA
FT                   RRFNNLYGETFVVPEAMILKTGARVMALDAPNEKMSKSSPRPASYVAILDDPDTVRRKI
FT                   RRAVTDSGTEIVAREDKPAITNLLDIYAAITGKTVPELEEQYRGRGYGEFKKDLAEVVV
FT                   EALAPIRERALELLENPGELEELLEAGAERARKAAAPALHAARAKMGLG"
FT   gene            complement(285668..286381)
FT                   /locus_tag="Rxyl_0276"
FT   CDS_pept        complement(285668..286381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0276"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: tfu:Tfu_0625
FT                   regulatory proteins, IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03252"
FT                   /db_xref="GOA:Q1AZC6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZC6"
FT                   /protein_id="ABG03252.1"
FT                   /translation="MDSLERGVIKNKSGVGVLDKAVAVLSLLAEEGPLPLAGVVEATGL
FT                   PRPTAHRILAALEAHHLVVRDRRGYSLGLRLYGWGNRAAGARLVDAARPVLAALRDETG
FT                   ESTQLYVREGEHRICVASVERSVGLRDTVPVGAVLPLERGSAGKVLLAYSEEGELRLGA
FT                   AEAREIRERGWAESVAEREAGVASVSAPVFGGGGALRAAVCASGPIFRLGESPGKRLAG
FT                   PVVAAARELGRALGG"
FT   gene            286472..287206
FT                   /locus_tag="Rxyl_0277"
FT   CDS_pept        286472..287206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0277"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11 Methyltransferase
FT                   type 12; SMART: Ribosomal RNA adenine methylase
FT                   transferase; KEGG: mca:MCA0998 methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03253"
FT                   /db_xref="GOA:Q1AZC5"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZC5"
FT                   /protein_id="ABG03253.1"
FT                   /translation="MTRWGAAFLERLELAGDEVVVDAGCGTGRVTELLLRRLPRGRVIA
FT                   VDASQTMVEAARRRFAGDSRVRVVRQDLLRLEVEEPVDVIFSTATFHWIPDHAALFRRL
FT                   AAALRPGGRLAAQCGGDGNVSRVREATRRTMREERFAAFFEGWEDNKLYADAEGTRRRL
FT                   EDAGFERVETWLHEEPTTFRSVQHLTRYLEAIILRGHLLRLPEAERRPFARSVAEKIAA
FT                   HDGPLLVDYVRLNMLAVRAPAR"
FT   gene            287254..288663
FT                   /locus_tag="Rxyl_0278"
FT   CDS_pept        287254..288663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0278"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, large
FT                   subunit; PFAM: aconitate hydratase-like; KEGG: tfu:Tfu_0626
FT                   3-isopropylmalate dehydratase large subunit region"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03254"
FT                   /db_xref="GOA:Q1AZC4"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1AZC4"
FT                   /protein_id="ABG03254.1"
FT                   /translation="MEKKKPRTLVEKIWERHVVRRAEGEPDLLYVDLHMVHEVTSPQAF
FT                   EALRLAGRRVRRPDLTVATMDHNVPTTDVRLGVRDRVSARQMEALRKNCEEFGIQLHEW
FT                   GSPGQGIVHVIGPEMGLTQPGMVIVCGDSHTSTHGAFGALAFGIGTSEVEHVLATQTIP
FT                   QRRPKTMAITVEGEAPPDVTAKDIMLGILHRIGTGGGVGHAIEYRGEAIRNLSMEGRMT
FT                   ICNMTIEGGGRAGMVAPDEKTYSYIEGRPHAPKGRAWEEALEYWQSLPTDEGATFDKEV
FT                   VIDAAELVPYVSWGTTPAQTVPLDGEVPEPQNEGHERALRYMGLRPGTPIREIEVDTVF
FT                   IGSCTNARIEDLRAAARVLEGHKVKEGIRAMVVPGSMRVKKQAEEEGLDEIFKKAGFEW
FT                   RNAGCSMCLGMNPDILSPGERCASTSNRNFEGRQGKGGRTHLVSPVVAAATAVMGRFAS
FT                   PSELGVPVEVG"
FT   gene            288664..289251
FT                   /locus_tag="Rxyl_0279"
FT   CDS_pept        288664..289251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0279"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: fra:Francci3_3620 3-isopropylmalate
FT                   dehydratase, small subunit; TIGRFAM: 3-isopropylmalate
FT                   dehydratase, small subunit; PFAM: aconitate hydratase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03255"
FT                   /db_xref="GOA:Q1AZC3"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1AZC3"
FT                   /protein_id="ABG03255.1"
FT                   /translation="MEPVRKVEGKALPLGYSDVDTDQIVPSDALKRIERTGFGRFLFAE
FT                   WREDPDFVLNKPEHQGAVVLIAGENFGCGSSREHAVWAVQDYGFGAVIAPSFADIFKNN
FT                   CTKNGVLTVELPKETVRRLLEAVREDPEATVTVDLESRTVKGPGVETTFEIDDFVRYRL
FT                   LNGLDDVGLTLRHEEDIERFERSRPRYMPRVL"
FT   gene            complement(289269..289859)
FT                   /locus_tag="Rxyl_0280"
FT   CDS_pept        complement(289269..289859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0280"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: sth:STH2911
FT                   TetR family transcriptional regulator?"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03256"
FT                   /db_xref="GOA:Q1AZC2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZC2"
FT                   /protein_id="ABG03256.1"
FT                   /translation="MPRVVDHERRRVQIAEAAWRVIEREGPDKANLREIAREAGYTTGV
FT                   ITHYFSNKQQLMAFAFELLARRQVERMARSAERRDLTDALAQFLPLDEERRRETSVWLA
FT                   LLGASLKDPDFAAELRWRYQRMREAAWPLFKEALEEGNPDIETAADELLAIVDGITVDA
FT                   LIDPERYTPERQLSLLRRSLERLGIRLGPQPHG"
FT   gene            289947..290264
FT                   /locus_tag="Rxyl_0281"
FT   CDS_pept        289947..290264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0281"
FT                   /product="small multidrug resistance protein"
FT                   /note="PFAM: small multidrug resistance protein; KEGG:
FT                   gsu:GSU0707 SugE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03257"
FT                   /db_xref="GOA:Q1AZC1"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZC1"
FT                   /protein_id="ABG03257.1"
FT                   /translation="MAWLALFVAGLFEAGMVVGLKLSEGFTRLWPGLLVLVSGGLSFFL
FT                   LSLAMRTISAGTAYAIWTAIGASGAVLVGILVFGEPADLLRLGGIAFVLVGVLMLRFAE
FT                   A"
FT   gene            290468..291385
FT                   /locus_tag="Rxyl_0282"
FT   CDS_pept        290468..291385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0282"
FT                   /product="luciferase-like protein"
FT                   /note="PFAM: luciferase-like; KEGG: nfa:nfa10300 putative
FT                   monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03258"
FT                   /db_xref="GOA:Q1AZC0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019952"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZC0"
FT                   /protein_id="ABG03258.1"
FT                   /translation="MLEVAIMIEGQDGIDWPRWKRIVRTVEDAGYAALHRSDHFTNPSG
FT                   PVKDALELWASLTWLAENTERIEFGPLVTPVSFRHPVITAWQAAAVDGLSGGRLRLGLG
FT                   AGWQEREHTAFGFELLDAERRFARFEEGLEVVTRLLRSAEPVSFEGEFYRLRGAVLLPR
FT                   PARPGGVPVVVGGNGPRRTLPLAARYADEWNGLFLDAKRFAGLSARLDEMVEEAGRRPE
FT                   EVRRSLMVRAVFGRTEARVREKLGGAPRGALEEQAAIVGTAGEFVERLGELQEAGAQRV
FT                   MLQWLETDDLEGIEELASGVLPQL"
FT   gene            complement(291382..292206)
FT                   /locus_tag="Rxyl_0283"
FT   CDS_pept        complement(291382..292206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0283"
FT                   /product="protein of unknown function DUF427"
FT                   /note="PFAM: protein of unknown function DUF427; KEGG:
FT                   mlo:mll7342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03259"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZB9"
FT                   /protein_id="ABG03259.1"
FT                   /translation="MSLTIGTGPFGPRGGAFNFEVKAPRGHVLYFEDSPRRVRVELGGE
FT                   TVADSRRMKLLHETGLLPVYYFPEEDVRTELLERTDHTTRCPFKGEAVYWTVRAGGRTA
FT                   ENAAWAYPEPLEGAPPLGGHIAFYWDRMDRWFEEDEEVDVHPRDPYHRIDALPSSRHVR
FT                   VTVNGELVAETRRPVILFETGLPPRYYIPREDVREELLVPSESSSVCPYKGVASYWSVR
FT                   AGGETVEDLVWSYPEPRRDAERVGGLLCFFNERVDLEVDGERQERPETQWSR"
FT   gene            292334..293428
FT                   /locus_tag="Rxyl_0284"
FT   CDS_pept        292334..293428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03260"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZB8"
FT                   /protein_id="ABG03260.1"
FT                   /translation="MSPEDGLHRLELNLHPNEASGLLAVENGGLLRLRGWDLGFWAVLD
FT                   EGGIQDCIALIGHREGAGIGEGWEIERLRAVPAGSPRKTADAEAIARRGVFVYAFGSHF
FT                   GRKDGPLQPKRGFVARFREDAVEGSASGFAAELEVYRESFRLHRLVNDALRERGPELVP
FT                   LREATRRAFVEAAVRRGREEGKAWSGMVRGGDYPLNFEGAAFRESGSLLLGLRFPTSAG
FT                   GRPVLVEMEGVERLFEGGLPEVRGFLVVDAVGRGGEMAGVRDLALVGGAGGEELHLVTG
FT                   NIDSREGESVLVRDYPEGRDTVATHFRCALPAGARSGSLPARFVREFPDLPRVEGIAVS
FT                   GDRFFYVTDEDEGVHLRLTRLLAG"
FT   gene            293446..294843
FT                   /locus_tag="Rxyl_0285"
FT   CDS_pept        293446..294843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0285"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gsu:GSU0719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03261"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZB7"
FT                   /protein_id="ABG03261.1"
FT                   /translation="MGAGGRSAGRTRLRRVLLFVLAGAALSAALLALFFWPWVAAQVRA
FT                   VVVLAAVLRPPALSPAVAALTPEPALSDREVAGVPTLVARPAGAGEGPALVFVNGAVPP
FT                   GRHEPNVRRLARGLARAGYQVYVPDVPGLRSGEISPSTVEATVGVARRAAEGSESGRVG
FT                   LAGVSVGASIALLAAEDPRINDRVSVVSGIAPYTDLKTVLRLATTGTYLRGGEPVPYRT
FT                   PPYLRLVVARSLVSMLPPGEDRRALMRRLPSLESYYPPRLVDDDPLAPLRAFVAARGGE
FT                   LGPAAESAARLLVNEDPARFEELFAALPPRLERLVGVLSPLAGAERLRAPVYIASAPRD
FT                   KYFPLVESRRLARASPRVDLTVTRTLVHAIPRPSPGDLAAFARLDAFVVRSLRASAQGA
FT                   PQGGQQDAGLEQGLRGGEQVLHLQQPPGRPLVLGGQPQHPFRDPVGEPPEGAQLLDARG
FT                   RRPLGVA"
FT   sig_peptide     293446..293583
FT                   /locus_tag="Rxyl_0285"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.778 at
FT                   residue 46"
FT   gene            complement(294628..295965)
FT                   /locus_tag="Rxyl_0286"
FT   CDS_pept        complement(294628..295965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0286"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: monooxygenase, FAD-binding FAD dependent
FT                   oxidoreductase; KEGG: ava:Ava_1825 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03262"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZB6"
FT                   /protein_id="ABG03262.1"
FT                   /translation="MPEKECTPAGEAVVVGAGIAGLLAARVLCGHLRRVTVLERDALPA
FT                   GPGPRKGVPQGRHLHSLATRGSGLLEELFPGLDAELAAAGCPEIDQALDAVTALPAGTL
FT                   PRFRSGLTMRSVSRDLLEWALRRRLLREGRVRFVEGREATGLVVEGGRVRGVEARARGG
FT                   GGRERFAAGLVVDASGQGSRAPRWLSALGYEPPAETVVDARLGYATRWYRVPEGFSEGW
FT                   RSLAVLPGWPHNPRGGSLREVEGGRWTVVLLGIGGDYPPTDPEGFERFARSLPSPILHR
FT                   AIAGAEPISRVYGYRRTANRRRHYERARLPEGFLVAGDAFCTLNPSYGTGMTAAALAAR
FT                   ALEESLRDGGARRLGRRFHRRQARAVAAAWRISASSDAQWAAASSVKELGPLRRLAHRV
FT                   SEGVLRLATEDERAARRLLEVKNLLAPPQALLEPGILLPALRRALG"
FT   gene            296085..296672
FT                   /locus_tag="Rxyl_0287"
FT   CDS_pept        296085..296672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0287"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: bat:BAS4721
FT                   ribosomal RNA adenine dimethylase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03263"
FT                   /db_xref="GOA:Q1AZB5"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZB5"
FT                   /protein_id="ABG03263.1"
FT                   /translation="MGGGVDLARRALFARAMIANPRQVGAIWPTSRRAVRGLLDMADLG
FT                   GARTVLEFGVGTGVYTAEILRRVGRKARVLGFEVDARLCRAVCARLDDPRLELVNDSAE
FT                   NAGRYLGGEAADVIVSSLPFTTLPAGAREAILDLSCRLLDPAGSFLVLQYSPALLGELE
FT                   RRFGRVRRRLCPLNLPPAFLFACEEPRTGGGG"
FT   gene            296669..297307
FT                   /locus_tag="Rxyl_0288"
FT   CDS_pept        296669..297307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0288"
FT                   /product="phosphatidylserine decarboxylase-related"
FT                   /note="PFAM: phosphatidylserine decarboxylase-related;
FT                   KEGG: sth:STH1715 phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03264"
FT                   /db_xref="GOA:Q1AZB4"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZB4"
FT                   /protein_id="ABG03264.1"
FT                   /translation="MTRRSWAAARPYVLGALLPGLALLLLRRRSSGWWLVGLAGALLLF
FT                   FRDPERRAVRRRGVAYAAADGVISAVERAGDPWIGGEAVRIVTFLSLHNVHVTRSPLAG
FT                   EVAALEREEGGHLPAFLGGAGRNLGYRVCLEGPEGRAVVEMRAGLVARRITPWVRRGER
FT                   VGPGQRLGIIHLGSRTDVLLPAGGTGVLVRPGQRVRAGLSPLARREGAR"
FT   gene            297304..297861
FT                   /locus_tag="Rxyl_0289"
FT   CDS_pept        297304..297861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0289"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /note="TIGRFAM: CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; KEGG: dde:Dde_3217
FT                   CDP-diacylglycerol--serine O-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03265"
FT                   /db_xref="GOA:Q1AZB3"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZB3"
FT                   /protein_id="ABG03265.1"
FT                   /translation="MSGMLRLPSLVTCAGLVCGFVALLFAARHDFGRAALLVGVAALLD
FT                   ALDGLLARRGRGGCEFGTNLDSLADLVSFGVVPAFALYLRALYELGGLGVAACAGFVVC
FT                   GALRLARFPLVRNERFFVGLPIPPAGVALAALCVSGPPPLVAALAAAGLGALMVSRLPF
FT                   PTISGLAALGRERASRFAGRPD"
FT   sig_peptide     297304..297384
FT                   /locus_tag="Rxyl_0289"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.938) with cleavage site probability 0.886 at
FT                   residue 27"
FT   gene            298025..298228
FT                   /locus_tag="Rxyl_0290"
FT   CDS_pept        298025..298228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0290"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /note="PFAM: Cold-shock protein, DNA-binding; SMART: Cold
FT                   shock protein; KEGG: xfa:XF2352 cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03266"
FT                   /db_xref="GOA:Q1AZB2"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZB2"
FT                   /protein_id="ABG03266.1"
FT                   /translation="MAQGTVKWFSDEKGYGFISPDDGSEDLFVHYTGIAGEGFKTLEEG
FT                   ARVSYEATRGRKGMQAENVSPL"
FT   gene            298314..298455
FT                   /locus_tag="Rxyl_R0004"
FT   misc_RNA        298314..298455
FT                   /locus_tag="Rxyl_R0004"
FT                   /note="yybP-ykoY element as predicted by Rfam (RF00080),
FT                   score 30.72"
FT   gene            298574..299500
FT                   /locus_tag="Rxyl_0291"
FT   CDS_pept        298574..299500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0291"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   gvi:glr4409 putative transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03267"
FT                   /db_xref="GOA:Q1AZB1"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZB1"
FT                   /protein_id="ABG03267.1"
FT                   /translation="MVPVSGFPLWAWVGFTALVVALLVLDLAVLARGSREISFRQAALL
FT                   SAFWVGVAVAFGVALFFVAGAARAAEYFTGYIVEKSLSVDNVFVFALIFSYFAVPSRYQ
FT                   YRVLFWGIVGALVLRGVFILIGAELLERFDWIVYVFGAFLVYTGIRMALHREVEVHPER
FT                   NPVLRLVRRLVPMTKSFEGERFFVRRSGKLLATPLFAVITVVMTTDVIFAVDSIPAIFG
FT                   ITSSAFIVWSTNAFAVLGLRPLYFMLAGMMERFVYLNLGLSVVLVFVGGKFIWSELFGK
FT                   VPIWVSLPFIAAAIGVSIAASLWKTRG"
FT   gene            299533..301887
FT                   /locus_tag="Rxyl_0292"
FT   CDS_pept        299533..301887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0292"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutS; PFAM: DNA
FT                   mismatch repair protein MutS-like MutS III MutS II MutS IV;
FT                   KEGG: sth:STH1757 DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03268"
FT                   /db_xref="GOA:Q1AZB0"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZB0"
FT                   /protein_id="ABG03268.1"
FT                   /translation="MLGRYAELKAQLPPGTILFYQVGTFFETFEEDAKTVSRELSLRLT
FT                   SREAAGEGRVPLAGVPGHALQEHVAALLRKGHSVAIAEQRQHPTKPRQFTREITQILTP
FT                   GTVIEDNVLSAGRSNYLATFVVRDGKAGIAVAEASTGEFSGTVVPEAELPAELERWSPR
FT                   EVVVPERTAAEDLPRLEARVSTAPRWTFEPSAGEQALRQHFGVASLKGYGLDGSPQLVA
FT                   AAGALIRYLSTLRGGSPPEQIVSFRRYDPGQAMLLDAATRRNLGLEELISTVDRTRTPM
FT                   GQRTLRRWLERPLLEASRINQRLEAVDALFPDYMLREEVREHLGGIPDIERIATRIVRL
FT                   SASPGDLLALRGALEALGPLRRALAPAAQRSELLRRALSAMEEPPGVRELIAEAISEEE
FT                   GEIIRPGYSAELDEARSFRDGAHEWLTRFEAEERLKTGLKTLKVGYRDGEGYFIEVGGK
FT                   EAHRVPPHYEHRKALKHNARYVTVELKEHESRMLTAREEVERLERRILGEIRAAVKEAA
FT                   PQLQRIARAVAVVDVVASFAAAAAELRYCRPRVAEERGIRIVSGRHPVVEHATETPFVP
FT                   NDARIDGGSRLQIITGPNMAGKSVYLRQVALIVLLAQTGSYVPAEEASLGVVDRIFTRV
FT                   GAEDRLASGESTFMVEMTEAAGILNGATERSLVILDEVGRGTSTYDGMSLAWAIAEYLH
FT                   DDVQALTLFATHYHELTRLADSLPGCRNLKAVVEEVGGEIVFLHRIEPGAESSSYGVHV
FT                   ARLAGLPPRVTDRAQEILSRLEAEGVKGFAG"
FT   gene            301884..303482
FT                   /locus_tag="Rxyl_0293"
FT   CDS_pept        301884..303482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0293"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM:
FT                   ATP-binding region, ATPase-like DNA mismatch repair
FT                   protein-like; KEGG: ade:Adeh_1715 DNA mismatch repair
FT                   protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03269"
FT                   /db_xref="GOA:Q1AZA9"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZA9"
FT                   /protein_id="ABG03269.1"
FT                   /translation="MRLFPRLVSEGPAGYDGGGRVRILPPDVARRIAAGEVIERPASAV
FT                   KELVENALDAGATRVEVEVEGGGTSLIRVRDDGAGMLPGDAERALGRHATSKLRCVDDL
FT                   ARVSTLGFRGEALHAIGAVSSLSLTTRAAGEALGRRVRVLAGEPAGSEPAAHPPGTTVE
FT                   VRDLFLNLPVRRGFLGTARAEGNAVARAVEALALSRPEVGFFLRAEGRPALSLPPAAGL
FT                   RERVAQVHGLALAETLLPLSDPAVRGLVSPLSASFPTRRYLHVTVNGRVVDPDSFAPAV
FT                   AKAYADLLPKGRHPAAFLRLELDPEEVDVNVHPAKRAVRLRGGRSVYPLVVGAVRSALE
FT                   LGRRGRGAAAPGREEPALALIGQFAGRCIVAQRGEELLLIDQHGAHERVLYERLLYGPP
FT                   ERPVALDPPRVVRLPGELGREVLWSFEEELASAGFRVEPFGEDAVRVLAAPRGVGDVAA
FT                   GLVGAAQALAGGEDYLKALACRGADRFGEELDRARMARLLEDWASTRFPEVCPHGRPIV
FT                   RRISLGELLRGFGRV"
FT   gene            complement(303479..303637)
FT                   /locus_tag="Rxyl_0294"
FT   CDS_pept        complement(303479..303637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03270"
FT                   /db_xref="GOA:Q1AZA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZA8"
FT                   /protein_id="ABG03270.1"
FT                   /translation="MSGKGIYVGGTLLSILLSLLLYAQGKRESAIFVGLWAPTILNLGQ
FT                   SLIDQED"
FT   sig_peptide     complement(303566..303637)
FT                   /locus_tag="Rxyl_0294"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.964) with cleavage site probability 0.941 at
FT                   residue 24"
FT   gene            303733..305364
FT                   /locus_tag="Rxyl_0295"
FT   CDS_pept        303733..305364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0295"
FT                   /product="gamma-glutamyltransferase 2. Threonine peptidase.
FT                   MEROPS family T03"
FT                   /note="PFAM: gamma-glutamyltranspeptidase; KEGG:
FT                   mlo:mll6984 gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03271"
FT                   /db_xref="GOA:Q1AZA7"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZA7"
FT                   /protein_id="ABG03271.1"
FT                   /translation="MFRSEGAAAKTRVRRPDGGGRSTVYGTRGAVSCEHPLAAVEGLRV
FT                   LDEGGTAADACVAMAACLAVVAPMTTGMGGDAFLLFYEAGSGRVIGANGSGRAPRGATI
FT                   EGLRARGVKEMPERGGLSVTVPGAVRLWEDAARRLGKLPLGRLLEPARRYAEEGFPVTE
FT                   VVSRYWEVAAELLGSREASARCFLPGGRAPRPGEVFRQPDLARTLALVAESGSEAFYGG
FT                   EVARSIARAVQEDGGYLSEEDLAAHETTWVEPISTGYRGLEVHEIPPPGQGIAALEMLN
FT                   ILEGFDMGSLDPSGAERIHLEVEAKKLAFRDLFGKVGDPEFAAVPVEELLSKDYAARLR
FT                   EEISPERAAVPSVGPALGSDTTYLCAVDAGGNGCSFINSLYMGFGSGVVADGTGVCLQN
FT                   RGRSFRLVEGHPNALAPGKRPMHTIIPGLVTRDGALWAVFGVMGGPMQPQGHAQLLSNL
FT                   IDHRMEPQEAVDHPRHFHDHEGDVLLVEGRVAPAEVERLRRMGHRVEVGPAYAIPTGGA
FT                   QLIRVLEDGVRACGSDPRKDGCALAQ"
FT   gene            305366..305842
FT                   /locus_tag="Rxyl_0296"
FT   CDS_pept        305366..305842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE1564 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03272"
FT                   /db_xref="GOA:Q1AZA6"
FT                   /db_xref="InterPro:IPR010387"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZA6"
FT                   /protein_id="ABG03272.1"
FT                   /translation="MEGRRKSPARRVAVAGVVGALYVVLSLAVAPIAFGPLQFRVGEAL
FT                   KPLVIKHPVLIPAFGVGTVIINLFSPFAGLLELAFMPAVDVAGGALCWLIARTVGGAFG
FT                   TYLASFVYAVFTAAGVGVVLHVAAGLPYLPSFASVAVSEAILLLAGNALLVRRV"
FT   sig_peptide     305366..305452
FT                   /locus_tag="Rxyl_0296"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.889) with cleavage site probability 0.850 at
FT                   residue 29"
FT   gene            305916..307199
FT                   /locus_tag="Rxyl_0297"
FT   CDS_pept        305916..307199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0297"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /note="PFAM: natural resistance-associated macrophage
FT                   protein; KEGG: sco:SCO4993 metal ion transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03273"
FT                   /db_xref="GOA:Q1AZA5"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZA5"
FT                   /protein_id="ABG03273.1"
FT                   /translation="MADVTGVGREGAGEAPRSWGARLKYIGPGFVVAATGVGAGDMVSS
FT                   LSAGTNFGTVLIWAIVIGALLKYVLTEGLGRWYMATGTTILEGWRSLGLWASLYFVIYL
FT                   LIVTFVFGAAVVSASALAVTAMFPGVMPLWAWAVLHGIFGFVVIGIGRYRLFERIMEFF
FT                   VALMFVTVVGLAIMLTPDLGELALGIVVPRIPEGSVLYALAVIGGVGGTFTLASYPYWV
FT                   RERGWSRPSWIPMMRLDLSVGYLFTALFMVSMLVIGAEMLFARGEGISGEEGLVALSDP
FT                   IRERFGTLASWFFLVGFWAAATSSILGAWNGAAYLFADSVRTILRVPDERAGEYLSETG
FT                   LWFRLMLVWITFPPMLLLSFGQPVLLVVVYAALGAFFMPFMALTLLWLLNSSRVSREYR
FT                   NGWLTNALLAAAILLFVVVGVQEVAGAL"
FT   gene            complement(307196..307819)
FT                   /locus_tag="Rxyl_0298"
FT   CDS_pept        complement(307196..307819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03274"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZA4"
FT                   /protein_id="ABG03274.1"
FT                   /translation="MEERGLAGLEARTPEGEPLGRIAEAVRDEESGAVTRVIVERDGER
FT                   YEVPVADIAVDSEAELATLSPREGPEGYAPSRGGEEERPHAGQFVTEPVSEAEAEPPEE
FT                   LAREDWEDEASTSVDSGYPRTDAYIDPDTGEEEVEPRMQESEDLRAEVEELLADTDLEV
FT                   GAIRDGVVELTGSVETQEDLEAIVEELMGIPEVLEVDTTDVEVG"
FT   gene            308173..310686
FT                   /locus_tag="Rxyl_0299"
FT   CDS_pept        308173..310686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0299"
FT                   /product="ATPase AAA-2"
FT                   /note="PFAM: UvrB/UvrC protein AAA ATPase, central region
FT                   Clp, N terminal ATPase associated with various cellular
FT                   activities, AAA_5 ATPase AAA-2; SMART: ATPase; KEGG:
FT                   tte:TTE2327 ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03275"
FT                   /db_xref="GOA:Q1AZA3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZA3"
FT                   /protein_id="ABG03275.1"
FT                   /translation="MLHNLLQQHAQGPGSLFEALSREAQEAVMRAREASAGAGGEAAIG
FT                   TDHLLAGIVAGDNLATEALRRAGADVEGMRAKFREQRGDPGEKVYTFTPSAKRALQLSF
FT                   TAARQMGAPQVGAEHLLLGLLGEGDGNAYRILSQHGAGDAEALRREILRLLQQRGGQVG
FT                   AGMPGAAPGGPGMPGGPQGPQSRTPTLDQVSRDLTRMARDGELDPVIGRAGEIARVVRI
FT                   LSRRTKNNPVLIGEAGVGKTAIAEGLAQRIVSEDVPEVLKGKRVVALDVGALVAGTRFR
FT                   GDFEERMKQLLNELQREEKNIILFIDELHTIVGAGGAEGAVTASNMLKPALARGELQVV
FT                   GATTLDEYRKHVEKDPALERRFQPVLVEEPTVDETIAILFGLRDRYEAHHRVRISDEAI
FT                   IAAAQLSERYITDRFLPDKAIDLLDEAAAEVRLRSTVPPVDLKRIEEEIASLENQKEDA
FT                   VRAEDYERAAQYKQRIEQLKLELREKQEGWAGNREANAPEVRREDIARILEEWTGIPAT
FT                   NIVQEEAERLLNLEAVLHERVIGQDEAVRAVAEAIRRARAGIKDPRRPVGSFIFLGPTG
FT                   VGKTELARTLAEYLFGEEEAMVRIDMSEYQEKHTVSRLVGAPPGYVGYEEAGQLTEQIR
FT                   RRPYSVVLFDEIEKAHPDIFNTLLQILDDGRLTDAQGRTVDFRNAVIIMTSNVGSQHLV
FT                   SERQFGFTAREGVDFREMERRARNALEQTFRPEFLNRVDEIIVFRPLSKEDVMQIVDIM
FT                   LRRLNKHLESQRISVEVTPEAREFLAEEGYDPKFGARPLSRAIRRHIENPLSSSIIEGE
FT                   FSPGDTVVVDRDGDRLTFRAKAPVS"
FT   gene            complement(310750..311454)
FT                   /locus_tag="Rxyl_0300"
FT   CDS_pept        complement(310750..311454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0300"
FT                   /product="glutathione S-transferase-like protein"
FT                   /note="PFAM: glutathione S-transferase-like; KEGG:
FT                   bur:Bcep18194_A5556 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03276"
FT                   /db_xref="GOA:Q1AZA2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZA2"
FT                   /protein_id="ABG03276.1"
FT                   /translation="MAQPIELYYWPTPNGHKITIFCEEAGVPYEIRPVDITAGDQFREE
FT                   FLRISPNNKMPAIVDPEGPGGEPISVFESGAILIYLGEKTGRFYPQEPRRKYRTLEWLM
FT                   FQMGTVGPMLGQNHHFRAYAPERIPYAIERYTKEATRIYRVIDRRLSESEYIAGDEYTI
FT                   ADMAIFPWLISHERQGQRLEDHPNLERWYRAIEARPAVRRALEVGRELRRSAEEMDERA
FT                   REVLFGRGQYDR"
FT   gene            complement(311532..313613)
FT                   /locus_tag="Rxyl_0301"
FT   CDS_pept        complement(311532..313613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0301"
FT                   /product="Alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="KEGG: tth:TTC0808 glycogen phosphorylase; TIGRFAM:
FT                   Alpha-glucan phosphorylase; PFAM: glycosyl transferase,
FT                   family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03277"
FT                   /db_xref="GOA:Q1AZA1"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011834"
FT                   /db_xref="InterPro:IPR024517"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZA1"
FT                   /protein_id="ABG03277.1"
FT                   /translation="MVEPPRGARKELTPAALAVKCTLVSEEARIPKPLRRLPELAYNLL
FT                   WSWRPEISDLFRRLDGELWEEGGHNPLLLLRRTRNLERAAGDPGFLGAYERALEVLERH
FT                   LAAPRPGQMPGLVAYLSAEFGLHESLPIYSGGLGVLAGDHLKSASDLGVPMVGVGILYS
FT                   EGYFRQRIGADGRQEEVYEPLDPAELPVRPLLDGEGREARVGVELPGRGLSLRVWRAEV
FT                   GRVPLLLLDANVPENAPEDRGITARLYGGGPRTRIAQELVLGVGGVRALRAAGLSPAVF
FT                   HMNEGHAAFSGLERVRELVRAGRGFEEARERVAATGVFTTHTPVPAGHDAFPPELFWEF
FT                   MSGWPERLGTGREGLWALGRAGGEDGAFNMTALAMNLSAETNAVSALHRGVTERMWGRP
FT                   VAHITNGVHTWSWLAPRMAALFDRHADRGWREAADDPAAWEFVRGIPAAELWAAHLEAK
FT                   REALELVERLAGRRLDPEALTVGFARRFATYKRATLLLRDPERLRRIAGDPQRPVQFVF
FT                   SGKAHPADEPGKALIRELHGAAEALGGRLVLLEDYGIGVARRLVQGVDVWLNNPRRPLE
FT                   ASGTSGQKAALNGVPNLSVLDGWWPEGYNGRNGWAVGEAREYASEEEQDAADAAALYGV
FT                   LEGEVAPLYYRRGAGGVPEGWVGVMKEAIATVAPAFSAQRMVGEYVRRLYLPRLSGRG"
FT   gene            313672..315426
FT                   /locus_tag="Rxyl_0302"
FT   CDS_pept        313672..315426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0302"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="PFAM: ATP-binding region, ATPase-like histidine
FT                   kinase A-like; KEGG: gme:Gmet_2460 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03278"
FT                   /db_xref="GOA:Q1AZA0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZA0"
FT                   /protein_id="ABG03278.1"
FT                   /translation="MSSPAHRGPGPPGARRSGLPGGLRSRAAAHLRKAALPYAVLALAL
FT                   AFTLLAWEYVRQNLEERDRDLFRNTVSAAELAVERRTRGHILALYGARALFIPGGEVDA
FT                   RDWERYVRSVRLRERFGGLLILGYAPRAPGGRERFPVRLAGPEDEAGRLLLGYDPYADP
FT                   EHRAAMERARDGGVPQATGMVYVPSEAPPGSVLDILLRRGFYVYLPVYRGGEDPGSPAD
FT                   RRRALEGFVVGIFEMEGLMRGIFRGDFAPAVDLEVYDGGRTSPEALLYDGDGVLRASDP
FT                   SAAPRFAGSSRLSVGGRRWTLFSAALPGFAGGDGALLPPLVLAVGGATGGLLFGATWLL
FT                   ASSRLRAQAAGRKLEEANRELEAFSYSVSHDLRAPLRSIEGFSQILLEDYGERLDAEGR
FT                   DYLNRVRRASQRMALLIDALLGLSRLGRREVRLARVDLSRMAREIVEELRQREPGREVE
FT                   VRVEDGLEATADPGLVKVALENLLGNAWKFTAREERAVIEFGRAVREREPGRPLSCYYV
FT                   RDNGVGFDMAYAGKLFGPFQRLHTEEEFEGTGVGLATVWRVVRRHGGVIWAEAAEGEGA
FT                   AFYFTLSP"
FT   gene            complement(315405..316088)
FT                   /locus_tag="Rxyl_0303"
FT   CDS_pept        complement(315405..316088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03279"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ99"
FT                   /protein_id="ABG03279.1"
FT                   /translation="MAEGGFRLPGCSYEELVNIIIAYGTRDSAASPGDVGKLNAVHQSS
FT                   ASRTNGFLVEIGVLTGERERLVTRRGRELALALARKDAEGVRRAWRALVSSSEFLQNVV
FT                   SAVKLREGMLYPTLQAYVAHAAGQPRNKPVMTGAGTVIEILKAAGLLREEAPGQLTAAL
FT                   EDGQGEEPEGPGEPEKRPAEVTLEAGSGPSLSIHLHIRCGAGELDEVVPRLKELLRELQ
FT                   GERVK"
FT   gene            316256..316705
FT                   /locus_tag="Rxyl_0304"
FT   CDS_pept        316256..316705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0304"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; KEGG:
FT                   dde:Dde_1416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03280"
FT                   /db_xref="GOA:Q1AZ98"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ98"
FT                   /protein_id="ABG03280.1"
FT                   /translation="MALRQKTAPTLAGLPRAEPAASRLPGLLLAALGALLIVLSAPDLA
FT                   SGAVLGGREGETLRGGLRGEALAGLSGGDALWGLGGGDLLLGGSGDDELYGGAGTDVLL
FT                   GGPGADFVEAADGEPDRILCGSGRDVASADRLDRLDSGCETVYRG"
FT   sig_peptide     316256..316393
FT                   /locus_tag="Rxyl_0304"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.639) with cleavage site probability 0.614 at
FT                   residue 46"
FT   gene            complement(316723..318075)
FT                   /locus_tag="Rxyl_0305"
FT   CDS_pept        complement(316723..318075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0305"
FT                   /product="Tryptophan synthase, beta chain-like protein"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: ade:Adeh_3748 tryptophan synthase, beta
FT                   chain-like; TIGRFAM: Tryptophan synthase, beta chain-like;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03281"
FT                   /db_xref="GOA:Q1AZ97"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006316"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ97"
FT                   /protein_id="ABG03281.1"
FT                   /translation="MEPTKFVLGDEHIPQSWYNIVPDLPFALEPPLDPATREPVGPEAF
FT                   APIFPRAIIEQEVSAEPRVPIPEEVRKIYGLWRPTPLFRARRLERLLDTPARIYYKYEG
FT                   VSPTGSHKPNTAVPQAYYNREEGVRRLTTETGAGQWGSSLAFACRQMGLECTVYMVRVS
FT                   YDQKPYRRIMMQTYGADVHASPTDLTQAGRRILEEHPDSPGSLGIAISEAVEDAVGSED
FT                   AKYSLGSVLNHVLLHQTVIGQEAIEQMELAGEYPDVVVGCAGGGSNFGGIAFPFLRENL
FT                   LNGRDTRFIAVEPASCPTLTKGRFTYDFGDTAGTTPLMKMYTLGHSFVPAGIHAGGLRY
FT                   HGDSPILSALVHEGLVEARAYLQNETFEAGVAFARAEGIVPAPEVNHAIKAVMDLALEA
FT                   REAGEGRVILFNMCGHGHFDLSAYERYLAGELVDLQLSQEEIDRALEGLPI"
FT   gene            complement(318153..319823)
FT                   /locus_tag="Rxyl_0306"
FT   CDS_pept        complement(318153..319823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0306"
FT                   /product="5'-Nucleotidase-like protein"
FT                   /note="PFAM: metallophosphoesterase 5'-Nucleotidase-like;
FT                   KEGG: gka:GK1763 5'-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03282"
FT                   /db_xref="GOA:Q1AZ96"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ96"
FT                   /protein_id="ABG03282.1"
FT                   /translation="MVKSRSTSTLVALAAALALALSLARAADAESGPKNEPVPEGRIAE
FT                   VQILGFNDFHGWLQSPRSVDGRPVGGAEYLAAYLDREERENPKGTIRIHAGDSVGGSPL
FT                   ISSYFHDEPAIYAMNLMGLDLGTLGNHEFDEGKTEMFRLLNGGQRTDGDQFKTGPDGEP
FT                   VNTSDPDFPGARFPYIAANTVWAGTEDPILPPYEVIKRRGVKVGFIGVVTPETEQIVIP
FT                   DAVAPFDFLDISDTVNRYVPKLRKRGVEAIVVLAHSGGFQSGQTATGEVVTETAQMSDA
FT                   VDAVIAGHSHTFMDTRVDGKLLVQAYSFGTAIEDVDLRIDRRTKDVVGAEAEVITTYRD
FT                   AIAPDPEVAALVAEYEREIAPVANRVVGVAAEDITRATTPAGESALGDLIADAQRAYAG
FT                   ADFAFMNPGGIRADIAAGEVTFGELFAVQPFDNQVAKMELTGDQIYALLEQQFQEGRTR
FT                   ILQVSGLEFSYDASRPAGQRITSVTLPDGTPIDRSATYTVAANSFIATGGDGFTVFKEG
FT                   RDQQTLGSDLEALEAYIDGLPQPFEAPDPFADPRITREG"
FT   sig_peptide     complement(319743..319823)
FT                   /locus_tag="Rxyl_0306"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.619 at
FT                   residue 27"
FT   gene            complement(319836..320795)
FT                   /locus_tag="Rxyl_0307"
FT   CDS_pept        complement(319836..320795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0307"
FT                   /product="Glycerophosphodiester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: btk:BT9727_3270 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03283"
FT                   /db_xref="GOA:Q1AZ95"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ95"
FT                   /protein_id="ABG03283.1"
FT                   /translation="MLAAAPAGAKAGAKQPEPEDVVLNVGHRGASGYAPEHTFTAYDLA
FT                   LRMGADYIEQDLQMTRDGVLVVLHDETLDRTARPTAESGPGDCTGLVREKTLAQIKTCD
FT                   VGSWFNEAYPQYARPEYVGLRIPTLEEVFQRYRKSVNYYIETKSPEAAPGMEEELLRLM
FT                   DEYGLTRPAAERWQVLIQSFSPASLQKVHALDPSLPLIQLFSGTETSETIRAKLDATAA
FT                   YAVGIGPSKDDVDAELVGAAHARCLDVHPYTVNESAEMEGLIATGVDGMFTNFPDRLDA
FT                   VLGESAIDGRKRAAALAERANDACRGEEERGRTASNGI"
FT   gene            complement(320910..322472)
FT                   /locus_tag="Rxyl_0308"
FT   CDS_pept        complement(320910..322472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0308"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: Alkaline phosphatase; KEGG: ana:all0207 putative
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03284"
FT                   /db_xref="GOA:Q1AZ94"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ94"
FT                   /protein_id="ABG03284.1"
FT                   /translation="MAQRDSRPRAGVTRRRFLGAAGAAGLILISGSPVWARPKRGGTTG
FT                   RPRVTHGVQSGDVGLRGGVVWARADRPARMIVEVSPTESFRRVRRYRGPVATPQTDLTA
FT                   RLELRGLPPGEEVFYRVRFEDEERPGRVGEAVAGRFRTAPGRGRDVSFVWGGDTAGQGW
FT                   GINPDFGGMKIYETMLREEPDFFVHSGDNIYADNPLEERVVLPDGTVWRNVVTEEKAKV
FT                   AETLDEFRGNYRYNLMDENLRRFNAAVPTFAQWDDHEVLNNWYPGEVLEDPRYTVKDVD
FT                   VLAARARRAFREYLPLRRRGEIFRKISYGPSLEVFFLDLRTYRGPNTTNDQPVRSELTE
FT                   LFGERQLRWIKRELKTSRATWKVIASDLPVGLVVPDGAAFEAVANARPGTPLGRELEVA
FT                   DLLSFMKRERIRNTVWLTADVHYTAAHRYEPSRAAFRDFDPFWEFVSGPLHAGTFGPNE
FT                   LDPTFGPQVVFQRAADYPNQPPSDGLQFYGHAAIDGDTGVMTVSLKDLRGETLHSVELE
FT                   PAR"
FT   sig_peptide     complement(322362..322472)
FT                   /locus_tag="Rxyl_0308"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.996 at
FT                   residue 37"
FT   gene            complement(322484..324526)
FT                   /locus_tag="Rxyl_0309"
FT   CDS_pept        complement(322484..324526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0309"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: protein of unknown function DUF839; KEGG:
FT                   tfu:Tfu_2294 phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03285"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ93"
FT                   /protein_id="ABG03285.1"
FT                   /translation="MEKSSGAGRALPVLSHAGGRSAMTCAYRCGNACAHEAPNASDNPY
FT                   FGDVLSRALSRRGFLKLGAAAAVVLYAGARPAGARRRSGLTFEPVPPNSLDDVVVPDGY
FT                   DYEVVVRWGDPILPGAPEFDFENQTAEAQSKQFGYNCDYVAFFPLRGRDGGRALLVVNH
FT                   EYTNTELMFRGFDPATGTSPEDPERIRVELMAHGISVVEVRRRRRGGYEMVRSRRYNRR
FT                   ITAMTPMRLTGPAAGHEWLRTEADPEGRTVLGCLNNCAGGLTPWGTYLSGEENYNQYFV
FT                   NAGAVEDPEKRASYERYGFGATLPDFGYRGWERVEERFDLARHPNEGFRFGYVVEVDPF
FT                   DPDSVPRKHTALGRVKHEGAETTLSRDGRAVSYMGDDERFEYVYKFVSSRKMARGSSRR
FT                   AREHNLALLEEGTLYVARFSGDSPPQEIDGSGELPSDGAFDGTGEWVPLVSGEESFVPG
FT                   MSAAEVLINTRLAADRVGATKMDRPEDIQRNPVNDRVYAALTNNTRRTAADEANPRTNN
FT                   KHGHVLEISEEGDDPAATRFRWRVFLLCGDPDDPSTYFAGYDKDQVSPISSPDNLAFDE
FT                   RGNLWIATDSGGALGQNDGFFAVPVEGPERGYLRQFLTVPVGAEACGPRITPDQRTIFC
FT                   AVQHPGEVDGASPDNPASRWPDGGQPRPSVVSVFKTGRGERRIGS"
FT   gene            complement(324761..326245)
FT                   /locus_tag="Rxyl_0310"
FT   CDS_pept        complement(324761..326245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0310"
FT                   /product="Alkaline phosphatase"
FT                   /note="PFAM: Alkaline phosphatase; KEGG: ava:Ava_3741
FT                   twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03286"
FT                   /db_xref="GOA:Q1AZ92"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ92"
FT                   /protein_id="ABG03286.1"
FT                   /translation="MDRGRFLRAAGALALLPVLVRCGGERLPDYPFRLGVASGEPSPDG
FT                   FVIWTRLAPDPLAPDGLGGMPEDAEHAVRWEVSEDEGFRRVVRAGRAEARPELGHSVHV
FT                   EVGGLRSGRWYWYRFEAGGEVSPVGRARTLPAPGEAVGSLSFALASCQDWAGGDYPAYR
FT                   RMAGEELDLVVHLGDYVYEEEDTRTLADFRRLYGLYKSAPALREAHAAFPFVAVPDDHE
FT                   VDNDWAGPYPEDYPELGREEFLRIRAAAFQAYYEHMPLRPSSLPRGPRMRLHRRLRFGG
FT                   LAELHLLDTRQHRDDQPTGRLIAPRRPEALEPGRSMLGEEQRRWLFSGLRRSRARWNLI
FT                   AQQTMLARYDYDTGPGVSVNHDQWDGYAAARRRLLGFLRERRPSGPVVLSGDWHAGFVN
FT                   DLKADFRDPASQTVAPEIVTPSISSGCPWADRVERALGENPHVKYFGGDRRGYVRCSLQ
FT                   EGLLRADFRLLEGPERMVTASSWAVEAGSPEARRAF"
FT   gene            complement(326295..328904)
FT                   /locus_tag="Rxyl_0311"
FT   CDS_pept        complement(326295..328904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0311"
FT                   /product="Glycogen debranching enzyme-like protein"
FT                   /note="KEGG: tac:Ta0686 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03287"
FT                   /db_xref="GOA:Q1AZ91"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ91"
FT                   /protein_id="ABG03287.1"
FT                   /translation="MAPPLFSRRLAWGFFTALALLLPALPASAQGAPDSPTLSVSERLE
FT                   ERRYVTTGERAYVVGTEDGRFPAMGFHTRGEMGGVWSPPIKLLDGIWFGVDGEWLPPAT
FT                   RFTSGYGYVRMELPGREGLAVTRTDFVPDGLRAALFGLTFSAETEQSLTLKVDAHSELM
FT                   GAYPWGETTPSQKTYNLEDSVSVEHGRLVFRERGTPPAENALPHDWAAVVGSSLEPSGS
FT                   DTGEDFRGPQDPPVICPASPEEAPDRCDDTAYGKGKGGQLRYEITVPAGETRTVWFAVA
FT                   GADFDGEASDGEAPEDAVAAAIEEHEAALADPEALLEEKVSGRLALARYTSLDLPGDRR
FT                   LERGIEWSKQNLADSVQAAEDLEIRETNAGQSYPAPEGELDRARFLGAGFPDYQWLFAT
FT                   DGEYTAFASVAAGQFEPIKDHLRALRDVSEIDNGGSGKVVHEVVTDGSVYFGSNADPGN
FT                   TDETAKFPSAVALVWRWTGDDAFRDEMYGFARRNMHYIFRELDEDGDLWPEGLGNVERE
FT                   GMGEEKLDNAVYTIRGLYDLADMARSRGDEETERWAVKRTRAMERRFERAWWFGREGAT
FT                   QYADSLRNPGNERVFQRHWIGATPMEVELVDRRGETVPGLASREHGLAALRERELACYT
FT                   DRFGMYHTGTGPTAAGGGNPGASCDEHVSEVPSERSIFTLNTAVMAVGEGNYGRLGEDQ
FT                   QRHYTGANAALQLIPDEQPGAMPEIAPSPDYGRSIDRPLNERAMVLQAWGAYGTLWPIV
FT                   HQWLGVRPDMGRGELSVVPQVPEGSSPISGENIRLGDGSVAVSAERGRNTYRTTVEPDV
FT                   ALEELVVGHTLPRGAKVRSVRLNGERTRYRVEETNRGLEVLVEAGTEGEQELVVRTR"
FT   sig_peptide     complement(328815..328904)
FT                   /locus_tag="Rxyl_0311"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.878 at
FT                   residue 30"
FT   gene            complement(328980..330746)
FT                   /locus_tag="Rxyl_0312"
FT   CDS_pept        complement(328980..330746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0312"
FT                   /product="peptidase S9, prolyl oligopeptidase active site
FT                   region"
FT                   /note="PFAM: peptidase S15 peptidase S9, prolyl
FT                   oligopeptidase active site region dienelactone hydrolase
FT                   WD40-like beta Propeller; KEGG: hma:rrnAC0178 prolyl
FT                   oligopeptidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03288"
FT                   /db_xref="GOA:Q1AZ90"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ90"
FT                   /protein_id="ABG03288.1"
FT                   /translation="MSYGFGRFLKIRGAYGAGWSPDGRRVTFITSITGVPQAWEVAAEG
FT                   GWPEQLTFHEERVAQAEYSPAAERLVYSMDAGGNERMQLFVLDRRTGVERDLTGRPDAI
FT                   HHFGAFSPDGGRIAYTATRRNGTDFDVYVQSLDGEPEPVWEVSGYHAVACWSPDGSSLV
FT                   VSRHRSNMDGDLFLLDLESGEATLLTPHEGEARFHSARITPDGRSLYLATDRDGDFLRL
FT                   ARLDLSTLEVEYLTPDDHDVEGVELSRDGRYLAATRNVEGYSDLMLFTGEGRRMPDPQP
FT                   PQGVFGGLAFSPDSRRLALTLTGPDRNPDIWVLELPDGEARRLTRSTTAGIPRSTFRRP
FT                   RLVRYPTFDGRKIPALLYEPEAGNAPVVVDVHGGPEAQERPDFDPVTQYLVHRGYAVFA
FT                   PNVRGSTGYGKTYARLDDVRRRMDAVKDLAHAALWLRENGHEKIAVMGGSYGGFMVLAA
FT                   LTEYPDLWSAGVDIVGIANLVTFLENTGSYRRALREAEYGSLERDREFLESISPIHKTE
FT                   RIRAPLMVIHGKNDPRVPVGEAERIVERVRRSGGAVEYLLYEDEGHGLAKLKNRLDAYP
FT                   RIAAFLDEHLGS"
FT   gene            330934..331299
FT                   /locus_tag="Rxyl_0313"
FT   CDS_pept        330934..331299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0313"
FT                   /product="rare lipoprotein A"
FT                   /note="TIGRFAM: rare lipoprotein A; PFAM: Rare lipoprotein
FT                   A; KEGG: syn:slr0423 rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03289"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ89"
FT                   /protein_id="ABG03289.1"
FT                   /translation="MRSLLKVFVLAGALAVAVAFAGEEAQAEPVVASWYGPGFEGALTA
FT                   SGEPFNPYAYTAAHPYLPFGTQLEVCYQGCVTVTVNDRGPFVAGRGLDLSQAAAEAIGL
FT                   TYVGSDVVDMRVVSYPY"
FT   sig_peptide     330934..330999
FT                   /locus_tag="Rxyl_0313"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.969 at
FT                   residue 22"
FT   gene            331629..333569
FT                   /locus_tag="Rxyl_0314"
FT   CDS_pept        331629..333569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0314"
FT                   /product="alpha amylase, catalytic region"
FT                   /note="PFAM: alpha amylase, catalytic region; SMART: Alpha
FT                   amylase, catalytic subdomain; KEGG: noc:Noc_0829 alpha
FT                   amylase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03290"
FT                   /db_xref="GOA:Q1AZ88"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ88"
FT                   /protein_id="ABG03290.1"
FT                   /translation="MPRPRPPIIIEDVYPELDCGRYPIKREVGDRLEVWADIFKDGHDA
FT                   VSAVVRYRERGARRWSEVPMRHHENDRWTASFPLTRNTRYQYTIEAWPDEFETWRSEVG
FT                   KKLEAGQRVEVELLEGREILERAYSRSKDGRLRQTLDAFDAAGYEGRLALLRSEEVRGL
FT                   MREHPDRSLATAYGKTLEVVVDRVRARYGAWYEMFPRSQGSVPGRSATFREAEGRLDEL
FT                   SWMGFDVVYLTPIHPIGKTNRKGRNNALVAGPGDPGSPYAIGSEEGGHKAVHPELGTLE
FT                   DFRRFVAAARERGMEVALDLALQCSPDHPYLREHPGWFRRRPDGTIKYAENPPKKYEDI
FT                   VNVDFYCEEWEALWREWLEVILFWVGQGVRIFRVDNPHTKPFPFWEWVIGEVQREHPDV
FT                   IFLSEAFTRPKVMRALAKLGFTQSYTYFTWRNTKQELTEYLTELTMDWPKEYMRPNFFA
FT                   NTHDILPHILQFGGRPAFMMRLVLAATLSPSYGIYSGYELCENTPRGERGTTVYYQDSE
FT                   VYEYKVWDWDRPGNIKGYIRRVNEIRRENPALQELTNLSFLPAPDDNIIFYGKRSGENA
FT                   VFVAVNLDPHNPHDTHVQFPLWELGIGEEEPYVVEELITRREIPARGSWFWVRLDPHQN
FT                   PAEIFRLRRAG"
FT   gene            333566..336931
FT                   /locus_tag="Rxyl_0315"
FT   CDS_pept        333566..336931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0315"
FT                   /product="Trehalose synthase-like protein"
FT                   /note="KEGG: noc:Noc_0830 alpha amylase, catalytic region;
FT                   TIGRFAM: Trehalose synthase-like Trehalose
FT                   synthase/probable maltokinase-like; PFAM: alpha amylase,
FT                   catalytic region; SMART: Alpha amylase, catalytic
FT                   subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03291"
FT                   /db_xref="GOA:Q1AZ87"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR012811"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="InterPro:IPR040999"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ87"
FT                   /protein_id="ABG03291.1"
FT                   /translation="MTQTARRGAARREEAYREDPLWYKDAIIYQLHVKAFFDSDNDGIG
FT                   DFRGLTQRLEYIKDLGVNAIWLMPFYPSPMRDDGYDISEYKNVHPEYGTRRDFRNFVRR
FT                   AHALGLKVITELVINHTSDAHPWFQRARKAPRNSVWRNFYVWSDTDKKYADARIIFTDT
FT                   ETSNWTWDPVAQQYYWHRFFSHQPDLNHDNPRVFDAIMRVMRFWLDAGVDGLRLDAIPY
FT                   LIEREGTDCENLPETHEILRRMRAELDARYQNRIFLAEANQWPEDVLPYFGKGDECHMA
FT                   FHFPLMPRIYMAVAQEDRHPIVEIMQQTPEIPEVCQWAIFLRNHDELTLEMVTDRERDY
FT                   MYQTYAADPRARINLGIRRRLAPLMENDRARIELLNSLLMSMPGTPIIYYGDEIGMGDN
FT                   VFLGDRNAVRTPMQWTSDRNAGFSRADPHSLYLPPIMDPVYGYEALNVEAQSRSPGSLL
FT                   NWMKRIIAVRKAHKAFGRGTLEFLHPGNRKVLAYLREYGDETILCVANLSRSAQPVELD
FT                   LSRFSGRVPVEMIGGSSFPPIGSLPYFLTLPGHSFYWFNLTTEAEAPSWHQESPRFFEP
FT                   PVVVLPAGRQTARDIRRLPLRLQHRQVAQLEQEALPAFLSVRRWFAAKGSEIERVSLLA
FT                   RAEFGPDRLLALLRVGAGGAEHTYFLPLAAAWEDEDGERVSGLMPHALAKIRRRYRVGV
FT                   LFDALADEGFCREVVAAMAGGRELEMGEGRVRFYATGALEELLAGEPVGELAVRRASVE
FT                   QSNTSVILGERLVLKAYRRLQPGVNPELEIGRYLTEVRRFPNTPPLAGAVEYEDPRSGT
FT                   VSLALLQGFVPSQGDGWSYVLGYLDRYLERRLLSASWSPEEEGPAEPPGQEGQEADEGF
FT                   FMELMRTLGVRTGELHAALAAPTDDPSFSPEPAPPAEVSRWVEAVLDDLRLTLSLLERR
FT                   RSGLPEEVRPEVDRLLRMEARAFDRLEAISARGIRAVKTRHHGDYHLGQVLVAGNDFQI
FT                   IDFEGEPARTLEERRRKHSPLRDVAGMLRSFDYAAQTALMNLGADRAVGEDPEPVVRRW
FT                   ERSVREAFLGGYAEGVRGAGVLPGEGEEAAALVELFALEKALYEIRYELDNRPDWIGIP
FT                   VRGVLDLLTREESP"
FT   gene            336928..339096
FT                   /locus_tag="Rxyl_0316"
FT   CDS_pept        336928..339096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0316"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="KEGG: mag:amb3065 1,4-alpha-glucan branching enzyme;
FT                   TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM: glycoside
FT                   hydrolase, family 13-like alpha amylase, catalytic region;
FT                   SMART: Alpha amylase, catalytic subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03292"
FT                   /db_xref="GOA:Q1AZ86"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1AZ86"
FT                   /protein_id="ABG03292.1"
FT                   /translation="MRREEAIRAVVAGDHPDPFSFLGPHEEAGRRVVRTFLPGAARVRV
FT                   LSAAGRPLGELERVHPEGFFSGPLSGNGRYRLRVLWEGGGEDELEDPYRFPPVLSDYDL
FT                   YLFGEGNNHRIYRHLGAHPAEMDGVCGTAFAVWAPNARRVSVVGDFNLWDGRRHPMRNR
FT                   NGVWEIFLPGVGPGALYKYEIKDAGGSLLPLKADPYGFFAEQYPGTASIVWDLSRHRWE
FT                   DGEWMERRGSRNAPDAPMAIYEVHLGSWRRRPDGSHLTYRELAEELVPYVAGLGYTHVE
FT                   LLPPMEHPFGGSWGYQPVGLFAPTSRFGPPEDFKHLVDAFHRAGVGVIADWVPAHFPED
FT                   AHGLARFDGTHLYEHADPRKGRHPDWGTLIYNYGRNEVRNFLISNALFWLDEYHIDGLR
FT                   VDAVASMLYLDYSRKEGEWVPNEHGGNENLEAIAFLRRMNEVVYGEAPGAFTVAEESTA
FT                   WPMVSRPTYMGGLGFGYKWNMGWMHDTLQYMKEDPVHRRYHHDRITFGLLYAFNENFIL
FT                   PLSHDEVVHGKGSLLGRMPGDRWQRFANLRAYYGFMYGHPGKQLLFMGGEFAQEREWDS
FT                   GSQLDWHLLEGGENRGVRDLVADLNALYRATPALHQVDFEPEGFEWVEGGDAEQSVVSF
FT                   LRRARNPEDFVLVVSNFTPVVRHGYRVGVPASGPYAEVLNTDDPRYGGSGVANGELEAE
FT                   EVPWHGRPFSLRLTLPPLATVFLRPRPV"
FT   gene            339187..341334
FT                   /locus_tag="Rxyl_0317"
FT   CDS_pept        339187..341334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0317"
FT                   /product="Glycogen debranching enzyme GlgX"
FT                   /note="KEGG: noc:Noc_1740 glycogen debranching enzyme GlgX;
FT                   TIGRFAM: Glycogen debranching enzyme GlgX; PFAM: glycoside
FT                   hydrolase, family 13-like alpha amylase, catalytic region;
FT                   SMART: Alpha amylase, catalytic subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03293"
FT                   /db_xref="GOA:Q1AZ85"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ85"
FT                   /protein_id="ABG03293.1"
FT                   /translation="MSEQRSVVWPGEPYPLGATWDGEGVNFALFSENAERVELCLFDPS
FT                   GRREVERIELREQTDQIWHCYLPYGRLGQLYGYRVYGPYDPENGHRFNPNKLLLDPYAK
FT                   SIAGSLDWRHPHFGYRPGEDDLSFDERDNAAGALKCRVVDTAFTWGDDRPPRTPWHDTI
FT                   IYELHVKGFTRLHPEIPPHLRGTYAGLASAPAIEHLKRLGVTAVELMPVHFFVDDKHLL
FT                   DRGLRNYWGYNSIGFFAPDARYSATGSINEFKTMVKRLHSAGLEVILDVVYNHTAEGNH
FT                   LGPTLSFRGIDNAAYYRLVPDDRRYYMDYTGTGNTLNMMHPRVLQLIMDSLRYWILEMH
FT                   VDGFRFDLASALARELHDVDKLSAFFDIIRQDPVISQVKLIAEPWDVGEGGYQVGNFPV
FT                   GWTEWNGKYRDAVRSYWKGDGGLVDELAYRLTGSSDLYERDGRRPYASINFVTAHDGFT
FT                   LQDLVSYNEKHNEANGEDNRDGHDDNRSWNCGVEGPTGDRGIRRLRARQKRNLMATLLL
FT                   SQGVPMILHGDEMGRTQNGNNNAYCQDNETSWVSWNLAPADRNFLAFVRRMIRLRREHP
FT                   IFRRRSFFQGRRLRGAGVKDITWLTPDGDEMTDEEWASSFARSLGLQMSGILEGEVDAQ
FT                   GRQIQDDDFLLLLNAHHEDLSFVLPPVPEDARWEAVVDTAHAAGLKPAGFYKPGDAYPL
FT                   KARSMAVLANARREAPEEEEE"
FT   gene            341331..343145
FT                   /locus_tag="Rxyl_0318"
FT   CDS_pept        341331..343145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0318"
FT                   /product="Malto-oligosyltrehalose trehalohydrolase"
FT                   /note="KEGG: tbd:Tbd_1173 alpha amylase, catalytic
FT                   subdomain; TIGRFAM: Malto-oligosyltrehalose
FT                   trehalohydrolase; PFAM: glycoside hydrolase, family 13-like
FT                   alpha amylase, catalytic region; SMART: Alpha amylase,
FT                   catalytic subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03294"
FT                   /db_xref="GOA:Q1AZ84"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ84"
FT                   /protein_id="ABG03294.1"
FT                   /translation="MIRRHRLPLGAEYLGDGRTRFSLWAPAASSVELVLEGGSSRMERG
FT                   EGGVFSLTTGAAPGARYRYRIDGGQEVPDPASRFQPEDVHGPSAVVDPASFEWGDGGWR
FT                   GRPWHEAVVYELHVGTFSPEGTFRGACERLDHLAGLGVTAVELMPLADFPGSRNWGYDG
FT                   VLPYAPDSSYGTPEELKELVQAAHGRGIMVLLDVVYNHFGPEGNYLPLYAPRFFTERHA
FT                   TPWGAAVNFDDAGSETVREFFVHNALYWIEEYGFDGLRLDAVHAIRDDSGRHFLAELAE
FT                   RIRGGPGRGRRVHLVLENEENEASLLRPAGEGRSLYDAQWNDDLHHALHVALTGEDAAY
FT                   YADYADAPVRHLGRCLAEGFAYQGDPSRHRGDRRGEPSADLAPPAFVAFLQNHDQVGNR
FT                   AFGERITDLASPEAVRAAAAVYLLSPQVPMLFMGEEWGASSPFLFFCDFGGDLAPLVTQ
FT                   GRREEFASFPEFSDPETRGRIPDPNAPGTFGASRLDWGEREAPEHARWLDLYRELLALR
FT                   RERIVPLLSGAPGGGGRYRLVGERGLEVRWGLGGGARLALRANLGPEPLGGFGLPEGDL
FT                   LYATEGAEAAGRRLPGWAAVWHLAGAGA"
FT   gene            343142..345883
FT                   /locus_tag="Rxyl_0319"
FT   CDS_pept        343142..345883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0319"
FT                   /product="Malto-oligosyltrehalose synthase"
FT                   /note="KEGG: tbd:Tbd_1174 alpha amylase, catalytic
FT                   subdomain; TIGRFAM: Malto-oligosyltrehalose synthase; PFAM:
FT                   alpha amylase, catalytic region; SMART: Alpha amylase,
FT                   catalytic subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03295"
FT                   /db_xref="GOA:Q1AZ83"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ83"
FT                   /protein_id="ABG03295.1"
FT                   /translation="MRVPRATYRLQLGPGLTLRDAARLVPYLAELGVSHLYLSPCTRAR
FT                   EGSGHGYDVVDHGALDPALGGEEGYAALLRAVRERGMGLLLDWVPNHAGVSPENGRWMS
FT                   VLEHGPASPHARFFDIDWDPPGRPHLRGRVLLPVLGDHYRAVLERGELELALEAGRGAL
FT                   CVRYYGHRFPVDPATYPAVLAASGEPELVRLAARFAALPDRSPGRGAERVRRTEALRER
FT                   LAGLLRESGRARRALEGVLEGPGRDPEELHRLLEGQAYRLAYWRVAGDEVNYRRFFAIN
FT                   DLVGLRVEDGRVFEETHRLALDLLRRGAADGLRIDHPDGLRDPAGYLRRLREAAGRPFY
FT                   LVVEKILCGNEELPGDWSVEGTTGYEFANLAGGLFVDAEGEAGMDRAYRRFTGEQRTFR
FT                   EVAREGKRLAMEEELSAGLDALAWRMLELSRRRRRYDLTLNALRRALAGVVEHLEVYRT
FT                   YATPEGLPEPDRRRLAEAIERAGAGGRGDPALFGFLRRVLLLEDGELREAARLLMDLQQ
FT                   QTGAVMAKGVEDTALYRYNRLVALNEVGGEPDRFGVAPEELHRWALRRRERHPHALLAA
FT                   STHDTKRSEDVRARLAALSELPGEWGERVERWARINAPHRGRVGGREAPAREDEYLLYQ
FT                   TLLGAWPLGEDEGFAGRISAYMRKAVREAKVRSSWISPDEAYEEALERFVRAVLSPETG
FT                   SGFLEDFLPFQRRIARLGALTSLSQTLIRLAFPGVPDLYRGAELWDLSLVDPDNRRPVD
FT                   YGLRERLLHELGRAGVRALLDEGAWQSGLPKLHLLRAALGLRAERPELFSGGEYLPLRA
FT                   EGPRARHVFAFARRLGEEVAVAAAPRLVANLAAPSGPLGFRPGAWEGTLLPVPPAGEGY
FT                   RNVLSGDAGELPGEREGGALRLPAGELFGRFPVALLVPVRRA"
FT   gene            346098..346559
FT                   /locus_tag="Rxyl_0320"
FT   CDS_pept        346098..346559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03296"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ82"
FT                   /protein_id="ABG03296.1"
FT                   /translation="MRHVATIAAMAAMLMFAAAAALAQSESDQATVCHKPGTPAEHTLT
FT                   VDESALDAHLDHGDTEGACPGQAAGQYEDAGAGQYADIGGEAGASAAAEQYSDSSAAAG
FT                   SQGNVQSSADLQYGGTSAEIQNNTQVNQTVSAEGDVNQSFFFAGSGGRG"
FT   sig_peptide     346098..346169
FT                   /locus_tag="Rxyl_0320"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.901 at
FT                   residue 24"
FT   gene            346682..347332
FT                   /locus_tag="Rxyl_0321"
FT   CDS_pept        346682..347332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0321"
FT                   /product="demethylmenaquinone methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase Methyltransferase
FT                   type 11 Methyltransferase type 12; KEGG: mhu:Mhun_2814
FT                   UbiE/COQ5 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03297"
FT                   /db_xref="GOA:Q1AZ81"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ81"
FT                   /protein_id="ABG03297.1"
FT                   /translation="MREGCYLRGMRGLAAALLFALLAGAGWLLLQRRRPVPMPAGLSFL
FT                   LESRYVERFAGPELLLERSGVSAGMRVLDAGCGAGRLAVSAARRVGPAGEVVALDVREG
FT                   MLSRLRGRVSREGLRNVRAVRAALGEGELEEGGFDRVLLAMVLGEVRDREAALRELYRA
FT                   LRPGGVLSVTELFPDPDYRRPQTVLRLAEGAGFRPEARYGRFPAFTLNLRRPA"
FT   sig_peptide     346682..346759
FT                   /locus_tag="Rxyl_0321"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.889) with cleavage site probability 0.846 at
FT                   residue 26"
FT   gene            complement(347310..347684)
FT                   /locus_tag="Rxyl_0322"
FT   CDS_pept        complement(347310..347684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03298"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ80"
FT                   /protein_id="ABG03298.1"
FT                   /translation="MIVGGPEGGAGLLAIVLDDGEAIPVFSSVEEAREFLESTGDFGRD
FT                   WRPLEVSAGELAAMLEHQGEEVRYAALSPPPESWEGGMEVRVVERELLAALLRQQGEAG
FT                   RREERRGGLLRRVLRRVSGG"
FT   gene            complement(347745..348041)
FT                   /locus_tag="Rxyl_0323"
FT   CDS_pept        complement(347745..348041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03299"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ79"
FT                   /protein_id="ABG03299.1"
FT                   /translation="MIEVTEEAKELFRNVEHPEGTVLRLDPVVDENTGQTMVGIAAGEP
FT                   REDDQVVEHQGEPLLHIAAPVSEALDGSTLNVVDTPEGPGIGITAPGQEPPAG"
FT   gene            348184..348999
FT                   /locus_tag="Rxyl_0324"
FT   CDS_pept        348184..348999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0324"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase
FT                   short-chain dehydrogenase/reductase SDR; KEGG: mlo:mlr1637
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03300"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ78"
FT                   /protein_id="ABG03300.1"
FT                   /translation="MEAGNTKTALVTGSTDGLGRGVARELARRGYAVILHGRSEARCEE
FT                   AAAELPGGAAGYLVADLSSLGEVRKMAREVLAGRERLDLLVNNAGVISRERRESREGFE
FT                   LTFAVNYLSHFLLTLLLLPLLRRSAPARVVNVASAAQSPIDFEDPMMERSYSPMEAYAR
FT                   SKLAQVMFSFALAGRLSGTGVCVNALHPASLMDTKMVRESFGRPMSSVEEGVRAVVRLA
FT                   ASSELEGVSGRYFEGTREARAHPQAYDPAARERLWELSEGLCGALDAGR"
FT   gene            complement(349038..349970)
FT                   /locus_tag="Rxyl_0325"
FT   CDS_pept        complement(349038..349970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0325"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   bja:blr3884 putative dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03301"
FT                   /db_xref="GOA:Q1AZ77"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ77"
FT                   /protein_id="ABG03301.1"
FT                   /translation="MSEARDEAPRGVFAAALTPMDGNLNVDREAFALHCRRLLEAGCHG
FT                   LGVFGTTGEASSLSAKERAAALEALVEAGIPGERLLPGTGSCALTEAVWLSRAALEAGA
FT                   AGVLVLPPFYYKGVTDEGLYRFFAQLIERVGDGRLRLYLYHFPQMTGGVGISVPLVRRL
FT                   AADYPEVVRGIKDSEGSWPRIEALCRELPGFGVFAGTERFLLDTLRAGGAGCISATANV
FT                   TARLARRVYDLHAAGEPGEASSAQRRLTGLRKALEAYPAIPALKLLMRDLTGEDRWLNL
FT                   RPPLVNLEGESAARLLEEARTLGLAEHAP"
FT   gene            complement(349951..350916)
FT                   /locus_tag="Rxyl_0326"
FT   CDS_pept        complement(349951..350916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0326"
FT                   /product="nucleoside recognition"
FT                   /note="PFAM: nucleoside recognition; KEGG: gka:GK3080
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03302"
FT                   /db_xref="GOA:Q1AZ76"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ76"
FT                   /protein_id="ABG03302.1"
FT                   /translation="MGAIKALRTISWAEGLRSGLRTTWELGLVIFPVTAAVALLRFTPV
FT                   YGLLLEALAPAMGLFGLPGEAAVPLVLGNLLGLYAAIGAILAMELTVKQVFTLALMLGF
FT                   SHMLPVETAICRRVGVSATLVVAFRLGLAAAAGLAVARLWDGGGERARYGLAAPVAEEP
FT                   SGWGEALLAALRAAAEGVAQLALIVFPVMLLIQALKDLGALDRFAALMRPLMRPLGIAP
FT                   RGAVTVAGGLVFGLAFGAGIILEQAREQRFSRREITLIALFLCACHAVIEDTLIFVPLG
FT                   IDVLPLLVIRLLSAIALVFLIARLWPEVERGEEHDERSPG"
FT   gene            complement(350965..353022)
FT                   /locus_tag="Rxyl_0327"
FT   CDS_pept        complement(350965..353022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0327"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="KEGG: chy:CHY_1100 DNA ligase, NAD-dependent;
FT                   TIGRFAM: DNA ligase, NAD-dependent; PFAM:
FT                   helix-hairpin-helix motif BRCT NAD-dependent DNA ligase
FT                   zinc-finger, NAD-dependent DNA ligase C4-type NAD-dependent
FT                   DNA ligase, OB-fold; SMART: Helix-hairpin-helix
FT                   DNA-binding, class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03303"
FT                   /db_xref="GOA:Q1AZ75"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1AZ75"
FT                   /protein_id="ABG03303.1"
FT                   /translation="MGAPTLPRIIPPVAEKLAEARQRVEELREQIRYHNRKYYVEDAPE
FT                   ISDAEYDALYRELEELESRFPELVTPDSPTQRVGGEPLEEFEEVRHAVPMLSLQNARRV
FT                   EELREWDARVRRLLGPEEEGRLRYVTELKIDGLAVSLRYENGRLVRGATRGNGFVGEDV
FT                   TRQLRTIRSVPDRLDDDPPGVLEPRGEVYIKLKDFEEFNRRRQERGERPFANPRNLAAG
FT                   SVRQLDPRVTARRPLTIYLYGVGEGYENFESHSEALAALRRYGLRVNPHTVHGDIDSVI
FT                   EECGRWAKKREALDFQVDGVVVKVDSREQQERLGAVQKAPRWAIAYKFEPLAGRTRLRD
FT                   IVVTVGRTGALTPQAVLEPVNVGGVTISRATLHNEDYIKEKGILIGDTVIVERAGDVIP
FT                   QVVRPVPEERDGDEEEFRMPERCPVCGERVSRPEGEAITRCANVRCPAQALEHIIHWAS
FT                   RGAMDIEGLGEKLARKLFDLGLIRDVADLYELRAEQLAPLEGLGEKSAQNLIRAIERSK
FT                   ERPFDRVLFGLGIRHVGSATAELIAERFSGEELLRGVGVEELTQIEGVGEIVARAVVEY
FT                   FSLEENRKLVRRLMEHGLNFGPVRGKPEEGPLSGRRLVITGTLSRPRSEISDLIEGAGG
FT                   TVTSSVSRNTDYLVAGENPGSKLERARELGVPVLDEEGLRRLLSGEERPG"
FT   gene            complement(353035..353514)
FT                   /locus_tag="Rxyl_0328"
FT   CDS_pept        complement(353035..353514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0328"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dge:Dgeo_1195 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03304"
FT                   /db_xref="InterPro:IPR025748"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ74"
FT                   /protein_id="ABG03304.1"
FT                   /translation="MRATLLLAALLLLLAGCRPSPPGEPQRALEVRGALSGQAFQGREE
FT                   PLAVVAPSRRALGGLLGGEVAGRLPAAEDATYLAVLWGRKPSGGYSVAVDSARLEEGRL
FT                   VVRLRLRSPGPGTIVTQALTYPYAAAVIAGVEPAGREVVLTDQEGRRLHWPVRRA"
FT   gene            353594..354160
FT                   /locus_tag="Rxyl_0329"
FT   CDS_pept        353594..354160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03305"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ73"
FT                   /protein_id="ABG03305.1"
FT                   /translation="MLLVCALGLALLPGCSREEGGAPGSFAGETTAAPVRWTTALAGVE
FT                   EAAGEARRWREDAELYAIATPEPALDARGRAPAWLYTFVSPSAGAVASVEVRGGEARRL
FT                   PEQPLPEADIRNLRRNALPPPERLLDSDEALRRAREVRGLLSGRGGRTASAGLDSLSGG
FT                   GPVWIFATVSEGRRLEERVPALSGG"
FT   gene            complement(354157..354471)
FT                   /locus_tag="Rxyl_0330"
FT   CDS_pept        complement(354157..354471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03306"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ72"
FT                   /protein_id="ABG03306.1"
FT                   /translation="MEEANHRPDNPYTEWEGYEVLDAAGEPLGRVERTVYDAPSGVLKY
FT                   LCVGGRAVPAEGLDAEPDRRRVLLPHPAEKVRSAPPLEERPDGDFDRRVRRHYGLERPR
FT                   "
FT   gene            354489..355511
FT                   /locus_tag="Rxyl_0331"
FT   CDS_pept        354489..355511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0331"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa40670 putative translation initiation
FT                   factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03307"
FT                   /db_xref="GOA:Q1AZ71"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ71"
FT                   /protein_id="ABG03307.1"
FT                   /translation="MAGTTRCAYDTSDVSGESSHRRNARCLKALALLYLALVGASFLLV
FT                   YGDAYEPAVHMLLFLAACSVGATASVAVLLLPVEQFSGGFSGGVYALLAASTAMMTFFS
FT                   GGTSSELYLLFFPLLLAAALHGSWRVALFALASVLLFYALAVMPGLLNEEADASVAAPV
FT                   LYRLAALGLTGAFVAAASRLSSGGGEEEYIVPDEDGSLLLERVEREISARRGVQVAVIL
FT                   VDPGRGVEDVEALLERVRARIAEPVLLGEGAVFGMVLSGVGDREIESAARRALAAAGSL
FT                   GAGETRAGVAVYPRDARSAEDLLVAAGRALEAAFEVDSPSAIVLAGRRAAREEGRRAAR
FT                   "
FT   gene            355683..356372
FT                   /locus_tag="Rxyl_0332"
FT   CDS_pept        355683..356372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0332"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tel:tll1692 lipid transfer protein M30
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03308"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ70"
FT                   /protein_id="ABG03308.1"
FT                   /translation="MEERNPEILLENAVQDELENLKKLQVAAARTMAYEKMLANDAAAK
FT                   QKLVAARERQAQELLARGQREAAIEVIQQKQEAQASLAELEGRLEEARRNSQEMERAFR
FT                   EQERRYNEVVRERAALMEEHQRARALRMANEARASISLSDSSRDLEKARQAIRQASYEA
FT                   EAVGELSVSETERQIAAAEVDLKRLEAERELEEMEVRMGLREPGQIGPGAAPAEERERR
FT                   GGEENRG"
FT   gene            356365..357156
FT                   /locus_tag="Rxyl_0333"
FT   CDS_pept        356365..357156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03309"
FT                   /db_xref="GOA:Q1AZ69"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ69"
FT                   /protein_id="ABG03309.1"
FT                   /translation="MARRRSGSLLVRLAPLGSLGGLGMLAVAGEHYALAGLLGAGAAVA
FT                   GYRLLDREGNARRELWRRARSNVRALERVAREDPVSAPQMRRIAELQGGLLESWELLPE
FT                   QYRPLLDEDVFTVVEEVENAVRLARRRAALRRHLDGMERQDIRRRIRSLQEDLAQLEEG
FT                   SPLRATFERALAGRRAELAGYEEMLDGVSMINAQLESAESLLGSLRGDLLTLEAGLAPQ
FT                   ALEGGLDRLKERVALFKRSMDEVTRAVGKLHERATEELPAR"
FT   sig_peptide     356365..356451
FT                   /locus_tag="Rxyl_0333"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.955) with cleavage site probability 0.784 at
FT                   residue 29"
FT   gene            357153..357806
FT                   /locus_tag="Rxyl_0334"
FT   CDS_pept        357153..357806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03310"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ68"
FT                   /protein_id="ABG03310.1"
FT                   /translation="MSEEHHGRQGFFSRIFSPEPEEEQHTTVYSAEDLEPGEDEEREGT
FT                   RRFTVERAAEIIRNLPPEVPRSSAVRIVRQTLIAAGIDIEELASSTRARESKLNSEISL
FT                   RQKRIQDLKERTEEVVRQLEEEIRKAREARNTGIAEEERRIARAREGLEDVERVRDFFG
FT                   LPRGDSEYTPPPEQGEETQVMDRPREGGGEDEDDTRVIRRPGPLSEGWEDRGER"
FT   gene            357803..358264
FT                   /locus_tag="Rxyl_0335"
FT   CDS_pept        357803..358264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0335"
FT                   /product="heat shock protein DnaJ-like protein"
FT                   /note="PFAM: heat shock protein DnaJ-like; KEGG:
FT                   xcv:XCV0501 DnaJ-related chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03311"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ67"
FT                   /protein_id="ABG03311.1"
FT                   /translation="MSIPRRLGRLARGFVSSLQEDERFRESLAEALRVGRERRETLREA
FT                   FEAAWRGAAEEWRSSEERRSASEGAGWRQTSATFRAVRYPPEVLEAYERLGLSPGTPIA
FT                   EVDRRRRELVKKYHPDRFTDPAKRARAERVTAEINAAHDRIERHLLRRA"
FT   gene            358369..359760
FT                   /locus_tag="Rxyl_0336"
FT   CDS_pept        358369..359760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0336"
FT                   /product="selenium-binding protein"
FT                   /note="PFAM: selenium-binding protein; KEGG: reu:Reut_B5039
FT                   56kDa selenium binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03312"
FT                   /db_xref="GOA:Q1AZ66"
FT                   /db_xref="InterPro:IPR008826"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ66"
FT                   /protein_id="ABG03312.1"
FT                   /translation="MASWRPDPTFYPSPKMAMQAPRERLGYVALLDPGRERPDALGVLD
FT                   LDPDSGTYAQIVGRVEMPNAADELHHFGWNACSAALCPYAPHPHVERRYLIVPGIRSSR
FT                   IHIVDTKPDPREPRIVKVIEPEELHRRTGYSRPHTIHCGPDGVYVSALGSPEGDGPGGV
FT                   FVMDHESFDPLGRWEVERGPQQLAYDFWWHLGYDTMVTSEWGTPNMIEGGLDPQILLNK
FT                   GYGRRLHIWDLRRRRHLQALDVGEEHQMVLELRPAHDPARTYGFVGVVVSLEDLSASVW
FT                   LWHRQNGSWGIRKVIEIPAEPAEPDQLPPLLKDFGAVPPLVTDINLSLDDRFLYVSCWG
FT                   TGELRQYDVSDPFNPRHTGSVRLGGIVRKAAHPASGPLNGGPQMVEVSRDGRRVYFSNS
FT                   LYASWDEQFYPVGIRGWIAKAEADPGGGLSLDPGFFTEVGDGLRPHQIRLEGGDSSSDS
FT                   YCYPS"
FT   gene            359757..360392
FT                   /locus_tag="Rxyl_0337"
FT   CDS_pept        359757..360392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B5040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03313"
FT                   /db_xref="GOA:Q1AZ65"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ65"
FT                   /protein_id="ABG03313.1"
FT                   /translation="MSGGWPWIALAALGAYHGLNPAMGWLFAVALGLQERRRGAVLGAL
FT                   PPIALGHAAAVAAALLVLGAAGLAAPPDLLRYGCAAVLVLFGLYRLLRRRHPRWVGMRV
FT                   GFRDLAAWSFLMATAHGAGLMLFPVLLGLSSGHGAHAAHAGMAAPGGLWTGLAAVGLHT
FT                   LAMFAVMAAVAVVVYERLGVMILKRTWFNLDLLWAGVLIGAGVLTLFV"
FT   gene            complement(360389..361012)
FT                   /locus_tag="Rxyl_0338"
FT   CDS_pept        complement(360389..361012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0338"
FT                   /product="peptidase C60, sortase A and B"
FT                   /note="PFAM: peptidase C60, sortase A and B; KEGG:
FT                   sth:STH2376 sortase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03314"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ64"
FT                   /protein_id="ABG03314.1"
FT                   /translation="MFGSARPTTALLAAALLFLLLAAAPVLPETDAASVRLAEPARLLG
FT                   EGGTLPPERAARPEPRGEARGAAMTLTVPRLGIRDLPVPTGSTQRELDREGILHLAGTG
FT                   PPWREGSNTFIAGHALGFRQTRVPYVFYRLERLRPGDEIIVRDRRGAAYVFRVYDRLTV
FT                   RPQDYWVTYPVAEQTTISLQTCVPVPTFERRLVVRGELVRRPPG"
FT   sig_peptide     complement(360941..361012)
FT                   /locus_tag="Rxyl_0338"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.618 at
FT                   residue 24"
FT   gene            361061..361894
FT                   /locus_tag="Rxyl_0339"
FT   CDS_pept        361061..361894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0339"
FT                   /product="phage integrase"
FT                   /note="PFAM: phage integrase phage integrase-like SAM-like;
FT                   KEGG: pca:Pcar_0623 site-specific recombinase, phage
FT                   integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03315"
FT                   /db_xref="GOA:Q1AZ63"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ63"
FT                   /protein_id="ABG03315.1"
FT                   /translation="MRVDELVEEFAAVLADDPDTSPRTAEFYAADLREFARFLAERGVE
FT                   EAREIRAGHVMEFRNHLLEGRRKRFTVYRKDAAVRRFLEWVRTSTDAGLELDPIEPVHQ
FT                   PLDQRIVFLEDEEVDQLLSFPLNRREDLRDAAVIRLMLETGVTVGEIRALLRSDVDLEA
FT                   GQVRLGGPGSHLAPRTRRISPETARVLRRYLESRDDDTPELIVGRAARPVATSKALQNA
FT                   VWKRCEQVGMWRVSPMNLRHTFAVRLLRRGATLNELREAMGVRDTTNIGVYRKFV"
FT   gene            361959..362288
FT                   /locus_tag="Rxyl_0340"
FT   CDS_pept        361959..362288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03316"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ62"
FT                   /protein_id="ABG03316.1"
FT                   /translation="MAGGKDFKRGSAEILADLLSEEKVRRVRDYVQSEEFRTERERIKR
FT                   EAVDRLKELRERYRSRGRSPEKAAREREINLRLAEIEAEAAELRLRLSGLLEEEERLRR
FT                   ELAGL"
FT   gene            362408..366877
FT                   /locus_tag="Rxyl_0341"
FT   CDS_pept        362408..366877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0341"
FT                   /product="glutamate synthase (NADH) large subunit"
FT                   /EC_number="1.4.1.14"
FT                   /note="PFAM: glutamine amidotransferase, class-II glutamate
FT                   synthase, alpha subunit-like ferredoxin-dependent glutamate
FT                   synthase glutamate synthase; KEGG: mca:MCA2039 glutamate
FT                   synthase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03317"
FT                   /db_xref="GOA:Q1AZ61"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ61"
FT                   /protein_id="ABG03317.1"
FT                   /translation="MTLKTGLYDPAYEHDACGFGFVARVDGRKTRETVEEGLEILRNLE
FT                   HRGARGSDPETGDGAGILLQLPDAFFRREAGRLGIELPPPGHYAVGTLFESEEGLGAER
FT                   MLEEIAAEEGQRVLGFRDVPVDAERCGRLARRVMPRIRQFFVGREAPDEMAFERKLYVI
FT                   RRRLHKAVADTHACYVVTLSSRTIVYKGLLTGVQLPEFYLDLQDPAVQSAIALVHARFS
FT                   TNTLGSWELAHPYRYVAHNGEINTLRGNINWMRARESRLESELFGEDLGKISPVIQPGG
FT                   SDSAAFDNVLELLYLAGRSLPHAVAMMVPEAWENDELMDPERRAFYRYHSALMEPWDGP
FT                   AAVAFTDGRLIGATLDRNGLRPARYSVTKDGRVIMASEDGALRVPAEEVVERWRLQPGR
FT                   MLVVDTERHEILHDEDVKRPLFRRRPYARWLEEQEIHLDELPDVEPDPRPEPATLFERQ
FT                   RAFGYTVEDLRLLLTPMARGGKEPDGSMGTDTPLAVLSERPQLLFNYFKQHFAQVTNPP
FT                   IDPLREELVMSLKMSLGPEQNLFDETPRHCRRVLLDHPILTGPELEKVRHLGREPFSAT
FT                   TLSALFPAAGGGEGLRRALESLCERAERAVRGGSPVLVLSDRGVSHNQAPIPSLLATAA
FT                   VHHHLVRRGIRTATTLVVETAEAREVHHFALLVGYGATAVSPYLAFETIEKLARDGMLG
FT                   GVGPEEAQENYIKAVQKGLLKILSKMGISTLLSYCGAQIFEAVGLSREVIDRYFTGTAS
FT                   RIGGVGLEEIAREVLMRHEAAFRAGELGPEELDVGGEYQQRQQGQYHQWNPETIVPLQR
FT                   AVRTRSFETFKEFTRHFDERSARFATLRGLLEFEEDPIPLEEVEPAREIVRRFTTGAMS
FT                   LGALSKEAHETLAVAMNRIGGKSNTGEGGEDPERFGDERRSAIKQVASGRFGVTTEYLV
FT                   NADMLQIKMAQGSKPGEGGQLPGHKVSGYIAKIRYSTPGVGLISPPPHHDIYSIEDLAQ
FT                   LIHDLKNANPRALVSVKLVAEAGVGTIAAGVAKAKADHITISGHDGGTGASPLSSIKHA
FT                   GLPWELGLAETQQVLVQNDLRGRVVLETDGQLKTGRDVVVAALLGAEEFAFSTAPLVTV
FT                   GCIMMRVCHLNTCPVGVATQDPVLRKKFAGAPEHVINYFFFLAEEVREYMARMGFRTFE
FT                   EMVGRCDRLRPRAALDHWKARGVDLSPLLHRPQIPQGVAIRHVQQQNHNLEKALDNELI
FT                   RRCRPALEGGEPVRFSRLILNTNRTVGGMLSGEVARRYGQEGLPDGTIRIDFKGVAGQS
FT                   FGAWLAKGITFTLEGTTNDYAGKGLSGGRLAVFPSREAAYRPEEAIVVGNVALYGATGG
FT                   EAYFRGFAGERFCVRNSGARAVVEGVGDHGCEYMTGGVVVVLGPTGRNFAAGMSGGMAF
FT                   VLDEESRFEKLCNTDMVGLEAVESEEDVALLRGMVEAHLRWTSSAVARRVLEEWEALLP
FT                   KFVKVMPHDLRRVLEERRRAEEEVEVAG"
FT   gene            366877..368304
FT                   /locus_tag="Rxyl_0342"
FT   CDS_pept        366877..368304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0342"
FT                   /product="glutamate synthase (NADH) small subunit"
FT                   /EC_number="1.4.1.14"
FT                   /note="TIGRFAM: glutamate synthases, NADH/NADPH, small
FT                   subunit; PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mpa:MAP0173 glutamate synthase
FT                   (NADPH) small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03318"
FT                   /db_xref="GOA:Q1AZ60"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ60"
FT                   /protein_id="ABG03318.1"
FT                   /translation="MGDPKGFLKIGRKPVPKRPVEERVRDYRWVYEPMPEGELRRQASR
FT                   CMDCGVPFCNTGCPLANLIPDWNDLVYRDHWREAIDRLHATNNFPEFTGILCPAPCEAA
FT                   CVLSINDRPVTIKEIERSIIERAFEEGWVVPKPPPPERRTGKRVAVVGSGPAGLAAAQQ
FT                   LNRAGHSVVVFEKDDRPGGLLRYGIPDFKMEKWVIDRRLRQLEEEGIEFRTGAYVGYDP
FT                   TAEELRRGFDAVVLAVGALQGRDLPVPGRELRGIHLAMEYLVQQNRRVAGLPVEGEEIT
FT                   ARGKHVIILGGGDTSADCLGNVHREGCASVRVLTHGPKPPESPDPLEWPDWPFVLHTYP
FT                   AHEEGGERGWNVAVTGFSGEGGRVRRMHCVRTRRDPDGRTHHLPGTEFELEADLVLLAI
FT                   GFTGPVRDRLLEELGVEFGPRGAIATREGFDTGIPGVFVAGDARRGADLIVTAIAEGRK
FT                   AARQVDAYLMGRSLLPG"
FT   gene            complement(368305..370032)
FT                   /locus_tag="Rxyl_0343"
FT   CDS_pept        complement(368305..370032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0343"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11 Methyltransferase
FT                   type 12; KEGG: dra:DR1078 antibiotic biosynthesis protein
FT                   LmbJ, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03319"
FT                   /db_xref="GOA:Q1AZ59"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ59"
FT                   /protein_id="ABG03319.1"
FT                   /translation="MPIQDPHLPPPGLVVHADWSLHPAKRWMAAAVLRDGRYSVLAPEP
FT                   VGEPSTFLERMRERAAPGAGVFAGFDFPIGLPARYARLAGIDEFLPLLPRLGEGEWSGF
FT                   YEVAERPEQVSARRPFYPRRPGGAALRHLLDALGLGSADELLRECERGYPGRPPASPLF
FT                   WTIGPGQVGKAAISGWRDLLAPALRGSGPDVAVWPFDGALRELLRSREITVAETYPAEF
FT                   YRRLGLKPGSKRNREDRRANAPILKEWAGRLGARLTPQMSAAVEDGFGPGASGEDPFDA
FT                   AVGLLGMLAVALGHLPPGDPPDPQVRRVEGWILGSPPREGAREASAPPAEYDPLADLYD
FT                   REYAHDHDVPFWLALAGREGGPVVEWGAGTGRIAVPLAGAGHDVAAVELSEAMAARGRK
FT                   KGGAVQWVVGDMRGARLGRAFRLAVCAFNSFLCLLSVEDALAFLRNAREHLVPGGLLGV
FT                   EVSAFAPEELADPPGGATLRHDLTRKTPEGRLERFSVSRYDAASQLLEMRLFYELYGES
FT                   GELESRRAHDLTIRVTGRDELLLMLRLAGFEVEAVYGGFEGEPFTAASDHLIVLARRS"
FT   gene            370137..370697
FT                   /locus_tag="Rxyl_0344"
FT   CDS_pept        370137..370697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0344"
FT                   /product="LemA"
FT                   /note="PFAM: LemA; KEGG: bcl:ABC1505 Listeria epitope LemA"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03320"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ58"
FT                   /protein_id="ABG03320.1"
FT                   /translation="MGTVLTIIVVVAVVAVAVYAVATYNGLVRRRNEVEEAYRQIDVQL
FT                   KRRYDLIPNLLEGVKRYFRQEQDVLTEITRARSAAMQPHSPREQAQAEARLSGAIGNLF
FT                   AVAENYPELRSERVLLDFQEELASTENKISFARQHYNDSVQAYNTKIQSFPAVIFARAM
FT                   GFTEKEYFEAAGPERESVTVSYD"
FT   sig_peptide     370137..370199
FT                   /locus_tag="Rxyl_0344"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.968) with cleavage site probability 0.817 at
FT                   residue 21"
FT   gene            370702..371661
FT                   /locus_tag="Rxyl_0345"
FT   CDS_pept        370702..371661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0345"
FT                   /product="HtpX-2 peptidase. Metallo peptidase. MEROPS
FT                   family M48B"
FT                   /note="PFAM: peptidase M48, Ste24p; KEGG: det:DET1587
FT                   peptidase, M28 family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03321"
FT                   /db_xref="GOA:Q1AZ57"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ57"
FT                   /protein_id="ABG03321.1"
FT                   /translation="MPASGEMVGTFRDRIAVNRRNSLLLVAVFLAFVTALGYVVGYAWV
FT                   GDPAGAVFGLLLALAAGTVSGFATYYAGDRMVLAASRAREITHDDAPVLFNVVEEMAIA
FT                   GGLPMPEVYIIEDSAPNAFATGRDPEHAKIAVTRGLLEKLDRDELQGVIAHEMAHVGNY
FT                   DIRYAMLVGVLVGTTVLISDFFLRGLWFGRGQRRGEGGGQIQLVMFLIALVLAILAPLF
FT                   ARLLQLSISRQREYLADATAVQLTRNPKGLADALQKISSDREVLEVANRATAHLYIVNP
FT                   IKKFERRARGLFSTHPPIEERIRILRSMETGGIPQQAR"
FT   gene            371715..371785
FT                   /locus_tag="Rxyl_R0005"
FT                   /note="tRNA-Gln1"
FT   tRNA            371715..371785
FT                   /locus_tag="Rxyl_R0005"
FT                   /product="tRNA-Gln"
FT   gene            complement(372049..372819)
FT                   /locus_tag="Rxyl_0346"
FT   CDS_pept        complement(372049..372819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0346"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   gka:GK1683 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03322"
FT                   /db_xref="GOA:Q1AZ56"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ56"
FT                   /protein_id="ABG03322.1"
FT                   /translation="MRLEDRVAVITGAASGQGRAAAKLFASEGAKVVAADIDEGGAQRT
FT                   VEEIKEAGGEATAVKVDVSREPDVRAMVESATDRYGRLDVLFNNAGVGYSASGRMKMAS
FT                   VVETPEKDWDAILAINLKGVALGCKHAIPVMERQGYGSIINNASINALVGLPGADAYTA
FT                   AKGGVVAFSRVLAVEWGPRGIRVNCICPGGVDTPMIAPVISDERVMQSMRQNTPLGRLA
FT                   RPEEIASVALFLASEEASYLNGAIIPVDGGWTAH"
FT   gene            complement(372838..373440)
FT                   /locus_tag="Rxyl_0347"
FT   CDS_pept        complement(372838..373440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0347"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: pfo:Pfl_3944
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03323"
FT                   /db_xref="GOA:Q1AZ55"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ55"
FT                   /protein_id="ABG03323.1"
FT                   /translation="MAERFDSTSARLHAAAAGLFWNKGYAATTTRELASLLGLQKASLY
FT                   HHMESKEELLYSLCVESLGNIRSAVEEAVGEAGDPLERVRALIRAHVVSMLVDKEKHAT
FT                   MLTELRSLSEERRREVIRLRDEYERIVRSVLAEGQRAGVLRGDLPAKHLALCLLDLMNW
FT                   AIFWFRSGEELSPERLAGVFTTLFLEGAGSKGEPPPS"
FT   gene            373796..374773
FT                   /locus_tag="Rxyl_0348"
FT   CDS_pept        373796..374773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0348"
FT                   /product="Pyruvate dehydrogenase (lipoamide)"
FT                   /EC_number="1.2.4.1"
FT                   /note="PFAM: dehydrogenase, E1 component; KEGG: tte:TTE0186
FT                   Thiamine pyrophosphate-dependent dehydrogenases, E1
FT                   component alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03324"
FT                   /db_xref="GOA:Q1AZ54"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ54"
FT                   /protein_id="ABG03324.1"
FT                   /translation="MEEREMPERERLLDFYERMVRCMLWEQKLLRFIDEGKISGFYHAG
FT                   RGQEGTQVGAVAALGPDDYMMYAHRGCGYMVARGMPMSKLFGDFLANTEGSTRGLGAGI
FT                   VHIAWPQLGILGQSGTLGGCFPIAAGAALSAKYRGTDQVCLCFFGDGTANRGTFHEAAN
FT                   AASVWKLPVIWLCENNQWAVSVSVREATAVKQIADRAGAYGMPGEVVDGQDVVAVYEAV
FT                   SRAVERARRGEGPSLIEAMTYRFRGHYEGDPDTYRDREEVERWRKERDPILLLANRLRS
FT                   EGLASEQDLEQIRARVQREVDEAAEEALGAPMPERERIFEFVTA"
FT   gene            374792..375784
FT                   /locus_tag="Rxyl_0349"
FT   CDS_pept        374792..375784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0349"
FT                   /product="Transketolase, central region"
FT                   /note="PFAM: Transketolase, central region
FT                   Transketolase-like; KEGG: sso:SSO1526 pyruvate
FT                   dehydrogenase E1 component, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03325"
FT                   /db_xref="GOA:Q1AZ53"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ53"
FT                   /protein_id="ABG03325.1"
FT                   /translation="MPGTISYTEALREALDEELGRDERTFFMGEDVGAFGGIFGEAAGL
FT                   QQKYGKERVFDTPISETFIVGGGVGAAITGLRPIVELQFADFVSVAMDEIYNKAAKWRY
FT                   MHGGLFKVPLVIIAPEGAMGGAGPEHSQCPEALFWSAAGLYVLTPATPADAKGLLKSAI
FT                   RDDNPVLFLPHKALGNTTGEVPEGEHLVPLGEAVVRRQGGDVTLVAWSAMVLKALEAAD
FT                   RLAEEGIEVEVIDPRGIRPFDFETVLRSVEKTGRVVLAHEAPLPGGPGSEVAAVIAERA
FT                   IASLEAPVRRVGAPDVPVPQSAHLERFVVPQTEDIVNAVREVAGSAVTV"
FT   gene            375803..376993
FT                   /locus_tag="Rxyl_0350"
FT   CDS_pept        375803..376993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0350"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /note="PFAM: biotin/lipoyl attachment catalytic domain of
FT                   components of various dehydrogenase complexes E3 binding;
FT                   KEGG: tfu:Tfu_3051 pyruvate dehydrogenase complex, E2
FT                   component, dihydrolipoamide acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03326"
FT                   /db_xref="GOA:Q1AZ52"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ52"
FT                   /protein_id="ABG03326.1"
FT                   /translation="MHKLHLPRLGQTMERGTILRWARREGEPFEVGDILYEVESEKAVN
FT                   EIEAKLPGTLARITVEEGQECPVGTLLAVVADPGETLSEEEIEAAIAEEGGREAPAASG
FT                   GGTGVRAPSSARAQRRVRAMPKARALARELGVELAAVEGTGQGGAITVEDVRRAAGAAP
FT                   GEGPRVRERRPLGDVGRTMARVVTRSWHEVPQFVQMVQLDASALVGRRRELAGQIKRSH
FT                   GVDLSYTDLLLEAVAGAAGEEPLANSSLVDGEILLYEDVNVSVAVATGSGLLVPVVRWA
FT                   QALELGELAARLREVLERARSGRLSAEDTAGGTITLSNLGMYGIEGGTPLVTHPQAAVV
FT                   FAGAIVERPWAVSGRVEVRPTLTLSVGFDHRILDGVAAARFTTALRRRLESPNQEG"
FT   gene            377009..378082
FT                   /locus_tag="Rxyl_0351"
FT   CDS_pept        377009..378082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0351"
FT                   /product="Alcohol dehydrogenase GroES-like protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding Alcohol
FT                   dehydrogenase GroES-like; KEGG: bur:Bcep18194_B1325
FT                   zinc-containing alcohol dehydrogenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03327"
FT                   /db_xref="GOA:Q1AZ51"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ51"
FT                   /protein_id="ABG03327.1"
FT                   /translation="MPEKKMMRAAVYRGPRELRVEPVPVPEIGPSDVLVRVHSCGICGS
FT                   DLHSYKAGMYIRPGQIMGHEFMGTVAAAGEDVEGVEEGDRVTGFSIGVCGSCYWCSRQQ
FT                   YILCPELFRNSTGYGLPGGFAEYVPIRNAVVGQSIHPVPSELDDETAATTEPVSVGVGA
FT                   IEAAGVRPGDRVVVLGAGMIGNACMQAARAAGAGQVAVIDVSPVRLEAARSLGADAVFD
FT                   ARTGDALSWVKELWGVGRYHFNEGGMADVVVEAAGAPVTVQQAFEMVRSGGAIVFVGLP
FT                   EEPAPIDVTKIVHKQPRIVGSLGGDFARAIELMASGSIRTKELITHRFPLEDAAEAFET
FT                   QLRTGEAMKVMIQPREG"
FT   gene            378084..378896
FT                   /locus_tag="Rxyl_0352"
FT   CDS_pept        378084..378896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0352"
FT                   /product="putative cyclase"
FT                   /note="PFAM: putative cyclase; KEGG: cps:CPS_3501 putative
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03328"
FT                   /db_xref="GOA:Q1AZ50"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ50"
FT                   /protein_id="ABG03328.1"
FT                   /translation="MPIIESAGVAGVLSGVRKGRVYDLGVPLKNFMPHAPLHPPFIFAQ
FT                   WAMHGDYHNGSCTPSNDLIVMGGHVGTHVDALGHIAREGRLYGGAEASEVQHGQLGLSE
FT                   GGVDQIPPVIRRGVLLDVAGHLGVERMEPNQPVGAELLEAVAEGQGVEVGEGDVVLVRT
FT                   GWIQTFEDGPTFVGDKGGCPGVDLDGARWVSGRGAYMTGADTLAYEVWPSHELPVHAHL
FT                   IPESGIPIIEMLDLEELAADGVHEFAFVMIPLNIKGGTASPVRPLALV"
FT   gene            378906..380468
FT                   /locus_tag="Rxyl_0353"
FT   CDS_pept        378906..380468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0353"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   nfa:nfa55900 putative acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03329"
FT                   /db_xref="GOA:Q1AZ49"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ49"
FT                   /protein_id="ABG03329.1"
FT                   /translation="MEGYPNANWRKLILGEMLARVSRKQPEKLALVFEGTRLTFADLDG
FT                   RVNRLANALASRGVAKGDKVAVLSYNSHRVVEAYFACHKLGAVAVPVNFRMVEGEVRYV
FT                   LSDSGARTLLFGEGFGGMAESIVGDGAVALAVDMDGDAGGFAEGYERLVSTAGPGEPAV
FT                   EVDDDDDAFIMYTSGTTGFPKGAVLTHKNLWMNTANWIMEMQVTGGSVWLSGLPLFHIG
FT                   GVNGVLPFIYLGGTNVITPSGGFDPEAMLRLMEKERVTHCYFVPAQWQQFLELDLSRYD
FT                   LGSLRKALWGASLAPMRVLEGMAEAFPSVEIVNAFGQTEMSSNTTFLKGEDAVRKMGSV
FT                   GLPAVNVEVRIVDDENRDVPEGEVGEIVYRGPTVFKGYHNDPEATAEAFEGGWFHSGDL
FT                   VRRDGEGYIYVVDRKKDMFISGGENIYPAEVERVISTHPAVAEVAVIGVPHEKWGETPK
FT                   ALVVPREGQRLTREEVIEHCRKHLAGYKKPTYVAFVEELPRNAAGKVLKRELRRLHGGS
FT                   DDA"
FT   gene            complement(380534..380947)
FT                   /locus_tag="Rxyl_0354"
FT   CDS_pept        complement(380534..380947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03330"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ48"
FT                   /protein_id="ABG03330.1"
FT                   /translation="MNGGSFRPGKREDYIHLVEERYFANVDHKNLEAVLDCFTEDATFT
FT                   IQSAFSTHRGRDTGIRRMFERLFERYSKTVHRGFRHVVDIEGECCASQFEVENVSARDG
FT                   TETRLSNCNFFYLEGGRFKRVYVYMSGGMNTLG"
FT   gene            complement(380944..382359)
FT                   /locus_tag="Rxyl_0355"
FT   CDS_pept        complement(380944..382359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0355"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein-like protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein-like FAD dependent oxidoreductase; KEGG:
FT                   sil:SPO1469 3-ketosteroid dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03331"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ47"
FT                   /protein_id="ABG03331.1"
FT                   /translation="MAAEVSSAGEVRFREGRPVVVVGAGGCGMAAALAASRSGARVLVL
FT                   EKGSEPGGNTALSTGLIPAAGTRFQREAGVPDDTPELMAEDIFRKNKRASDPALTRHLC
FT                   ETSAGLVEWLADEVGCELVCHTDFLYPGHSRFRMHGPPRGYGAELVRQLAGAVERDPSI
FT                   ELRLETPVRGLVLDEGRVVGVKTGGGSIEAGAVILALDGFGGNPEMVRKHLGPEVAAAP
FT                   YFGSPNNTGDGIRWGIAAGAAAGYLDAYQGHGSVAVPGGPLVTWGLVMNGAILVNRHGR
FT                   RFGDESRGYSEFAREVLAQPGGEAWEIFDQRAHDASRGTRFEEVISAGRVVRGGTLEEL
FT                   ASALGLPAAALAETVATVNRAAGGEGSDPFGRTAFAGGLSEPPFYGIHVRGALFHTQGG
FT                   LRVDTGARVLRPDSSPIPGLYAGGGTAAGISGNGAEGYLAGNGLLAALGLGRTAGETAS
FT                   RELKNAAQTRRQP"
FT   gene            complement(382349..383050)
FT                   /locus_tag="Rxyl_0356"
FT   CDS_pept        complement(382349..383050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03332"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ46"
FT                   /protein_id="ABG03332.1"
FT                   /translation="MNVRIRAITPIRVSEAELARRQARYESLSPPGVEVELANLPDRPG
FT                   VPHRLDSARDIRFSEELVIEEALRTDPARHDAVLPDCVLDPGLDRLERESPVPAFGILK
FT                   LSAGLLVSLGHRFAAFTRNRPIGEELRDRLEAYGFLPSFDRVEVLDLAFEAIADDEGWN
FT                   EALRESGQRFSGSSTTAVINGCSAVELRPAGNAVAVVDPTRLALSLLGLAAGEGLGPLG
FT                   RPGRRGGGLGR"
FT   gene            complement(383047..384411)
FT                   /locus_tag="Rxyl_0357"
FT   CDS_pept        complement(383047..384411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0357"
FT                   /product="MmgE/PrpD"
FT                   /note="PFAM: MmgE/PrpD; KEGG: bbr:BB1350 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03333"
FT                   /db_xref="GOA:Q1AZ45"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ45"
FT                   /protein_id="ABG03333.1"
FT                   /translation="MRQGTVPPAEPSRRTAAALEDLGRFVSGLDPADHPGLREPLLRTL
FT                   LDTLGVSVAGSRTPELRALVAAWEPPPGPAAIFGAGVRTVPETAAYLNGVSAVTLELDE
FT                   GNKYARGHPASHVFPAALAVAQARGATGRELAAALLAGYEVASRFGRATRLRPGVHPHG
FT                   NWGTAGAAAAVARLMGLDAPAVADALDVACATVLATPFEAALAGSAARNGWVGTSNVSG
FT                   IAAARMAAAGIAGNAGLAAVTLGDILGELDPEELTRGLGERFDIERGYFKRHASCSYTH
FT                   PPADAVLEILRENPRLDPARVRQITVETHGLAAPLNRTDCPTRLAAMFSIPYVVSVALV
FT                   TGGCGPEAFGDARRADPAVRRLMRVTRVAAAEEINRRLPEERAARVKITLDDGTSLAAE
FT                   VPNPVGDAAHHPFGLREIRQKLDGLLGREAAEAIESIAQDLPECENVNDVLERSP"
FT   gene            complement(384419..385870)
FT                   /locus_tag="Rxyl_0358"
FT   CDS_pept        complement(384419..385870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0358"
FT                   /product="Dihydropyrimidinase"
FT                   /EC_number="3.5.2.2"
FT                   /note="PFAM: amidohydrolase; KEGG: ana:alr5010
FT                   D-hydantoinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03334"
FT                   /db_xref="GOA:Q1AZ44"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ44"
FT                   /protein_id="ABG03334.1"
FT                   /translation="MARFDTAVVNGTAVLPGHGAIAADIGIKDGRIAALGDSIPASDAE
FT                   EVIDAEGRLVLPGAVDAHFHLGIYRDIAEDARSETASSLAGGVTSVISYFRTGSHYLEK
FT                   SGPYAEIYPEVLEKTAGNSWVDYGYHLAPMVRDQIREIERLVNEDGVASFKYYMFYKGM
FT                   DLAGQPGESETMSEVYDLGHMFEIMEEVARLQASRTDGSRISLSIHCEQPELIRVFMER
FT                   VQSEGVLEGLEAYSAARPPLTEHLAVAEVGVLAGHTRCPVNLLHLSSEEALEAAVELKR
FT                   RHPSLDARLETTLHHLALTYETYNDQRGKVNPPIRAQSDVEALWRGVLRGEIDWVCSDH
FT                   ACCSEEHKEGELWRALPGFGGTALIYPFMLTEGRRRGLSLERIVELVATNPARAYGLAP
FT                   RKGAITIGADADLAIVEMEETHAVTPERLLSAQEYTPFEGMELAGWPVRTLLRGRTAFA
FT                   GGETVGEPAGSYLKRPLAAEPIPAS"
FT   sig_peptide     complement(385802..385870)
FT                   /locus_tag="Rxyl_0358"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.600) with cleavage site probability 0.597 at
FT                   residue 23"
FT   gene            complement(385904..386605)
FT                   /locus_tag="Rxyl_0359"
FT   CDS_pept        complement(385904..386605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0359"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   sak:SAK_1594 hydrophobic amino acid uptake (HAAT) family
FT                   ABC transporter, ATP-binding protein LivF"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03335"
FT                   /db_xref="GOA:Q1AZ43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ43"
FT                   /protein_id="ABG03335.1"
FT                   /translation="MLALENVSAGYGNLQVLHGISLEVQPGELVAIIGANGAGKTTTLR
FT                   TISGFIRPSSGSISFEGEPLAGKRPHDIARRGLVQVPEGRSLFGGLTVLENLSMGGYTR
FT                   TAAEREEALREVYELFPVLKERRDQPAATLSGGQQQMVAIGRALMARPRLLMLDEPSLG
FT                   LDPKTTGRVFSVVERIRQTGVAVLIVEQDAVKTLRLADRAYVLESGEVALQGTGSELLE
FT                   DQKVRSAYLGL"
FT   gene            complement(386592..387323)
FT                   /locus_tag="Rxyl_0360"
FT   CDS_pept        complement(386592..387323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0360"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   ape:APE2524 putative branched-chain amino acid transport
FT                   system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03336"
FT                   /db_xref="GOA:Q1AZ42"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ42"
FT                   /protein_id="ABG03336.1"
FT                   /translation="MTLLEVQDVSKSFAGLRALHSVSLQVERGSIVGLIGPNGAGKTTL
FT                   FNVIAGVMKPDAGRVLFDGTDVTGWPPYRIARLGIGRTFQLMKPFDTLSVLDNVTVATL
FT                   QRHRSRKEARRAATEVVERVGLGEWADRKASVLSTAGYKRLELAKALGLEPSLLLLDEV
FT                   LAGLVPAERARVVELLREIRAEGVTMLLVEHVMSAVMALSDHVYVLHHGEMLASGTPEE
FT                   VTKDPRVIEAYLGEEGHHAGA"
FT   gene            complement(387320..388321)
FT                   /locus_tag="Rxyl_0361"
FT   CDS_pept        complement(387320..388321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0361"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rpb:RPB_3618 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03337"
FT                   /db_xref="GOA:Q1AZ41"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ41"
FT                   /protein_id="ABG03337.1"
FT                   /translation="MGALRRFDRDLLVLAAGVLVLIPVPLFLSGFLLEVAIQTLLFGLL
FT                   GVAWNLMGGFAGQFSFGHAAFFGIGAYATAVAVTDYGLSPWVGMLLGAALAAAFGVLVG
FT                   FLSFRYGLKGVFFALATFAFAEMLRLISRSLEAVNAARGYNIPIRSGNPWLTLQFPQGS
FT                   PNYYYVILALLALSLLAVILLMRSRAGTFILSIRENEDAAAALGVNPMRYKLLAVALSA
FT                   ALTAVGGAFYVQYFFFIDPELAFGASVSIQILLPAIVGGIGTTWGPVVGSLIITVLGQG
FT                   STALVRTPPPFLEALQGVSGLDVAIYGALIVLVVLFLPRGVFGTLRERLGAA"
FT   gene            complement(388321..389211)
FT                   /locus_tag="Rxyl_0362"
FT   CDS_pept        complement(388321..389211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0362"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   cch:Cag_0852 branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03338"
FT                   /db_xref="GOA:Q1AZ40"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ40"
FT                   /protein_id="ABG03338.1"
FT                   /translation="MLVQALVTGLLLGGVYSLVSMGLTLIFGVLDILNFAHGAFMALAM
FT                   YASFVLVANAGFDPYLSLLVSVPLLFVLGVLVQRVLLARVMDQPHENQLLLTFGLALLI
FT                   ENALLMVFTATPRTVEFPYAQTGIPLGFATVRGPLDVFGAVADLPRVIAFLGSLVIAGG
FT                   LFYLLRRTSLGTAIRAVAENPDGAAMVGIDVRRMHMIAFGLGTACVAAAGTLVLPFLSL
FT                   QPTTGEQFNVIAFVVVVLGGLGNVVGALVGGILIGLVQELGGAFVPGVDKLFFVFVVFV
FT                   LTLLLRPQGLFGGKP"
FT   sig_peptide     complement(389143..389211)
FT                   /locus_tag="Rxyl_0362"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.740) with cleavage site probability 0.721 at
FT                   residue 23"
FT   gene            complement(389347..390588)
FT                   /locus_tag="Rxyl_0363"
FT   CDS_pept        complement(389347..390588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0363"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   ape:APE2521 putative branched-chain amino acid transport
FT                   system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03339"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ39"
FT                   /protein_id="ABG03339.1"
FT                   /translation="MRTRVQATLLMVAAALVVVACGGGGGASQGGSETIKIGSLHPLTG
FT                   PLAVDGKRMDQAVKMAIEDINKAGGIEALDGAKLEFISGDTKGEPETASSEAQRMIDEG
FT                   AVALVGPYTSATAATIARTAERSQVPFIIDVATADSILAQGYRYTFRIQPGSQTMGEYG
FT                   ARYLKEISEAQGSPVESVAYIHESSEFGTSVFEAFQKEAQRLGIEVVREITYDALNVSD
FT                   LTSELTQAKAADADVIVATGYYRDGLLLAQAAANVKPDVKAVYGVANGAFDLDTFPEDA
FT                   GDNGNYYLSSNYHYDATSDRARKLRQRFEERTGESMRTAAVFSYQAVEVIADALERAGS
FT                   SEPQELRDAIAETSLQTELFPFDGPIEFDDRGQNVNAQPIVMQVQDGEVVQVYPEKYAQ
FT                   EEPIFPATPWSEGR"
FT   sig_peptide     complement(390496..390588)
FT                   /locus_tag="Rxyl_0363"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.594 at
FT                   residue 31"
FT   gene            390810..391607
FT                   /locus_tag="Rxyl_0364"
FT   CDS_pept        390810..391607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0364"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: sth:STH2538
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03340"
FT                   /db_xref="GOA:Q1AZ38"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ38"
FT                   /protein_id="ABG03340.1"
FT                   /translation="MSSAGSAPRPGTEAAVRVADVLLLFASGPDALGVSEISRRLGLSK
FT                   AVVHRILRSLASRGLVSHDAESRSYGLGPAAAALGARALAGLELRRVALPVLRRLQRET
FT                   GETTTLSELVGTARVYLDQVPSLKEIKMTVEVGRPFPLHAGASSKAILAFAPPEVREHV
FT                   LEGPLEALTPLTVTDRARLEVELGQIRESGTAVSCGERQSGAGSVAAPVIGVDGYAVGS
FT                   ISVCGPVDRFGEETVERMRPLVLEAARGISRVLRGEAVDGRRG"
FT   gene            391609..392799
FT                   /locus_tag="Rxyl_0365"
FT   CDS_pept        391609..392799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0365"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /EC_number="2.8.3.16"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: sco:SCO2032 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03341"
FT                   /db_xref="GOA:Q1AZ37"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ37"
FT                   /protein_id="ABG03341.1"
FT                   /translation="MERHRALEGIKVIDAANLFAGPLAATILGDFGAEVIKVEHPRGDP
FT                   SRYHGYSKDGVGLWWKFLGRNKKCVTLNLSKPEGQEIFRRLAGDADVVIESFRPGTFER
FT                   WNLGYEELEKGNPGLILARVTGFGQFGPYKDRPGFGTLAESMSGFAYVTGQPDGPPTLP
FT                   PFGLADGIAALATAVAVLMALRARDVTGRGQVVDLAIIEPIFTILGPQPTVYDQLGIVQ
FT                   KRSGNRSVNNAPRNIYKTKDGHWVAVSTSAQNIAERVMRLVGRPEYVDEPWFQKGSERA
FT                   KHADELDEAVGGWISERTREEVMEAFEEAGAAVAPIYSIADIMEDPQYRALESIITVDD
FT                   PELGPIKMQNVLFRLSETPGEVRWSGPRLGEHNEEVYGELGLGRKDLEELAGKGVL"
FT   gene            392796..393656
FT                   /locus_tag="Rxyl_0366"
FT   CDS_pept        392796..393656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0366"
FT                   /product="Citryl-CoA lyase"
FT                   /EC_number="4.1.3.34"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: bte:BTH_II2226
FT                   probable citrate lyase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03342"
FT                   /db_xref="GOA:Q1AZ36"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ36"
FT                   /protein_id="ABG03342.1"
FT                   /translation="MTPTAAPPRSYLYVPGSDPRRIEKALSSEADAVVLDLEDAVAPDH
FT                   KEEARENVAGVLARANRKPVFVRVNAPGSALCGRDVEAVARPGLAGVRLPKTESAEEVR
FT                   RVAERLEELGCEAGVQCLIESALGLEMAFELARSHPRVTGLSLGEADLAADLGASGEEG
FT                   LLYARSRVVAASRAAGLQRPVQSVYTNVRDLDGLRRSTEAGKRLGFFGRSAIHPAQLPV
FT                   INEVFTPTEEEVAEARELLSRMEGAAASGSGAFVLEDGRFVDEAVVRAARFTLAVARGA
FT                   NGEER"
FT   gene            393653..394462
FT                   /locus_tag="Rxyl_0367"
FT   CDS_pept        393653..394462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0367"
FT                   /product="putative cyclase"
FT                   /note="PFAM: putative cyclase; KEGG: eli:ELI_08540 probable
FT                   polyketide cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03343"
FT                   /db_xref="GOA:Q1AZ35"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ35"
FT                   /protein_id="ABG03343.1"
FT                   /translation="MSRLLEVLEEGVEVFDLAQPLATETPHSPNHPPFRMSLMRRHGDM
FT                   VREDGSSAANEMIVTGGHTGTHVDALAHVSYRGELHGGVSAEEAQRGGRFRRHGVDAMP
FT                   PMVCRGVLLDVAALHGADALPGGYGITEEDLAAAARKAGVEVRAGDVALIRSGWGRYFG
FT                   DAHAFLGHDTGVPGPTEEAARWLADRGVRATGAETIAYEQIKPGVGHALLPVHRLLLVE
FT                   RGVHIIEVMNLAGLAEAGVSEFLFVLAPLKIVGGTGSPVRPLAVVGR"
FT   gene            394459..395877
FT                   /locus_tag="Rxyl_0368"
FT   CDS_pept        394459..395877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0368"
FT                   /product="MmgE/PrpD"
FT                   /note="PFAM: MmgE/PrpD; KEGG: bte:BTH_II2225 MmgE/PrpD
FT                   family superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03344"
FT                   /db_xref="GOA:Q1AZ34"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ34"
FT                   /protein_id="ABG03344.1"
FT                   /translation="MSGRTVLQEVSRFAARVRDEGIPPELLRDARRRVTDIVGIALAAS
FT                   AMEPARIVGEVVDAWGGAGQASAVGRGRRYPAASAALLNGTLAHALDYDDTHLPSVLHP
FT                   SAAVVPAALAAAEAAGAAGPQLLAAVAAGDELVVRVGMAGYDAKLGNSVFFEKGMHATS
FT                   IAGTLGAALAAAMVYGLGEEEIGHAVAIAASMGAGIIEANRTGGTVKRVHCGWAAHAGV
FT                   TAAELARSGLTGPPTVFEGRFGFLRAYLDDRAHPDAILRGLGEEWELPRIFFKPYPANH
FT                   FTHAGIDAALRLREEGLDVREVEAIELGVASPTLRTIAEPPEEKARPKSGYAAQFSGPF
FT                   AVATALVGGGGLGVSLEDFTDEAVRDRLKLDLASRVRCVADEECDRIFPNQFPAVLRVR
FT                   LRSGEVREARVLHNRGGPENPLSDEELEVKFRANAGRALSEERVGELWEALRSLGEADA
FT                   LEGITALVRESRPA"
FT   gene            395886..396809
FT                   /locus_tag="Rxyl_0369"
FT   CDS_pept        395886..396809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0369"
FT                   /product="luciferase-like protein"
FT                   /note="PFAM: luciferase-like; KEGG: sma:SAV589 putative
FT                   F420-dependent dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03345"
FT                   /db_xref="GOA:Q1AZ33"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019921"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ33"
FT                   /protein_id="ABG03345.1"
FT                   /translation="MHFGVVLQHFREHASPEAISEVARVAEELGYDSVWVMDHVVVPDV
FT                   PEARQFTPLVYDPLLTLAYVAAKTGRVRLGTSVLVVPYRSPLVQAKMLSTLDALCGGRL
FT                   ILGVGAGWLPQEFEALGVPFRGRGSLMDEYLEAMRVLWTSEGPASFRGPTVRFENVFCE
FT                   PKPVQRPHPPLWVGGGSEGALRRAARLGAAWHPSSRYAGVLAEKIEHLRRLSAAEGREP
FT                   PPVRMRATLRLLPEGGTATERGPLIGTPEEVRASIRAYAAMGVSGFVLDAFYGSPPVEH
FT                   KGPVEVVAALRDFAGKVMPEFRERPA"
FT   gene            complement(396874..397545)
FT                   /locus_tag="Rxyl_0370"
FT   CDS_pept        complement(396874..397545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0370"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: tfu:Tfu_2799
FT                   TetR/AcrR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03346"
FT                   /db_xref="GOA:Q1AZ32"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ32"
FT                   /protein_id="ABG03346.1"
FT                   /translation="MSGLRRRGIGRPPLSGPEAEANPLSELSFEERRELFLEAAVRLFE
FT                   EKGYKNTSVEDIAGELGFTKKVFYYYWKNKREIVQEIHDRGMALMNAQLDAVLEEEGAP
FT                   DARLDAAIRNHLRTVLRDRSIAGTLLGDFEFSEETLRARREYTRRFQRLVEDGMAAGVV
FT                   RKTDPRMLTFAILGLCNSVGQWYRREGRLTDEEILDIFASFAARGWREGEPAEEQREGG
FT                   G"
FT   gene            397682..399316
FT                   /locus_tag="Rxyl_0371"
FT   CDS_pept        397682..399316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0371"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   chy:CHY_2411 long-chain-fatty-acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03347"
FT                   /db_xref="GOA:Q1AZ31"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ31"
FT                   /protein_id="ABG03347.1"
FT                   /translation="METRRPWLGVYEGRISYGTIETSLTRFLEGAAARYRDRPVMTSAG
FT                   GRRVTYGELLEQSERFAAALAGLGVGKGDRLALMLPNSIEYVISFFAAARLGAVVVQLN
FT                   PLYAGRELRHILQDSGARAAVVHEGAYGRLREVREGLPLERAVVVGEEPAKPDVSFGEL
FT                   LSSGSGPLPEAPLDPASDLAVLQYTGGTTGVSKGAMLTHRSLLVNIEANISLAMENPRD
FT                   LDGGKTVAVAPFFHIFGNVVILLTSIHYGMNLLLVPRFQVDEMMQLIKRERPAMLGGVA
FT                   TIFTALHNYPRMEDYGLGEVLLYISGGASVPAELLRSFQRRTGRPIWEGYGLSEAGTVT
FT                   INTYLRGPVPGSVGVPMPTLDVRVVDPETGEREMPVGEPGELVVKGPQVMKGYWNMPEE
FT                   TEKALREGWFYTGDIARMDEEGYLYIVDRKKDMINVSGYKVYPREVEEVIYSHPEVVEA
FT                   VVVGSPDPYRGEVPKAFVVRRRRRGEGTSVSEEELIEHCRRELAPYKVPREVEFREELP
FT                   KSAVGKLLRRVLAQEERSRGQEQGSAG"
FT   gene            399340..400116
FT                   /locus_tag="Rxyl_0372"
FT   CDS_pept        399340..400116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0372"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   afu:AF0435 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03348"
FT                   /db_xref="GOA:Q1AZ30"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ30"
FT                   /protein_id="ABG03348.1"
FT                   /translation="MEHVRVEREGGGVAVVTIDRQEKLNALNARVQREITEVFEQALPG
FT                   ETRAAVITGAGERAFVAGADAGEMGSLSALEIREFGRIGTRMMEAIEQAPFPVIAAING
FT                   YALGGGLELALACDIRVAAENAVFGFPEVTIGIMPGAGGTQRLPRVIGSGIARELVFTG
FT                   RMVSAREAKEIGLVNRVVGEGEALGAAREMARQIAGNAPLAVRSAKIAMNVARNTDLAS
FT                   GIEHEGDLFALLFTTEDAREGLSAFAGRRKPEFKGR"
FT   gene            400127..400894
FT                   /locus_tag="Rxyl_0373"
FT   CDS_pept        400127..400894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0373"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase
FT                   short-chain dehydrogenase/reductase SDR; KEGG: pae:PA2554
FT                   3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03349"
FT                   /db_xref="GOA:Q1AZ29"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ29"
FT                   /protein_id="ABG03349.1"
FT                   /translation="MEIRNSAFLVTGGASGLGAATARLFAQNGAGVVVADVNEAAGEET
FT                   AAGIGERARFVRTDVTDEGSVRKAVDAALQSFGALHGLINCAGIGPARKVLGKKGIHPL
FT                   EDFVRAVQVNLVGTFNAIRLAAAAMAGNEPTEGGERGVIVNTASVAAFEGQIGQAAYSA
FT                   SKGGVVSMTLPIARELAGHGIRVATIAPGIFQTPMLAALPEGVRESLGEQVPFPRRLGR
FT                   PEEYAALARHIVENEMLNGEVIRLDGAIRMAPR"
FT   sig_peptide     400127..400207
FT                   /locus_tag="Rxyl_0373"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.884 at
FT                   residue 27"
FT   gene            400962..402263
FT                   /locus_tag="Rxyl_0374"
FT   CDS_pept        400962..402263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0374"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter major
FT                   facilitator superfamily MFS_1; KEGG: bja:bll0889 putative
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03350"
FT                   /db_xref="GOA:Q1AZ28"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ28"
FT                   /protein_id="ABG03350.1"
FT                   /translation="MGERSPLGRVITSSVVGNIIEQFDFALYGSMAALVFGPLFFPEFS
FT                   PLAGTLAALATFAVGFVARPLGSIFFGHFGDRIGRKSMLVLCLLIAGSATFLMGVLPTY
FT                   ATIGIWAPVLLVTLRFVQGFSFGGEYAGAVLMVAEYAPPERRGFFSGFVPAGSPVGLML
FT                   ANGTVLLVALMPREQFLAWGWRLPFLFSIVLVAIGLYIRLKIYETPAFRRVRETRTEAR
FT                   MPIIDVLRRSPGRVLLAGGISFGFAAIFYITIIFLLSYGTSQLGISGSVLLVGTIIGAV
FT                   FQIATILGFNALSDRIGRRPVIIGGALVSAALAFPFFWLLQSGAPALVWLAITAMMVSS
FT                   AAIYGPLAVLLAELFGTRLRYSGASLGYQLGATIGGGFSPLIATSILAWSGGGPWPVAL
FT                   YLVAVGLVAAACTYLLTETVRADMLEDVPAVGYE"
FT   gene            402273..403430
FT                   /locus_tag="Rxyl_0375"
FT   CDS_pept        402273..403430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0375"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase-like Acyl-CoA
FT                   dehydrogenase, type 2-like; KEGG: cef:CE0723 putative
FT                   glutaryl-CoA dehydrogenase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03351"
FT                   /db_xref="GOA:Q1AZ27"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ27"
FT                   /protein_id="ABG03351.1"
FT                   /translation="MVPDYYLLDELLTGEERAVRERVRAFVDREVLPVIGDYWERGEPP
FT                   FELLPKLAELKLAGGTIEGYGCPGLSAVAAGLVTMELSRGDGGLNIFFGGTSSLVMPAI
FT                   YMLGSEEQRERWLPPMARLEKLGAFALTEPEHGSDAVALETRARRRGEGYVIDGRKRWV
FT                   GNASFADVILVWARDDEGEVGAFVVERGAPGLSARVMAGKTAVRSSWQAEVELSGVEVP
FT                   AENRLERARSFRDASRVLAAMRYGAAWAALGHAAACYEAALAHARERRQFGRPLVSFQL
FT                   VQKKLAGMLAEITSMQLLCLRLSRLADQGKMTGAMASLAKMNNARKARGVCLEARDILG
FT                   GNGLLLEHHVARHAADIEAVYTYEGTDDINALIVGRDITGVSAFA"
FT   gene            403447..404307
FT                   /locus_tag="Rxyl_0376"
FT   CDS_pept        403447..404307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0376"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: rpb:RPB_1417
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03352"
FT                   /db_xref="GOA:Q1AZ26"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ26"
FT                   /protein_id="ABG03352.1"
FT                   /translation="MDVSKLEAIDVHTHAESSRERPGEKHAFAEAAEEYFGESEHPNAW
FT                   EVAEYYRNLRMAAVIFTVDMEMKTGQRRVPNEEVLEAAKENPDVLIPFASIHPARGAMG
FT                   VKEARRLIEMGVRGFKFHPNLQDFYPNDRMAYPLYEVIAEAGLVALFHTGHSGMGTGMP
FT                   GGGGVRLKYSNPMYIDDVAVDFPEMKIILAHPSFPWQDEALSVCLHKPNVYIDLSGWSP
FT                   KYFPENLVHYANTLLKRKMLFGSDYPAIKPERWISDFEQAGFREEVRPLILKENAARLF
FT                   GLEGS"
FT   gene            404478..406298
FT                   /locus_tag="Rxyl_0377"
FT   CDS_pept        404478..406298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0377"
FT                   /product="Adenine deaminase"
FT                   /EC_number="3.5.4.2"
FT                   /note="PFAM: amidohydrolase; KEGG: mta:Moth_0463 adenine
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03353"
FT                   /db_xref="GOA:Q1AZ25"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1AZ25"
FT                   /protein_id="ABG03353.1"
FT                   /translation="MEERGRRKPLYEMTRELAATARGDLPATLVIRDGTLVSVTSGEVL
FT                   PGMSVAVRGPRIAYVGPDAGHTVGPQTTVIDAAGRYIAPGFLDGHCHIESSQITVTQFA
FT                   RAVLPLGTTGGFFDAHEITNVLGLRGLRLMLDEARSTPLAAYLEVASCVPSTSTELETP
FT                   GAVIGPEEVAEALSWGEDVIALGEVMNFPGVVFGDERMHAEISAALRAGKIADGHFCWP
FT                   PDDHRLAAYAASGISGCHEGTTPEDTLWRLRQGMYAKLRRGSAWHDVAATIKAHTERGL
FT                   DPRRILLVTDDRSPESLLEEGHMDFVVRHAIAQGVNPVTAFQMATLNPAERFRVSHDVG
FT                   SVTPGRYADILLLEGDLAEVRVSLTVAAGEVVAEGGRMVAELEPYDYPAFCLDTVRVAG
FT                   GLGPEDFDIPAPGGGERARVRAIRVVENHVETRGEWVELPVEGGLVRLDPRKDVCKLFV
FT                   IERHGRGGGRGAGFVTGLGFERPAALASTVAHDSHNLMVLGNSEELMSRAAREVVAARG
FT                   GVAVAVGGETAVLPLPVAGLMSPEPYEEVARLSREIGRALRSAGCRMNYAFMTISLLAL
FT                   VVLPELHLSDRGLVEVGEEGFRLVGLAAEG"
FT   gene            complement(406295..406999)
FT                   /locus_tag="Rxyl_0378"
FT   CDS_pept        complement(406295..406999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0378"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver transcriptional
FT                   regulatory protein-like; KEGG: ctc:CTC01130 transcriptional
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03354"
FT                   /db_xref="GOA:Q1AZ24"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ24"
FT                   /protein_id="ABG03354.1"
FT                   /translation="MARVLIVEDDPAVRDVVEHTLSREGIETETVPDGETALELLSDSK
FT                   PFDLVLLDVMLPGMDGISVCRELRESHSPHRTVPVVMLTARDDETSIVVGLEVGADDYI
FT                   TKPFSPRQLASRVRAQLRRQRMNAQASPEQRKLEFPGLEIDLLRRRVTARGEQVELTAR
FT                   EFEVLALLASNPGRVYSREQIMDHLWGGEFFGEPRSADVHIQHLRQKIEPDPKNPRYIQ
FT                   TVRGMGYRFAEL"
FT   gene            complement(406992..408716)
FT                   /locus_tag="Rxyl_0379"
FT   CDS_pept        complement(406992..408716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0379"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="PFAM: ATP-binding region, ATPase-like histidine
FT                   kinase, HAMP region histidine kinase A-like PAS fold-4 PAS
FT                   fold; SMART: PAS; KEGG: sth:STH3307 two-component sensor
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03355"
FT                   /db_xref="GOA:Q1AZ23"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ23"
FT                   /protein_id="ABG03355.1"
FT                   /translation="MLARRPGISSFVAFRFRIWMPVAVILTVLLTVALMFAYGIPAVQT
FT                   RLRDYAQDRTLARAAAIADALSGERRGDWRQTLRASAGEERASVLVVGRDGEVELRVGQ
FT                   PLPEGLPGKVREKAASGERMRLKLGERWLAVVPINRGGELFGGLVLVSGDPGGAVYRIF
FT                   LRAGVEAAAIASVFGGGLALLISTLLTRRVERLAHGARTIERGDLSYRIKPGYRDEFGE
FT                   LAEAFNAMAGRLERSFSRVEEERATLRAVLDNLTEGVLATDLKGRVLFANPAAREMLGL
FT                   DDRDGPQRLPDPWPEFSLPEAVLRCARRERCGEARVRGKDTFLRVRLEHLPHFDDHRGG
FT                   VLVVVQDLSEGLRLEARQQRFLANAAHELKTPITAILGAAELLLTEEEDDPEVRRRFLE
FT                   HIHSEARRMQRLSETLLRLARTGWDHREPDLRPLDPEEAARRAAESMRPLADRDGVSIR
FT                   VEGEGSRAYADPEWLEQALLVLLGNALRHSERGGEIRLRVSGPSITVEDEGEGIRREDL
FT                   PHVFERFYRGRGSRGGFGLGLPICKELVEGMGGRISISSERGVGTAVTVELREVEDG"
FT   gene            408805..409266
FT                   /locus_tag="Rxyl_0380"
FT   CDS_pept        408805..409266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03356"
FT                   /db_xref="GOA:Q1AZ22"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ22"
FT                   /protein_id="ABG03356.1"
FT                   /translation="MRAPGNVRLSWAAVALGWLVAACAGAGLTALLKRLYPVAVGAPVG
FT                   ADGTSLGLAVVLAVSGFLAYLLGGYVAGRRAGASGGINGAMTGLLGLCVGGVLVSALPP
FT                   AGDALARDGLLPPAALGFALGSAPVVALLSGATLFGGCVGGLMGEPVHP"
FT   sig_peptide     408805..408885
FT                   /locus_tag="Rxyl_0380"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.503 at
FT                   residue 27"
FT   gene            complement(409263..410363)
FT                   /locus_tag="Rxyl_0381"
FT   CDS_pept        complement(409263..410363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0381"
FT                   /product="GTP cyclohydrolase II / 3,4-dihydroxy-2-butanone
FT                   4-phosphate synthase"
FT                   /EC_number="3.5.4.25"
FT                   /EC_number="4.1.2.-"
FT                   /note="PFAM: 3,4-dihydroxy-2-butanone 4-phosphate synthase
FT                   GTP cyclohydrolase II; KEGG: gsu:GSU1690
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP
FT                   cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03357"
FT                   /db_xref="GOA:Q1AZ21"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ21"
FT                   /protein_id="ABG03357.1"
FT                   /translation="MPFSPVEEIIEEIRAGRMVIVCDDEDRENEGDLTVAAELVTPEHI
FT                   NFMAKYGRGLICLPMAQELIERLEIPEMVRHNSSRMGTAFTVSIEAREGISTGISAADR
FT                   AHTCRVAVSDEAGPEDIVMPGHVFPLKARKGGVLQRPGQTEAAVDLARLAGLKPAGVIC
FT                   EVMKDDGTMARVPDLERFSAEHGIKMVTVAQIIEYRLASDPHVRCLGEEALPTRFGEFR
FT                   LRSYAGVSTGLIHRALLAGEPGENGPPLVGVRAACPTGDALHSLRCDCGERLRDAMERV
FT                   AAEGEGVILYLHPGPGAPLHPLPGGEDEDLAPYRAGVEILRDLGLGRVRLLMAGGEEPL
FT                   DLESGPGPALAGRLLRAKAGVAAPSL"
FT   gene            complement(410384..411439)
FT                   /locus_tag="Rxyl_0382"
FT   CDS_pept        complement(410384..411439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0382"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: lxx:Lxx07200 2-dehydropantoate 2-reductase;
FT                   TIGRFAM: 2-dehydropantoate 2-reductase; PFAM: NADP
FT                   oxidoreductase, coenzyme F420-dependent NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase-like Ketopantoate
FT                   reductase ApbA/PanE-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03358"
FT                   /db_xref="GOA:Q1AZ20"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ20"
FT                   /protein_id="ABG03358.1"
FT                   /translation="MDGPGMRDGRGGTSGKRVRIAVVGAGAVGSLVGGLLARAGEEVVL
FT                   VGRRAHVEAIESRGLLLEGLGGGPLRVRVAARERLEERPEVLLLAVKSQDLERACREVA
FT                   PLARKAVVVTMQNGLRCDGIARRFFRPDQIVGCVVYSMATFPEPGRVECGVRGWLCIGD
FT                   PFVPDRTRLAGLRALLGRALPVRVSRDIAATRRTKLVGNLNNALPAATGRPLQEIYFSP
FT                   ATGRLPLRVMREGLETLEAAGLATDRSPQALALNLLSRRMPEGAALALLRAFSRTPLGR
FT                   RPVLGSTYQSVVRGSPTEVDFLNGEIVALGQRAGVPTPYNARLVRLVHEVERGGRFLPP
FT                   EALWPEDTCDG"
FT   gene            411596..412729
FT                   /locus_tag="Rxyl_0383"
FT   CDS_pept        411596..412729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0383"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   sco:SCO5681 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03359"
FT                   /db_xref="GOA:Q1AZ19"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ19"
FT                   /protein_id="ABG03359.1"
FT                   /translation="MRTLLVTNDFPPKVGGIQSYLLELLSCLPPCGVRVLAPTHPEAGA
FT                   FDASLPYEVVRWPRPRLYPTPGLVRRVSGLAAGTDVVQYGYALQSWLVAPAVLRRTGVP
FT                   YAIFVHGAEVLLPLRLPGAAGLLVRGTLGRAAAVISVSRHTAAGVEGATGIGCPVLPPP
FT                   VDLERFRPPPGARERARRRYGLGGRPVVLCVSRLAFRKGQDRLIDAMPPLARRFGARLL
FT                   LVGEGPRAGSLRRRARRRGVAGAVVFAGRVPAGELPACYAAADVFAAPVRDRWLGLEQE
FT                   GFGVVFAEAAAAGLPAVVGASGGAREAVEDGVTGYLVDGRSAAAVGKALARLLGDAGLR
FT                   ERMGRAARGRAAELYGRRAVGRRYRSILERAAGGGGA"
FT   gene            412726..413721
FT                   /locus_tag="Rxyl_0384"
FT   CDS_pept        412726..413721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0384"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; KEGG:
FT                   lmf:LMOf2365_2525 membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03360"
FT                   /db_xref="GOA:Q1AZ18"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ18"
FT                   /protein_id="ABG03360.1"
FT                   /translation="MRRSLLGVLLGLALGAVGFAFAAYHVDRPLRIAHLWPVPLAAAVT
FT                   LLCWLIQGSIIALLAWPELRRVRVLQMTRVYLATQAVGGITPFAGGEIAYQLLALKRHG
FT                   LGADVGGAVIALRSALNGVVLLAAAVAGLLVVRRVPFVGGGSSLPFSATTVLLVGVVAL
FT                   SAAWLLLVFLIRRRRGREGGGGGPGLVGRAASYLRHLRDSLLLIWRREPRVIAGCLLLA
FT                   ALYWLLYPLLGTLSLRAAGWDGSGWLAVFAAQYVLFLVIPIAPTPGNGGAAEIAFVALM
FT                   SNYVPQGALLGGVVLWRVLNHFSELVVGAFIAGSEVHEDIELARREFGSG"
FT   sig_peptide     412726..412794
FT                   /locus_tag="Rxyl_0384"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.910 at
FT                   residue 23"
FT   gene            413718..414488
FT                   /locus_tag="Rxyl_0385"
FT   CDS_pept        413718..414488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sth:STH2880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03361"
FT                   /db_xref="GOA:Q1AZ17"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ17"
FT                   /protein_id="ABG03361.1"
FT                   /translation="MRESAALWPGSAVREVSLRSVDGLRLRAYWHPGGDRAAVLLHGKR
FT                   GSGRSEAVVATARVYAGAGFGVLVPDLRGRGGSEGRFLTAGYQEERDVRGALRWLAERG
FT                   FEARRVVLHGWSAGGAAALRAAPGAGVGAVVEDSAFAELPLLLGDLFPGPPRLLCGAAR
FT                   LVSRVLGTEFDPWALCPREDAARLYGEGVPLLIIHCRGDRVVPFRHAELLAAAHPAADF
FT                   WEVADGFHGGAYAHPGYRERLLGFVERALGPGGG"
FT   gene            complement(414493..415127)
FT                   /pseudo
FT                   /locus_tag="Rxyl_0386"
FT   gene            complement(415243..416556)
FT                   /locus_tag="Rxyl_0387"
FT   CDS_pept        complement(415243..416556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0387"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   gsu:GSU3264 membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03362"
FT                   /db_xref="GOA:Q1AZ16"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ16"
FT                   /protein_id="ABG03362.1"
FT                   /translation="MRPRPTAAPGRVLSWTLYDFASTVFSVSILSYFFPLWLADELGAG
FT                   ADLFNYITAASMVLVFLTAPLLGALADLGQRRKPYLAASTLLAVGCTAGLELSGSLAAA
FT                   VALFVAGNLGYQWAQIFYNALLPGVAPGRSTGRVSGYGGVAGYAGTIVALAALTPLVTH
FT                   PEAVRSALGPLGFWLETEGATNSNAFLPTAALYLIFGLPALLWVPDRAAREPRPAGLVR
FT                   GYREVLHTIRGLRGYAGMGAFMLSTVLYMDVSNTVVANMALYGREVFGMEQADIRNLLL
FT                   LSTVFAAAGAAGFGLVADLLGPKRTLMAVLGLWLAAIAAVAAATEAWMLLLAGPLVGVV
FT                   FGATGPVSRVLLIALSPPAKLGEFFGFYALAGRFSAATGPALTGLILTAFEPLGTGAYR
FT                   LAVLSLAAATVLAMAVLAHVPDRRPPEPAWNPAAEGGG"
FT   gene            complement(416553..417437)
FT                   /locus_tag="Rxyl_0388"
FT   CDS_pept        complement(416553..417437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0388"
FT                   /product="degV family protein"
FT                   /note="TIGRFAM: degV family protein; PFAM: DegV; KEGG:
FT                   deh:cbdb_A1004 DegV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03363"
FT                   /db_xref="GOA:Q1AZ15"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ15"
FT                   /protein_id="ABG03363.1"
FT                   /translation="MAERRVAVVTESVSSLPRQLAGELEIEVVPVPFSYAGRDYLDGED
FT                   ITPEEFYGILRPDLPPASTSSPSPGAYLEVFRRLCGAGLEVLCVTATGKIATRMPESAR
FT                   MGRELAREEGVEGRIEVLDSGSAAMGEGFLALEAARMAWEGAGMEEILSRLEELSGRVS
FT                   LLVTLDTLQYLSKTARLRRLAALFAKALQIKPVILFERGEVRPLETPRTRRKAVERLLA
FT                   LAEERVSGEGPLHVAVQHAAAGEEAGELAEEVRERLGPRELLVAEFSPVMTSYAGPGLL
FT                   GLALYEEPPGAGP"
FT   gene            complement(417636..418268)
FT                   /locus_tag="Rxyl_0389"
FT   CDS_pept        complement(417636..418268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03364"
FT                   /db_xref="GOA:Q1AZ14"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ14"
FT                   /protein_id="ABG03364.1"
FT                   /translation="MWVALLAALQWAAAAVLWVIAASSPQTPGWVKAAGGVWAAGGAAA
FT                   LVLATEAAARGSASGVLLAGAAGAASCALLSAALLRERGRGVSPERVLRERGEGARPPQ
FT                   DALSLARRIQQRARHLRGTLEAGPSEIEVEMCLMGYRACCDELLDMRLRLAEELPAAGP
FT                   LGRLRLRAALRRAEKAVDRVRAALPAGALREEARAHRSRAEPGRHDA"
FT   sig_peptide     complement(418197..418268)
FT                   /locus_tag="Rxyl_0389"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.662) with cleavage site probability 0.315 at
FT                   residue 24"
FT   gene            complement(418416..419072)
FT                   /locus_tag="Rxyl_0390"
FT   CDS_pept        complement(418416..419072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0390"
FT                   /product="acyl-phosphate glycerol-3-phosphate
FT                   acyltransferase"
FT                   /note="PFAM: protein of unknown function DUF205; KEGG:
FT                   gsu:GSU0507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03365"
FT                   /db_xref="GOA:Q1AZ13"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ13"
FT                   /protein_id="ABG03365.1"
FT                   /translation="MELSTLLEATVAFLLGYAAGSVPLGLLVAYLFAGIDIRRHGTGNV
FT                   GASNVWRNVGLLPAAVVALGVFLQGLLPPLAARLLGAQEEVVAAAALGPVVGYGWSPFL
FT                   GFRGGRGVGVSTGAAAALSPGGFLVLLAVYGLGRLADQMGLATVAGFALYAVYALWSAG
FT                   WSATGLAALALLALVLLRRLEGVSEDLRHHPALPTLAGRLLLDRRPGQRLRGRNG"
FT   gene            419125..419676
FT                   /locus_tag="Rxyl_0391"
FT   CDS_pept        419125..419676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03366"
FT                   /db_xref="GOA:Q1AZ12"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ12"
FT                   /protein_id="ABG03366.1"
FT                   /translation="MGVMWGVVAVGEPVAGVLVFLLGGALRAARALRDLPGRRRAPGAL
FT                   PARYRLHGVELFPGIGVPLSRTTRYGATFAGVHRGEPAALLLGWVNYTPIFFKPSTECA
FT                   VVGGRWWLVAAEGGRPRVLRGRFGRGTVRWDGKGKLAAAEVGVRLGGRGGEGRLAAALN
FT                   HLPFPPRIGGALRLPGASGP"
FT   gene            complement(419665..420849)
FT                   /locus_tag="Rxyl_0392"
FT   CDS_pept        complement(419665..420849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0392"
FT                   /product="oxidoreductase-like protein"
FT                   /note="PFAM: oxidoreductase-like Oxidoreductase-like; KEGG:
FT                   bms:BR0546 oxidoreductase, Gfo/Idh/MocA family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03367"
FT                   /db_xref="GOA:Q1AZ11"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ11"
FT                   /protein_id="ABG03367.1"
FT                   /translation="MQRLKMGMVGGGEGSFIGAVHRRAAALDGEIELVAGALSSTPEKA
FT                   LRSGRALGLPEGRNYASWEEMLEGELALPEEERIDFVSIVTPNHMHFPVARAFVRAGFD
FT                   VICDKPLVHTSEQALELVRAVEKAGTIFCVTYNYTGYPMVRQARHMVRSGMLGELRKVI
FT                   VEYSQGWLVRRLEDEDKQARWRTDPSLAGAAGAIGDIGSHAENLVATVTGLRISEICAD
FT                   LTTFVEGRRLDDDGNLLVRYEGGAKGVMISSQISTGEENNLSLRVYGTEGALQWRQEEP
FT                   NHLLFAPFGKPVQTLRRGNPYLCEEARAASRLPAGHPEAFIEAFANLYLEAAAAMRARR
FT                   GLSPERPPDFPTVYDGARGVHFIERVVESSRSEKKWLDARWEAPQPEGAGASGP"
FT   gene            complement(420851..421852)
FT                   /locus_tag="Rxyl_0393"
FT   CDS_pept        complement(420851..421852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0393"
FT                   /product="Xylose isomerase-like TIM barrel"
FT                   /note="PFAM: AP endonuclease 2-like Xylose isomerase-like
FT                   TIM barrel; KEGG: rba:RB4654 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03368"
FT                   /db_xref="GOA:Q1AZ10"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ10"
FT                   /protein_id="ABG03368.1"
FT                   /translation="MPRRPVTLFTGQWADLPLEELAPLAREMGYDGLELACWGDHFDVR
FT                   RALEDEGYAAGRRELLSSHDLRCWAIGNHLVGQAVCDPIDERHRATLPERVWGDGDPEG
FT                   VRRRAAEEMKDTARAARRLGVEVVTGFTGSSVWHKLYFFPPTPHEEVEAGYEDFARRWN
FT                   PILDVFDEEGVRFAFEVHPTEIAYDLYSAERALEAVGGRRAFGFNFDPSHLYWQFVDPV
FT                   KFIDRFADRIYHVHMKDAARTLDGQSGILSSHLPFGDHRRGWDFRSLGRGGVDFEEIVR
FT                   ALNRTGYGGPLSVEWEDSGMDRVHGARESAAFVRRLDFEPSGVAFDAAFGEE"
FT   gene            complement(421871..423115)
FT                   /locus_tag="Rxyl_0394"
FT   CDS_pept        complement(421871..423115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0394"
FT                   /product="oxidoreductase-like protein"
FT                   /note="PFAM: oxidoreductase-like; KEGG: sme:SMb20013
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03369"
FT                   /db_xref="GOA:Q1AZ09"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ09"
FT                   /protein_id="ABG03369.1"
FT                   /translation="MQKKNAPPLRIGFVGSGFIARFHLEAFLGVRDARISGVFSPTPAH
FT                   REALAAEAGRLGLGPCAPFPSIESMLRSGEVDAVWLLGPNSTRLANMRAIHREVKAGRA
FT                   TLRGVACEKPLARNLAEAREMLRLAEDANLNHGYLENQLFSTAVRRGREIIWRRAAPIA
FT                   GRPYLARASEEHSGPHAPWFWRGEEQGGGVLSDMMCHSVEVARYLLTEPGRDRHSLRPL
FT                   SASATIATLKWGRREYARRLEETIGVDYSSSPVEDFARGTLALEDEAGNRLIIEATTSW
FT                   SYVGPGLRIQLELLGPEYAMEYSTLNSGLKVFLSRNVSGEAGEDLVEKQNAEQGLMPVL
FT                   EDEAASYGYTLEDRHMVGCFLRGERPEETFRDGVAVVELLMALYRSAETGRTIALPDPE
FT                   LEDYVPAVARGEYRG"
FT   gene            complement(423128..424075)
FT                   /locus_tag="Rxyl_0395"
FT   CDS_pept        complement(423128..424075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0395"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   atc:AGR_L_989 sugar ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03370"
FT                   /db_xref="GOA:Q1AZ08"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ08"
FT                   /protein_id="ABG03370.1"
FT                   /translation="MKRPRVDPVLIALLLAAGLFALGSLLQPGFGSYDQAMNILRLAAF
FT                   LGIVAAGQTLVIISGGEGIDLSVGAVVTLGAILVFRLGTGEAGGALLALAIALGVGLLI
FT                   GAANGLGITLLKIPPLVMTLGMAGVVQGLILVVTRGELRGETPDLLAGLVSGSLAFGIP
FT                   GVVLVWAALGLLMWLLLWRTPYGRQLFAVGANRTTARLSGVRVPAVVVATYALSGMLAA
FT                   LGGAILLGYTRQVFLNLGDPYTLPSVAAVVVGGTLLAGGVGSYAGTMAGALVLTLLTSL
FT                   LTALDLPESARQIVYGLTLLALLSLYGRQRALRE"
FT   sig_peptide     complement(423995..424075)
FT                   /locus_tag="Rxyl_0395"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.524 at
FT                   residue 27"
FT   gene            complement(424072..425061)
FT                   /locus_tag="Rxyl_0396"
FT   CDS_pept        complement(424072..425061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0396"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   atc:AGR_L_991 sugar transport system permease protein
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03371"
FT                   /db_xref="GOA:Q1AZ07"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ07"
FT                   /protein_id="ABG03371.1"
FT                   /translation="MRAAQALPPRGRLREAALRQSYAFALVLLVAAAAANYALQPNFFN
FT                   PAVLGGNLMTYLPLLLLAAGQTVVVIGGGIDLSLGAILSLSNVIIVSALGESPGAAQIL
FT                   LAVGAGLLAGALAGAVNGACVAYLRFQPIVTTFATSFVFSGLALYVMPSPGGSVPQGLL
FT                   SAYGADPLGLPLVFWAAVLVLLAWGLLRSTRYGVYLYATGGDQLSAFVSGVPVSPVRLA
FT                   SYCIAGLMAALAGLAMALSTSTGDPLIGEPLTLSSIVAVVIGGTRLSGGQGGVFGTILG
FT                   VVVLGLFQSIVSFMGVPSWWQTLINGLIVVVALAGPGLLGLLHRGRRP"
FT   gene            complement(425058..426566)
FT                   /locus_tag="Rxyl_0397"
FT   CDS_pept        complement(425058..426566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0397"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   atc:AGR_L_992 high affinity ribose transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03372"
FT                   /db_xref="GOA:Q1AZ06"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ06"
FT                   /protein_id="ABG03372.1"
FT                   /translation="MPGEVSLSARHLAKRYGGVVALADGNLEVSSGEVVALMGANGSGK
FT                   STLGKIITGAVVPDSGTLLLDGEEVRFSSPHAARRAGIAAVYQELSLIPDMTVAENVWL
FT                   AHEPLSRGLVKRRERRERTARLLELFRGVVGPSLGPDALVSRLSPGERQIVEILKALSA
FT                   EPRLMILDEATASLDGEQVARLFELVGGWKAQGRAVVFVSHRMEEIFRIADRAVVLRSG
FT                   RTVGEAETSRTTEQELISLMIEGGVTKRHIEHPPGPAGGRKILLRAEDLRAPGVRGVSL
FT                   ELARGEILGLGGLQGQGQPELLRALFGALPRSGRLLLGGREVRLSHPRQAMREGMAFVP
FT                   GDRGREGLLRVRSILENLMLPSWRRYGRLLDLKRARRDAERIAGELRIVMGSLDDPVDT
FT                   LSGGNAQKVVLGKWLLRAPQILLLDDPTKGVDVGAKGELYAMLGDLRKEGVAILLYSSD
FT                   DEELLGLCDRVLVMREGRVRRELKSPELTRSALVKASVGTEDGG"
FT   gene            complement(426569..427666)
FT                   /locus_tag="Rxyl_0398"
FT   CDS_pept        complement(426569..427666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0398"
FT                   /product="periplasmic sugar binding protein-like protein"
FT                   /note="KEGG: atc:AGR_L_993 periplasmic sugar binding
FT                   protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03373"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ05"
FT                   /protein_id="ABG03373.1"
FT                   /translation="MTGSSFARWGHRGAALLAAVAAVLLVAACGGGGSQQGSEGGAPYT
FT                   IGVSNGFISSEWRTQMIQDLERVNKEYMEEGLTEELVIESADVDVQGQIQQMRNLINQG
FT                   VDAIIVNPNSVTGLNQVIKEASDAGIVVISVDQEIPAEGAINVVIDQAEWARRSAEWLV
FT                   EQLGGEGDVVVINGIAGHPANEARYDAVKEVFSRNPGIEVIAEANANWDQATGQQKMSN
FT                   ILASETGIDGVWTQDGMARGVLQAIVASDPERFPVVVGEARLGYMRLWHELRQQDEDFS
FT                   SYGVINPPGVGASGLRVAVEMLRGKELKEGVLSGEANNTIYVPIPGVVNDQNFDEWYAR
FT                   VKDKEGEYVLDGIISREKAQSYFKQ"
FT   sig_peptide     complement(427553..427666)
FT                   /locus_tag="Rxyl_0398"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.352 at
FT                   residue 38"
FT   gene            complement(427722..428930)
FT                   /locus_tag="Rxyl_0399"
FT   CDS_pept        complement(427722..428930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0399"
FT                   /product="ROK domain containing protein"
FT                   /note="PFAM: ROK; KEGG: lxx:Lxx03030 transcriptional
FT                   regulator, ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03374"
FT                   /db_xref="GOA:Q1AZ04"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ04"
FT                   /protein_id="ABG03374.1"
FT                   /translation="MRSGESGTVGQIFGLIRSGRARTRAELAAVTGLTRATVSQRVEVL
FT                   MEAGLVVETKEGVSTGGRPPMVLGFNKDAGVVLAADLGATHCRLAVADLGGRPLVELPA
FT                   DLDIAQGPDAVLGWVQDRFEELLEEAGRSREEVWGIGVGVPGPVDFARGQAVSPPIMPG
FT                   WDRVPIPERFRERFGGVPVLVDNDVNIMALGEHRVNWSDVEHLLFVKVATGIGCGIVAG
FT                   GRIHRGERGAAGDIGHIRISGHEETVCRCGNVACVEAVAGGWALAKQLSGLGYPATGSR
FT                   DVVGLVRAGNPAAARLVRTAGELIGEVLASLVNFFNPAVIIIGGDLAHAHEQLFAGIRS
FT                   VVYQRSLPLATRHLQIVPSELDDRAGIHGAAAMVIEHVLRPETIEEMAQERIRRRAGRP
FT                   AGG"
FT   gene            429223..430278
FT                   /locus_tag="Rxyl_0400"
FT   CDS_pept        429223..430278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0400"
FT                   /product="Isopentenyl-diphosphate delta-isomerase,
FT                   FMN-dependent"
FT                   /EC_number="5.3.3.2"
FT                   /note="KEGG: cyb:CYB_2691 isopentenyl-diphosphate
FT                   delta-isomerase, type 2; TIGRFAM: Isopentenyl-diphosphate
FT                   delta-isomerase, FMN-dependent; PFAM: FMN-dependent
FT                   alpha-hydroxy acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03375"
FT                   /db_xref="GOA:Q1AZ03"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ03"
FT                   /protein_id="ABG03375.1"
FT                   /translation="MGEDAFERAGGTGTARRKKEHIRICLEEDVDHPVLTTGFERYRVP
FT                   YASLPELDLAAVDLSCGMLGRRLSMPFMILSMTGGARLSRTINRNLARAAQECRVALGL
FT                   GSMRIALEDPAAAESFRVRELCPDVPLWANLGAAQLNRGFGVEECRRVVEISGADGLCL
FT                   HLNALQEAAQPGGDTDWSGIAEKLAAVAGELGVPVIVKEVGFGIGPRTARMLGGLPVWG
FT                   VDVGGAGGTSWLEVEKRAWGRDDLDAFDAFGTPTAESISVVRKHCPDKLVIGSGGVRTG
FT                   VDAVKALALGADMVGAARPLLRPATESEEAVIRWLRRFREEMRLAAFCAGAPDLNALRE
FT                   LELEPAPDNLP"
FT   gene            430304..431368
FT                   /locus_tag="Rxyl_0401"
FT   CDS_pept        430304..431368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0401"
FT                   /product="Xylose isomerase-like TIM barrel"
FT                   /note="PFAM: Xylose isomerase-like TIM barrel; KEGG:
FT                   eca:ECA1953 putative xylose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03376"
FT                   /db_xref="GOA:Q1AZ02"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ02"
FT                   /protein_id="ABG03376.1"
FT                   /translation="MKNSVGIWAFGPAVTRFVPPGYHPEAAEEPMAEKTKRVCEGLSDV
FT                   LDGIEYHYPGEINEENADEITEILESHRMDLPVVAAGLHTDPTYALGAFINPDPSLRRK
FT                   GIDTLKRGIDLAAEVGANFIIWPGAEGYNYPFQRPYAETWRAFVEAVAELAEHASGRGI
FT                   KVFLEHKNSEPAMQILMKNIGMTLFVIHKVEELGVDTRNLLVNMDWQHLIMNGENLAEY
FT                   AALLSAENRLGHQHANDGWGTFDDDNVVGTNFFMQTLELCHTLREIGYGEGGERMGFDL
FT                   YPYTEDQVAAVRRAILHLEFIWELAGRIDGAVLAEARERADALGAQKAVYGALGLDEEF
FT                   ERRVVRARREERGG"
FT   gene            431365..432861
FT                   /locus_tag="Rxyl_0402"
FT   CDS_pept        431365..432861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0402"
FT                   /product="xylulokinase"
FT                   /EC_number="2.7.1.17"
FT                   /note="KEGG: mta:Moth_2025 xylulokinase; TIGRFAM:
FT                   xylulokinase; PFAM: carbohydrate kinase, FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03377"
FT                   /db_xref="GOA:Q1AZ01"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ01"
FT                   /protein_id="ABG03377.1"
FT                   /translation="MSPLVGLDIGTGGARAVAVEESGGILAEATSSYPLTSPRPGWTEQ
FT                   DPEEWWRAAREVLGRVAAEVGGEVRGIGLTGQMHGSVFLDAGERPIRPALLWNDQRTAR
FT                   QCAEISGLVGAERLIAIAGNPALTGFQAPKILWLREEEPQNYRRVASVLLPKDYIRLRL
FT                   TGERATDASDAAGTLLLDVGRREWSEEILSRLEIPRGWLPRVYEGPEATGALRGGVASE
FT                   LGLPAGIPVAAGGGDNAAAAVGVGVVREGILSSSVGTSGVLFAHTDAFSPDPSGRVHAF
FT                   CHALPGAYHLMGVTLSAGGSLAWWRSTLEKDYEVLVEEAAQVPPGAEGLLFLPYLTGER
FT                   TPHLDPAARGAFIGLTARHTAAHMSRAVMEGVVFSLRESLEILRSLGVPVEEVRATGGG
FT                   ARSPLWRQLQADIYNTPIRRTTADEGPAYGAALLGGVAAGAYRDVQEAVASCVRLREEL
FT                   TEPDERRSKAYEEHYAVYRSLYAANREAMHRLSELAGSAS"
FT   gene            432980..434635
FT                   /locus_tag="Rxyl_0403"
FT   CDS_pept        432980..434635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0403"
FT                   /product="peptidase S1 and S6, chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6, chymotrypsin/Hap; KEGG:
FT                   cef:CE1931 putative periplasmic serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03378"
FT                   /db_xref="GOA:Q1AZ00"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ00"
FT                   /protein_id="ABG03378.1"
FT                   /translation="MHRSWIATPLLALFLFAGACAGSREDAPDPGRGGDRGDPGGRDAA
FT                   VSSIEDVRKATVYIEARGGAYDEGRGFGEVSYGSGSGFIVGDGGGSGKLVITNNHVVTG
FT                   AGFLQVYLDGQDEPVDARVLGASECSDLALLELEGGGYPYLSWRTGDIDAGLGVRAAGY
FT                   PADDVETGERPDYTITSGSINSTEADGETPWASVDSVLEHDVLIRPGNSGGPLVDENGR
FT                   VVGVNYASRVDDEGRPTGPQLAIARDEARTIVDKLRQGDVESIGVNGEAFSLPEQEISG
FT                   IRVTSVKTDSPAGRVGLRNAVIDPQSGEFAAFDVITEIEGTRLGEGGTMEEYCNILRQH
FT                   EPDDRLSIQAVRVEENGDVSLMEGALNGEELAVVETIPAQTDAGGEPQGGFVSLTDDTG
FT                   TLTMEVPAAWSDVRTGGSLKLDGESLGPAMLASTDAQRWIDTFEVPGVYFAASSRLAER
FT                   FPENPVEQILDLPEYDFSGTCRYEGREGYQDSKFTGAVDTYTGCDGTDNAFQIYAATPP
FT                   DGSYVVVLQAVITSEADLDGLQRTLATFDVLQQP"
FT   sig_peptide     432980..433045
FT                   /locus_tag="Rxyl_0403"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.681 at
FT                   residue 22"
FT   gene            435009..435254
FT                   /locus_tag="Rxyl_0404"
FT   CDS_pept        435009..435254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03379"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYZ9"
FT                   /protein_id="ABG03379.1"
FT                   /translation="MHRDFMYEMARERMAEYHREAERRRRSGPSGRGVWRRWVARRLFE
FT                   AAFSVDAEEGWRAMWDRMSAPGRRGRRSSGARKVAG"
FT   gene            435244..436056
FT                   /locus_tag="Rxyl_0405"
FT   CDS_pept        435244..436056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0405"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   tko:TK2026 ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03380"
FT                   /db_xref="GOA:Q1AYZ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYZ8"
FT                   /protein_id="ABG03380.1"
FT                   /translation="MRGEGVLVEALRMRGVRKRFRRRRGEVVCALEDVSLEIRRGEVVG
FT                   ILGPNGSGKSTLVRVISTLVLPDSGSVEVFGVDALRHPKRVQRSMNRVSVEASFFKKLS
FT                   AMENLLYGAKLYGVSDREARPRIEEIMGHIGFDYKRAAEPMEHLSRGMQQKVALARALL
FT                   TSPMLMLLDEPTTGLDPRSRRDVQAFIRRIREAHDSSILLCTHDMGEAEELCDRVGIMV
FT                   GGRIIALDEPRRLKERYASGGRLPDLEEVFMAATGYTVEEASAEEGER"
FT   gene            436053..436892
FT                   /locus_tag="Rxyl_0406"
FT   CDS_pept        436053..436892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0406"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: ape:APE2512
FT                   putative ABC-2 type transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03381"
FT                   /db_xref="GOA:Q1AYZ7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYZ7"
FT                   /protein_id="ABG03381.1"
FT                   /translation="MIRGGGRPRWLMEAIAVWGYVQRNYFLTKRYFMWEVVWLVYITAN
FT                   ALAITYIGAGASEFGSGIDTARLMTFLLVGALVWSYLSVLFDVLSETVSWERWEGTIEY
FT                   TFMSPASRVTHLLGMGLYAVIYGVLQISVMLGAVSLFFELDLSRANYAGALLVLGVASV
FT                   SLVGFGIMAAVLPLLSPEKGQQVSYIVSSLLLLVSGVYYDVGVLPGWMQFIARFSPVTY
FT                   ALEGIRAALLDGAGLAELRGSVGVLLAMGALFVPLGLLVFHLGERYAKRTGKLKRSG"
FT   gene            complement(436921..438726)
FT                   /locus_tag="Rxyl_0407"
FT   CDS_pept        complement(436921..438726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0407"
FT                   /product="IucA/IucC"
FT                   /note="PFAM: IucA/IucC; KEGG: ava:Ava_2833 IucA/IucC"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03382"
FT                   /db_xref="GOA:Q1AYZ6"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR037455"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYZ6"
FT                   /protein_id="ABG03382.1"
FT                   /translation="MEHVEQVRQSLRPEVWERVGRRLLEKMISEFMYEEIIRPERVAER
FT                   GEGVFSYRLPLGDGVGYAFDARRRLFDTYRVVPGSVVRTARGSAAPATDPLRFLLDIRE
FT                   AAGLNPETAAHLLNEYSRTLLADAHIAARKEGRTLDPEEVGYAELEGEMEGHPWITFNK
FT                   GRIGFGYDDYLLHAPEMRRPTRLPWLAVSRERSRFSAVSGLDHEALMREELGEEALREL
FT                   RGRLDEPEAYHLLPVHPWQWKNVVVPLFAGELASGAIVPLGEGPDLYLPQQSIRTFFNV
FT                   SSPEKLTVKLPLSILNTLVWRGLPGERTEVAPRVTEWVRNIRDGDPFLREECRLILPGE
FT                   VAGLNYDHPYHADLPGTPYQHLEMLGAIWRESVFRHTEPGERPITLAALLHVDGAGRPF
FT                   FSSLVERSGLGAEEWLSRFFGAVLPPLLHYLYRYGTVFSPHGENTILVLDEGFIPSRLA
FT                   MKDFVDDVNVSEHPIEELGSMPEDLRPVLLREPPEGLCQFIWSGLFICHLRYLAEIAED
FT                   HHGIPERRFWGLAREEILRYQDRFPELEERFRLFDLLAPSFTRLCLNRNRLFDYGYADD
FT                   GERPHASEFGRVTNALHEAGAAAGR"
FT   gene            complement(438745..440040)
FT                   /locus_tag="Rxyl_0408"
FT   CDS_pept        complement(438745..440040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0408"
FT                   /product="L-lysine 6-monooxygenase (NADPH)"
FT                   /EC_number="1.14.13.59"
FT                   /note="KEGG: ava:Ava_2835 probable monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03383"
FT                   /db_xref="GOA:Q1AYZ5"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYZ5"
FT                   /protein_id="ABG03383.1"
FT                   /translation="MRSGRPCDLLGVGIGPFNLSLAALLEPVEEVEALFVEQKPRFDWH
FT                   PGLLMEGTTLQVPFLADLVTMADPTSPHSFLNYLREQGRLYNFYFLERFHVPRREYEHY
FT                   CRWVAERLPSCRFGERVEGVRHAGDHFEVSTRKISTGERRTRRARHLALGVGTAPQVPA
FT                   CFEGKLGEDAFHSADYLPNRERCMEAASVTVVGSGQSAAEVFYDLLCAQAERGFRLDWL
FT                   TRSKGFFPMEYSKLGLEHFSPEYIRYFHGLPQKKRDEVRGRQDLLYKGIDVETIAGIYD
FT                   LLYERSVGGARPDVRLMALAEVGEAERTGSAWQLHCRQTEQDRYFVHETEVVVLATGYA
FT                   YRVPGFLEGVRDLIRWDGRGRYAVSLDYRLEKTAEVANEIFVQNGEIHTHGVGAPDLGL
FT                   GAHRSAVIANQLAGRAVYPVRERNVFQQFGVA"
FT   gene            complement(440027..440614)
FT                   /locus_tag="Rxyl_0409"
FT   CDS_pept        complement(440027..440614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0409"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all0393 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03384"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019432"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYZ4"
FT                   /protein_id="ABG03384.1"
FT                   /translation="MRETGSRYAYRTVDPETGAEIAFRPLQPEEDAERVCAWMNEEHVI
FT                   PFWQMAWPEERIARYLHDLLHDPHSTPYIGHLDGVPMSYWEAYQAKDDIVATRYPAGPR
FT                   DRGVHLLIGPPEYVGRGFALPLLRAMTAFQFAGAAAEKVVAEPDVRNARMIHVFKKCAY
FT                   EPQGEIELPDKRALLMFCRREEFERRFPDALG"
FT   gene            complement(440611..442347)
FT                   /locus_tag="Rxyl_0410"
FT   CDS_pept        complement(440611..442347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0410"
FT                   /product="IucA/IucC"
FT                   /note="PFAM: IucA/IucC; KEGG: ana:all0394 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03385"
FT                   /db_xref="GOA:Q1AYZ3"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR037455"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYZ3"
FT                   /protein_id="ABG03385.1"
FT                   /translation="MLDQRMTARQIADHAAMQNLLNCFLRETGRGAFLREGAVLVPLER
FT                   LGMEVLAPLRRPSPTGRHLFGFPVTAGPCGDPRRAELDPATLAALISRELSLERGGSPE
FT                   ELLLRVLESRRNVERFVGARLEEGKRPREGFIGAEQSLVFGHHLHPAPKSRQGFAEEEL
FT                   AAYSPEMGAAFPLHYFWAHRSVVSEGSALPQSASQLVAEELRRDPEARTLPREDQDRAL
FT                   IPAHPWQAGRLLRRPEVRRLIGEGLLEHLGPLGSPYLPTSSVRTVYRPRSRFMLKLSLG
FT                   VGITNSVRNNLRKELRRGIKMCRVLESAVGRELRERFPGFRIIRDPAHITVETGVGEES
FT                   GFEMLLRENPFRGDEDAAAVVALCQDGLGEEGSRLARLVARLARREGRPPSEVGREWFR
FT                   RYLEVSLRPILWLYFAHGIAPEAHQQNTVLELEGGYPARFYCRDNQGYYFRESAREHLE
FT                   RLVPGVHGIEDGTVVEDPVAEERLRYYFFINNLFGVVNALGCAGLADERELLGELRRAL
FT                   EELEPEAPASSELIPSLLHLRRLPCKANLLTRLHDMDELLGDLETQSVYVEIDNPLAEV
FT                   SA"
FT   gene            complement(442329..443800)
FT                   /pseudo
FT                   /locus_tag="Rxyl_0411"
FT   gene            complement(443797..445194)
FT                   /locus_tag="Rxyl_0412"
FT   CDS_pept        complement(443797..445194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0412"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="TIGRFAM: 2,4-diaminobutyrate 4-transaminase; PFAM:
FT                   aminotransferase class-III; KEGG: ava:Ava_2839
FT                   diaminobutyrate--2-oxoglutarate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03386"
FT                   /db_xref="GOA:Q1AYZ2"
FT                   /db_xref="InterPro:IPR004637"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYZ2"
FT                   /protein_id="ABG03386.1"
FT                   /translation="MREGENTLRAESTAAFRARKGLSEGLLERQAARESNARTYPRSIP
FT                   IAVSRARGPYVWDADGRRYLDCLSGAGTLALGHNHPVVVEAIREVLDRGGPLHTLDLAT
FT                   PVKDRFVEELFGSLPRRFAERARIHFCGPAGADAVEAAVKLAKTATGRETVLSFSGGYH
FT                   GMTHGALSLTGKLAPKEPLAGLMPGVHFLPYPYGYRCPFGVGGEDGWRVGARYVERLLD
FT                   DPESGVKRPAAMVLEVVQGEGGSIPAPDGWVREMRRITRERGIPLIVDEIQTGLGRTGT
FT                   VWAFERPGIEPDAVVMSKAIGGSLPLAAVVYDAALDVWEPGAHTGTFRGNQLAMAAGAA
FT                   TVRHVLKNRLHEHAARMGELLLERLREVQREAGCVGEVRGRGLMVGVEVVDPEAGPDPL
FT                   GSRPARPDLARRVQAEALRRGLILETGGRHGAVVRLLPPLIIAEEEAEEICALFGEAVL
FT                   AASRGAR"
FT   gene            complement(445285..446244)
FT                   /locus_tag="Rxyl_0413"
FT   CDS_pept        complement(445285..446244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0413"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: gka:GK1457
FT                   iron(III) dicitrate ABC transporter (lipoprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03387"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYZ1"
FT                   /protein_id="ABG03387.1"
FT                   /translation="MSWWRGFVISVLLAAGALGLAACGGASGGSSGGEEGSGGRIIEHA
FT                   MGRTEVPERPERVVVLDTGELDSAITLGVKPVGAVEAVPGMGLPEYLGEKTRGIELVGT
FT                   IEQPNLEKIAALDPDLILSSKLRHEKIYDQLSEIAPTVFTETTGVTWKQNFELHARALG
FT                   RTERAEEVKREYRRHIRELRDELGEKPWPEVSVVRFVPGDTRIYQKENFIGTVLEDVGL
FT                   PRPESQDVEEFALLNVSKEAIPKMGGDVIFVTVYGNEEDTAKQEIMNDPLWRQLEAVRE
FT                   GRVYEVSDDLWMLGIGYTAANGVLDDLEKYLAEERRAS"
FT   sig_peptide     complement(446146..446244)
FT                   /locus_tag="Rxyl_0413"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.459 at
FT                   residue 33"
FT   gene            446383..447390
FT                   /locus_tag="Rxyl_0414"
FT   CDS_pept        446383..447390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0414"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   ana:all2586 iron(III) dicitrate transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03388"
FT                   /db_xref="GOA:Q1AYZ0"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYZ0"
FT                   /protein_id="ABG03388.1"
FT                   /translation="MRLLRSRAALLAGLGVLCVLLLVCLLASVRFGAARIGTMEVISAF
FT                   TDYDRSSEEDLIVRTLRVPRALVAALVGASLAVAGAIMQGLTRNPLADPGILGVEAGAA
FT                   LAVVGAVFLLGVSSLSGYALFAFAGAALAAAVVYGLGSLGRGGMTPMKLTIAGAALASL
FT                   LTSLTTAVLIIDRQTLEEIRFWLAGSVAGRDLELLLQVLPYIACGLLLALGLARQITTL
FT                   SLGDEVAAGLGQRVGLAKLLAALAVVLLAGSAVSVAGPIGFVGLVVPHVARFFAGVDYR
FT                   WVLPYSALAGAVLLVCADIAARVVLRPMELPVGVMTALVGAPFFVYLARWRVKR"
FT   sig_peptide     446383..446481
FT                   /locus_tag="Rxyl_0414"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.686 at
FT                   residue 33"
FT   gene            447387..448427
FT                   /locus_tag="Rxyl_0415"
FT   CDS_pept        447387..448427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0415"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   ana:all2585 iron(III) dicitrate transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03389"
FT                   /db_xref="GOA:Q1AYY9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYY9"
FT                   /protein_id="ABG03389.1"
FT                   /translation="MRRRAALRRGGLSLAVDLRAAAVTAALCAAGLAGVVLHVGVGEYP
FT                   ISPPDVLRALLGLTSGEENYAFIVNALRLPRALVAFLVGAALALSGAILQGLTRNPLAA
FT                   PEILGINAGAGLAAVTLIVALPSVPAALVPPAAFAGAVAVAGALYLVAWRGGSSPVRLV
FT                   LIGVGIGAVATALTTIMITYGEIEQVSQALVWLTGSVYGRSWEELWTLLPWLVAFGALA
FT                   LLRARHLNALSLGDEVAAGLGVGVERERGVLLLCSVALAAAAVATAGTVGFVGLMAPHI
FT                   ARRLVGPSHGGLLPAAAATGGTLVVVADLAGRVAFAPLEIPCGIVTSAVGAPFFIYLLY
FT                   RSKDVK"
FT   sig_peptide     447387..447488
FT                   /locus_tag="Rxyl_0415"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.789) with cleavage site probability 0.249 at
FT                   residue 34"
FT   gene            448438..449292
FT                   /locus_tag="Rxyl_0416"
FT   CDS_pept        448438..449292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0416"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   syn:slr1318 ABC-type iron(III) dicitrate transport system
FT                   ATP-binding protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03390"
FT                   /db_xref="GOA:Q1AYY8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYY8"
FT                   /protein_id="ABG03390.1"
FT                   /translation="MKELGRLLKRVEAPAGPAKLRAEGLVLGYDEATVIDGLEVEVPPG
FT                   RITSVVGPNGCGKSTLLRSLARLLRPRGGGVYLDGKEIFSLPTREVARRLGILPQSPEA
FT                   PEGLTVRELAAQGRYPHQSWLSQWSASDERAVERALQKTGMLPLADRPLDTLSGGQRQR
FT                   AWISMALAQETETLLLDEPTTFLDLAHQLEVLQLLGRLNAEEGRTVVMVLHDLNNAARY
FT                   SHHVIALHDGGVYAAGPPEEVVTPELLRDVFHVEADVVADPRTGLPLCVPYGLRRRAEG
FT                   EEA"
FT   gene            449289..450092
FT                   /locus_tag="Rxyl_0417"
FT   CDS_pept        449289..450092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_4381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03391"
FT                   /db_xref="GOA:Q1AYY7"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR024726"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYY7"
FT                   /protein_id="ABG03391.1"
FT                   /translation="MSGSPLAEALGRVDPDRHRFRMRAGASGEGWVVAAELVSDAALAG
FT                   RQIQRARSRWGLRRREAAAYLVGSYAWGVGGPAAAAYVLARRVPDLSPQNVLVRLDEGG
FT                   GIPEAALCGGRFAALASDPASGHPEALAFPGEPELLAWMRGRLVAGLGPLVELVSGLTR
FT                   VGGRTLWGRAADLLAQSFLMVGEDTPDQVGCMRDARAFVSGLPFGERVGFFVVGSGERR
FT                   RAFMRRSICCQAYRNPGYGYCDSCPALSQEERERRALEELARIRA"
FT   gene            450117..451160
FT                   /locus_tag="Rxyl_0418"
FT   CDS_pept        450117..451160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0418"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: periplasmic binding protein; KEGG: cjk:jk1776
FT                   putative iron ABC transport system, solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03392"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYY6"
FT                   /protein_id="ABG03392.1"
FT                   /translation="MAETVERLGSSRRPGCRRTTRREFLAGAAALLVLPAGCAGGSGGA
FT                   SGGSRAVEHRYGVTRISGRPRRVISLGYQEHDALFALGVEPVAVRYWYGDRDDVIHPWA
FT                   EDEAGEADPEILDMPFGELNFERMAALEPDLIMGVYAGLTRDEYETLSEIAPTVAQPAG
FT                   YVNFGTPWQRATLMAGRAVGREGRARRLVSRVEGRFEEARREHPRFDGATVAVASYGTG
FT                   EKIGFFSSQDARARFFTGLGFRVPERLDELAGESFYGTISPERMDLLDADLLVWCQLAS
FT                   TEGGREAIERDPLVRRLAASREGRMFFMEGVLDDALQFGTVLSLPFLLERAVPGIAAAV
FT                   DGDPQTT"
FT   sig_peptide     450117..450260
FT                   /locus_tag="Rxyl_0418"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.765) with cleavage site probability 0.311 at
FT                   residue 48"
FT   gene            451190..452224
FT                   /locus_tag="Rxyl_0419"
FT   CDS_pept        451190..452224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0419"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: mbo:Mb0271c
FT                   probable periplasmic iron-transport lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03393"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYY5"
FT                   /protein_id="ABG03393.1"
FT                   /translation="MRKSPTVEPLRDMRISCDLTRRDFLLGGAAALLFAGCGGGAGEGG
FT                   GEARTIEHKYGKITIEGTPERVVSVGYTDHDPLLALGVRPVGIRRWFGDPPRGVWPWAR
FT                   DELGDATPELLPVDSINYEQVAALEPDLIVGISSGMTRNDYDTLSEFAPTLAQSDRWPD
FT                   YGVPWQPQTLVIGRALGREGRARRLVSRVERRFEEARREHPRFDGATVSVIGVGDGLFY
FT                   LYSTVDRSVQFFTSLGFGLTEEAARIAPENRYYVEISEEQLGLADADVLVCFCASPADE
FT                   RRIRSNRLFRRLDAVREGRVVYLSENDNPLKGALSFNTVLSHPYLLENFVPRLAGMVRR
FT                   ARRG"
FT   gene            452250..452609
FT                   /locus_tag="Rxyl_0420"
FT   CDS_pept        452250..452609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_2469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03394"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYY4"
FT                   /protein_id="ABG03394.1"
FT                   /translation="MDRHSFDVRLTPEARDLLRPGEAVVLDWHRLAVCCAGAGEVGLYA
FT                   MPEEVARRRKGLVRLRGEDRVFAARAVFPHLAGRRVIIDGRRWLGLRRFKADLPGDFGL
FT                   RAALGRLPGPGSPAG"
FT   gene            complement(452661..452861)
FT                   /locus_tag="Rxyl_0421"
FT   CDS_pept        complement(452661..452861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0421"
FT                   /product="protein of unknown function DUF466"
FT                   /note="PFAM: protein of unknown function DUF466; KEGG:
FT                   bur:Bcep18194_B0098 protein of unknown function DUF466"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03395"
FT                   /db_xref="InterPro:IPR007423"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYY3"
FT                   /protein_id="ABG03395.1"
FT                   /translation="MAHGNRLGAALRYAWDYLKEVSGENAYDHYLRRHRATHPGKPPMS
FT                   RREFYRRRQDERFSNPGSRCP"
FT   gene            complement(452874..454997)
FT                   /locus_tag="Rxyl_0422"
FT   CDS_pept        complement(452874..454997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0422"
FT                   /product="carbon starvation protein CstA"
FT                   /note="PFAM: carbon starvation protein CstA; KEGG:
FT                   fra:Francci3_2468 carbon starvation protein CstA"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03396"
FT                   /db_xref="GOA:Q1AYY2"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYY2"
FT                   /protein_id="ABG03396.1"
FT                   /translation="MGSRLKRYGIWVLVAVVGAVCWGVLALARGETINAGWLLFAAIAS
FT                   YAIAYRFYARFIQTRVLETDDSRATPAERLENGRDFVPMDRRILFGHHFAAIAGAGPLV
FT                   GPVLAAQMGFLPGTIWIIFGVILAGAVQDMTTLFFSMRRDGKTLGQMAREEIGPVGGAA
FT                   ALIAVMSIMVILLAVLALVVVNALTASPWGSFSLLMTVPIAIFMGFYLRFLRPGRVIEV
FT                   SLIGFALLILAIVGGGWISESGYAEAWTFEGTTITWALIIYGFVASVLPVWVLLAPRDY
FT                   LSTFMKIGTVLLLAVGIALTLPAMQMPRTTQFAFNGEGPVFSGPLFPFVFIIVACGALS
FT                   GFHSLIASGTTPKLIAKESQVRMIGYGAMLMESFVAVMAMIAACILDPGVYFAMNAPAG
FT                   VLGETARSAAEAVRGFGFTVTPETLNQIAQNVGEESIIARTGGAPTLAVGMSQILSSLL
FT                   GGTTLQAFWYHFAIMFEALFILTTVDAGTRVGRFMLQDMIGNVWRPFARTSWLPANIVA
FT                   SALIVAAWGYFLYAGVTDPLGGINQLFPLFGIANQLLAAVALTVGTTILIKMGKLKWAW
FT                   VTALPLAWDASVTLTASWYKIFSPDPSIGFFAQRAAFQEALANGEVVAPAQSLEDMRQV
FT                   VLNSTVDGILSILFALMIIIVILDAARVWVGVITGRKPAETTEAPYERSRLDHEGKPLE
FT                   PEPVGAGGSPSSS"
FT   sig_peptide     complement(454911..454997)
FT                   /locus_tag="Rxyl_0422"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.951) with cleavage site probability 0.824 at
FT                   residue 29"
FT   gene            complement(455081..455803)
FT                   /locus_tag="Rxyl_0423"
FT   CDS_pept        complement(455081..455803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0423"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: sai:Saci_0388
FT                   conserved archaeal membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03397"
FT                   /db_xref="GOA:Q1AYY1"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYY1"
FT                   /protein_id="ABG03397.1"
FT                   /translation="MRLDPPDSYWKKDVALFLGRRLSLAIKMLYPAAIILPVAASGIPA
FT                   QYAAAVVGLVAIMAGTFGAGESLTNDINDGILVRVALTPLSPYRIVAEILVVNAALDFL
FT                   QLLPALAGVYLLHPAPPAWVLAATVAVFATLLTANAIGVLLANFTSSPADVLLYATIVL
FT                   FPLIYLSGFFRNQHPEGLLAALRHLVPFAYMNDALKEIFGLATAASPLAVILVPTLLGA
FT                   LAAAAVCLTAPRLLSPRL"
FT   gene            complement(455793..456743)
FT                   /locus_tag="Rxyl_0424"
FT   CDS_pept        complement(455793..456743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0424"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   ape:APE2579 putative ABC-2 type transport system
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03398"
FT                   /db_xref="GOA:Q1AYY0"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYY0"
FT                   /protein_id="ABG03398.1"
FT                   /translation="MASAALEAENITRRYRSSGRGVEGVSLSVAPGEVLGLVGPNGSGK
FT                   STLLRVLSTAIAPDSGAFRVCGLDGLRERRKVRARLGIMVDRPTHYGDLSGWANAYLFA
FT                   RAYGVPEEKADRALRGLFEHFGLAEYRDEKAKTYSYGMAKKLALIEALAHEPAVLLLDE
FT                   PSLGLDYTSRLAYQRKLREAAENGCAVLLASNQVDEVEALCDRVVFLHRGRAVAEGTPE
FT                   GLVSSLEGLRRVVAALRNPVPYAEVGEVPGVRRVVPEGRGLVVHCEDRPGIVAGVVGAI
FT                   VRCGGDITGLSVERPTLEDVFARLTGEALRGEDEA"
FT   gene            456903..457787
FT                   /locus_tag="Rxyl_0425"
FT   CDS_pept        456903..457787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0425"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding
FT                   protein"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase, NAD-binding;
FT                   KEGG: sma:SAV1542 putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03399"
FT                   /db_xref="GOA:Q1AYX9"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYX9"
FT                   /protein_id="ABG03399.1"
FT                   /translation="MNGNVSVAVLGTGIMGSAMARNLLKAGMEVRVWNRTRSRAEPLAA
FT                   EGARVADSPREAARGAGVLLTMLADAGAVAGAVGGGALEALSPGAVWLQMSTVGVEGTG
FT                   RLQRMALERGVAYVDAPVLGTRQPAEAGELVVLASGPEEVRPACEPVFEAVGKKTLWVG
FT                   PVGAGTRLKLVVNNWITGLLGVLGETFALAQKLGVDPSLFFEAVEGGPLDLPYARAKGK
FT                   MMAEGEYPTSFSVRLARKDAGLVLEAAEDLRLPVCEAVAYHLDRAAETGHAEDDMAAIY
FT                   EGVRTAAEPGGAG"
FT   sig_peptide     456903..456965
FT                   /locus_tag="Rxyl_0425"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.995 at
FT                   residue 21"
FT   gene            complement(457819..459216)
FT                   /locus_tag="Rxyl_0426"
FT   CDS_pept        complement(457819..459216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0426"
FT                   /product="FAD linked oxidase-like protein"
FT                   /note="PFAM: FAD linked oxidase-like
FT                   Berberine/berberine-like; KEGG: reu:Reut_A1637 FAD linked
FT                   oxidase, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03400"
FT                   /db_xref="GOA:Q1AYX8"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYX8"
FT                   /protein_id="ABG03400.1"
FT                   /translation="MDQRYTPGPDLRELDGSFRGELIRPGEAAYEDARRVFNGMIDRRP
FT                   ALIARCTGVADVVAAVIFARASGLEVAVRGGGHSVSGYGTCDGGLVIDLSPMKGVWVNP
FT                   GERRARAQAGLTWGEFDRETQLFGLAVTGGRVSGTGISGLTLGGGSGWLERRLGFTVDN
FT                   LLSVEMVTAEGGLVRATEEENEELFWGVRGGGGNFGIATSFEFALHPVGPLVLGGMLLY
FT                   PAEQAPGLLRFYREFMRGAPDELGGGCAFLTAPPEPFIPEHVRGTKLIAVIVCYAGGVE
FT                   EGEAAIQPLKKHLPPAMDMVRPMPYTELQTLLDAANPPGMQHYWKAGFLDELPDEAIDV
FT                   LVEHAGRMASPLTVLALFPMGGAISRVGEDETPLGPRGAAYNYHALAQWAEPSEAGRHV
FT                   GWAGELEAALRPWTGERTYLNFIGDEGEERVRTGYGPEKYRRLAGLKKRYDPDNLFHLN
FT                   QNIRPGA"
FT   gene            complement(459259..460062)
FT                   /locus_tag="Rxyl_0427"
FT   CDS_pept        complement(459259..460062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_I2822 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03401"
FT                   /db_xref="GOA:Q1AYX7"
FT                   /db_xref="InterPro:IPR018688"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYX7"
FT                   /protein_id="ABG03401.1"
FT                   /translation="MWAAPRDLHNRIFVALMALIALAWLALWLWGASPYAPYLDHEELG
FT                   HLASGGAGAGGLAARLAPLVALFVSGWTLMVVAMMLPTSLPLVLLFGRLTRRRPDGRLL
FT                   LALLLCGYVSVWALFGALAFLGDLLVHEGAERSAWLGDNPWAIGAGTLALAGLYQFAPL
FT                   KNRCLQRCRSPLGFITEHWRGERERSRAFRLGAHHGIFCLGCCWSLMLVMFAVGAGSLL
FT                   WMLLLGAVMAAEKNAGWGRRISAPVGIALLCWAAAMALGGVPALR"
FT   sig_peptide     complement(459967..460062)
FT                   /locus_tag="Rxyl_0427"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.720) with cleavage site probability 0.581 at
FT                   residue 32"
FT   gene            complement(460129..460749)
FT                   /locus_tag="Rxyl_0428"
FT   CDS_pept        complement(460129..460749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0428"
FT                   /product="protein of unknown function DUF1326"
FT                   /note="PFAM: protein of unknown function DUF1326; KEGG:
FT                   rso:RS01737 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03402"
FT                   /db_xref="InterPro:IPR009758"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYX6"
FT                   /protein_id="ABG03402.1"
FT                   /translation="MAYQLEGRLLEVCDCNVLCPCWIGEDPDGGTCDAVVAWKVDRGTV
FT                   DGVDVSGHTFAVLNYIPGNIFEGNWRAVVFVDEDATEEQQEALLNVFTGRLGGPMAEFA
FT                   QLIGEVVAVERAPITFTVEEGKGTLRIGSGTNPIAEAEMASYMGATEKPTTLQETVFST
FT                   IPGSPAYVSKATKYRRNSSGYGLRDVDLEGHNAIQGHFKLEAA"
FT   gene            complement(460787..461161)
FT                   /locus_tag="Rxyl_0429"
FT   CDS_pept        complement(460787..461161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mll5389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03403"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYX5"
FT                   /protein_id="ABG03403.1"
FT                   /translation="MSEQREKAPGTLDLEALRRAIEGRDTEALIALYADDAELRVVNKD
FT                   TPPSRPFVMRGRDEISAYLRDVCSREMAHRLEDPVVGEGRVAFNEACEYPDGTRVLAAA
FT                   TLEVRGGRIRRQVNVEAWDE"
FT   gene            complement(461323..463365)
FT                   /locus_tag="Rxyl_0430"
FT   CDS_pept        complement(461323..463365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:glr3133 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03404"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYX4"
FT                   /protein_id="ABG03404.1"
FT                   /translation="MSSRQTGRLGLERHRMLVGREEERRLLEEALAGGEPPFAVLYVFG
FT                   IGGCGKTALLREFAYLCEEAGTRALYLDAHRLTEPPLPLLLERARPGRRVILLDGCERL
FT                   PPLQEWVDEDLLLGLQEGLLLVLSGRSPPPAEWLADPGWRSLVRLLPLGNLGEQESREL
FT                   LARRGLHPRQQRGVLGFARGHPLALSLAADAALRNPLGRFGPEEEIEVVGTLAGHLVGE
FT                   LPGPEHREALEVCALSRHTTESLLARAVPGAEPGELFGWLRGLSFVRPGPLGLVPHPTA
FT                   REVLAADLRWRDPDRHARLLRRVRRYHVARLGESRGAERQRALLDYLFLHREDPEVRPL
FT                   LGRGEADGASAGPPRPGDSARLEKAVERHEGPASGRLARRLLSRGSLEVAIYRDPAGRP
FT                   AGFAASLRLRRAGGEERDPAALAALRHLEGRGPLRTGEEAALLRFWMARSSYQSGPALR
FT                   GILLDAVLRHVLDAPPPACTLLVVADPPRSGRALDRLGFPRLPGEGFAVGGRRYALYGH
FT                   DWRTVPPGDWLDLLAERGPAGEALAGPAGERPAVLEREEFASAVREALKNHARPGALAS
FT                   SPLLRSRLVARRTGGGSGERERVAALRALLEEAAETLRQHPRDARLYRALHHTYFRPAP
FT                   TQEQAARLLGLPFSTYRRHLRAGIENVTDLLWRQETHPPAKPDRK"
FT   gene            463575..463829
FT                   /locus_tag="Rxyl_0431"
FT   CDS_pept        463575..463829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03405"
FT                   /db_xref="GOA:Q1AYX3"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYX3"
FT                   /protein_id="ABG03405.1"
FT                   /translation="MLPRERGSRRAEEAFPERRFSGLSEEQKITWDPEADRRIKRSPFL
FT                   MRRFIRKRIEDRVRSRGRTRVTEADVDESARMYRQYRFK"
FT   gene            463834..464193
FT                   /locus_tag="Rxyl_0432"
FT   CDS_pept        463834..464193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0432"
FT                   /product="protein of unknown function DUF498"
FT                   /note="PFAM: protein of unknown function DUF498; KEGG:
FT                   bta:533224 hypothetical LOC533224"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03406"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="InterPro:IPR034096"
FT                   /db_xref="InterPro:IPR036748"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYX2"
FT                   /protein_id="ABG03406.1"
FT                   /translation="MGSPRITGLSWGRLETERGAFKDAKLYPGGAREWDWNETGTRHDP
FT                   GIQPADVAELLERGAEVVVLGRGFYGRLGVCEETLRLLRERGVEVYAERTEEAVRRYNG
FT                   LAPERRAGALIHSTC"
FT   gene            complement(464412..464858)
FT                   /locus_tag="Rxyl_0433"
FT   CDS_pept        complement(464412..464858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03407"
FT                   /db_xref="GOA:Q1AYX1"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR014747"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYX1"
FT                   /protein_id="ABG03407.1"
FT                   /translation="MEVWPPAKPGKLRGEGASQGKEARALAGEEELVRIGEFEGELDEE
FT                   WREVRGRKVLDHAGEEVGRVEDAYVWARVPAVHLLRVSAADGEDRLIPVDAVTGVDEEG
FT                   VRVEQGRAKILEGPRYGKEEVPDAEARRAAFEHYGYADQLSLGG"
FT   gene            464930..465442
FT                   /locus_tag="Rxyl_0434"
FT   CDS_pept        464930..465442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03408"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYX0"
FT                   /protein_id="ABG03408.1"
FT                   /translation="MTNARTLPGALPLLAAALLALALAVALAASGERAAAAEKAPRYTV
FT                   LSVSDAPGVREVVVSTAARREEGLRLVADELREKGNVPEDGTLLVEYRKRRDPSRETGF
FT                   ALVFDSERAVLEAGKTARYGEVYDEEDAEQIMEEEGGIRAVSYRDFAEENPGLWERIRG
FT                   FLLPVLS"
FT   sig_peptide     464930..465016
FT                   /locus_tag="Rxyl_0434"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.555 at
FT                   residue 29"
FT   gene            complement(465439..465708)
FT                   /locus_tag="Rxyl_0435"
FT   CDS_pept        complement(465439..465708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0435"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: tel:tsl1009 ferredoxin I"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03409"
FT                   /db_xref="GOA:Q1AYW9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR010241"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYW9"
FT                   /protein_id="ABG03409.1"
FT                   /translation="MAKTHRVTFKKSGVTIEVAEDEYILEKAEEAGLDLPYDCRSGTCT
FT                   TCMQRCLEGEVDQDLAFAISEEELEEGYRLICIGSPLSDVVLDA"
FT   gene            complement(465816..468224)
FT                   /locus_tag="Rxyl_0436"
FT   CDS_pept        complement(465816..468224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0436"
FT                   /product="UspA"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein UspA; KEGG:
FT                   mma:MM1452 universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03410"
FT                   /db_xref="GOA:Q1AYW8"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYW8"
FT                   /protein_id="ABG03410.1"
FT                   /translation="MSERTMSGAPRGAPRAGGILASSKARGDMYKEVYVPVDNSDYSNQ
FT                   ACVIGVDVARAFGGRVAGCHAYAAKMHDVRFRQMESGLPEEFRDEEEMQRQRKIHDQLI
FT                   TKGLEIITDSYIDVLEPLCEKYDVELVRRSLEGKNFKVIVEDVNSGDYDLVVMGAMGMA
FT                   AVKDTVLGSVTERVTRRLKKADCLIVKDLDRSPFEHIVVTIDGSAKSLGGLKRAIDLAR
FT                   EFGGTVEAISVFDPYFHYAMFHSIAGVLSTKAQKVFRFKEQEKLHEEIIDSGLAKIYTA
FT                   HLEVAKKVAADEGVELKTTLLAGKPFEQTLKYVREVEPSLVVMGRIGYHSDEDMDIGSN
FT                   TENMMRYLPTNVLVVNYEYQAPDLYTAEEHITWTKEALERMDRVPGFVVGMASGAVIRY
FT                   AIEKGYTVITTSVIDEVIENILPPGAMESMRAIGDQIRAQEAAGEEAPVDSLFKDFEER
FT                   TRQNGSSNGHRNGTSDPEKEAKREIIEGGRGGFGKAEDQGDVEGISEEVQEEIQRAAQG
FT                   RDRFECDVCRYVAKGKPARCPVCGAGPTHFHPVDAEIATAAAGENLNRSEVYDGRELHW
FT                   TDEAQAFLDSLEGWQEKRRVKARAEKSALKKGYTTITREYVEQQYREETGREAPETKRG
FT                   GGCPVHQAKEKVERETGGKCPIDHRAFKEAGRRVPEGGSGEFAWTEDAVARLERVPKGF
FT                   MRNISRNMTEKLARKKGVREIDMPLIEEALEGARNTMEDVITGKISIAELARDTGEKIE
FT                   AGENGEAPHPNLTVTMVCTTCGEEMEGIQPPEECPVCGAPAEDFEQKGR"
FT   gene            complement(468493..469764)
FT                   /locus_tag="Rxyl_0437"
FT   CDS_pept        complement(468493..469764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0437"
FT                   /product="monooxygenase, FAD-binding protein"
FT                   /note="PFAM: monooxygenase, FAD-binding FAD dependent
FT                   oxidoreductase; KEGG: ava:Ava_2049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03411"
FT                   /db_xref="GOA:Q1AYW7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYW7"
FT                   /protein_id="ABG03411.1"
FT                   /translation="MGAPARSVTRTTCAVVGGGPAGAMLSLLLARAGVSVTLLEAHPDF
FT                   DREFRGDTLHPSVMEVMDQLGLAGRLLELRHSKVRSFTLDTPKGPFTPVDFSRLNTRFP
FT                   YITMMPQASFLEFLTAEARRYPGFRLVMGARVRELVEEGGAVRGVRYESGDGTHEVRAS
FT                   LTVGADGRGSRVRRLAGFEPVKTSPPMDVVWFRVPRSPGDPEGAMARFGRGRIVVLLDR
FT                   DDHWQAGYVIPKGTFPELRRAGVEGLKVGFAELFPELSDRLAALGDRRQVSLLSVESSR
FT                   CRRWHRPGLLLIGDAAHVMSPVGGVGINYAIGDAVVAANVLAGPLRECQERLVALPERH
FT                   LAAVQRRREPPVRTIQALQALVQRRVLAPTLAAGRPFAPPLPLRLLSRAPLLRSVPARI
FT                   IGFGPLPARVDLPQGGVERAGPPG"
FT   gene            complement(469776..470513)
FT                   /locus_tag="Rxyl_0438"
FT   CDS_pept        complement(469776..470513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0438"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: det:DET0814 ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03412"
FT                   /db_xref="GOA:Q1AYW6"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYW6"
FT                   /protein_id="ABG03412.1"
FT                   /translation="MRRTLIVGGRVLRQLRRNPRFLVLSIVGPLVIVYFLKLFFDTFPE
FT                   GFDTGRYAVPAAAFIVHFMAFLLCAIALVQERTAGTMERMFVNGFRRAEVIGGYVLGYL
FT                   GLATLQAAVALGEVLWLFELDYDADALAALFAVVWLLAIASVMLGIFVSTFARREGQVF
FT                   PFVPLIILPSVFLSGFLVDVDELPGWAGWLGHAFPMLYANNVIQEMIEPGGALADVWTN
FT                   FAVLAGYGAALLALASLTLREVE"
FT   gene            complement(470510..471361)
FT                   /locus_tag="Rxyl_0439"
FT   CDS_pept        complement(470510..471361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0439"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   chy:CHY_0900 daunorubicin resistance ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03413"
FT                   /db_xref="GOA:Q1AYW5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYW5"
FT                   /protein_id="ABG03413.1"
FT                   /translation="MDAVEAVGLEKRYGKQVEALRGVDLSVRKGEVFGLVGPNGAGKTT
FT                   LIKALVGSLRPSGGRARVLGLDPLRDRPELRRRIGYMPQSPVLYDDLPALENVEFFGAA
FT                   HGVPGLRGRAREALRFVELEERAKDPVHTLSGGMKNRVSLACALVHEPEMLFLDEPTAG
FT                   VDPRLRSRFWAAFRELARGGATLFISTHLMDEATLCDRVAVLRQGRVVVSDSPRGILRR
FT                   GRTRLRVREGEREEERLIGGRPEDLAEALRGYGLRGSVSAVSVEADSLEQVVLSIIGEE
FT                   AG"
FT   gene            complement(471349..471972)
FT                   /locus_tag="Rxyl_0440"
FT   CDS_pept        complement(471349..471972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0440"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: sth:STH2255
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03414"
FT                   /db_xref="GOA:Q1AYW4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYW4"
FT                   /protein_id="ABG03414.1"
FT                   /translation="MGEERDRRDQILEAAFEEFSAKGFRGATIKSIAEAAGLQSPALIY
FT                   WYFPDKEALFREVLGSRIPVLRAVRDPARLLERPPEEVLPLIARRYLSTFDNPAAQRMA
FT                   RLLVGEATRRPEIAEIFGNAVIKRMLGFLKSYMARQVELGRLRPHDVRSSARAFIGMLL
FT                   PQVGGKVFFPAIREDGLTDEEHVENAVGMLLEGLRPEGKQGWTP"
FT   gene            472116..474092
FT                   /locus_tag="Rxyl_0441"
FT   CDS_pept        472116..474092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0441"
FT                   /product="Amylo-alpha-1,6-glucosidase"
FT                   /note="PFAM: Amylo-alpha-1,6-glucosidase; KEGG: sco:SCO7493
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03415"
FT                   /db_xref="GOA:Q1AYW3"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="InterPro:IPR032856"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYW3"
FT                   /protein_id="ABG03415.1"
FT                   /translation="MQLPDRETETLEWAVSVVSPGAYAVSDGAGDFDAGAGGLYYRDTR
FT                   HLSRFVLEVGGERPVVRGREARGTAAEFLLEAAGLELVRRRRLGHGMEEEVEVRNPSGR
FT                   AVEARLSFGVGADFEDVFVVRGFAGRAERGEVVEEVREGGLRYLYRRGGFSRGTEVRAF
FT                   AEGAEPVAGSGGIHCLLRLGAGQRRVVRVSVALEEGGERVRAAGRRGAPYAAAPALETD
FT                   WEALRRSWERSVEDLAALTFDAGEGLLVPAAGAPWYMALFGRDALLAAYGAMILTPEPA
FT                   RNALRALARWQATERDDYTDAEPGKIPHELRRGELAYFREVPQPYYGTADATPLFLVLL
FT                   EEHRRWTADEGLARELEGAARRALDWLLAHADRTSGGFVAYESRSPAGLRNHGWKDSDG
FT                   SMLFRDGRRAGGGVAPCEVQGYAYDALLRTARLAESAWGDAALAGRLRDEAGDLRERFD
FT                   RDYWMEDRGCYALALDGEGRKVDSVTSNAGHLLWSGIVPEEKAPLLARRLLSEEMFSGW
FT                   GIRTMAEGEGGYDPLSYHNGSVWPHDSALIALGLARYGFRKEAARVAAALVEAAERFGY
FT                   RLPEVFGGERRREGEGPAGYPSSCSPQAWAAAAVPLLVRALLGAEPDPEARVLRSGPVL
FT                   PEGVRGLRLEGVPAFGGRHAVGG"
FT   gene            474125..474370
FT                   /locus_tag="Rxyl_0442"
FT   CDS_pept        474125..474370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03416"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYW2"
FT                   /protein_id="ABG03416.1"
FT                   /translation="MVSLPCSLEEKGACSHVVDRKDLILLESAIDAIEEAASAVAQEIE
FT                   RDRLGETSLARLATVEAELNRSRLALEEIVREESGG"
FT   gene            complement(474375..475544)
FT                   /locus_tag="Rxyl_0443"
FT   CDS_pept        complement(474375..475544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0443"
FT                   /product="peptidase S1 and S6, chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6, chymotrypsin/Hap Colicin
FT                   V production protein; KEGG: fra:Francci3_4292 colicin V
FT                   production protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03417"
FT                   /db_xref="GOA:Q1AYW1"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYW1"
FT                   /protein_id="ABG03417.1"
FT                   /translation="MWVRIARMTALDWCIVAFVALAVFRGARTGFLAGLFSLVGVLLGA
FT                   SVGSRVAGHLIPEGESPFLGAAITLVSIVSFAILGEMIARSAGGSLRSRLRGGGSSLLD
FT                   SAGGAALGLALSLLLVWAVGIFAIQSPPLSGLHPLVKDSRIIRALDERMPAELLTQAVA
FT                   QLNPLPQMRGPDAGVGAPDGSIVRDPDVLAASSRMVRITGIACGYGIEGSGWVAAPDLI
FT                   VTNAHVVAGETVTSVQPGGTGPRRRADVVVFDPKNDVAVLRVEDLGLTPLPLDEPVPGE
FT                   PAAVLGFPGNGPLDIQPARTGATQRVISSDAYNRGPVERTVTSFRVYVRPGNSGGPVVN
FT                   AEGEVTATIFASRANSRNSGYGIPSQIIRRHLERATLRAEPVGTGPCAS"
FT   gene            475594..476661
FT                   /locus_tag="Rxyl_0444"
FT   CDS_pept        475594..476661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; PFAM:
FT                   Radical SAM; KEGG: gka:GK1174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03418"
FT                   /db_xref="GOA:Q1AYW0"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1AYW0"
FT                   /protein_id="ABG03418.1"
FT                   /translation="MGLAGAQERAGRPLAAEFLPEVEEVLAERGEPPYRLRQVYAALAG
FT                   SLASGWDEVASLPKGLREELAGRVPASVLELRRISRARDGTRKYLFFTRDGHAIETVMI
FT                   PERSRRTVCISTQVGCPMACTFCATGLLGIKRNLKAREIAEQVFAVARDIAPERVTNVV
FT                   VMGMGEPFLNYRETLRALRVLNDRRGFNLAARHIAVSTSGLVDKIRRFADEPEQFHLAI
FT                   SLHTPFEEERRRLMPVAARHPIPELMNAARYYVERTRRKLFFEYTLLAGVNDRMRHAEA
FT                   LAELLDHPLYHLNLLRFNWTDTGFSATSARRAKEFLRRARELGLSATLRPSRGQDIEAA
FT                   CGQLAARDARSPTAR"
FT   gene            476658..477137
FT                   /locus_tag="Rxyl_0445"
FT   CDS_pept        476658..477137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0445"
FT                   /product="membrane-flanked domain"
FT                   /note="PFAM: membrane-flanked domain; KEGG: bha:BH1720
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03419"
FT                   /db_xref="GOA:Q1AYV9"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYV9"
FT                   /protein_id="ABG03419.1"
FT                   /translation="MREEPKERLDPRAKTLWRLSGFLEMLPVLAAGAGTGWAVARFGGQ
FT                   PPAVAAVPVLATLLATLANALVLPELRWRRWRYEIREDEVDLQRGVLWVVRTLVPFARI
FT                   QHVDTRSGPLQRRFGLATVVFYTAAGPNRIPELSAPVAAEVRDRIAELTRERDEL"
FT   gene            477127..478623
FT                   /locus_tag="Rxyl_0446"
FT   CDS_pept        477127..478623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0446"
FT                   /product="membrane-flanked domain"
FT                   /note="PFAM: membrane-flanked domain; KEGG: bld:BLi00548
FT                   YdbT"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03420"
FT                   /db_xref="GOA:Q1AYV8"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="InterPro:IPR014529"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYV8"
FT                   /protein_id="ABG03420.1"
FT                   /translation="MSSEPRRLHPAAMVIEGIRAVRRWASAAAIPGLAALLGGLSWWAL
FT                   ALLLAGAVLLAAGTVLWGFLSWRATVYRVEGGAFHLRSGVLQKKERTIPLEHVQSVDAV
FT                   QGVLQRLFGVVEVRIETAGGGSSEPDASLAALSRRAADELRRELGGGGRGGEPGEGGGA
FT                   GTVRRLSTRELLVAGATSGQIGPAAALIGAASQFFDDLYDRLLSEEAARGLLEALAPHA
FT                   FAAAALLLLAVGLLAWLLAIAGTVLAYAGFTLSRSPDGRNIHISRGLLSRYEATIPVAR
FT                   IQAVRVVEGVLRQPFGLASLRVESAGYGRDEGVSTTLFPMLPRGEAARLLAAVDPGLAA
FT                   DPPLAPLPRRALRRYALRSALPALAAPLAAAGAWSAGAGAGWLLAALPLPALAALYGAL
FT                   RYRDAGWALAGDRLVARSRLVARTTTIAPRRRLQSRSLLRSPLQRRAGLATFRARIASG
FT                   GGGTGVEVVDLDLRSAWDLMAALGPRPPSPASGRRPVPSR"
FT   gene            complement(478592..479491)
FT                   /locus_tag="Rxyl_0447"
FT   CDS_pept        complement(478592..479491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0447"
FT                   /product="Alkaline phosphatase"
FT                   /EC_number="3.1.3.1"
FT                   /note="PFAM: metallophosphoesterase; KEGG: syn:sll0222
FT                   alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03421"
FT                   /db_xref="GOA:Q1AYV7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR039331"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYV7"
FT                   /protein_id="ABG03421.1"
FT                   /translation="MNDVLGLRLLKYAACLLLACCGALVVAVPVLGQTSAVTMVGAGDI
FT                   ADCKGTGERQTARLVARISGTVFTVGDNVQGRGRWSEFTDCYAPTWGRFKNRTRPAAGN
FT                   HEYYTSGARPYYRYFGSRAGRPGLGYYSYDRGSWHVVVLNSNCGHVRCGAGSRQLEWLK
FT                   RDLAANRSRCTMAIFHHPLFTSSRSADTKEVRPFWKVLYNNRAELILNGHAHSYERFAP
FT                   QTPFGRRAPERGIRQFVVGTGGTPPLNPFGARPANSQVRNDKTFGVLRLTLRPGGYSWR
FT                   FVPVAGKTFTDSGRGVCR"
FT   sig_peptide     complement(479393..479491)
FT                   /locus_tag="Rxyl_0447"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.904 at
FT                   residue 33"
FT   gene            complement(479590..482457)
FT                   /locus_tag="Rxyl_0448"
FT   CDS_pept        complement(479590..482457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0448"
FT                   /product="SMC protein-like protein"
FT                   /note="PFAM: SMC protein-like; KEGG: mka:MK0690 SMC1-family
FT                   ATPase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03422"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYV6"
FT                   /protein_id="ABG03422.1"
FT                   /translation="MILKRLYLENYKQFRDPLELLPPEGAIGVVGANGAGKTTLFEAIL
FT                   WAFFGSRGTDARFANDSIPWSGGSASDRSAVEVTLEVGGTSYRVERSLRRGRTEARVCR
FT                   EPDEELVGGPSEVKRWVQEHLLGMDRTAFEATFFARQKELEFFAETTGVERRRKIAQLL
FT                   GISRVEEAQKLLREDRRAAENLRRALEGVLEGTDAEALEREIPAARARRDEARSRKDAA
FT                   QRELEERERELASARAEAERAEALYRSVTDLERRLDAAAAERERAGERADRLREHLGSL
FT                   EEDERKARELEPRTLGLAGVEREISALEEARDRERRREMAREEMQRLRRSAHDALMEAC
FT                   DLLEELDGEEPPLPGWGGLFGVEDEAARLREAVRLLGEAEDARRRAELRLKDLREAAEL
FT                   HGRLAELRGELRQLREEREAARGELARLEREISRSSGGEPPERLLERLREEEGRLRQRA
FT                   AGRRALAELEEQEARRLSQARRLIDTSHERAECPTCRRGFAAGEHAEVLETLRGQEEAA
FT                   RARAAEALSSSRRLEERASGLRRRMEEAGRLLERLRLLNEERRLAAARLESLDARLGPL
FT                   EEKAGALRERLGPSPAPTERELEAAERELEALRRLCGARPALEGLLSSYEKDCAAAAER
FT                   ANEAERLSRGPAYDEAAHRRLLERRSEIERLGGILETIRERLSQRPAVEEALRRALEER
FT                   RRAGERAARLREELSALDFDEGAYRRARERAGEAERRRDAARQRREEAAAELQELEHRL
FT                   QTLEADLARYREHRRKADEQAALSGELSQMDRLLGEFHGALAARLRPHLQREASALISV
FT                   LTDGRYSRMEFDDEYNIRLFDGLSDSYEISRFSGGEADIASLCARVALSKTISDRGPDT
FT                   LGFIVLDEVFGALDTDRRRNVLLALDRLKRTFGQIFLISHVGDIQESALLDEMWLVEVD
FT                   GAGKSSVRRLNAASKQVAEILQNSS"
FT   gene            complement(482454..483518)
FT                   /locus_tag="Rxyl_0449"
FT   CDS_pept        complement(482454..483518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0449"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: mka:MK0691 DNA
FT                   repair exonuclease of the SbcD/Mre11-family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03423"
FT                   /db_xref="GOA:Q1AYV5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYV5"
FT                   /protein_id="ABG03423.1"
FT                   /translation="MDVSEAYARAVDAILERDVDLVIHSGDVFDSVRPATHVVVHFLKQ
FT                   TARIIGRNIPYYGIAGNHETPRLRATTAALEYATLVGARFVHGFEPDYGAVEVRGARVG
FT                   LSLVPHGAVADREVVVTPGRDDDISILVTHGTVPGLRIRGHELGEVDLPGHVLDGSFDY
FT                   VALGHYHYFHPHRPNAYYAGATERFGFGEADSRPGFALVEFDGEGVRVEHVPIPCRPML
FT                   DLPRIDASGMDAAELTEAIRERAGRAEIDGAVVRLKVVEAPRGAAAGVDREVLRELRRR
FT                   CLDFSLEISEAGAEEAAGGEETAGAAFGPLEEEFRAFVERRRESGKIGRTFAERFLEAG
FT                   LGYLRRAGEEGPAA"
FT   gene            complement(483675..484454)
FT                   /locus_tag="Rxyl_0450"
FT   CDS_pept        complement(483675..484454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0450"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /note="PFAM: biotin/lipoate A/B protein ligase; KEGG:
FT                   bbr:BB2891 putative lipoate-protein ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03424"
FT                   /db_xref="GOA:Q1AYV4"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYV4"
FT                   /protein_id="ABG03424.1"
FT                   /translation="MTAERWSRYRWRLIRGEPVPPPVNHALDEVLTRRVGAGERPPTLR
FT                   FWGRFAPEVALGRFQSLGNEVDAGGVRRHGVAVVRRMTGGGAMFIEPASVITYSLYAPA
FT                   ELVAGMSAAESYPFLDAWVVEALRSLGIEAHHEPINDISSPEGKIGGSAQARAFGAVLH
FT                   HTTLAYDMDARKMLEVLRIGQEKISDKAVRSAERRVGPLRRQTRLPRERIVERMVSTFS
FT                   RYAGALEEDRVSPQEAEEAEALVRSKYGTPAWNALIP"
FT   gene            complement(484451..484729)
FT                   /locus_tag="Rxyl_0451"
FT   CDS_pept        complement(484451..484729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbr:BB2890 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03425"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYV3"
FT                   /protein_id="ABG03425.1"
FT                   /translation="MHGEYKTPGGKLVAADLEVAGDRLRSVRISGDFFLEPPEALESIS
FT                   GALEGASAAASEEELAALVSGALPRGTEMVGFSPQAVARAVRRALSR"
FT   gene            complement(484731..486779)
FT                   /locus_tag="Rxyl_0452"
FT   CDS_pept        complement(484731..486779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0452"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: tth:TTC1879 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03426"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYV2"
FT                   /protein_id="ABG03426.1"
FT                   /translation="MLHPEYLDTSSGPIGRAVTSEEYPATAHEFYFWTAETEAARRLDI
FT                   GHIVAAESEDATAIAVLDDPRRYSDLQSFLDDFYAHDGDAALEPLSERTEILVFRARVL
FT                   ATRHRHPGRKSRRPVRSGPVYFATREAIEFALGVEDFSGTPIPMLLHENGNERDGRPQR
FT                   TPLYADEDYLLGPEAGHLNITGMSGLSTKTSHALFTIASIFQRSRRKVAALMFNVKGAD
FT                   LLFLDKPAQVDPEEDPELAARYERAGQRGLSDEEREMYRELGLRTEPFENLRIFAPLRP
FT                   GMDPGESVVRARDLDARQLNTLRNARGEDHCVHPIVWDLGGILPYAGRIFEHSDYDDKF
FT                   RGFVETLRADGVDTMEAFFRKMGEIQDYFEEEEGRSSWRGHNRMTINKVWNRFNGLPSK
FT                   CGGLLVHGRVDYSDSPHVEDAFADREMRVVDISRLTGVPQDLVVTKVIERIWEKAELGE
FT                   LGVDKLIIFVDELNKYAPAGAASSPLRETLVDISARGRHLNLTLFGAQQFRSKVHDEVV
FT                   GNAATSLYGRIGDEELTNASYRSFSQTTREELLQLEKGRLLLRHAHYAVPVFGRFPRPP
FT                   VLMGKQGTDIFGGQRVDLATEVHSVLRRMMNRPPTLQEIRADLDGEEPGRVHEALDALR
FT                   AAFRGGRGPKNPYESLKRSLRRGSRRPAERWDPDPAILANVERLRGD"
FT   gene            complement(486788..487906)
FT                   /locus_tag="Rxyl_0453"
FT   CDS_pept        complement(486788..487906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03427"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYV1"
FT                   /protein_id="ABG03427.1"
FT                   /translation="MLPGGTAREFVDRIGRALELAEERGIRPVAGSGPVDLEAEELAPA
FT                   GEAGGAPGEARHLESPPGARDPGRPDGRSRLRYFLDGVQSTREICRIGAAPVVATTVAA
FT                   AIAERSGRRLARMRFDGPPELVRAVILPVEAGDERIAELRDLLVQTGLEPLGYEEAPGS
FT                   PWHVLSSTEHVPAPDPSDYAGLRALAFGRARTLRERLETELLRRWEEDDRVLDNDDWLA
FT                   ADGQLGRPSPRAVGLVKSVARPEFGGAEAELLLDLAPGMRTTSFIPGWQVRRAVTDQRA
FT                   SWYVRCWPPQPGAGALGSLMRVEAARGTDPRMADEITRWILAERAPLAKPDPRWPAMIY
FT                   PIHHVERTLKPAVQGSERAYLRLQRQLRQHGR"
FT   gene            complement(487940..488482)
FT                   /locus_tag="Rxyl_0454"
FT   CDS_pept        complement(487940..488482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03428"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYV0"
FT                   /protein_id="ABG03428.1"
FT                   /translation="MRASLARAVGERGVQARVVSTQRRGSMRPPTAHILVAAPAGRVED
FT                   VRGPARVARRLEVYRTPHGPVVRLALSIYPEGREPLSAATLLNVAQVSGDAALAGLTRQ
FT                   SKLHVHFYRAEGGELAYAFSKELSNAPRQREEAREILRTAREAFRQTPQERRSFRRAVA
FT                   AAAPRFELPVPLPEEQG"
FT   gene            complement(488509..489888)
FT                   /locus_tag="Rxyl_0455"
FT   CDS_pept        complement(488509..489888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0455"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20 peptidase dimerisation; KEGG:
FT                   tth:TTC0765 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03429"
FT                   /db_xref="GOA:Q1AYU9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYU9"
FT                   /protein_id="ABG03429.1"
FT                   /translation="MQSGRKASGMELRERLVGMREELLEELKEFLRMPSVSAREDGGGA
FT                   FRECAEWVLGKLEEAGARARLLETGGHPVVYAEAGEGEGALLSYGHYDVQPPEPLELWE
FT                   SDPFEPAIRGDRLYARGVADDKGDVLARIQALRIYLREHGELPFRLRFLIEGEEEVGSP
FT                   SLGPFVRENAGLLSADACLWEGSIKDEAGRPVIFCGTKGLAYVELRARGPSHDLHSMYG
FT                   GIAPNPAWRLVQALRTIKNERGEITLDGFAELAEPPSPEDLEAISRIPFDDAALRTAWG
FT                   VEELDRGLSGREALEEMLLRPTANIAGMHSGYTGPGSKTIVPSEAFVKMDFRLVAGQSP
FT                   SRVVQLLREHLRRRGMEDIEVVDLHGLEPAKTPVNAPIVRLAKETWSDLGRDDALVYPT
FT                   IGGSGPTSLIATGLGIPTIMAGNVADSESRIHSPNESVRVEDYLETVAYFVRLFERFGG
FT                   R"
FT   gene            489968..490459
FT                   /locus_tag="Rxyl_0456"
FT   CDS_pept        489968..490459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03430"
FT                   /db_xref="GOA:Q1AYU8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYU8"
FT                   /protein_id="ABG03430.1"
FT                   /translation="MAKGKKAARPAGPPHRARPDEFFGLDLERLSPRAQALTGLTVGGL
FT                   ILAGAALLLALRPEFFWLIFVFGWAVFPALGLFARGVAGLADLGSDGRAAGSGERELLE
FT                   ALRRRGEITPVEAAMETSLTVREAERLLKELAEGGHLDVRVRGGGLSYSLWEREGLEGR
FT                   "
FT   gene            490587..491282
FT                   /locus_tag="Rxyl_0457"
FT   CDS_pept        490587..491282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03431"
FT                   /db_xref="GOA:Q1AYU7"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYU7"
FT                   /protein_id="ABG03431.1"
FT                   /translation="MRDEAKSPEEWDFYQEHVYRLRKEEYRARGIRTEISSRRRERQSA
FT                   IELSREMFFLEVSEIAGRVAGGGRRARAAQEEARRYAARLDTHAFLKQLAAPHSGAVDL
FT                   YRRNYLELLRMGKPPAEAYYLSRIIGLAGEQEFRAALESIRRTGYPGGRLTYLVEKAAI
FT                   RIRDLPGGMILILLTFFVSLFAFVWATNEWGNASAGTILFVTLGLIAAGALMLISAVFI
FT                   VTFIRSINK"
FT   gene            491375..491899
FT                   /locus_tag="Rxyl_0458"
FT   CDS_pept        491375..491899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0458"
FT                   /product="Allergen V5/Tpx-1 related"
FT                   /note="PFAM: Allergen V5/Tpx-1 related; KEGG: mta:Moth_1705
FT                   allergen V5/TPX-1 related"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03432"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYU6"
FT                   /protein_id="ABG03432.1"
FT                   /translation="MGRLALVLAALLLAACMGVIALRAEPATAASGGYVARCGGGKIFL
FT                   NAKEKRSFQLHNKVRRERGLRPFCLHPALQRAARAHSKDMIRRDYFAHGNVGARLKRYG
FT                   YDWRLYGENIAGGSGSYGSPGVIFNRWMKSTSHRKNILDRRFREIGVGTYTGVYRGYRN
FT                   YTMYTADFGRR"
FT   sig_peptide     491375..491464
FT                   /locus_tag="Rxyl_0458"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.562 at
FT                   residue 30"
FT   gene            complement(491982..492788)
FT                   /locus_tag="Rxyl_0459"
FT   CDS_pept        complement(491982..492788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0459"
FT                   /product="Creatininase"
FT                   /note="PFAM: Creatininase; KEGG: blo:BL0014 creatinine
FT                   amidohydrolase; creatininase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03433"
FT                   /db_xref="GOA:Q1AYU5"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="InterPro:IPR031034"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYU5"
FT                   /protein_id="ABG03433.1"
FT                   /translation="MAQRRTRILSEMTWPEVREAIERGAGVFLPVGSTEQHGYHLPLAT
FT                   DVILPTELALAVADELDFLVAPPVAYGYRSRPLSGGGQGFVGTISLQARTLMSLVEDVL
FT                   SELIRQGFERIAVVNWHFENQNFVYEAACLALERHRGSSARILVAEHPFAELSEATMKT
FT                   LFPEGFPGWDYEHASIMETSLMLHLRPELVLFDRAVDDASKRHPWYDVLPVPEDFVPAS
FT                   GTLWKATQASEEKGRITWEEIVAQFREAVVTELAGTGSPEAVRHER"
FT   gene            complement(492878..494386)
FT                   /locus_tag="Rxyl_0460"
FT   CDS_pept        complement(492878..494386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0460"
FT                   /product="permease for cytosine/purines, uracil, thiamine,
FT                   allantoin"
FT                   /note="PFAM: permease for cytosine/purines, uracil,
FT                   thiamine, allantoin; KEGG: bja:bll3347 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03434"
FT                   /db_xref="GOA:Q1AYU4"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYU4"
FT                   /protein_id="ABG03434.1"
FT                   /translation="MSGHHEVEEVLEHEREELEEAIHIEKHNSIEPVPEEYKDAKPLHQ
FT                   FWIWAGANIAPINWVLGALGIVLGLGLWETVLTLAVGNLLGMLLFGSFVLMGQRTGVTQ
FT                   MVLSRSAFGRRGAYLPAIFQIIIPTGWIAINTWIILDLTATLLELLGIPGTALTKVIVV
FT                   LVIMATQVGLATLGFYAIRSFEKWTVPPTLLILVAMSVVAWTGGDVNWSFAGEAEGAER
FT                   WTAMSQVMTAIGIGWGIGWLPYASDYSRFVPRATSRKRLFWASALGQFVPVLWLGLLGA
FT                   SIATTGTGVDPGLVIVQIFGALAIPVLFLVVHGPIATNILNVYSMSVAALAVDIKIPRH
FT                   VLSVIVGFFATLFTIYLVFAGDLAKNLDAWLASVVAWVSPWAAIMFIHYYIIRRENIDV
FT                   AALYQRPGESRVGDINWGAIACLVIGLAVTWSFLYGLVPVLQGPFARALNGLDLSWAVG
FT                   LTVTGALYYGLYRLGLVNPGGSRSGEEARQATPAEEPAQRGTGV"
FT   gene            complement(494510..495769)
FT                   /locus_tag="Rxyl_0461"
FT   CDS_pept        complement(494510..495769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0461"
FT                   /product="creatinase"
FT                   /note="PFAM: creatinase peptidase M24; KEGG: ppu:PP3667
FT                   creatinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03435"
FT                   /db_xref="GOA:Q1AYU3"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="InterPro:IPR039394"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYU3"
FT                   /protein_id="ABG03435.1"
FT                   /translation="MQQVSDLPRTKIIRNGEKVRPTFSREEMERRNAALRRHMAENDID
FT                   AVLFTSYQNIDYYSDFLYTWFGRSYGLVVTQERHVTVSANIDAGMPWRRSFDDNIVYTD
FT                   WQRDNFYYAVREVLKDAGFSKGRLGIEYDHVNLDMKRKLQDALPGAELVDISQATMAQR
FT                   MIKSEEEIELIKNGARIADIGGAAVVEAIDEGVPEYEVALHGTQAMVREIARTYPHAEL
FT                   RDTWVWFQSGINTDGAHNWPTSRRIQRGDILSLNTFPMIAGYYTALERTLFFEEASDEH
FT                   LRLWEINCEVHRRGIELIRPGVRCMDIAAELNEIYREHGLLANRTFGYGHSFGVLCHYY
FT                   GREGRLELREDIETVLEPGMVISMEPMIMVPEGQPGAGGYREHDILVVREDGAENITKF
FT                   PFGPEHNIIKKNGGGAWQPA"
FT   gene            complement(495838..496974)
FT                   /locus_tag="Rxyl_0462"
FT   CDS_pept        complement(495838..496974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0462"
FT                   /product="glycine oxidase"
FT                   /EC_number="1.4.3.19"
FT                   /note="TIGRFAM: Glycine oxidase ThiO; PFAM: FAD dependent
FT                   oxidoreductase; KEGG: gka:GK0623 glycine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03436"
FT                   /db_xref="GOA:Q1AYU2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYU2"
FT                   /protein_id="ABG03436.1"
FT                   /translation="MSSGGPAEVAVVGGGAIGCSVAYHAARRGARVILLEAEQLGSGSS
FT                   GALAGMLSGQGELEPPGPLLRLMLLGRERHREISEELQDLTGIDPGYVWEGALRTAVDE
FT                   ASSELLAEAHALQREEGLRAEWLTGDEARELEPALSREVVAGLYLPDDGQVNPPQLVQA
FT                   LARGAALHGAEIREATRVTGFIVRGGRVEGVGTSRGEVPAGTVVLAGGAFSDLLSGQLG
FT                   VSLPLFPVKGQMLITNMWPSPIRANVWDAANFYVVPKRDGRVIVGATEEPGVYDRRVTL
FT                   GGVAELSRAATSLVPALSEALFAGSWGGLRPATSTGRPVLGPVEGWEGLLLATGHFRNG
FT                   VLLSVITGEIISALALGEEPPTDISPFLYGSLLTGRLE"
FT   gene            complement(496971..497954)
FT                   /locus_tag="Rxyl_0463"
FT   CDS_pept        complement(496971..497954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0463"
FT                   /product="Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit; KEGG: noc:Noc_2604
FT                   pyridoxal-5'-phosphate-dependent enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03437"
FT                   /db_xref="GOA:Q1AYU1"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYU1"
FT                   /protein_id="ABG03437.1"
FT                   /translation="MQTRKLVKEVRMAAPGLSESVLEAIGDTPLIEVEEGIYAKLEYLN
FT                   PSGSIKARIARYIVEKAEREGLLLPGHTIVEATSGNTGNAFSMVAAIKGYRMVVLMPEG
FT                   LSTERVAISRAFGAHIEHVGEFYVTEALKRARELGKKEGYFCPAQFDSEWNVEENREWL
FT                   GKEILGQLEEGGVGAPDALVMGVGTGGTLIGVGQAFREKNAEAKLIAVEPEESCTLLCG
FT                   ESGVHKIEGISDGFVPGIYERHAERLGVDEVYAVGSEEALGAMRWLARRRGLFVGPSSG
FT                   ANLVAARRLKEAHPELKSIVTLFCDEGEKYISEHFPATREVEAEAR"
FT   gene            complement(497983..499293)
FT                   /locus_tag="Rxyl_0464"
FT   CDS_pept        complement(497983..499293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0464"
FT                   /product="General substrate transporter"
FT                   /note="PFAM: General substrate transporter major
FT                   facilitator superfamily MFS_1; KEGG: ppu:PP3666 metabolite
FT                   MFS transporter, MHS family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03438"
FT                   /db_xref="GOA:Q1AYU0"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYU0"
FT                   /protein_id="ABG03438.1"
FT                   /translation="MAVEARVGLSLEERRSTVRRAVFGAAVGNMIEWFDYASYGYLAAV
FT                   IAAVFFAPGDETAALLATFAVFAVSFVVRPIGGLVWGHYGDRIGRQRVLALTIIIMSAA
FT                   TFAIGLIPSYASIGLAAPLLLLLCRLVQGFSASGEYAGASSFIAEYAPDERRGLLVSMV
FT                   PASTAAGLVLGASIAALLEHGLSEAALHSWGWRVPFLLGGPLGIAGLYIRLKLEDTPLF
FT                   RALEREQHVARAPVLTGIRENWRQILVALGVICLNAVGFYMILSYMPTYLSRELGFDPV
FT                   TAILTTIVSVAAYVLLLPLVGVLADRFGRRPVLFAACALFLLLTLPLFQLLSLGGVAFA
FT                   VLAQTLLGAILAGNDGVLATFLSEMFPTAVRYSSFALSFNLGNAVFGGTAPFVATYLIS
FT                   LTGTDFAPGFYLMAAAVVAFLALLFTAETAGRPLRQE"
FT   gene            complement(499478..500284)
FT                   /locus_tag="Rxyl_0465"
FT   CDS_pept        complement(499478..500284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0465"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: mlo:mlr8761
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03439"
FT                   /db_xref="GOA:Q1AYT9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYT9"
FT                   /protein_id="ABG03439.1"
FT                   /translation="METARTDDRNRNRPGTRSGTSALRHGIRVLQTFTREEPILGVSEI
FT                   ARRVGLHKSTVSRILATLEEAMLVERHPTSGRFRLGVGVIALAGPMLANLDVRRVARPF
FT                   LEELTRATGETTGLLVWSEGAAISVEQVASPKTVKHTIPIGTQFREHASASVKVFLAES
FT                   PPEEVQKVLDRGLKRYSERTVVDPEEYLKGLQRVRELGYAVNAGETSLEETGIAAPVRD
FT                   HRDQTVAAVLLSAPYYRTPPERIEELGELVRKTAEAISKRLGGASA"
FT   gene            complement(500453..501808)
FT                   /locus_tag="Rxyl_0466"
FT   CDS_pept        complement(500453..501808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0466"
FT                   /product="Peptidase M20D, amidohydrolase"
FT                   /note="TIGRFAM: Peptidase M20D, amidohydrolase; PFAM:
FT                   peptidase dimerisation; KEGG: eli:ELI_13895 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03440"
FT                   /db_xref="GOA:Q1AYT8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017145"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYT8"
FT                   /protein_id="ABG03440.1"
FT                   /translation="MAHSTLLEAVDRRVREAGPLVARIAREVWELAEVSHEEAESARLL
FT                   MDVLEESGFAVTSRGTAGVPTAFVAEWGSGEPVLGFLPEYDALPGLGNEAVPRREPRKD
FT                   GKTSGHGCGHNLLGAGLVGTAVALKGVMEERGLPGTLRVYGCAAEETEGAKVYMAREGL
FT                   FSDLAAALHWHPMAYAGVFNLRLAAMNQLAVEFFGRTAHAGMEPWKGRSALHAAELFAH
FT                   GINLMREHLEPTARVHYAFQRAGESPNVVPDYARVWLFVRDADRGRVEETTRWVERIAE
FT                   GAALATRTASKVELRFGMYDLLPNGPLAERMQVHLERVGVPEWTEEEQRFARECQENFG
FT                   VEARGMAAEVLPLSDEVTLGASSDVGDVSWNAPTMGCTMPAWPQGISAHTWPVVACGGT
FT                   SIGPKAALHAARVLAGIGAEILTDEELRAAARADFERRTRGRPYVSPLPFGE"
FT   gene            complement(501827..503131)
FT                   /locus_tag="Rxyl_0467"
FT   CDS_pept        complement(501827..503131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0467"
FT                   /product="General substrate transporter"
FT                   /note="PFAM: General substrate transporter major
FT                   facilitator superfamily MFS_1; KEGG: bpm:BURPS1710b_1596
FT                   putative proline/betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03441"
FT                   /db_xref="GOA:Q1AYT7"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYT7"
FT                   /protein_id="ABG03441.1"
FT                   /translation="MTATTAGGEAYPGRVRKKAVVAAVIGNFVEWYDFTIYGYLAVVIA
FT                   PLFFPAENRLVSLMATFAVFGVAFLMRPVGALFFGNIGDKIGRRSTLSAVILIASGATF
FT                   LIGLLPSYETIGILAPLLLVLARLVQGFAVGGEFGGATAFMVEYAPDERRGLYGSWQFF
FT                   TQATSLVAGLLIAAGLTAAVSEEALYSWAWRVPFLITLPLGLIGLYMRLRLEDTPAFRA
FT                   VQEHHEIERAPLLESLRTHGKDLLKVVGLTWPLTGLVYLLIFAPTYLSEQLDVPLSLGY
FT                   TAVILGTSSWAVVVLLSALLSDRVGRRKPFLLASPVLAAVTAVPVFMMLQSGSFPVITL
FT                   ALVIVGSVVGISSGVYAAAMCEVFPTNVRYSSLSLGYSVAVSIFGGTTPFIFTALLAAT
FT                   GNPLSPAFYLVVAGLAGLVAALAFPETAREPLKET"
FT   gene            complement(503202..504518)
FT                   /locus_tag="Rxyl_0468"
FT   CDS_pept        complement(503202..504518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0468"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: bur:Bcep18194_C7676 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03442"
FT                   /db_xref="GOA:Q1AYT6"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYT6"
FT                   /protein_id="ABG03442.1"
FT                   /translation="MKLRGQTPAFRTSSGAGRRWSSRAASGRAGSPRGRRWSLNSDQAG
FT                   HATTNGVVAFKDNVANADDPHVRKLREAGAVFVGRSNTPAFSYRWFTDNDLHGRTLNPW
FT                   DAGRTPGGSSGGAASAVASGMVPVAHGNDIGGSIRYPAYACGVAGIRPTVGRVPGWYGP
FT                   VDADEALSVQSMLVQGPLARTVEDLRLALDAMSGFDARDPFAVPVLPASANEPLPRPVR
FT                   VGLLRDVGVAAPQPAVNEALDLAAGWLGEAGYVVEEVELPLLAEAYRLWYLLCMEEFRL
FT                   VMPLVEEMGDEGMKRAAATYYAAAKEWWGESPGLEDYMNGYARRGTLIGRLQAFMQEYP
FT                   LVLLPVSAEQAFEYDADIASLQRGLQVVAAQWSMMAIPLLGFPAISVPTGVADGLPVGV
FT                   QLMGRRFREDAIFDAAEVIEARAGVFAPVDAQSELGASR"
FT   gene            complement(504667..506091)
FT                   /locus_tag="Rxyl_0469"
FT   CDS_pept        complement(504667..506091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0469"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: glycine hydroxymethyltransferase aromatic
FT                   amino acid beta-eliminating lyase/threonine aldolase
FT                   aminotransferase class-III; KEGG: tfu:Tfu_2353 glycine
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03443"
FT                   /db_xref="GOA:Q1AYT5"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYT5"
FT                   /protein_id="ABG03443.1"
FT                   /translation="MRNDHRVSPALGDRGGAAANRRASAGGASFGLPGGYMTAPLAEVD
FT                   PEIQEVLERELERQRNTLEMIASENFVPQAVLEAVGSVLTNKYAEGYPGRRYYGGCHEV
FT                   DVAEQLAIDRAKELFGAEHVNVQPHSGAQANNAAYMALLEPGDTFLGLALDHGGHLSHG
FT                   MKLNVSGRLYNPVPYHVRREDSLVDMEEVERLANEHRPKLIVAGWSAYPRQLDFAAFRE
FT                   IADSVGAKLMVDMAHFAGLVAAGIHPNPVEYADVVTTTVHKTLAGPRSGMILCREEHAK
FT                   KIDSAVFPGQQGGPLMHVIAAKAVALRIAHTEGFRARQRQTVANAKALAEALMQNGIEV
FT                   VSGGTDVHLVLVDLTSTGLDGKTAEDRLEKVGITVNRNTIPFDPRPPMNPSGLRIGTPA
FT                   LTTRGLLEEDMREIAGIIAGALSDNFEAEHKALLERSRALMQKYPLYPDSQRPTPADGE
FT                   GKEAPAPPPPTRPSWL"
FT   gene            506265..507587
FT                   /locus_tag="Rxyl_0470"
FT   CDS_pept        506265..507587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0470"
FT                   /product="aminomethyltransferase"
FT                   /EC_number="2.1.2.10"
FT                   /note="KEGG: mlo:mlr4790 aminomethyltransferase; TIGRFAM:
FT                   glycine cleavage system T protein; PFAM: glycine cleavage T
FT                   protein (aminomethyl transferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03444"
FT                   /db_xref="GOA:Q1AYT4"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYT4"
FT                   /protein_id="ABG03444.1"
FT                   /translation="MGERRTPLYDFHLRAGRGMVRGGGGYLFPSSYTSPVEEHLNVRRN
FT                   VGLQDLSSMGQIDVKGPGAERLLRRLLVNEVLDMQPGQLRYSTMCNEAGGVVDDVTVYK
FT                   FSDEHFMVVASSAPRLKSYRWIREHAEGSSAYVTDMTAGIALLAVQGPLSRPLLEGVVE
FT                   GAELERMRFFRFAACRVGEVEVIVSRSGYTGELGYEVYVPADQAREVWDFLLERGKEFE
FT                   LKPYGVEAMQSLRIEKALPLYGPDISEEHTPFHVGLERWIRFEKPDFIGREALLGVQRR
FT                   GIERRWVGLVLESEVPASNGDAIYSIADVASYREVIETGAEAGHYEEALLPGERKVGEV
FT                   TSSAWGPSVGKMLALGYVHTAHAWPGSNLIVDIGGGRPVPARVERTPFFDPENARVRSA
FT                   PLEDGRRLGQKGGAALHEAETQKNIPLRHTTTVADGGGQRP"
FT   gene            507584..508915
FT                   /locus_tag="Rxyl_0471"
FT   CDS_pept        507584..508915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0471"
FT                   /product="Sarcosine oxidase"
FT                   /EC_number="1.5.3.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   sma:SAV6950 putative sarcosine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03445"
FT                   /db_xref="GOA:Q1AYT3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYT3"
FT                   /protein_id="ABG03445.1"
FT                   /translation="MTTTMRGAGGYYYYGGRYDAIVVGVGAMGSAALYHLARRGKRVLG
FT                   LERFGIPHAMGSSHGHTRIIRLAYYEHPSYVVLLRRAYELWRELEREAGEQLLHITGSI
FT                   DAGPEDSWVFRGSWESARMHELPHEVLTGSELHRRYPAYRLPKDHLALLQPEGGFLKPE
FT                   RCIVAHVMAAQARGAEVHAHEKVLEWGPSEGGGGVRVRTERGTYEAEKLILSAGAWMGE
FT                   LAPEALGGVAVAERQVLAWLQPQKPELFRPQNFPVFNLLVEEGRFYGFPVFGVPGFKFG
FT                   KYHHLLEELGEPDRLDRQVHWRDEQMLREFAERYFPEGCGPTMDLQVCMFTNTQDNHFI
FT                   IDLYPGLEQVVIASPCSGHGFKFASVVGEILADLADSGASRHDISLFRVGRFAPQRGFL
FT                   SARASSRPPAGTAARLERRTVEAVAGKNGRLHRFPEAGEISAPW"
FT   gene            complement(508958..509227)
FT                   /locus_tag="Rxyl_0472"
FT   CDS_pept        complement(508958..509227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03446"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYT2"
FT                   /protein_id="ABG03446.1"
FT                   /translation="MCTPGSKATTVATPVASDLDLFADEVLVDPYPAYARLRELGGAVY
FT                   LPKNDAHNALLPPDAFHLPVGRPVTQKIYRDAAHPSRLALPFTT"
FT   gene            complement(509280..511361)
FT                   /locus_tag="Rxyl_0473"
FT   CDS_pept        complement(509280..511361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0473"
FT                   /product="Phenol hydroxylase-like dimerisation"
FT                   /note="PFAM: monooxygenase, FAD-binding Phenol
FT                   hydroxylase-like dimerisation; KEGG: bja:blr4222 phenol
FT                   2-monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03447"
FT                   /db_xref="GOA:Q1AYT1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR012941"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038220"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYT1"
FT                   /protein_id="ABG03447.1"
FT                   /translation="MQQFHLNGFKVGDPFVHEAVGEPVDPEVLPEAVDVLIVGCGPAGL
FT                   TLATQLAAFPEIRVRIVERKGGPLELGQADGIACRTMEMFEAFGFSERVLKEACWINET
FT                   VFWEPDAADRRGIVRSGRIQDTEDGLSEFPHVVLNQARVHEFYLDAMRKSPTRLVPNYS
FT                   RRLVGLEVGEGRSGAGDRDHPVKVTLERTDPEHAGETETVRARYVVGCDGAHSTVRKLL
FT                   GLSMKGDSANQLWGVMDVLAVTDFPDVRMKAVIHSSGGGNLLIIPREGGYLVRLYIELG
FT                   RPGERFSREDVTAGQLVEAARRILHPYTLEVKEIAWWSVYEIGQRLCDRFDDVPEEEAG
FT                   ERFPRVFIAGDACHTHSPKAGQVMNVSMADAFNLGWKLASVLLGRSKPELLYTYSAERR
FT                   AVAQELIDFDREFARMISAPPKATGDDDEGIDPKEFQEYFVKQGRFTAGVATRYGPSLI
FT                   TAEPVHQDLARGFVVGTRFHSAPVIRLSDAKPVQLGHAVKADGRWRVFAFADREDPADP
FT                   SSAIQRLCRFLAGSPESPVLRHTPKGADIDSVIDVRAVFQQGHRELALEKMPPFLLPRK
FT                   GRYGLVDYEKMFCPDLKGGEDIFELRGIDRERGCLVVVRPDQYVAQVLPLDAHEGLAAF
FT                   FARFMLGAGRHGRPSNEERSAMVGRVGSESGAGFAGAGRFGGFGAMPASSRRPPGARG"
FT   gene            511602..512483
FT                   /locus_tag="Rxyl_0474"
FT   CDS_pept        511602..512483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0474"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR LysR,
FT                   substrate-binding; KEGG: ava:Ava_0824 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03448"
FT                   /db_xref="GOA:Q1AYT0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYT0"
FT                   /protein_id="ABG03448.1"
FT                   /translation="MELSHIRYFVAAAEELHFGRAARRLHVTQPSLSKRVAGLERELGV
FT                   RLFHRTRREVRLTEAGEIFLEGARRVLEDALRAAEEARKAGRGELGRLEIGFFSPAIYG
FT                   VLPEILKEYHERFPEVRVTLHEWTSSVQLERMREGKIEIGFMRAPVEEAGFVTEHVFVE
FT                   PVVAALPEGHPQARREVVSPRELADEPFIMVPRSKEPNSFDRYVSICQRAGFSPKITQE
FT                   VFEIHAIVGLVATGMGVAFVQGSVANLKRPGVVYRPLDDPEARIGTAIVRRSSRPSPVL
FT                   RTFLETLQAFVA"
FT   gene            complement(512480..513082)
FT                   /locus_tag="Rxyl_0475"
FT   CDS_pept        complement(512480..513082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03449"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYS9"
FT                   /protein_id="ABG03449.1"
FT                   /translation="MTKLASMLGIGALFAAAVIGALAAAGFFGNPTFAGLRPDRPPQPA
FT                   EPPPGAARVPGEAVAAGHPVRVGDLEWTVTGARRSPELTSYTFPPETRLGSFVSASFEV
FT                   RNASKRPVTLTEELVRLVDGQGREYAPSPEFNSQFVPPERNLLFNEHGLVPPGASREGR
FT                   VNFEVASGASRFWLEISGPGAEERYVRLPLSQSAGAG"
FT   sig_peptide     complement(513011..513082)
FT                   /locus_tag="Rxyl_0475"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.414 at
FT                   residue 24"
FT   gene            513233..513475
FT                   /locus_tag="Rxyl_0476"
FT   CDS_pept        513233..513475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0959 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03450"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYS8"
FT                   /protein_id="ABG03450.1"
FT                   /translation="MRPVARCEVCGNDYDLAFEVITAGERHVFDCFECAIHALAPVCEH
FT                   CGCRVIGHGVQAGDALFCCAHCAGAEGREGVRDRV"
FT   gene            513493..514392
FT                   /locus_tag="Rxyl_0477"
FT   CDS_pept        513493..514392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0477"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   sco:SCO6189 transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03451"
FT                   /db_xref="GOA:Q1AYS7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYS7"
FT                   /protein_id="ABG03451.1"
FT                   /translation="MGPVRAGASPPGGASGGRVSVVVATRDRRDELLRTVYHLLALPER
FT                   PRVVVVDNASSDGTPQALARLHPEVEVVALGENLAAAGRTAGVRRCPTPYVAFADDDSW
FT                   WEPGSLRRAADLLDAHPRLGLVAGRVLLGPEGREDPVCGLMAASPLPAEPDLPGPGVLG
FT                   FVACAAVVRREAYLGSGGFERRLFWGEEELLAADMAAAGWALVYDAGVVARHHPSPARD
FT                   ARANRRRAVRSALLTGWLRRPARVALGRSLRALRSSLRDPDARAGLAAALAGLPWALRG
FT                   RRPLPPRVEEGLRMLESG"
FT   gene            514403..515431
FT                   /locus_tag="Rxyl_0478"
FT   CDS_pept        514403..515431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0478"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   mka:MK1055 predicted deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03452"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYS6"
FT                   /protein_id="ABG03452.1"
FT                   /translation="MLVYTHPACRKHLNPSSGVEVPERYPAALAGAEAAARDGAPVEVR
FT                   RSEPAPEAALLAVHERGYLKLLRELSSSGGGVLDPDTALGPGSWEAALLAAGAAAGAAE
FT                   AALSGAASFALVRPPGHHAGRGRAMGFCLINNAAVAAAHARALGARRVAVLDWDVHHGN
FT                   GTQEIFYAAGDVLYLSVHRGGLFYPGTGHPEEVGAGPGKGFTVNVPLPAGSGEGGYAAA
FT                   FGGVLLPVLEEFAPELVVVSAGYDAHASDPLGGMRLEAGSFGRFAAAVASLARRASGTP
FT                   PAFVLEGGYEAGALTACVAATIRGAGEGETGGEPWPAEGRGDLLGPPRRALAPYWESLR
FT                   GG"
FT   gene            515506..515922
FT                   /locus_tag="Rxyl_0479"
FT   CDS_pept        515506..515922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0479"
FT                   /product="protein of unknown function DUF101"
FT                   /note="PFAM: protein of unknown function DUF101; KEGG:
FT                   ttj:TTHA1745 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03453"
FT                   /db_xref="InterPro:IPR002804"
FT                   /db_xref="InterPro:IPR023572"
FT                   /db_xref="InterPro:IPR036820"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYS5"
FT                   /protein_id="ABG03453.1"
FT                   /translation="MIRMLDHTADVGFEVEAPSVEGLFAEALGGLLQVMFEAPPREGGA
FT                   EERRVELSAPDLETLLVRWLNELTFLVQGEGFVPVSAEVRVGEGPSLRARLRGVPLDVE
FT                   RYGWQGEIKGATFHGLEVARRREGALHARVILDV"
FT   gene            515915..517369
FT                   /locus_tag="Rxyl_0480"
FT   CDS_pept        515915..517369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0480"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   tth:TTC1426 RtcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03454"
FT                   /db_xref="GOA:Q1AYS4"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYS4"
FT                   /protein_id="ABG03454.1"
FT                   /translation="MSEKAGVADTVGFERLSEYRYRIPRQGKMRCDAVFYASRRILEDL
FT                   AAEDYASLRQLMGVATLPGIVEPALSMPDIHWGYGFPIGGVAAFDPEEGGVVSPGGVGF
FT                   DINCGVRLLVSDISREELADRKARLADELFRSVPSGVGRGRKDFRIGRPDLRRLLVEGP
FT                   SWLVERGYGEPGDLDGIESRGRLAGADPDAVSERAYQRGQPQLGTLGSGNHFLEVQYVD
FT                   EVYDEEAARAYGLHPGQVTVLIHSGSRGLGHQVCTEYVERFLQVAPKYGIELVDRQLAA
FT                   APIDSPEGRAYLGAMSAAANFAFANRQLIAHFTREAFARAGFGGRPLRVLYDLAHNNAK
FT                   LEEHGARRVLVHRKGATRAFGPGNPELPERYRGVGQPVLVPGDMGRYSFVLAGTEGSMR
FT                   ETFGSSAHGAGRKMSRRRAKKAARGRDLIREMEQVGILVRAAGRATVDEEMSEAYKDAA
FT                   EVVEVTDGAGIGKKVARLRPQIVVKG"
FT   gene            517372..518043
FT                   /locus_tag="Rxyl_0481"
FT   CDS_pept        517372..518043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0481"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: ava:Ava_4124
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03455"
FT                   /db_xref="GOA:Q1AYS3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYS3"
FT                   /protein_id="ABG03455.1"
FT                   /translation="MFDGPIFRDRREAGRVLASRLERYRDERPVIFALPRGGVPVGYEI
FT                   SRALGAPLEVIVARKLGAPGQPEFGIGAIAPGVRVLNEEAVRRLGIPEDYIERVTERET
FT                   REMERRLRRFRGDRPEPEVRDRTVILVDDGLATGVTARAAIRALRRREPRRLVLAVPVC
FT                   AAQTAQVIRPLVDDFVCPATPPDLGAIGFWYENFEQVSSEEVAELLEEARRLFSGERDG
FT                   G"
FT   gene            518040..518702
FT                   /locus_tag="Rxyl_0482"
FT   CDS_pept        518040..518702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0482"
FT                   /product="dienelactone hydrolase"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: eba:ebA2870
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03456"
FT                   /db_xref="GOA:Q1AYS2"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYS2"
FT                   /protein_id="ABG03456.1"
FT                   /translation="MSVGETVRIEAGGARIEGDLEIPEGARGIVLFAHGSGSGRHSPRN
FT                   RFVAARLREESLLLGTLLIDLLTEQEEAEDARTGLLRFDVGLLAGRVEAATRWLLDNPR
FT                   TRGLRVGYFGASTGAAAALVAAARLPEAVGAVVSRGGRPDLAGEHLGRVRAPVLLIVGG
FT                   RDHTVLELNREAMRRLPPQTRLEVVPGATHLFEEPGALEEVARLAARWFARHLAGGR"
FT   gene            518708..519691
FT                   /locus_tag="Rxyl_0483"
FT   CDS_pept        518708..519691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0483"
FT                   /product="poly-gamma-glutamate synthesis protein (capsule
FT                   biosynthesis protein)"
FT                   /note="KEGG: dps:DP2296 poly-gamma-glutamate synthesis
FT                   protein (capsule biosynthesis protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03457"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYS1"
FT                   /protein_id="ABG03457.1"
FT                   /translation="MVVLNLAGDVMLGRGVNEALAEMPPEEVWGDVLPLLLEGGVRIVN
FT                   LECAITDHRRPWTRTPKVFHFRADPRAVRVLTAARIDAVSLANNHTLDFEERGLLDTIA
FT                   HLRSAGIACAGAGRDLAEASRPAVVEGGGERVALVAFTDNEPPFAAGPDRPGTNYLPVS
FT                   LEGEVLERVEEAVARARAEGAGTVVFSNHWGPNMVERPPECFRRFARAVIDRGADVYYG
FT                   HSAHVFQGVEVYRGRPILYDTGDFVDDYAVDPRLRNDRSFLFRVEVGEEGLRGLELFPV
FT                   RLPYARVRRAAGEEAEAIMERMERLSAEMGTRFERAGDRLLLRGPG"
FT   gene            complement(519688..520680)
FT                   /locus_tag="Rxyl_0484"
FT   CDS_pept        complement(519688..520680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0484"
FT                   /product="luciferase-like protein"
FT                   /note="PFAM: luciferase-like; KEGG: mpa:MAP3120c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03458"
FT                   /db_xref="GOA:Q1AYS0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYS0"
FT                   /protein_id="ABG03458.1"
FT                   /translation="MPVAGESFRRRAEMAKIGYFLSCEEWGPRELLEQAEMAEAAGFEG
FT                   LWISDHYHPWNSEQGNSPFVWSVIGGLSRATSLPVTTAVTCPTIRIHPAIIAQAAATSA
FT                   VMLEGRFVLGVGSGENLNEHVLGDRWPPADVRLKMLEEAVRVMRLLWEGGVKDFHGDYY
FT                   TVENARLYTLPEEPPPVYVSGFGPKSVRLAGRIGDGYCSTIPDGELVSLFRSSGGGDKP
FT                   AQAGMKVCWSEEESRARKTAHRIWPNEQLPGELAQELPTPRHFEQASELVTEEMVAAEV
FT                   PCGPDPELHLRSIRRYIEAGYDEIYVQQIGPEQEGFFRFYETEILPELP"
FT   gene            complement(520718..521440)
FT                   /locus_tag="Rxyl_0485"
FT   CDS_pept        complement(520718..521440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0485"
FT                   /product="beta-lactamase-like protein"
FT                   /note="PFAM: beta-lactamase-like; KEGG: pca:Pcar_2717
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03459"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYR9"
FT                   /protein_id="ABG03459.1"
FT                   /translation="MRLLFAGTRGEIEARTPRHAMHSALVVFCGGGRVMVDCGADWLGR
FT                   FGGLDPAAVVVTHAHPDHAWGLREGAPCPVYATRESWALMERYPVRERRVVEPRRPFRA
FT                   EGLVFEAFPVEHSTRAPAVGYRISAGRTAVFYAPDVVYIHGRGEALRGVELYAGDGASV
FT                   ARPLVRRRGEALIGHAPIRTQLTWCAKEGVRRAVFTHCGTEIVAGDEERLEREVRRLGA
FT                   ERGVEAALAYDGMEVGVP"
FT   gene            complement(521437..523161)
FT                   /locus_tag="Rxyl_0486"
FT   CDS_pept        complement(521437..523161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0486"
FT                   /product="PHP-like protein"
FT                   /note="PFAM: PHP-like; SMART: DNA polymerase X
FT                   Phosphoesterase PHP-like Helix-hairpin-helix DNA-binding,
FT                   class 1; KEGG: cbu:CBU_0490 hypothetical DNA polymerase /
FT                   putative histidinol phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03460"
FT                   /db_xref="GOA:Q1AYR8"
FT                   /db_xref="InterPro:IPR002008"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR022311"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYR8"
FT                   /protein_id="ABG03460.1"
FT                   /translation="MPVHNAEIAEILYEVADLLEIEGENPFRVRAYREAARTVENHPRS
FT                   LAEMAGEGEDLTRLPGIGEDLADKIREIARTGTLRQAEELRERVPPGLRGLLGVPGLGP
FT                   RRVRELHRRLGVESAAELERAAREGRVRRLPGFGAKTERNILEALGRKERPQRFRLSAA
FT                   EPAARALEEHLEGCGAVREAVVAGSFRRRKETVGDLDVVACSQEGRRVIEHFVAFEDIE
FT                   RVVSKGSTRSSVVLKNGLEADLRVVPEESFGTALLYFTGAQPHHVALRDMALKRRLKLN
FT                   EYGLFRGEERVAGRTEEEVYAQLGLRYIEPELREHRGEIEAARQGSLPQLLAQEDLRGD
FT                   LHSHTTATDGRSGLHEMAEAARERGYEYLAVTDHSRRLRVARGLDERRLREQMEEIDRL
FT                   NEELEGITLLKGAEVDILEDGSLDLPDGVLEELDVVVCSVHHKLRLPEREQTRRVLRAL
FT                   ENPNVNILAHPTGRLIGRREPYELDVERVMEAARERGCVLELNSNPERLDLNDAHCKLA
FT                   KEMGVKIAVSTDAHSADELANIRFGVGQARRGWLEREDVVNTRPLGELRRLLRREGA"
FT   gene            complement(523163..523891)
FT                   /locus_tag="Rxyl_0487"
FT   CDS_pept        complement(523163..523891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0487"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   sru:SRU_0463 protein of unknown function superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03461"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYR7"
FT                   /protein_id="ABG03461.1"
FT                   /translation="MGGRVHIGTSGWHYDHWRGTFYPPGLPADRLLEHYATRFETAEIN
FT                   NSFYRLPEAKTLAGWRRRTPRGFVFAAKASRYLTHMKKLREPEEPLRRLFGRLEALGEK
FT                   LGPVLFQLPPRWRANPGRLEALLKALPPGRRCAFEFRDESWFCEEVYRLLQEHGAALCV
FT                   YDLGERSSPRRLTAGFAYARLHGPEGPYRGCYGERQLASWAGLLGGWAEEGTEVYCYFD
FT                   NDEAGYAPRNAARLRQMMEV"
FT   gene            complement(523971..524438)
FT                   /locus_tag="Rxyl_0488"
FT   CDS_pept        complement(523971..524438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0488"
FT                   /product="kinase-like protein"
FT                   /note="KEGG: sco:SCP1.90c putative atp/gtp-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03462"
FT                   /db_xref="GOA:Q1AYR6"
FT                   /db_xref="InterPro:IPR017101"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYR6"
FT                   /protein_id="ABG03462.1"
FT                   /translation="MLPVGGRQGTGPRLALMCGLPKSGKTTYARGLQERGWVRVCPDEI
FT                   RRALHGRGHYPPAEPVVWANAELSVRALLLGGHRVVLDATNTTRHRRAPWLRLARELGV
FT                   PALAYVLRTPREECLRRNEASEEPVPPEVIDRMARQWEEVTEDGLEVHLVE"
FT   gene            524527..525195
FT                   /locus_tag="Rxyl_0489"
FT   CDS_pept        524527..525195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0489"
FT                   /product="protein of unknown function DUF159"
FT                   /note="PFAM: protein of unknown function DUF159; KEGG:
FT                   ava:Ava_3892 protein of unknown function DUF159"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03463"
FT                   /db_xref="GOA:Q1AYR5"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYR5"
FT                   /protein_id="ABG03463.1"
FT                   /translation="MCGRYTLATPAERLAEEFGVSGPLPEIPPSYNVAPGRGVAAVVAD
FT                   DGRRRLEVLRWGLVPAWAEDPSIGNRMINARAESAAEKPSFRRAFRERRCLIPADGFYE
FT                   WRRLLEGGKQPYYVRRRDGAPFAFAGLWELWRGEGGEKIRSCTILTTRPNRLLREIHDR
FT                   MPVIVPPDLYGLWLEGGAEREELEAVLRPYPEEELEAYPVSRLVNSPANDGPRCIEPAA
FT                   "
FT   gene            525195..526103
FT                   /locus_tag="Rxyl_0490"
FT   CDS_pept        525195..526103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0490"
FT                   /product="Indigoidine synthase A like protein"
FT                   /note="PFAM: Indigoidine synthase A like protein; KEGG:
FT                   tte:TTE0327 uncharacterized enzyme involved in pigment
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03464"
FT                   /db_xref="GOA:Q1AYR4"
FT                   /db_xref="InterPro:IPR007342"
FT                   /db_xref="InterPro:IPR022830"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1AYR4"
FT                   /protein_id="ABG03464.1"
FT                   /translation="MRPVQPAPEVAEALEGGRPVVALESTLISHGLPRPDNLRVARALE
FT                   EAVRREGAVPATVGVVGGVARVGLGPEELELLASGEVPKLSARDLPAAAATGSSGATTV
FT                   AATAHLAALCGIKLFATGGLGGVHRGARESWDVSADLAALSRAPVAVVCSGVKSILDVP
FT                   ATLEQLETLGVPVVGFRSRSFAGFYLTDSGCALDWSVEDEGEAAALIRALPGLGLGCGV
FT                   VISNPLPPEEQLDPSLHERALRSGLEELARRGISGKEVTPFLLEHFRERTGGESLRANE
FT                   RLVVRNARLAARIARRLAAGR"
FT   gene            526100..527011
FT                   /locus_tag="Rxyl_0491"
FT   CDS_pept        526100..527011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0491"
FT                   /product="PfkB"
FT                   /note="PFAM: PfkB; KEGG: tfu:Tfu_2129 putative sugar
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03465"
FT                   /db_xref="GOA:Q1AYR3"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYR3"
FT                   /protein_id="ABG03465.1"
FT                   /translation="MSAPRVIVVGDVLYDMVARVEGGLPVGADSFVRIQDSPGGSGANV
FT                   AAWLASLGVEAHLVGRVGEDPLGDHLEAGLREAGVRTHLPRDPSLPTGRVFVLVDGSGE
FT                   RTMITDRGAGEALGPRDIPARLFAPGAHLHLTGYLFSGGGRREAALEALRLARSAAMSF
FT                   SVDPSSVTLLRAVGVERFAGWTSGADLLFPNLSEAALLSGRAEPEEAARRLLERYRAVV
FT                   LKLGPEGALYADREGRRARLPAPRVRRADATGAGDALCAAFLASWVRGEPPARALREGV
FT                   RLAARVVGRTGARGFRRTRGPC"
FT   gene            527042..529306
FT                   /locus_tag="Rxyl_0492"
FT   CDS_pept        527042..529306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0492"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: tel:tll0627 hypothetical protein; TIGRFAM:
FT                   GGDEF domain; PFAM: GGDEF EAL PAS fold-3 PAS fold; SMART:
FT                   PAS PAC motif"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03466"
FT                   /db_xref="GOA:Q1AYR2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYR2"
FT                   /protein_id="ABG03466.1"
FT                   /translation="MRSACEENGATGQKGPEPDDLRLLQFLRWVVPLVFGFAALAGAAA
FT                   ALFSDPGLLAAGVILLTYGGLLLFARRRVGAGERVEAVWTICVGLLLAALLMSAVQPGW
FT                   LAVLAVTPLISVAVALPYVRGGDLLRLIFLAWLTVVVMAILSRALPPLSRPPAWFVDAF
FT                   TAGALAAATAVVLLLLWQFSTRLNETLARTRAAEERYALAERGVNDGLWDWDLRRDRVY
FT                   YSSRWKEMLGWREDEVGEEPDEWFRRVHPQDRKRLLEEVREHLRGRREHLNVEYRIRHR
FT                   DGSYRWMLTRGLAVRDGEGNPVRMAGSQTDITRRKQAEEKLLHEASHDALTGLPNRAFF
FT                   MERLGEALRRPGDGDRVAVLFIDLDRFKMINDSLGHAMGDRLLVAAAERLKGCLRPQDT
FT                   LARLGGDEFTVLLEGVSSEEAASVADRLLERLREPFRLDGYELFTAASVGVVLGGRERA
FT                   GPEELLRDADIAMYRAKALGGGRKGIFEAGMHTRAMELFRLENELRRAIEREEFTAHYQ
FT                   PIVSLKTGLISGFEALVRWRHPERGLIRPDEFVPVAEETGLIVPLELSVVREACASLVS
FT                   WQREFPQHRPLTMSVNLSRNQLARPELPEQVERILLETGLDARSLRLEVTESAIMENVG
FT                   SAAATLSRLRDMNIRVHIDDFGMGYSSLSVLHQLPIDALKVDRSFVGRMDGANDDVEIV
FT                   QTIITLAHNLGLDVVAEGVEREEHLDRLRRLGCDYAQGFLFSEPLDAAGARRLLSAYRR
FT                   W"
FT   gene            complement(529311..530285)
FT                   /locus_tag="Rxyl_0493"
FT   CDS_pept        complement(529311..530285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0493"
FT                   /product="Terpene synthase, metal-binding protein"
FT                   /note="PFAM: Terpene synthase, metal-binding; KEGG:
FT                   ava:Ava_1982 terpene synthase, metal-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03467"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR034686"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYR1"
FT                   /protein_id="ABG03467.1"
FT                   /translation="MSTENGHRDGLGPLRCPFPAAINPHADEVHRETVEWAEGFGLLGP
FT                   GDGHRMMRDTGIGRLAGRFHPGAGREELRLISDWCAWMFLRDDLADAPAYFRHPERLAA
FT                   LDAAFLDILSGRASGEGCGSFGRALRDLRERLLPKVPAPLWLRRFLRSVEEHFESTLWE
FT                   ATNRARGVVPDLETYLRMRPITGGMHVDTDFIEISSGVYLPPEVRRHPAVSALTGASNN
FT                   VVCWANDIISLAKERSRGDVHNLVLVLRASRRLTTREAVAEAARMYEAEVRRFVRLERE
FT                   LPPFGPAIDANLRRYVSVLKSRMRGNLDWTYESARYRAGAASR"
FT   gene            complement(530406..531362)
FT                   /locus_tag="Rxyl_0494"
FT   CDS_pept        complement(530406..531362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0494"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: syn:slr0545
FT                   auxin-induced protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03468"
FT                   /db_xref="GOA:Q1AYR0"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYR0"
FT                   /protein_id="ABG03468.1"
FT                   /translation="MRTNGYERAPLASELGIEPLGVGAWAWGTRRLWGYGSGYGRAEVE
FT                   AALRESLAAGVRLVDTAEIYGNGESERIIGSILQEGGLPARPVLATKFAPYPYRLSPRS
FT                   LLRALDGSLRRLGVESVDLYQIHWYSPVPAPGGLLDALAEAVKEGRVRRVGVSNYGAEA
FT                   MRRAHERLASRGVPLASNQVEYSLLHRAPETDGTLEACRELNVTLIAYSPLAQGLLTGK
FT                   YAPGSRPAGLVRRFGRDFGERNLRRVQPVVGILREIAEPRGKTPAQVALNWLLAQSTLP
FT                   IPGAKDAGQARQNAGALGWTLTPEEKERLDLATLGWR"
FT   gene            complement(531359..532342)
FT                   /locus_tag="Rxyl_0495"
FT   CDS_pept        complement(531359..532342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0495"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: cya:CYA_1156
FT                   hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03469"
FT                   /db_xref="GOA:Q1AYQ9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYQ9"
FT                   /protein_id="ABG03469.1"
FT                   /translation="MRLAHAALAAAGTLGALHALNRRLERSGGPPRATLGGERRRYGWR
FT                   EGKISYSVAGEGPPLLLVHGIYAGASSLEFRKNFGPLSRHFTVYAPDLLGCGASERPRR
FT                   RYSPEDITSQIEDFAREEIGRPVHLVASSLSATLALPAAVRSPRLFRSLVLICPTGLGT
FT                   LDRPSGRLGEAIYRLLASPLAGDLLYHALVSRRGIRLYLERMAYHDPSRVTEELVEDYH
FT                   RAGHGPNAKYLPASFVAGRLNLPALPYWTQVRQRAMVCWGEEARTPPPSELDAFLRYNP
FT                   RTAPRLFRGAALLPHDERAEDFNREVADFVSAGKVRISESNGRSGG"
FT   sig_peptide     complement(532283..532342)
FT                   /locus_tag="Rxyl_0495"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.838) with cleavage site probability 0.641 at
FT                   residue 20"
FT   gene            532535..533887
FT                   /locus_tag="Rxyl_0496"
FT   CDS_pept        532535..533887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0496"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase tyrosine protein kinase; SMART:
FT                   Serine/threonine protein kinase; KEGG: sth:STH1353
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03470"
FT                   /db_xref="GOA:Q1AYQ8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYQ8"
FT                   /protein_id="ABG03470.1"
FT                   /translation="MPIRREAAGGGRELETSAKTVFGDRYVVRERLGSGGMAVVYRAED
FT                   TLLGRDVAIKTLHRRYAEMPAFRRRFRQEARAMASLDHQNIVKVYDISPDGEAPFIVEE
FT                   YVGGRDLGSLLSRQRGGRLEEPFAVRVAVQLLKALAYAHWRGVIHRDIKPSNILITPGG
FT                   IVKVADFGIARLVEEDGEGDGEIIGSARYMSPEQLRGLEATQRSDVYSVGVLLYHCLTG
FT                   RPPFSGDVRSLVRQHLREAPRPPRELNRGISPQMEAVILRAMAKDPEARYPSATAMLDE
FT                   IEEGARQKARSGTREMPRRRMGRGRLALVSTLAVLLLGGGTAVGASGLAGYVDLSPRSS
FT                   VGQAVAAEPLRSAPPGIPEVAGQEASRDAPLVPVPDVRPYFDYSAREILVNRGFKVRIV
FT                   YAYREGYANRGVAWGTDPPAGTLAPAGSTVTVYSTPKDLYQPQIRTAGAAP"
FT   gene            complement(533894..534337)
FT                   /locus_tag="Rxyl_0497"
FT   CDS_pept        complement(533894..534337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0497"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_1681 PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03471"
FT                   /db_xref="GOA:Q1AYQ7"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYQ7"
FT                   /protein_id="ABG03471.1"
FT                   /translation="MRQDPNYGRQREPADELRSPFPGWGMSPEDERVWSVLAHLSALAG
FT                   LVGLMPLGALVIWLVYRDRSPRVGFHALQALLYQTMWLAIWVVGAVVGVVFTLVTLGLG
FT                   LVLVLPLALVFWLLPMAHSCYAAYRVGQGRDYRYPVVGHRAGW"
FT   gene            complement(534359..534844)
FT                   /locus_tag="Rxyl_0498"
FT   CDS_pept        complement(534359..534844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03472"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYQ6"
FT                   /protein_id="ABG03472.1"
FT                   /translation="MAAPPKPWSPLSARLEGRFAARGLPPLGFSLLEAEGPAFGRLRPE
FT                   GGRGARISAAGALVVIEREGRGRYRMLWEGVQALSAEGPPEGFRIAPGGEPWEAGLRLL
FT                   RNFATARGPGGRARVEGDLAGLRYGARFEGEAGLPAALFLLYRLAAARSRAFVVGGR"
FT   gene            534936..535295
FT                   /locus_tag="Rxyl_0499"
FT   CDS_pept        534936..535295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03473"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYQ5"
FT                   /protein_id="ABG03473.1"
FT                   /translation="MELKNKEELRGEILQSWLRNAWVYPVEGPDRKVYLRLTPGGRLKM
FT                   RKKIGEMERSLGVSGPELARQDEAGTLPLDRDRLELAMMVRAYTSERRFIESSGATLGT
FT                   PAVTLEEEREEGASS"
FT   gene            complement(535292..536020)
FT                   /locus_tag="Rxyl_0500"
FT   CDS_pept        complement(535292..536020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0500"
FT                   /product="Amino acid ABC transporter, permease protein,
FT                   3-TM region, His/Glu/Gln/Arg/opine"
FT                   /note="TIGRFAM: Amino acid ABC transporter, permease
FT                   protein, 3-TM region, His/Glu/Gln/Arg/opine; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; KEGG: sao:SAOUHSC_01991 ABC transporter,
FT                   permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03474"
FT                   /db_xref="GOA:Q1AYQ4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYQ4"
FT                   /protein_id="ABG03474.1"
FT                   /translation="MPDWWPPVEINPQDLSPERLVGYYLDFGVVLENPAPLLKGLAVTL
FT                   SLAALAEVVGIVLGLFLALLKISRSRLLSLPAQVYIDVFRGTPLLVQITIIYFTTAAVG
FT                   IRFTSLFFAGLTALSLNSAAYVAEIFRAGIQSIDKGQMEAGRASGLSYAQTMRYIIVPQ
FT                   AFRRVIPPLTNEFVTLIKDTSLVSVIGLAELLRAARVLQSATFNGTPLIAAALIYLAVC
FT                   LPLIYLTNILERRLNRRTAA"
FT   gene            complement(536044..536889)
FT                   /locus_tag="Rxyl_0501"
FT   CDS_pept        complement(536044..536889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0501"
FT                   /product="extracellular solute-binding protein, family 3"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; SMART: Ionotropic glutamate receptor; KEGG: chy:CHY_0504
FT                   glutamine ABC transporter, glutamine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03475"
FT                   /db_xref="GOA:Q1AYQ3"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYQ3"
FT                   /protein_id="ABG03475.1"
FT                   /translation="MPERKVVARSFATLALALAAALLLAAACGGGEGGGGGEQTAAGGG
FT                   EGTAGMEAGRTITVASDIAYRPFEFYRNGEPVGFDIDLMREIGRRAGFTPEFQNVTFDG
FT                   IIPGLGSNLYDAAISAITITEERRQQVDFSEPYFNADQSLLVRSDSDIRSVDDLGQATV
FT                   GVQIGTTGANKANQFQQQGRIAEVRTFDTIEDAFTALENGQVDAVINDLPVSQDKANTS
FT                   DGRLEVVQVIPTGEQYGIAFPKGSNLVGPVNRALREIKRDGTYAEIYEKWIGRKPEEIP
FT                   "
FT   sig_peptide     complement(536806..536889)
FT                   /locus_tag="Rxyl_0501"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.325 at
FT                   residue 28"
FT   gene            complement(537013..537747)
FT                   /locus_tag="Rxyl_0502"
FT   CDS_pept        complement(537013..537747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0502"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   dde:Dde_1428 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03476"
FT                   /db_xref="GOA:Q1AYQ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYQ2"
FT                   /protein_id="ABG03476.1"
FT                   /translation="MSIIEFRNVSKSFGDFEVLKGIDFSVEEGEVVVIIGPSGSGKSTL
FT                   LRCINALEGISSGELIVDGIRVHDRKADLNRLRTEIGFVFQQFNLYPHMTVAENVMLAP
FT                   MKVRKLSRKEAEERCMRLLERVGIPEQAGKYPENLSGGQQQRVAIARALAMEPKIMLFD
FT                   EPTSALDPEMINEVLEVMVDLARGGMTMVVVTHEMGFARRVADRVVFMDEGRILEEGPP
FT                   EHFFENPENERTKRFLDRILHM"
FT   gene            537835..538485
FT                   /locus_tag="Rxyl_0503"
FT   CDS_pept        537835..538485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0503"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   syf:Synpcc7942_2543 phage SPO1 DNA polymerase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03477"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYQ1"
FT                   /protein_id="ABG03477.1"
FT                   /translation="METLFDAVEGGENREERLAELARQVSVCTRCDLSRSRTNTVFGTG
FT                   DPYSPLMLVGEGPGENEDATGLPFVGRAGKLLDNILAAVNLSREQVYITNIVKCRAAVE
FT                   ENGRLRNRQPRAAEINACNPYLQAQIEAVRPEIILCLGGPAAKTIIDRDFRITRDRGRW
FT                   YEVGGIRAMATFHPAYILRQSGEELARTKRLVWKDIQNVYAEYQKALERRGAS"
FT   gene            538472..539575
FT                   /locus_tag="Rxyl_0504"
FT   CDS_pept        538472..539575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0504"
FT                   /product="glucose sorbosone dehydrogenase"
FT                   /note="PFAM: glucose sorbosone dehydrogenase; KEGG:
FT                   cbu:CBU_0368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03478"
FT                   /db_xref="GOA:Q1AYQ0"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYQ0"
FT                   /protein_id="ABG03478.1"
FT                   /translation="MGPPSLLAPLALLLSFLLAVSCAGEAPPGGREGVGPLRVETVLSG
FT                   LDTPWEVVFAPDGRVFVTERPGRVLVVEDGELREEPYARLPVEEVGEGGQLGLALHPNF
FT                   RRNGVLYAYYTTREDGRLRNRLVRLVEEDGSARQEEVLLEGPAASIHDGGRVRVGPDGK
FT                   LYATLGDTADAGLAQDPRALAGKIIRLNLDGSVPRDNHFPGSPVYSYGHRNPQGLAWDE
FT                   AGNLYAPEHGQSAHDELNLVRPGRNYGWPVIEGGERREGMVAPILHSGEKTWAPSGAEY
FT                   VREGPWRGSILFTGLRGESLHRVEVDPEDPGRVVRHREYLEGEYGRLRTVVQGPDGALY
FT                   LLTSNRDGRGDPAPSDDRLLRVEVGGR"
FT   sig_peptide     538472..538543
FT                   /locus_tag="Rxyl_0504"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.684 at
FT                   residue 24"
FT   gene            539678..540739
FT                   /locus_tag="Rxyl_0505"
FT   CDS_pept        539678..540739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0505"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="SMART: regulatory proteins, AsnC/Lrp; KEGG:
FT                   tdn:Tmden_1976 putative transcriptional regulator, AsnC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03479"
FT                   /db_xref="GOA:Q1AYP9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYP9"
FT                   /protein_id="ABG03479.1"
FT                   /translation="MVSAISGSRILDGIDKEILNLIQRDLPLEREPFAAVGREVGVSGQ
FT                   EVIRRIEALKKGRVVRQISAIFDTRVLGYESSLVAARIPPERLSEGAKAINSHPGVSHN
FT                   YERDNYFNLWYTLAVPPDSRLGLAGTVEVLHRISGAESTRILPTLKLFKIGVTLDMKEG
FT                   ATARKEAPAYGHADREGADRNITEEDRDAIRILQEDIPLTSRPFDLWARRVGTSWEELL
FT                   ERAEDLRRRKIMRRFSAVLYHRKAGFRANAMGVWKVPAERVDEVGTMFAHYQAVSHCYE
FT                   RPTYEDWPYNIFSMVHGRSREECEAVLDAMAAESGITERLSLYSTREYKKTRVRYFTPE
FT                   MEAWERLYAGVLR"
FT   gene            540752..541486
FT                   /locus_tag="Rxyl_0506"
FT   CDS_pept        540752..541486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0506"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   rpb:RPB_1485 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03480"
FT                   /db_xref="GOA:Q1AYP8"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYP8"
FT                   /protein_id="ABG03480.1"
FT                   /translation="MGVLVALGAAFAAGAVSGLTGFGLALVGVPLLLFVYDPATVVVLI
FT                   MAFSLLINAAVVQDSWRKVDRRMAAALSPPALAGVAGGTEVLRVASPEQLRLAVGVLVV
FT                   LSALLMLRDVRLPGTGSRLAPAVAGLVSGALSTSVGLAAPPVVLLLAARGLPKAAFRAT
FT                   SALFFLVMSVFGAAALAARGLIPEGSLSLAAALLPAALAGKLAGTALVGRIPEGAFRRI
FT                   TLLLTLATGALGAATALLALLR"
FT   sig_peptide     540752..540829
FT                   /locus_tag="Rxyl_0506"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.929) with cleavage site probability 0.361 at
FT                   residue 26"
FT   gene            541560..542912
FT                   /locus_tag="Rxyl_0507"
FT   CDS_pept        541560..542912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0507"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RS00896 probable transport transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03481"
FT                   /db_xref="GOA:Q1AYP7"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYP7"
FT                   /protein_id="ABG03481.1"
FT                   /translation="MRTAGGAKGGFATAEEDVGPGRRPARVFLGSGFMHGFLRGAPLAR
FT                   RDRLSFLVLLVSQFAATTGFMFVMPFMPLYVQQLGVEDPGRAAAWAGLLNTATAATMAL
FT                   AAPLWGRLADRFGPKPMLLRATFAGAAVVGVMGLAASPWHLLGLRLLQGTLTGTVAAAT
FT                   LLVAATAPAGRAGQRLGTLQTVIFAAAAAGPFLGGVFADLVGIRASFGVTSGLLALSAV
FT                   LILLGVDGARAPAEGAPRAQEGAGGGVPWLGLVPVLAALFVVQASNTGVAPALPGFVAG
FT                   LMEEPSGVASLAGQILGAGALAAALGSAAGGRLAERLGARTVIFCSLVLGGLAFLPQAA
FT                   VSSVAALWVLRVAASFFIGAVVPVANLAVRQAVPPDRQGRAFGVAASVTSVAFGVGPLG
FT                   GGLLASAFGFGAAFLVPGVLLLAAAGVLLLAPRSRARAVRILKAAAAHIIR"
FT   gene            complement(542902..543639)
FT                   /locus_tag="Rxyl_0508"
FT   CDS_pept        complement(542902..543639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0508"
FT                   /product="haloacid dehalogenase, type II"
FT                   /note="TIGRFAM: haloacid dehalogenase, type II
FT                   HAD-superfamily hydrolase, subfamily IA, variant 2; PFAM:
FT                   Haloacid dehalogenase-like hydrolase; KEGG: bte:BTH_II0507
FT                   haloacid dehalogenase, type II"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03482"
FT                   /db_xref="GOA:Q1AYP6"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYP6"
FT                   /protein_id="ABG03482.1"
FT                   /translation="MAPAETKALLFDVFGTTVDWRGGIIRAGRELEQRRGSPAPEGVDW
FT                   AALADAWRAEYRPSMERVMRGELPWTNLDGLHRASLEGLLPRFGLAGLGAEEREFLVGA
FT                   WHRLDPWPDVLEGLRRLRRRYIVAPLSNGNVALLTNMARRAGLPWDLILSAEWVRRYKP
FT                   DPATYLLLPRLFSFDPKQVMMVAAHPDDLLGARRAGLRTAFVPRPLEFGPEGTAPPPEG
FT                   PFDVVAGDFVDLAERLGAPAASG"
FT   gene            543735..544067
FT                   /locus_tag="Rxyl_0509"
FT   CDS_pept        543735..544067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0509"
FT                   /product="conserved hypothetical protein 103"
FT                   /note="PFAM: conserved hypothetical protein 103; KEGG:
FT                   mta:Moth_0028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03483"
FT                   /db_xref="GOA:Q1AYP5"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYP5"
FT                   /protein_id="ABG03483.1"
FT                   /translation="MAGRRNINKMMKQVQQMQQEMQRAQEELARETVTASAGGGAVKVT
FT                   MTGGLELTSIEIDPGVLDPEDVEMLQDMVQAAVNEAINSAQELASRKLGGVTGGLGDLG
FT                   LNLPGL"
FT   gene            544081..544680
FT                   /locus_tag="Rxyl_0510"
FT   CDS_pept        544081..544680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0510"
FT                   /product="DNA replication and repair protein RecR"
FT                   /note="KEGG: lxx:Lxx03440 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: RecR protein
FT                   TOPRIM; SMART: Toprim subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03484"
FT                   /db_xref="GOA:Q1AYP4"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1AYP4"
FT                   /protein_id="ABG03484.1"
FT                   /translation="MATYARSVERLIAELSRLPTIGPRSAQRIAFHIIRTRKEEALALA
FT                   EALREVKERIRPCRRCFNLTEGEECDICRDPRRDRSVICVVEDPYDIGPIERTGEYRGL
FT                   YHVLGGALSPLDGVEPEDLRIAELVERVRSEGTRELILATNPNTTGEATAMFIAQEVRE
FT                   LPVRVTALASGLPVGGDLEYADEVTLGRAFAGRREL"
FT   gene            544718..546937
FT                   /locus_tag="Rxyl_0511"
FT   CDS_pept        544718..546937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0511"
FT                   /product="DEAD/DEAH box helicase-like protein"
FT                   /note="PFAM: helicase-like DEAD/DEAH box helicase-like;
FT                   KEGG: deh:cbdb_A928 ATP-dependent RNA helicase, DEAD"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03485"
FT                   /db_xref="GOA:Q1AYP3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYP3"
FT                   /protein_id="ABG03485.1"
FT                   /translation="MVASLGPRPASLVEPPGDLHPALREALRRGGMARLYSHQREAYER
FT                   LRCGENVVVATATASGKSLCYKLFAFQGVLEEPRSRALFLYPTKALAQDQLGKIRAFGL
FT                   RGVRPATYDGDTPQPLRADIRRRANVVLTNPDMLSVGILPNHDAWGPFLRGLRVVAVDE
FT                   AHVLRGVFGSHVAAVLRRLRRLARLHGGDPRFVLTSATIANPQELAETLTGLPFSPVER
FT                   DGAPSGERRVVFRNPPLLDRERGERRSLLTEGALVFAALVSQGVRTIAFARTRRAAELI
FT                   YRYAADRLGPEGARRISPYRAGYTPGERREIEGRLFRGELLGVVSTNALELGVDVGSLD
FT                   AAICCGYPGSVASVWQQWGRAGRGEGASLAVYIPGRDALDQFLYENPQRILGRRVEAAR
FT                   LTLDNPYILAPHLLAAAREAPLEPEDEEFFGPQYGRVAGELEEAGALLRSGGRLVYAGV
FT                   GSPARGISLRSASSETVVIADGEGELVGTAEAARAPSELHPGAVYLHRGAAYEVERLDL
FT                   AARRALVRRVPDRFYTRPRVETDVEILEELERRPLSGGALLHRGRVRTTDAVTHYKKVR
FT                   VADDREVGVFPLDLPEVSLETQALWVTLPPPPPEGRPSFEGFGGALHAAEHGLIGLLPL
FT                   FAMCDRADIGGLSTPVHRQTGRPTIFVYDGYPGGVGIAHRGFDAFPSLARDALGAIVRC
FT                   PCERGCPGCVQSPKCGNWNEPLSKEGAVWLLRFVLGQVDRHPALS"
FT   gene            546934..547398
FT                   /locus_tag="Rxyl_0512"
FT   CDS_pept        546934..547398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; KEGG:
FT                   mka:MK1390 predicted Rossmann fold nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03486"
FT                   /db_xref="InterPro:IPR005268"
FT                   /db_xref="InterPro:IPR041164"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYP2"
FT                   /protein_id="ABG03486.1"
FT                   /translation="MSGAPYISVVGSGRASGELYELAREVGRLVAGRGAVVVCGGLGGV
FT                   MEAAARGAREAGGVAIGVLPGEDRRGANRYLTYAVATGAGQARNLAVVCSGDAVIAVGG
FT                   EYGTLSEIGLARKVGRPVVVLRGWELGPHVAVAATPREAVERAFGMIGAL"
FT   gene            547428..548129
FT                   /locus_tag="Rxyl_0513"
FT   CDS_pept        547428..548129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0513"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   gvi:glr0293 probable carbonyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03487"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYP1"
FT                   /protein_id="ABG03487.1"
FT                   /translation="MSEGEGRVALVSGGNRGIGLEICRQLAAKGIAVVLGSRDERRGRE
FT                   AAEGIAGRVVAHQLDVADQESVDRIAAYVEREFGRLDILVNNAGVAPDGGQRGVEADLE
FT                   KVREALEINLLGAWRLSRAFIPLMRRNGYGRIVNVSSGLGSISEMGGGSPAYRVSKAAL
FT                   NALTRILASELRGTGVLVNAVCPGWVQTEMGSPGAPRPVQEGADTPVWAATLPKGGPTG
FT                   GFFRDRRPIPW"
FT   gene            548215..548835
FT                   /locus_tag="Rxyl_0514"
FT   CDS_pept        548215..548835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0514"
FT                   /product="alkaline phosphatase"
FT                   /note="KEGG: sth:STH2141 alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03488"
FT                   /db_xref="GOA:Q1AYP0"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYP0"
FT                   /protein_id="ABG03488.1"
FT                   /translation="MPDLAGWAAEVIRSLGYAGVILIMLAENLFPPIPSEVVLPFVGFM
FT                   VSRGHLAFVPALLTATLGSLAGAYALYALGRWGGRPLILRYSWLLRVSKEDLDRADHWF
FT                   DRYGGWIVFFGRMVPGVRSIVSIPAGLSEMPLGRFTLLTAAGSALWNTALISAGFFFGE
FT                   NWRRVAGFADSASPVLLAAAAAALAGWWLLWRARRRKGRGAAG"
FT   gene            548832..549704
FT                   /locus_tag="Rxyl_0515"
FT   CDS_pept        548832..549704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0515"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: tfu:Tfu_0079
FT                   similar to hydrolase or acyltransferase (alpha/beta
FT                   hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03489"
FT                   /db_xref="GOA:Q1AYN9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYN9"
FT                   /protein_id="ABG03489.1"
FT                   /translation="MTGWREERVPGEVELAVSLWGEGPDPVLCLHGITAQHRAFNFLAR
FT                   CLDGRRPLAGMDLRGRGNSGKPPAGCYGLGAHAGDVVRVLDHLGLREATIAGHSMGAFV
FT                   GLEVARRHPERVRALILLDGGWPRAGEPSGELDEGLERAFSRLEMTFAGLEEYLDFWFP
FT                   GRNLSPEDLPPELEDYYRYDLEEADGGLRPKASLAAAREDARYLASRGPTVRELAGVRC
FT                   PVALVRAAEGFFPGSDPLIPDPVRDAMAGALDVRREILAAGANHYTLLLDPRHVRRWAG
FT                   LAADEGWAR"
FT   gene            549704..550480
FT                   /locus_tag="Rxyl_0516"
FT   CDS_pept        549704..550480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_1083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03490"
FT                   /db_xref="GOA:Q1AYN8"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYN8"
FT                   /protein_id="ABG03490.1"
FT                   /translation="MLRLLFVGDVVGEGAVDAVVGLLPRLREELGLDAAVVNGENAAGG
FT                   AGITPQLAERLLSAADFITLGDHAFDREEAAAYLDREGRIIRPANLPEGLPGRGWGAFE
FT                   AGGARVGVACVQGRLFMREACSPFEAADRALEGLRGADLVLFDLHAEATSEKQALGWHL
FT                   DGRAAAALGTHTHVPTADLRLLPGGTAYVSDVGMAGSPDGIIGMDREGFMEVFLRRRRA
FT                   PVTPARGPVRVDAVLVEADPKSGRAVGASRVFREAA"
FT   gene            complement(550489..551664)
FT                   /locus_tag="Rxyl_0517"
FT   CDS_pept        complement(550489..551664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0517"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ava:Ava_0244 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03491"
FT                   /db_xref="GOA:Q1AYN7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYN7"
FT                   /protein_id="ABG03491.1"
FT                   /translation="MKGTPGGEDRRGRAALRFVVLLGVVDLLADATYEGARSIAGPFLA
FT                   HLGAGAAATGFVAGLGEFAGYALRAVSGYLGDRTGRFWAITIFGYVLNLAAVPLLALAG
FT                   SWQAAFALMVAERSGRAIRGPARDAMLSHAGSRMGRGWAFGLHEALDQLGAVAGPLAVA
FT                   AALYLAGGYRTGFAILAAPAALSIATLLLSRRLYPEPERLETEREGRGLPRAFWLYMAF
FT                   VVPGVAGFASFQLVSYHLKTAGLLPGAGIPLAFAAAMGVDALVALASGRLFDRLGLAVL
FT                   ASVPLLTLPVAPLAFSGSAVAALAGVLLWGAVMGVQETIMRAAVGGMAPAGVRGTAYGL
FT                   FNAVYGLCWFAGSAAMGALYEVSADHAVAFSVALELASVLPLALLLREVRR"
FT   gene            complement(551719..551967)
FT                   /locus_tag="Rxyl_0518"
FT   CDS_pept        complement(551719..551967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0518"
FT                   /product="protein of unknown function DUF190"
FT                   /note="PFAM: protein of unknown function DUF190; KEGG:
FT                   mta:Moth_0526 protein of unknown function DUF190"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03492"
FT                   /db_xref="InterPro:IPR003793"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYN6"
FT                   /protein_id="ABG03492.1"
FT                   /translation="MHEAFREQGIEDVSVHRGILGFDRSSEILSARPLRFHPDLPVVVE
FT                   AAGTRWRVEAALPRVRAALPRGLITLSEVELHPPEGG"
FT   gene            complement(551970..552566)
FT                   /locus_tag="Rxyl_0519"
FT   CDS_pept        complement(551970..552566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03493"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q1ARK2"
FT                   /protein_id="ABG03493.1"
FT                   /translation="MAVAEANPETWAVGFEDECWWSRLALPTLNTWSEEGKPLRLVQRS
FT                   VAKNDPEPKAISCYGLYLPEIGDTWLRFVDGRPVSSITTRFLSWCLEKLEAVGKKILLL
FT                   IWDNASWHVSREVRRWLGKHNREVKESGRGVRVVSCLLPKQSPWLNAIEPKWIHGKRKV
FT                   VEPEDLLGTYELAERVCRVFGCPHYEHLSVPREVT"
FT   gene            complement(552566..553228)
FT                   /locus_tag="Rxyl_0520"
FT   CDS_pept        complement(552566..553228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0520"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV1204 putative IS630 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03494"
FT                   /db_xref="GOA:Q1AYN4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYN4"
FT                   /protein_id="ABG03494.1"
FT                   /translation="MSGGPGAALRARVYLRDSARAGDRPAYEAVAECIFRIGFGLRVTV
FT                   RSMKSPIFVRSLSENEREDLEAGLRSKDAFVMRRSQILLASSRGEKAPKIAENLGCGTQ
FT                   TVRDAIHDFNERGPDALVARSSRPKRTRDAFDEESAERLRGMLHRSPREFGRESSLWTL
FT                   EMAAEVAFEEGLTQRRVSGETIRATLARLLGVRWQRAKRWITSPDPLYERKKEGATC"
FT   gene            complement(553225..553557)
FT                   /locus_tag="Rxyl_0521"
FT   CDS_pept        complement(553225..553557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0521"
FT                   /product="protein of unknown function DUF190"
FT                   /note="PFAM: protein of unknown function DUF190; KEGG:
FT                   ttj:TTHA0334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03495"
FT                   /db_xref="InterPro:IPR003793"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYN3"
FT                   /protein_id="ABG03495.1"
FT                   /translation="MRPAIRLRVLIGEDERYRGRPLFEALVLAAREQGLAGATVFKGFM
FT                   GYAPHADIASAGILRLAENLPVVVDIVDEAERIEGFLPFVRRAVREGLVIRSEVLAEQV
FT                   LPGEVR"
FT   gene            complement(553554..553928)
FT                   /locus_tag="Rxyl_0522"
FT   CDS_pept        complement(553554..553928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0522"
FT                   /product="camphor resistance protein CrcB"
FT                   /note="PFAM: Camphor resistance CrcB protein; KEGG:
FT                   tth:TTC1648 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03496"
FT                   /db_xref="GOA:Q1AYN2"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1AYN2"
FT                   /protein_id="ABG03496.1"
FT                   /translation="MAPAELALTLAAAGAGSVLRYLLGGWVAHRMGPEFPWGTLAVNAL
FT                   GCLGLGLLQGAAPHDRALLLVLGSGLLAGFTTFSTLMLETANLATAGERDRAFSNIVGT
FT                   LALGLFALSAGARAGAWAAG"
FT   gene            complement(553929..554606)
FT                   /locus_tag="Rxyl_0523"
FT   CDS_pept        complement(553929..554606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0523"
FT                   /product="Camphor resistance CrcB protein"
FT                   /note="PFAM: Camphor resistance CrcB protein; KEGG:
FT                   hch:HCH_02448 integral membrane protein possibly involved
FT                   in chromosome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03497"
FT                   /db_xref="GOA:Q1AYN1"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1AYN1"
FT                   /protein_id="ABG03497.1"
FT                   /translation="MAQATVRLGSELQCERAVRLAHRRGVASATAYWGPETGSARHVFL
FT                   MLLDEEGKIEGVLPELRELLPDAGISVSREVVVHEAPRGFLEGEALRPRPFRAGLGHLG
FT                   WIFAGGALGAAARLAVEGAARRLAPAAYEAFPWGTLAANAAGSFLIAIFGTLIFERFVG
FT                   ERARAFWVLGFLGSLTTFSSYALHTLRGWEASPLLGGLYGGGSLLLGLLAALAGLRLTR
FT                   RLL"
FT   gene            554886..555290
FT                   /locus_tag="Rxyl_0524"
FT   CDS_pept        554886..555290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0524"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: nfa:nfa7500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03498"
FT                   /db_xref="GOA:Q1AYN0"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="InterPro:IPR019966"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYN0"
FT                   /protein_id="ABG03498.1"
FT                   /translation="MAVVEPWVERRLREEKILWLTTVRADGQPQPVPVWFLWGTEGFLI
FT                   YSRPNAQKLRNIRSNPRVGLNLNCDERGGSVVRAEGTAEIVEDAAPASEIPEYVQKYRE
FT                   DMRRLGYEPAGFALDYAVAVRVTPRRWQSW"
FT   gene            complement(555298..555828)
FT                   /locus_tag="Rxyl_0525"
FT   CDS_pept        complement(555298..555828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0525"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="PFAM: transcriptional regulator PadR-like; KEGG:
FT                   deh:cbdb_A1083 putative transcriptional regulator,
FT                   PadR-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03499"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYM9"
FT                   /protein_id="ABG03499.1"
FT                   /translation="MVRAPGGFFWRGSGFGPRRRFGKGDLKYVILDLLERGPAHGYQLI
FT                   KALEERSRGLYAPSPGSVYPTLQMLEDMGYVGSSREDGKKVYQITEEGRGFLRERRRSL
FT                   EEVWRRFGRGWDPGLEGELHEIRHELAHLWRLFGRKARAGRVDQEKLRRVRGVVVEAAR
FT                   RIEDILEDRDARA"
FT   gene            555947..556927
FT                   /locus_tag="Rxyl_0526"
FT   CDS_pept        555947..556927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0526"
FT                   /product="D-amino acid oxidase"
FT                   /EC_number="1.4.3.3"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   sma:SAV1672 putative D-amino acid oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03500"
FT                   /db_xref="GOA:Q1AYM8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYM8"
FT                   /protein_id="ABG03500.1"
FT                   /translation="MCGMRGRVVARAVVVGCGVAGLSAAIALRERGFGVRVVAREPPER
FT                   TTSAVAAAVWYPYRAYPEERVLSWGARTFEVFRGLAADPRTGVRLGEGVELLRRSAPGE
FT                   PWWREAVSGFRRCREEELPPGCRGGYRFVAPVAEMPAYLAYLLDRLRGAGGTLELREVS
FT                   SLEEAGEGADVVVNCSGVWARELARDPSVFPIRGQILRVANPGLERFVLDEENPAGLTY
FT                   IVPRSGDCVLGGTAEEGRWSTEPDPATAEAILRRCSALEPRLRGARVLEHRAGLRPGRP
FT                   EVRLELEELPGGTPCVHNYGHGGSGVTLSWGCAEEAAALAGAALS"
FT   gene            557027..557785
FT                   /locus_tag="Rxyl_0527"
FT   CDS_pept        557027..557785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0527"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH GntR-like; KEGG:
FT                   mta:Moth_2304 GntR-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03501"
FT                   /db_xref="GOA:Q1AYM7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYM7"
FT                   /protein_id="ABG03501.1"
FT                   /translation="MSTGGSGRERRLRPPRLSVGLAERLRGRILGGEFGPGERLPGNRE
FT                   LAAAYSVSVGSVREALQRLASEGLVEVRPGSGTYVSRDLRGSPWLPGGEQPLLDREQVE
FT                   ELIEAREVLEPRLAELAARRASAEQVEGLWRALERMQESVSDPSAFAEADVGFHMAVAE
FT                   ASGNRFLTRATADIRSLLRRDMELSAEVGIRRAGTLQFSVDSHRRLVAAIAAGDPEKAG
FT                   RIVSGILRRNRGFVIGLYSGGVSAEGSGEF"
FT   gene            557803..558756
FT                   /locus_tag="Rxyl_0528"
FT   CDS_pept        557803..558756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0528"
FT                   /product="beta-lactamase-like protein"
FT                   /note="PFAM: beta-lactamase-like; KEGG: gsu:GSU2769
FT                   metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03502"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYM6"
FT                   /protein_id="ABG03502.1"
FT                   /translation="MEVAPGVHRIESVLGPRTFSQYLLLGERALLVDTGVAETPEKVIL
FT                   PYLESVGLSARDLDFALVTHADVDHFGGNGALRGAAREAVLCAHAADAPWVEDRERILR
FT                   ERYGWYAGEGVDYPPDVREWLRESLGPDVPLDLHLSGGEVFRLGPGLLVEVLHLPGHSP
FT                   GHVGLWEPSSRSAIITDAALGGGLLDMEGNVISPPPYFDARAYEESVRRLQGLSPRLLL
FT                   TAHYPVMEGEEAARFLEESLEFVRRARRVVAEALEERGELDLRNLLELAGPRLGPFTAM
FT                   ENELAGTLRAHLRELVAAGRAREAPGGGGTVWRSLG"
FT   gene            558830..559675
FT                   /locus_tag="Rxyl_0529"
FT   CDS_pept        558830..559675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0529"
FT                   /product="Xylose isomerase-like TIM barrel"
FT                   /note="PFAM: Xylose isomerase-like TIM barrel; KEGG:
FT                   rba:RB201 sugar phosphate isomerase/epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03503"
FT                   /db_xref="GOA:Q1AYM5"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYM5"
FT                   /protein_id="ABG03503.1"
FT                   /translation="MAQRLELGMISSAWFDTSVGLEEGIRRAREIGFDSYDIFEDPLDI
FT                   DDATRRLIKQTCREVGLPIRSVVCVNFGLVDFNPSVERFAMDRARAYIDQGAYFGARNL
FT                   LLVIGEYYWDGEVFPYEAIWGFAVDRVRRLGDYAAEKGLEIVIELEPFSQALVRDVDEL
FT                   ARFIREVGHPAVKANADISHLHLSGASFEDVGKLRGIIGHIHLSDCDGKKHGDLPAGRG
FT                   VTPIKDYLKAIIDTGYSGTVSIELEYSPDPDRIVEWVEEAYRETSRIMSELGVREEARA
FT                   "
FT   gene            559688..560794
FT                   /locus_tag="Rxyl_0530"
FT   CDS_pept        559688..560794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0530"
FT                   /product="oxidoreductase-like protein"
FT                   /note="PFAM: oxidoreductase-like Oxidoreductase-like; KEGG:
FT                   rba:RB7494 probable NADH-dependent dyhydrogenase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03504"
FT                   /db_xref="GOA:Q1AYM4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYM4"
FT                   /protein_id="ABG03504.1"
FT                   /translation="MAGIDLDLKHLPELGSKTDYRIGAIGAGFIMRDVQLAAYDEAGFD
FT                   VVAIASRTPEHARSCAERWGIGRVYETWRELLDDPEVEILDIAYPPDRQLGIVREAVEH
FT                   ADHIKGILAQKPLATTLEDAAEIVRLCEEAGVVLGVNQNMRYDQSMRALKTLLDRGYLG
FT                   EPVVAQIVMHARPHWQDFLRGLDRLAMLNMSIHHLDIFRFLFGDPERILASVREDPSIG
FT                   FEHADGMAFYILEYAGGLRAVSIDNCFTWTDHGIEWRVEGTEGVARGTIGWPDYPEGSP
FT                   STVDFTTKRQPGYWFLPRWEERWFPQAFIGTMGQLMRALEEGSEPEISGRDNLRTMALV
FT                   EAAYRSVAEGRAVRLDEVGTKEATGGSA"
FT   gene            560781..561533
FT                   /locus_tag="Rxyl_0531"
FT   CDS_pept        560781..561533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0531"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR Insect
FT                   alcohol dehydrogenase family; KEGG: sco:SCO0365 probable
FT                   oxidoreductase (secreted protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03505"
FT                   /db_xref="GOA:Q1AYM3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYM3"
FT                   /protein_id="ABG03505.1"
FT                   /translation="MAALDGKVAVVTGGGGGLGEGICAGLAAAGAAVAAVDVDLEKARR
FT                   VERLVAGRGGRCVAVEADVSSRRSVERMAERVAGELGGIDILVNNAAIYPLRPWTEIDE
FT                   EEWDRVLAVNIKGYFLCARAAYPYMRERGGGRIINVASITFFIGWAGFLDYVSSKGAVV
FT                   GFTRTLAREVGPEGITVNAVSPGAFPTDAERVHPDQEALNRRILDAQCIKRRGKPEDVG
FT                   NLVTFLASEEASFITGQTIEIDGGWAMH"
FT   gene            561533..562660
FT                   /locus_tag="Rxyl_0532"
FT   CDS_pept        561533..562660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0532"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO0366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03506"
FT                   /db_xref="InterPro:IPR027839"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYM2"
FT                   /protein_id="ABG03506.1"
FT                   /translation="MVRLWGGEYGRRELLRRVGRLEQVAGVRLVTLGDGAGRGVRALEF
FT                   RTGSGLSFDVLVDRAFDIGRCEFGGRSLCWLSGVGTSGPWFYEPEGLGFFRTFGGGMLT
FT                   TCGLDHTLFMAEDTAEQYHYPPKRTERYGLHGRVSNLPARLVGYGERWEGEGCVLWAEG
FT                   EVLQAAVFGERLLLRRRVEARVGESRITVRDEVENAGFDPTPHMYLYHVNVGFPVVDEG
FT                   AELLAPAVSVTPRGDYPAEGYGRFHAPEEGYVERVFEHELAAEEGGTVPVAVVNRRLGL
FT                   GVYQLYDRNQFPHHFVWRMLGEGTYVVGIEPSTNRTAGRLDARRRGELIRLRAGERRAY
FT                   GMELGVLEGESEIERFARRVASSKARRARREGEAR"
FT   gene            562657..563793
FT                   /locus_tag="Rxyl_0533"
FT   CDS_pept        562657..563793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0533"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: bja:bll7907
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03507"
FT                   /db_xref="GOA:Q1AYM1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYM1"
FT                   /protein_id="ABG03507.1"
FT                   /translation="MRGTAAEPAGRRERLEDILIVDCDVHVHESPGELAPYCEMPWRRA
FT                   LENIADVEEYYLDIPGFSPGMTWYEARFPSGHEGRRMVHDARQMREELDAIHVDIGILF
FT                   PDHLLKIALITQDEYAAALARAYNRWLLEKWCSPERKLLGCILACPQDPEDAAREIRRY
FT                   AREPGMVGVYLPCAGLDPLWGNRRYDPIYEAAQEADLPVLLHSVTVVHPVFPFNLHGFE
FT                   TEFGRHICGHTFAIMANLVHMISTGVPERYPRLRIAVTEAGVSWVPFLMNRMDKEYLER
FT                   RREIPLVKQRPSRYLKRMYFATQPVEEPEDLGDLVRLVELYDGEDRTIFASDWPHHDFD
FT                   HPMKVHQAPFSNEARRKIFGENALGLFRIDAQGRRLNL"
FT   gene            563793..564164
FT                   /locus_tag="Rxyl_0534"
FT   CDS_pept        563793..564164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0534"
FT                   /product="Rieske (2Fe-2S) region"
FT                   /note="PFAM: Rieske [2Fe-2S] region; KEGG: mpa:MAP0741c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03508"
FT                   /db_xref="GOA:Q1AYM0"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYM0"
FT                   /protein_id="ABG03508.1"
FT                   /translation="MAGERRKHPVGRLSEFPPGTHRVVRVGRREVGIFNIRGTLYGLPN
FT                   LCPHQTGPLCEGKTTTGTLIARRENGWRLEWAYEGEIVACPWHGLEYHIPTGRCLAFPE
FT                   ITLRCYEVVVEDGEVKVIL"
FT   gene            564168..564404
FT                   /locus_tag="Rxyl_0535"
FT   CDS_pept        564168..564404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03509"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYL9"
FT                   /protein_id="ABG03509.1"
FT                   /translation="MKEPGAQLDGRLAVAEVAGAYLVVREADPADWLVRFEKSPGFPAR
FT                   EWAENMASIYNRRLELGGGPPTPPGTRPPGYHP"
FT   gene            564451..567138
FT                   /locus_tag="Rxyl_0536"
FT   CDS_pept        564451..567138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0536"
FT                   /product="D-galactarate dehydratase/Altronate
FT                   hydrolase-like protein"
FT                   /note="PFAM: D-galactarate dehydratase/Altronate
FT                   hydrolase-like; KEGG: bmb:BruAb2_0426 hydrolase, UxaA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03510"
FT                   /db_xref="GOA:Q1AYL8"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYL8"
FT                   /protein_id="ABG03510.1"
FT                   /translation="MRERAADFEEVGRLPGPRDNVAIATRRLEAGTRVRCGGSSFSLSH
FT                   AVLEGHRFAVSRIGEGEALLSWGLPFGWALREIRPGEYVCNARILRVLRERRVDLDLPG
FT                   EPNFRDDPLRPYVLDERNFGPGEQVPRHERPGTFMGYGRGAARGAGTRNHIVVLGLTSR
FT                   TGPYARALERRLAGLAAGVPGLDGIVAVAHTEGGEDRPPNNLGLLLRTLAGFMVHPNAG
FT                   AVLAVDDGRGALTGGALRRYMKERGYPLREVPHRFMTLRGSFAGELRRGERAVRGWLGE
FT                   AGSARRSPQPLSRLRLALQCGGSDAFSGVSANPLVAWVARELLRHGGSANLAETDELIG
FT                   AERYVLENVRDLATARRFLQTVERFRELVGRHGHTAEGNPSGGNNYRGLYNIAIKSIGA
FT                   ARKKDPGVRLDYVIPYAGRMDAPGYYFMDSPGNDLESVAGQVASGANVIFFTTGNGSIT
FT                   NFPFVPTIKVVSTTGRYRLLADEMDVNAGAYLDGTPMEELGRDAFDLAVRVASGERTAG
FT                   ERAGHSQVSIWRNWRQTSRPSPAALREPPEPDGRPLPLGEREEAGGFSFEGVRKGEGYA
FT                   ADRVGLIMPTSLCAGQIALIIAGRLNGLGVGEGKLSRFVALPHTEGCGVSGGHSERLYA
FT                   RTVLGYLSHPSVGAALLLEHGCEKTHNDYFRARLAERGLDPGDFGWASIQLDGGIERVV
FT                   RRVEGWFGEALEGMGEMEREPAGPEHLRVGLHAEGPLPEGTAGALAQLALRVAASGGTV
FT                   VIPERSPALEGLRGRVPLRATLAYGQRPAAPGLHVMEAPTGDWMEIATGLGAAGVEVML
FT                   AHVAGRPLRAHRLVPLLQASSDAETLYRCGEDLDVALRGEPSGWRAALERAVLEAASGR
FT                   RFPRLARQGYAGFQLARGPLGVSM"
FT   gene            complement(567143..567913)
FT                   /locus_tag="Rxyl_0537"
FT   CDS_pept        complement(567143..567913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0537"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /note="TIGRFAM: 2-deoxy-D-gluconate 3-dehydrogenase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR; KEGG: xcb:XC_0161
FT                   2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03511"
FT                   /db_xref="GOA:Q1AYL7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011286"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYL7"
FT                   /protein_id="ABG03511.1"
FT                   /translation="MGVLDSFRLDGRVALVTGAAQGLGQGIAVGLAEAGAHIAALDVMP
FT                   LDETRESVAAEGRRFHAMEYDLRKTGAGLAARIVGECVEAMGRLDILVNNAGIIRRAPA
FT                   LEFSEEDWEEVIRVNLSAAFYLSQAAARHFVEAGRGGKIINLASVLSYEGGILVPSYSA
FT                   SKAGIANLTRALANEWAPMGINVNAIAPSYFATSLTSALRADPERSEALLARIPAGRWG
FT                   TPEDLKGAAVFLASDTASYVHGAVVPVDGGWLGR"
FT   gene            complement(567915..568403)
FT                   /locus_tag="Rxyl_0538"
FT   CDS_pept        complement(567915..568403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0538"
FT                   /product="Cupin 2, conserved barrel"
FT                   /note="PFAM: Cupin 2, conserved barrel; KEGG:
FT                   reu:Reut_A0381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03512"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYL6"
FT                   /protein_id="ABG03512.1"
FT                   /translation="MAIDRGLRTFVEEMQLPDRAIDGEKIPWVPQGERVWFKPLRFDLA
FT                   GGRWINLLKVEGGGKVNRHRHTGGQVLGYCVEGSWRYLERDWVARPGTLVYEPPGDIHT
FT                   LVVDEESGGMVTLFILEGSVQYLDDEDNLIYQDDVFSKLRRYLDYCEQRGIEPEDLCY"
FT   gene            568535..569278
FT                   /locus_tag="Rxyl_0539"
FT   CDS_pept        568535..569278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0539"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH GntR-like; KEGG:
FT                   mta:Moth_2304 GntR-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03513"
FT                   /db_xref="GOA:Q1AYL5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYL5"
FT                   /protein_id="ABG03513.1"
FT                   /translation="MPGIDWSLSRDTTTERVIGRLKELIGERKFGPGDKLPPERELCSL
FT                   LGVSRPILREALQALAALRLVRIRQGDGVYVTSLKTDLLLEPLRFVLRLDPTAIEQLYR
FT                   ARQVIEVGITELAASSMTPEAERRLEEILAESEAQVEDPKAFSRTDIELHETIARLVTN
FT                   PFLTVVIESLNELSRAGREFTCTVPGVTPRALEEHRRIVAALKARDGRAAGRAMKEHLE
FT                   NVLAAWQSAREGAVGGQGAKEGESG"
FT   gene            569271..570092
FT                   /locus_tag="Rxyl_0540"
FT   CDS_pept        569271..570092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0540"
FT                   /product="beta-lactamase-like protein"
FT                   /note="PFAM: beta-lactamase-like; KEGG: nph:NP3970A
FT                   hydrolase (probable hydroxyacylglutathione hydrolase) 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03514"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYL4"
FT                   /protein_id="ABG03514.1"
FT                   /translation="MADCKVKVLDHGVLECDQELITPLQSLATAENKQTTSKWIRVPTF
FT                   SLIIEHPEIVVGVDNGNHPEAMRGYWPEHLRSIFPWVHSEADEYANRLEQAGYAPTDLD
FT                   LMVQSHLHLDHAGCLYLFEDTGVPVLVHEAEMREALYAAYALPVEKRGGYHRPDFCRDV
FT                   NYRPTRKDRFELAEDLWVFNFPGHTPGVLGVLFRAAGRWYLYPNDGVWTRANYEQGLLP
FT                   SILWSSRHYWDTTLPLVREIVEEYEATLVFSHDLEDFGKLKGYEDFEVVGG"
FT   gene            570142..570897
FT                   /locus_tag="Rxyl_0541"
FT   CDS_pept        570142..570897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0541"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bbr:BB1748 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03515"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYL3"
FT                   /protein_id="ABG03515.1"
FT                   /translation="MRLEGKVCVVTGGATGIGEASALALAREGARVVVGDVNVEEGRKT
FT                   VEDIKKEGGEALFVECDVSREEGARRLVEETVGAFGRIDVLFNNAGINITEGSVPEMKV
FT                   EDWRRTFAVNVDGIFWCSRYAIPEMRKNGGGRIINTASPSSFVGWAGNAAYIASKGAVM
FT                   SLTRAMAMDHAKENIRVNAIVPGLILSPLGLNWVQQQEDPEAVKESIHPIGRPGYPEDV
FT                   APVVVFLAQDDAEFATGAPFFMDGGLVAS"
FT   gene            570910..571278
FT                   /locus_tag="Rxyl_0542"
FT   CDS_pept        570910..571278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0542"
FT                   /product="Cupin 2, conserved barrel"
FT                   /note="PFAM: Cupin 2, conserved barrel; KEGG: hma:rrnAC3415
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03516"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYL2"
FT                   /protein_id="ABG03516.1"
FT                   /translation="MVRIRRVEEARNIGEERWNVSGLEQRVLFHTDELMVVWLKIPPGT
FT                   EFPDHSHPHAQIGFQVSGRVELRGENGRFEIGPGTAYMFEPNELHGSRVVGGEPAVQLD
FT                   AFHPAREDYLDADEVVKR"
FT   gene            571275..572318
FT                   /locus_tag="Rxyl_0543"
FT   CDS_pept        571275..572318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0543"
FT                   /product="Alcohol dehydrogenase GroES-like protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding Alcohol
FT                   dehydrogenase GroES-like; KEGG: bja:blr3675 putative
FT                   alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03517"
FT                   /db_xref="GOA:Q1AYL1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYL1"
FT                   /protein_id="ABG03517.1"
FT                   /translation="MKAARLYEYDPELEGQEFLKVEEVPEPEIEAPDDVIVRVGGAGVC
FT                   RTDLHIIEGLWDEALVVEPPYTLGHENAGWVEEAGSSVSRFAPGDAVVIQPALSDGTCL
FT                   SCLRGRNNLCESLVWIGIQQNGGFAEYVRVKERNLVKLPENVEPRDAAPYADAGLTAYH
FT                   ATKKAARVLDAGDVAVVIGIGGLGHIGVQVLKALSPARVVALDRSEGALRLAEEVGADH
FT                   VVNSAGDAVDRVLELTGGRGAQAVVDFVGEADVPARALAMTRTGGYYFVVGYGGEIRVP
FT                   TMEMIATEKSIVGNIGGTTSELHELIALAGEGKVRMNVRHYPLEEANRALLDLHEGRIH
FT                   GRGVLVP"
FT   gene            complement(572584..574032)
FT                   /locus_tag="Rxyl_0544"
FT   CDS_pept        complement(572584..574032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0544"
FT                   /product="Aldehyde dehydrogenase (NAD+)"
FT                   /EC_number="1.2.1.3"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: bsu:BG11159
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03518"
FT                   /db_xref="GOA:Q1AYL0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYL0"
FT                   /protein_id="ABG03518.1"
FT                   /translation="MIESQIESRNYIGGEWVPADSGEVEEVRNPARPSEVLGTAPRSDR
FT                   GEMERAVAAAQEALPGWRSALPAARGQILLRAADIIDSRSEELARLMALEAGKPLGESR
FT                   AEVSRAAAIFRYYGSEGWRLYGVEAPSTRPGVRITSTREPLGVVGLITPWNFPLAIPSW
FT                   KMAPALICGNTVVIKPAANAVLNAAELVRILEEAGLPGGVVNLVMGPGGSSGDALVRDE
FT                   RVRAISFTGSTAVGLSIQERAAGKKVQLEMGGKNPYVVMEDADLEDAAAKVAYGAFGYA
FT                   GQKCTASSRAVVVEEVYEAFLEQVVEATRALKLGEPLDEEAVIGPVINESQYESILGAI
FT                   EQAREDGRVVLDGGATGPREEGYYISPVIVADVDNGSKTAREEIFGPVLAVIKARDFDH
FT                   AVEIANDTRYGLTAGIATRSLRYAEEFIERSQTGLVNVNLPTAGVEFQVPFGGSKQSGV
FT                   GGREQGMAAIEFYTGWKTASVLAL"
FT   gene            complement(574098..574916)
FT                   /locus_tag="Rxyl_0545"
FT   CDS_pept        complement(574098..574916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0545"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   rba:RB8851 probable 2-hydroxyhepta-2,4-diene-1,7-dioate
FT                   isomaerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03519"
FT                   /db_xref="GOA:Q1AYK9"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYK9"
FT                   /protein_id="ABG03519.1"
FT                   /translation="MHLSRHAAPGGPRWALDGRYLPAGFTLDLLLELPADGVEGFLRAL
FT                   PSGDPAGHPPLAPVEPGHEVWASGVTYERSREARMLESSEADIYDKVYTAERPELFFKA
FT                   PGWRVVGPGEMVRVRADSAWNVPEPELVLVLNSRMEVVGYTAGNDVSSRDIEGENPLYL
FT                   PQAKIYDGACSLGPGIELAGAAELGDLGISLRILRGGEKAFEGETSTSRMVRPPEELAA
FT                   YLGRELSFPRGAFLMTGTGIVPEEDFSLSPGDAVEVAVGGMTLRNEVAPL"
FT   gene            575052..575945
FT                   /locus_tag="Rxyl_0546"
FT   CDS_pept        575052..575945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0546"
FT                   /product="beta-lactamase-like protein"
FT                   /note="PFAM: beta-lactamase-like; KEGG: tfu:Tfu_2040
FT                   similar to Zn-dependent hydrolase including glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03520"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYK8"
FT                   /protein_id="ABG03520.1"
FT                   /translation="MEILPGIHRIESDLGPRFMCQYLLLGEERRVLVDTGIAKTPGEAI
FT                   APYLEGLGLGVGDLDEVIISHADLDHCGGNRALKRENPGLRISCGEPDRPYVERNRTML
FT                   AELYCWTEPYGFGPDEAAKERILEDLGGDCPVDAGLRGGETLRLGPGWRIEVLHLPGHT
FT                   PGHLGLWDARSGAAIIIDAALESGIYDREGNRLIPPRYFDAAAYERTLRSLLALRPRHL
FT                   LTAHYPPMGEREAEEFLRRSLEFVGRMRSLVRAALREGTTGLKELTARADAGLGPYPQS
FT                   AFELAAGVRAHLSELY"
FT   gene            575970..577172
FT                   /locus_tag="Rxyl_0547"
FT   CDS_pept        575970..577172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0547"
FT                   /product="Mandelate racemase/muconate lactonizing
FT                   enzyme-like protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   enzyme-like; KEGG: hma:rrnAC0575 mandelate
FT                   racemase/muconate lactonizing enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03521"
FT                   /db_xref="GOA:Q1AYK7"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="PDB:2QQ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYK7"
FT                   /protein_id="ABG03521.1"
FT                   /translation="MSAPRITRVETAAIRAVGPSVLVRVWAGDEHGLGECYPSAPAAGI
FT                   HHIVMNMEEQLLGEDPRDVERLYEKMRRWNIFTGGQAGAVITALSGIETALWDLAGKLQ
FT                   GVPVYRLLGGAFRRRVRLYADCNAGTVDAAAHHIEGGLFEEGSNEEYIAVAREAVERGF
FT                   DAIKLDVDDITGPLHRDFWNGAISPREHEAMVARVAAVREAVGPEVEVAIDMHGRFDIP
FT                   SSIRFARAMEPFGLLWLEEPTPPENLDALAEVRRSTSTPICAGENVYTRFDFRELFAKR
FT                   AVDYVMPDVAKCGGLAEAKRIANLAELDYIPFAPHNVSSPVGTVAAAHVCAAVSNFAVL
FT                   EWHAIDMPHWEDFVRYPGGPVIREGHIELTEEPGLGLELDEEAAFEHRHEKGGVPFFGR
FT                   T"
FT   gene            complement(577169..577969)
FT                   /locus_tag="Rxyl_0548"
FT   CDS_pept        complement(577169..577969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0548"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   tfu:Tfu_1921 ABC-type sugar transport system ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03522"
FT                   /db_xref="GOA:Q1AYK6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYK6"
FT                   /protein_id="ABG03522.1"
FT                   /translation="MRPDAPEVLRVENISKRFGSVVALRDVSLRLRKGEVLGLIGDNGA
FT                   GKSTLIKIITGFHRPDSGRIFLEGEEVQLRSVSQAQSLGIQTVYQDLALVNDLSVYHNM
FT                   FLNKELTRRPLPLLNNRKMKELTRRYLSDIGINIPSLDIEVAMLSGGQRQAIAVARAVY
FT                   SEAKILLMDEPLAAMGAKEGAMILDLIQRLKEEGEVSIILIAHNYAHVLEVCDRVNVLQ
FT                   HGRIGYDRPAEETSVEELTELMVSEYRRARAGGGEAPPWEGGAG"
FT   gene            complement(577966..578970)
FT                   /locus_tag="Rxyl_0549"
FT   CDS_pept        complement(577966..578970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0549"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   sai:Saci_2121 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03523"
FT                   /db_xref="GOA:Q1AYK5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYK5"
FT                   /protein_id="ABG03523.1"
FT                   /translation="MAGQSATGGREGLLPRLSGALLERREAGIFAVAVALVVYFQAANA
FT                   AFLTQGNLRALAQFAATTAIIAVGLVMVMILGEIDLSVGQAYGFAPIVMYLAYERLLLV
FT                   LPLAIAVALAATAVVGFANGALRVYFGVPSFVATLGTFFLLGGLNVILTGGFPRPAPEE
FT                   SALKQALGAYPYAGILWATGIMIIMHAVLNHTRWGIHTFATGGNFTGAREAGIRVDRIR
FT                   IGNFMLCSVLGGFAGIIEAMRIDSIDPLVGGAEIMFYAIAAAVIGGTPLAGGVGTVIGA
FT                   FIGTLVISILRNGFTLQGVNANEFNIILGVAVLIVMALNIYVGRLRRGRRAPT"
FT   gene            complement(578974..580068)
FT                   /locus_tag="Rxyl_0550"
FT   CDS_pept        complement(578974..580068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sai:Saci_2122 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03524"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYK4"
FT                   /protein_id="ABG03524.1"
FT                   /translation="MEPSSSGGLGGYRLGRREFLAAGALAGAGLLLGGCRRAEEAGQQG
FT                   GGGGVGNFPETPEYNFVFVNHVTTNPFFTPTQYGIEDASALLGTRYQWTGSETSVVREM
FT                   VDAMNTAISGGADGIAVSIVDPDAFNDPIRRALDQGIPVVAYNANGKGPGTNPALAYIG
FT                   QDLFLSGVEMGKRIVELVEEGPVALFIATKGQLNIQPRIDGAIQAIEDSGAPIEYEEIE
FT                   TGAELPEELNRIDAYYQGHKDVRGMFAVDAGSTQGVAQVMKKYNLHEQGVRAGGYDLLP
FT                   KTLEILREGHIDFTIDQQPYLQGFYPVLQLYLYKISGGLTGPAETNTGLKFVTQEDAGQ
FT                   YLETESRYEGDSERPRLLEAPAAS"
FT   gene            complement(580146..580925)
FT                   /locus_tag="Rxyl_0551"
FT   CDS_pept        complement(580146..580925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0551"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   gka:GK1190 3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03525"
FT                   /db_xref="GOA:Q1AYK3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYK3"
FT                   /protein_id="ABG03525.1"
FT                   /translation="MYDLAGKRALVTGAGMGIGQAIAVELARCGADVAVHYAHTPPDET
FT                   VGEVERAGRRAHPVRGDLSRVPECERVVEEAAEALGGLDVLVNNAGITRALDFLDTDEE
FT                   TYDAIFDLNMKGYFFCARSAVPHMLEAGGGSIVNITSVHGFAGFPHHTAYAATKGAIIA
FT                   FTRQLAIELAGRGIRVNAIGPGLIEVPRYYDIPGYSPEQGRELVPWGRVGKPKDVGPAA
FT                   AFLASDAADFITGQVLYVDGGTTARMGLWWEQGEQPQ"
FT   sig_peptide     complement(580854..580925)
FT                   /locus_tag="Rxyl_0551"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.782) with cleavage site probability 0.781 at
FT                   residue 24"
FT   gene            complement(580929..582101)
FT                   /locus_tag="Rxyl_0552"
FT   CDS_pept        complement(580929..582101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0552"
FT                   /product="Mandelate racemase/muconate lactonizing
FT                   enzyme-like protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   enzyme-like; KEGG: sco:SCO2401 dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03526"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYK2"
FT                   /protein_id="ABG03526.1"
FT                   /translation="MRISEVETFVVGTEWRNLTIVRLSTDEGLTGLGEARMVNHTEALL
FT                   GYIREAAGRHIIGHDPFRIEELVLKLTRDDFSRPGEVLSSGLACFEMACWDIVGKALGR
FT                   PVYDLLGGPVRERIKAYANGWYRVEREPEEFYAAARRVVERGYRALKVDPFGPGYYELE
FT                   REEKLRAVALVEAVREAVGPQTEILLEMHGRFSPAQALEMIRLLEPYGLGWAEEPVPPT
FT                   NLKALKKVSERVPAGIPVATGERIHQRGEYRELFELQAADVIQPDISHIGGLLETKKLA
FT                   AWADACYVTVAPHNVGGQIGTAAALHLAACTTNFRIQEYFNDFADPWLKRVAPGLPEVE
FT                   DGCFPLPRGPGLGVELDEEVVEAHPKQDVHFNLFAEGWEKREARRGRGAG"
FT   gene            complement(582098..583033)
FT                   /locus_tag="Rxyl_0553"
FT   CDS_pept        complement(582098..583033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK1960 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03527"
FT                   /db_xref="GOA:Q1AYK1"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYK1"
FT                   /protein_id="ABG03527.1"
FT                   /translation="MRARELLLGLGLPGGEPGEPPDSPKRFPDGAHYRVEIPSVEGPRV
FT                   LEAVLEEAERRGVHIHRVSQGSGIMLLTDAEIAEMCAMAREAGVELSLFVGPRASWETG
FT                   AAAISGAGRVLGAQHRGQDQLAYALEDVLRGVELGLRGVLVADAGLLWVLRDLKARGEL
FT                   PGDLVVKVSVQLAAANAAAVKAMESLGADTYNVPTDLSPAQLAAIRAVTSLPLDVYVEV
FT                   PDDFGGFVRHYEISEIVRAAAPVFVKFGLRNAPNIYPSGTHLEQTAVALGRERVRRAEI
FT                   GLSMLERYYPQAETTKPGTPFAGIPAREAA"
FT   gene            complement(583030..583788)
FT                   /locus_tag="Rxyl_0554"
FT   CDS_pept        complement(583030..583788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0554"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH GntR-like; KEGG:
FT                   mta:Moth_1310 regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03528"
FT                   /db_xref="GOA:Q1AYK0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYK0"
FT                   /protein_id="ABG03528.1"
FT                   /translation="MTMCGGMGGATRRVRLRDRAAERLLEMILSGGLAVGERLPPEREL
FT                   VERLGVSRTVVREALNLLEARGVVSIEHGRGAVVSGGNPAAVQEALSALLRVRSRSLLE
FT                   LQEIRRILEVEVAGLAAERAGPEEVRAMREQLERMRAQIDAPEGYVDADVEFHAQLARA
FT                   TGNGVLLTMLEPVVELLRESRKVSASLPGAALRALEEHERILGCVERGDARGAREEMRA
FT                   HLEHTHRDIREALEEGLLADGRATRREEGR"
FT   gene            583889..584287
FT                   /locus_tag="Rxyl_0555"
FT   CDS_pept        583889..584287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03529"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYJ9"
FT                   /protein_id="ABG03529.1"
FT                   /translation="MQNGRVFGPGDTIRISVGIRHTMHIDSVTVVFAHERREGVELQLF
FT                   GGPAPFEEGGRTYTVSEVWRSEAEVVATVPANTTPGRYALSQVLLETYGGRVYRYGPEE
FT                   LGAAAGDLGFEVVEEPLERPVIEGLGYT"
FT   gene            complement(584262..584525)
FT                   /locus_tag="Rxyl_0556"
FT   CDS_pept        complement(584262..584525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03530"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYJ8"
FT                   /protein_id="ABG03530.1"
FT                   /translation="MRRGRASPLSLGPAPSSLLQKRPVVEPLEEVCDLALGREPAEEAL
FT                   LEEPGALLLQGREHPASPPSGGSIFPGRPPGETSPTCSRAPL"
FT   gene            complement(584552..584809)
FT                   /locus_tag="Rxyl_0557"
FT   CDS_pept        complement(584552..584809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03531"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYJ7"
FT                   /protein_id="ABG03531.1"
FT                   /translation="MRRRAAQLVITAVAALVVMVPPAFAVSKCPEPPPQKVHCNAGNGN
FT                   GNEGCDPGNSTLNNRGGDEIGAPARRGGSQPNPGGNNVLW"
FT   sig_peptide     complement(584732..584809)
FT                   /locus_tag="Rxyl_0557"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 26"
FT   gene            complement(585027..585626)
FT                   /locus_tag="Rxyl_0558"
FT   CDS_pept        complement(585027..585626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03532"
FT                   /db_xref="GOA:Q1AYJ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYJ6"
FT                   /protein_id="ABG03532.1"
FT                   /translation="MGLSSPFSGAGFRLFVLAAAVFAATLLAASAAEAQFEDQYGAPVA
FT                   PAGPLAGLQVIVQNDTDGVVNAGDVLVIPGEYTVTEGASVTLQDADATQGTLIDGQNAE
FT                   IEEGSVVITVTADPVINAPGANGVLNTEGLFVVASTGIFPKAGGAAAAQTEAGAAAEAA
FT                   APSGTLPETGGALLFGVLGGLALVATGGLSLRYIRR"
FT   sig_peptide     complement(585531..585626)
FT                   /locus_tag="Rxyl_0558"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.683 at
FT                   residue 32"
FT   gene            complement(585742..587685)
FT                   /locus_tag="Rxyl_0559"
FT   CDS_pept        complement(585742..587685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0559"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: TPR repeat O-antigen polymerase
FT                   Tetratricopeptide TPR_2; SMART: Tetratricopeptide region;
FT                   KEGG: mta:Moth_1253 O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03533"
FT                   /db_xref="GOA:Q1AYJ5"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYJ5"
FT                   /protein_id="ABG03533.1"
FT                   /translation="MRKMEGLLKHARSRRLLPTLALAALALSAGWMGAWGAGYFVAVWG
FT                   PVALLLAALALALSLAGVPPGRGAARAALGLLAAYTLWTFASVLWAANKGDAWAGAGKT
FT                   AVYLLAFWVAAALVGAGASRRWALAASVLGPAAVAALTLPVLPESMGQMFHANRLLGTV
FT                   NYYNGEAALLLVPFWVAVYLGGSRQAHPLLRGAVLAGAALSAQLAVLTQSRGAMFAMAA
FT                   SLPVFFLLSGKRLRGLLALAAPAAAVSLSFPELNRVYLEFLNEGSPREALQAALPEVWL
FT                   LAAGAGLYGLAWGAADAVWSVDRRVVRAAGAVALAAALVGGAAGALAAVQRVGDPVAWA
FT                   GEKWEAFRTNDTAGQEQSRYLSVSGSGRYTLWRVAWEDFARRPVLGVGTHNYEATYYRL
FT                   REQAVGYVRQPHSLPLEVLAERGVVGGALLAGFLAVCVGAGLRERFGSLGGEGRAQVGA
FT                   LAAAVAYWFVHSSAEWFWQMPGVTLPAFLYLALLASPWRVARPSPLRWPLRAAAAAVAL
FT                   AAAAAVAPLYLADRAEAQSHGLRDPREALAAVERAQSLNPWDPRLREREAELAMQAGQW
FT                   ERAERAYREAIELNPRHFAPYMRLATYYERRGRLEDALRSYREALRRNPLDEELQRKVG
FT                   WLASSAGRERQE"
FT   sig_peptide     complement(587575..587685)
FT                   /locus_tag="Rxyl_0559"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.848 at
FT                   residue 37"
FT   gene            587827..589305
FT                   /locus_tag="Rxyl_0560"
FT   CDS_pept        587827..589305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0560"
FT                   /product="Protein-tyrosine kinase"
FT                   /EC_number="2.7.10.1"
FT                   /note="PFAM: lipopolysaccharide biosynthesis; KEGG:
FT                   fra:Francci3_3472 protein-tyrosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03534"
FT                   /db_xref="GOA:Q1AYJ4"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYJ4"
FT                   /protein_id="ABG03534.1"
FT                   /translation="MRDENHLRQRRSTNGPEAGPPPDDEIVISLDELLRVLWRRAWIIA
FT                   LVAGLLTAAAAGFSLLRTPIYEASIQIVIGQREGAAPTNLGSDVMGLQQLTRTMAEVLE
FT                   SRTVANAVIREMNLPTDAETFLENMTVEPVTETQVIEVSYRDPDPERAQQVANTIGRVF
FT                   SEQVSDLSPSANAVTATVWERAQLPDEPVSPQPLRNAAMALVLGLMLGTGAAFLVEHLD
FT                   DRWRSPEDAEQVSGVPTFGVVRQFDTSGGKRRRGRLLRRRGDKKEDMLDLAGRLVTLVD
FT                   QDGLAAEDYRSLRTNLFYAFVDAPPRAIVTTSPGPREGKSTTCANLGVALAQAGRSTLL
FT                   LDCDLRKPVVHEIFGLRNIRGVVDVLAGTRELREVWHSPVPNLRVVPTGPIPPNPAELL
FT                   SSRRFQQMLEEARGQFDYVLMDAPPVEAVSDPVILATHSDGVLLVIDAQNTRKGAVRRA
FT                   MRSLEAVGARVLGTVLNNAGETEGGYYYYRRYGY"
FT   gene            589575..590945
FT                   /locus_tag="Rxyl_0561"
FT   CDS_pept        589575..590945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0561"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   noc:Noc_1513 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03535"
FT                   /db_xref="GOA:Q1AYJ3"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYJ3"
FT                   /protein_id="ABG03535.1"
FT                   /translation="MMGLSSSMFDKYVLLSLKRRLFSGGAWAFAGRVGTMFFGLASNAL
FT                   LARLLSPQDLGTYFLAFSVASFGAMAGSLGLNQAAVRLIAESLGTGQFGRTRRVVGAVI
FT                   VLGVLGILIIGCLYLLLLGRFLGTDLFDAPSLVAITWLVAGWMAVLTWQEILSGVFRGF
FT                   HDIRWATVFGGLMTSVLLATSLLLLWLFQEESTLATVVLLAIVSGGASALLGGWLLRLK
FT                   VTSIPLEGALNQRAFKTVAGVAWPLLITNLTLFALMQVDLWILGAFRSQEEVAIYGAAA
FT                   RLAALVVAPLAVVNAVVPPLIAEMYAQGRRGELERMLRFTAALAAAPALLTVLGFTILG
FT                   VPILTLVYGGYYREGTVVLALLSLGQMASVLTGSCALTLMMTGHQVTSMIITVAAGVLM
FT                   IIVALQVVDPYGATGVAVATCGGLVFQNVVMWLMAKRKTGIWTHFSFSVLRSIRGFS"
FT   gene            590942..591901
FT                   /locus_tag="Rxyl_0562"
FT   CDS_pept        590942..591901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0562"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rba:RB10430 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03536"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYJ2"
FT                   /protein_id="ABG03536.1"
FT                   /translation="MNPKIIVLFIGAWGRSGSTLLERMLGQMPRFFAVGELRHVWDRSF
FT                   QDNQLCGCGKSFYSCEFWRAVGSEAFGGLERVDVDKILTLKATVDRYRYMPCHIRASKT
FT                   GKYNRRMADAVKEYASLLERFYRAIQAVSGAEVIVDSSKDPPYAFLLNALPFVDLRLIH
FT                   LVRDSRAVAYSWSRERERPEITDRLELMPRFGPVMSSYGWNLYNYSLGFLRRFVPSSAL
FT                   LRYEDLVQGPDTQVRRVLEETGFDQPLALPFVHGRKVRLGTNHTVSGNPMRFQTGMLDL
FT                   RPDEEWKTKMRRTDKYVATVLTAPLLLRYRYLSSKRIR"
FT   gene            591962..592810
FT                   /locus_tag="Rxyl_0563"
FT   CDS_pept        591962..592810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0563"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   gme:Gmet_2885 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03537"
FT                   /db_xref="GOA:Q1AYJ1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYJ1"
FT                   /protein_id="ABG03537.1"
FT                   /translation="MSQKISVLVNTLNEEANIRNCLECVKWADEIVVVDMYSEDRTLDI
FT                   AREYTDKVFLHERVDYVEPARRYALEQATNEWVLVVDADELVTRELRDRILQIAEEDRY
FT                   DVVYVPRINYFFGRAMRGTGWAPLQDMHVRFFKKWCVRYSDEIHSPVGVDPSARVYELL
FT                   DESCAFVHFNYIDAEHFIDKLNRYTTIEAKNSAAAGRSFSGLGVLYAVLKEVGWRFFLK
FT                   NGFKDGFQGLALSLLMGFYRLSAGLKLYLMERYSTENVRDTVLKQYARIAEREIRRYEQ
FT                   S"
FT   gene            592846..593838
FT                   /locus_tag="Rxyl_0564"
FT   CDS_pept        592846..593838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0564"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   tbd:Tbd_0313 rhamnosyl transferase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03538"
FT                   /db_xref="GOA:Q1AYJ0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYJ0"
FT                   /protein_id="ABG03538.1"
FT                   /translation="MGMDDSKGPEVYVVILNWNGWQDTIECLESLFRSRYTRYRVVVCD
FT                   NGSDDGSLENIKAWAEGRLDLPFSSDNPLRYLAPIPKPVPYVEHDREVRDGDCVEGCTR
FT                   FLVLVRTGANLGFAGGNNVGIRYALERKADYVWLLNNDTVTDLNALGAMVNVAQSDPDI
FT                   GAVGSTIYYMDAPNDIQLYGGGWVSFWLGICRHFTTSVSDDKLGYVAGTSLLLRREVLE
FT                   QVGLLDDKFFMYWEDTDYGIRVREAGWKLAVAPESRIWHRESAALGKKNPVLYTYFNAS
FT                   AVRFFRKFSPLPFVPISVGVGGRFLKRVMQGDWNQAKAVWQGALAGCRE"
FT   gene            594291..595172
FT                   /locus_tag="Rxyl_0565"
FT   CDS_pept        594291..595172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03539"
FT                   /db_xref="GOA:Q1AYI9"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYI9"
FT                   /protein_id="ABG03539.1"
FT                   /translation="MPTASADAFFEVFSWSFYGEVRAFSLFGSASKFGHYIALVGALGI
FT                   SFLYSEKLEAKAAGLVLTILVLAAGFATLTRATYMEILMTLFAAWLLVRPRGTLLKYLV
FT                   SLLPLVYGVTGAFVAFALPSWITVASNRSPLLSDNTLLMRYASWDTYGGLWMESDLFAK
FT                   LFGMGIIQNNRFPVTENVLIDNSFLALLIHIGLLGLMVWLMLMWALWRYVLRVAISHGS
FT                   PLAVAIAAIWSTWMATGVFGITTEGYPLLLVLLLLSSVGGKAEAFRKRNPWEENLQSRR
FT                   SESNHSSCWQKA"
FT   gene            595213..596298
FT                   /locus_tag="Rxyl_0566"
FT   CDS_pept        595213..596298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0566"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   tcx:Tcr_1682 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03540"
FT                   /db_xref="GOA:Q1AYI8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYI8"
FT                   /protein_id="ABG03540.1"
FT                   /translation="MVKVLMISGSLPPRVCGVGDNAFRLAAALSEAGMNVEILTTTGPV
FT                   PDDSLGVDIHASVRNWNLLRLSEAMREIRAIRPDIVHLQYPTAEYKAGLLPQALVLSRV
FT                   PLVVTIHEASYVHILRRISLYPFLILADRVVATTRFEADFLVGLYPSVRKKLSVVSIGS
FT                   SIPAGPVLVRDRNTIMYFGLIAPRKGIEEFLELADLAGEAGKPWTFRIVGALSSRWREY
FT                   AQELHKDALSLSVEWHLNLSAEEVAKHLASVGAVYLPFPDGASLRRSSLIAALVNSSPI
FT                   ITTRGGSTPSDLVDGENVLFANSPEVALKKIQRLVSDAELSRRLSCGAAEYGKRFSWSQ
FT                   IAEQYIDLYGYVLSTRKRGRP"
FT   gene            596295..597299
FT                   /locus_tag="Rxyl_0567"
FT   CDS_pept        596295..597299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0567"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase dTDP-4-dehydrorhamnose
FT                   reductase; KEGG: aae:aq_1082 GDP-D-mannose dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03541"
FT                   /db_xref="GOA:Q1AYI7"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYI7"
FT                   /protein_id="ABG03541.1"
FT                   /translation="MSSTALITGITGQDGAYLAQLLLEKGYRVVGAFRRASMVNTARLD
FT                   ALGIAEHVELVPFDLTDHGNMRRVIEAVAPDEVYNLAAQSFVGVSFEQPVTTGEITGVG
FT                   VVRLLEAIREVNPEIRFYQASTSEMFGKARETPQNETTPFHPRSPYAASKLYAHWTAVN
FT                   YREAYGMHASSGILFNHESPLRGVEFVTRKISLGAARIKYGLQEKLTLGNLEARRDWGY
FT                   AKEYVEAMWLMLQQPEAEDYVVATGESHSVREFVETAFEVAGLDWERYVVTDPAFLRPA
FT                   EVDFLLGDPSKAKSKLGWEPRTTFRELVEIMVEADLRRAAFEARHGREMLEIR"
FT   gene            597300..598247
FT                   /locus_tag="Rxyl_0568"
FT   CDS_pept        597300..598247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0568"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase
FT                   dTDP-4-dehydrorhamnose reductase Male sterility-like; KEGG:
FT                   rpa:RPA3952 possible oxidoreductase Rmd"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03542"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYI6"
FT                   /protein_id="ABG03542.1"
FT                   /translation="MPRALVTGASGFAGGYLVRYLLELGYEVVGAVHGAGARLPDGCHR
FT                   AVLDITDRQSLREVVAATQPDEIYHLAGIARPANDSVDEFYEVNFGGTLKLLETVREHA
FT                   PDAAVLLVGSAYAYGSVGHPISEIELFKPVNHYGSSKASADLLGHVYSLEGLRVVRARP
FT                   FNHSGPGQSPAFVLPTLVEQFVEIEAGKREPVIRLGNLDSVRDFSDVRDIVRGYRLALL
FT                   KGRSGEPYNLGSGRGTSVRELFEMVREKAEQEVELQVEPSRTRIIDIPYLVADTSKARE
FT                   ELGWEPEVSLEQTLHDMLDAVRKRLVAEDGVCGT"
FT   gene            598244..599398
FT                   /pseudo
FT                   /locus_tag="Rxyl_0569"
FT   gene            599377..599514
FT                   /pseudo
FT                   /locus_tag="Rxyl_0570"
FT   gene            599744..601204
FT                   /locus_tag="Rxyl_0571"
FT   CDS_pept        599744..601204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0571"
FT                   /product="Undecaprenyl-phosphate
FT                   galactosephosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="PFAM: sugar transferase; KEGG: noc:Noc_1508
FT                   undecaprenyl-phosphate galactosephosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03543"
FT                   /db_xref="GOA:Q1AYI5"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017472"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYI5"
FT                   /protein_id="ABG03543.1"
FT                   /translation="MEAEAALPEGLLGRGIRERLGRQPVAVLVLVASDVALALLMWSAA
FT                   IALRYLWLGSLPLMGLTLSGVAANTVVWVLLRAGRGLYPGYGLDQVQELKRQTYATLSA
FT                   FAIHLCGAFVLQLGDSISRLVFVSGFAGLLVAAPFGRHFAKWALMRAGLWGRPVLVVGA
FT                   SGDGERLIGDLRREWGMGFRPVAVFDDDFVPEGGAVEGVPYGGGLREARALAQERKVGT
FT                   LVVAMDHSRQERAVEIMREASSVFRHVIFIPQLNAVTNSATEARYLSGTLGLEVKHNLL
FT                   DPWAVRAKRALDLLLAAALTVVLSPLILLIALLIKLDSPGPVIYGHVRLGAGNTSFRCW
FT                   KFRTMYEDADRLLHEHLLKNEHLRIEWELNQKLRNDPRVTRIGRFLRKTSLDELPQIWN
FT                   VIKGEMSLVGPRPIVDSEVVRYGETYDLYRRVKPGISGLWQVSGRNDTSYSERVGLDVH
FT                   YIMNWSVWLDLIILARTVRCVLLRKGAY"
FT   gene            601474..601803
FT                   /locus_tag="Rxyl_0572"
FT   CDS_pept        601474..601803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03544"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYI4"
FT                   /protein_id="ABG03544.1"
FT                   /translation="MLAAYRPGGVVALETGRWRAAGIAAGTGPELRRRARAHRPGRADA
FT                   SDGGYLARTARRGGGRLVREDGAVEVPQKAAEHLAGLGAVPGGAAVGFRLLPVPPGRGG
FT                   GLGPF"
FT   gene            601974..602795
FT                   /locus_tag="Rxyl_0573"
FT   CDS_pept        601974..602795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0573"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4; KEGG: sru:SRU_0356 IS982
FT                   family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03545"
FT                   /db_xref="GOA:Q1ARN0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q1ARN0"
FT                   /protein_id="ABG03545.1"
FT                   /translation="MTPTGFSTLKGRRYESLKRLSDSEVITLALFQQLRGVESERSFLR
FT                   DCERFFSHLFPGVVGLHPSSFHRRVRKLRRFLEPLRRALLEELVGDPETLIVDSTLLSV
FT                   LHPRQVKQSAAGFEGAGWSRWGSFCVYGVKLHLVCSTNRVPISYEMTAANEADVLLVEE
FT                   LLAGAALEEGEVARRLFGDLAYESGALRRRLAESGILLSTEGASRRPATRQQIEVCFAH
FT                   LKGAFGLGETLAKTLVGLAIRIAAKVTAYTYGLYVNRLLGRPQGRIKELWA"
FT   gene            603080..603967
FT                   /locus_tag="Rxyl_0574"
FT   CDS_pept        603080..603967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0574"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; KEGG:
FT                   sco:SCO0724 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03546"
FT                   /db_xref="GOA:Q1AYI2"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYI2"
FT                   /protein_id="ABG03546.1"
FT                   /translation="MAEREDGERRAGVADGRVRALLQRLFDGSRLSPTQRRLARYVMDH
FT                   PDEALFLSSVELARRVGVSQPSVTRLAVAMGYGGYGELQRELRAVALEGGGGGAGSEAP
FT                   NKFQGAVRAEIENLRALERSLEDTGAVEELGRELAASEPLCVLGLRVSAPLAGYFGYFA
FT                   KKIHPDVRVLTEGGSAAFDALAQARAAGGAWVLCFLLPRHPRETLQAMSYARSLGLRVA
FT                   TVADRETGWIRELSDAVLPAEVGTRLVFDSQAAAMVLAGVLLEALSDAAPKRAQERLEE
FT                   FEQRAARLGFFETG"
FT   gene            604020..605459
FT                   /locus_tag="Rxyl_0575"
FT   CDS_pept        604020..605459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0575"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: pae:PA0287
FT                   probable sodium:solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03547"
FT                   /db_xref="GOA:Q1AYI1"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYI1"
FT                   /protein_id="ABG03547.1"
FT                   /translation="MNGVIDYLMIIAYFALMLAAGYWGYRRAKTADDFLVAGRRLGPVM
FT                   YLGTLSATTLGGASTIGGVALGYQFGVSGMWLAAMIGLGAAALSLLFSSRLANLGIISF
FT                   SDVLELRYRRAAGLFGALVMGVYEVMVVVTQVLAIGTLFDVVLGLSPTLAIVAAGGIVL
FT                   LYSVAGGMWAITLTDIIQFVVMTVGIFFLLLPLALSQAGGLGGLRAELPASYFDLTAIG
FT                   GQTILAYFLSFFLGIMIGQETWQRVFTARSGSVARWGGLLTGLYCVAYAFAGALVGCAA
FT                   RVLLPDLANPDNAFAQVATTVLPVGVQGLVLAAALAAVMSTASACLMAASTVLANGVYA
FT                   HFFAGRETAGVALNRLIMLLVGVAALVLAVIVGDVVGALSVAFALLVSATFVPIVGALY
FT                   WRRATGAGALAAIAAGSVVALAFIFTQGIHSNAAIIFGLLASLVAFVGVSLLTPPPSPR
FT                   RLEEWERRMEEPAVARGGGLS"
FT   gene            605484..607013
FT                   /locus_tag="Rxyl_0576"
FT   CDS_pept        605484..607013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0576"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="KEGG: nfa:nfa12280 putative histidine ammonia-lyase;
FT                   TIGRFAM: histidine ammonia-lyase; PFAM:
FT                   phenylalanine/histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03548"
FT                   /db_xref="GOA:Q1AYI0"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYI0"
FT                   /protein_id="ABG03548.1"
FT                   /translation="MAAGAVLVDGLDFGGVIAVARRGARVGVSPAARERVRRFRAHVER
FT                   ASGSEEAVYGVTTGFGALATVRIPAGERRELQHAILRSHAAGMGPFVEPEVVRAMMLIR
FT                   AKTLAMGHSGVRPELLDALVALLNSGVVPAVPEHGSLGASGDLAPLAHAALCLTGEGWA
FT                   LEGGEAVPAREALARAGLEPVRLEAKEGLALVNGTDGMLAVLVLALEDLGLLLKTADVT
FT                   AAMSIEALLGTDRVYREELHALRPHPGQLASARNIHRLLQDSPIVASHRESPHLVQDAY
FT                   SLRCTPQVCGAARDTLAFAEEVARRELASTTDNPLVLEDGSVESCGHFHGEPLAFALDF
FT                   LAVAAAEVGAIAERRTDRMLDPARSQGLPPFLVPRAGTNSGFMVAQYTAASLAEENRRL
FT                   AVPASTGSLPTSAMQEDHVSMGWSAGLKLRRVLRNLARILAVEAVCAAQALDLRSPLEP
FT                   APATGAVRERIRREVPFVERDRFLAAHLRAAEGLVLSGALVEAANEMVEQR"
FT   gene            607231..608235
FT                   /locus_tag="Rxyl_0577"
FT   CDS_pept        607231..608235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0577"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   sco:SCO2931 putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03549"
FT                   /db_xref="GOA:Q1AYH9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYH9"
FT                   /protein_id="ABG03549.1"
FT                   /translation="MPRSSCQGCISERTGDAMIEFRGVTKTYPGSERPAVENLSFEVPE
FT                   GEICVLVGPSGCGKTTTMRMINRLIEPTEGEILIGGEPNTRISGTELRRKIGYAIQQIG
FT                   LFPHRTIAENVGTVPSLLEWDRERIRRRVDELLELVGLDPAGFRDRYPAELSGGQQQRV
FT                   GVARALAADPPIMLMDEPFGAVDPITRERLQDEFLKIQQDIKKTIVFVTHDIDEAIKLG
FT                   DRIAILKEGGTLAQYDSPENILTSPASEFVASFVGADRVLKRLSLTRLEEVELDPPRGN
FT                   GGLPRLPEQASLKDALSEMIGSGAERVLVLSGDGGVRGSLSLDGLRRLSGRAG"
FT   gene            608239..608946
FT                   /locus_tag="Rxyl_0578"
FT   CDS_pept        608239..608946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0578"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ava:Ava_2960
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03550"
FT                   /db_xref="GOA:Q1AYH8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYH8"
FT                   /protein_id="ABG03550.1"
FT                   /translation="MEPAPASLALLQRLEPRIMDWAWVRENFAEDILPALVGHIYLSGV
FT                   SLAIALAVSLPTGVLVARYRKAYPPVVFLAGLLFTIPSLALFAILVTIPGVGIGPNAVI
FT                   IALVAYSILVLVRNTVAGLDSVPPETIDAARGMGLTPRQILFKVELPLALPVIVAGVRI
FT                   ATVTVIGIATIGAYIAGGGLGQLIFDGIDRLFPTMIIAGAALATALAVAADVVLSSLER
FT                   YLRPWAQRGKRAA"
FT   gene            608947..609600
FT                   /locus_tag="Rxyl_0579"
FT   CDS_pept        608947..609600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0579"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cya:CYA_2571 quaternary
FT                   amine ABC transporter (QAT) family, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03551"
FT                   /db_xref="GOA:Q1AYH7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYH7"
FT                   /protein_id="ABG03551.1"
FT                   /translation="MSGVLEVFARPSFFVKLATHVELSMISLIIAIAIALPTAFAVRNT
FT                   QIGTAIAINAGNVGRAVPSLALLALALPFLGFGFAPSLVALTALAVPPILINATTGLRE
FT                   VSGEVVDAARGMGLSEAQILRDIQLPMAAPVVFAGVRTSAVQVVASATLATFIGGGGLG
FT                   DLIVEGFQSGDSSILLAGAFSVAILAIITEIIFEILEKVFTPKGLKLAQKKRGR"
FT   gene            609626..610591
FT                   /locus_tag="Rxyl_0580"
FT   CDS_pept        609626..610591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0580"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: cyb:CYB_0579 quaternary
FT                   amine uptake ABC transporter (QAT) family, periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03552"
FT                   /db_xref="GOA:Q1AYH6"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYH6"
FT                   /protein_id="ABG03552.1"
FT                   /translation="MKNNTRPIQAVLVLLTPFALAIVFLVACGNVGESGGSGPGAGEGG
FT                   GPAITVGSKNFTEQYILGNMYALALEDAGFKVERRLNLGSEQIADRALQNGQIDLYPEY
FT                   TGTALAAVLDYEGDPAQLDTPEQTYQRAKELYAGRDPADTMLRPAPFNNTYAIFVRREA
FT                   AKRYDLRTLEDLAEASPNLVFVSFSEFQHREDNFKNMKENYNFDFKDVEIVNSIGLRYQ
FT                   GVLQGEGDVGVGFTTDGQLASDRLVVLEDPKSIWPFYQPAPVVRTEVLEKNPKIREVLN
FT                   EVSASLDVETMRRLNGRVDLQKEDPEDVAREYLEREGLIK"
FT   sig_peptide     609626..609709
FT                   /locus_tag="Rxyl_0580"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.603 at
FT                   residue 28"
FT   gene            610588..612075
FT                   /locus_tag="Rxyl_0581"
FT   CDS_pept        610588..612075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0581"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="PFAM: phenylalanine/histidine ammonia-lyase; KEGG:
FT                   sma:SAV3504 putative histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03553"
FT                   /db_xref="GOA:Q1AYH5"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYH5"
FT                   /protein_id="ABG03553.1"
FT                   /translation="MISSHSTVTLDGASLTPKAVARVARESCPVALAPEARERNEIAYR
FT                   ISLDLTKSNTPVYGLNTGVGSLRSIKIPPELQNDYQRRLLRSHAIGAGKPVPDSIVRAM
FT                   LVVRANQLAAGGAGVHPALLDSLVEVLNKNLVPEIRELGSLGTGDLTSLAEVGLALLGE
FT                   RPFRNGKRNSSTPLGPRDGLMLMSSNAHAIGESALCAVDLNQLTSSLEACAAISFEAAR
FT                   ANSKALDERVHAARPYPGQIAAAAHLRALLEGYVPKSFRLQDSYAFRCLPQVQGALRDA
FT                   LSHLASILQIELNSASENALLVDGEALTTGNFHAVQLSSTLDHVRNTASQAASLSAART
FT                   SALMSPEITGLNPFLAEEPGPDSGLMALEYTANSAVGELRILAAPAAAHSAAFISHGVE
FT                   NHASLASLSARKTTRAVHLLSVVAATELVTAVRAIRMRGEPPVGRGAREAFEISASILS
FT                   PDIADRYLTGDLDNAINLVLKGEFLPNISTTQGVEAS"
FT   gene            612077..613294
FT                   /locus_tag="Rxyl_0582"
FT   CDS_pept        612077..613294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0582"
FT                   /product="Amidase, hydantoinase/carbamoylase"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: gka:GK3252 N-carbamoyl-L-amino acid
FT                   amidohydrolase; TIGRFAM: Amidase,
FT                   hydantoinase/carbamoylase; PFAM: peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03554"
FT                   /db_xref="GOA:Q1AYH4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYH4"
FT                   /protein_id="ABG03554.1"
FT                   /translation="MDIKRVRERLEELFALAPDPRGGATRLAYSPEEARAMRLVAGWLE
FT                   EAGLSARLDRFGNLWGLPPAGGRLVTGGSHVDTVPNGGRLDGALGTVLAVEAAGELEGP
FT                   FGVLVCAGEEAPRFGAGTLGSRQLAGRLGEAELARMRDRDGVSALAAREEFLRLLRDIP
FT                   RLEEPDPLSRVAAHLEVHVEQRRWLGERGASVGIATAVAGPERYRLLLSGQSGHSGEAR
FT                   MPERRDALCAAAEVILLVEGAARKASSTVATVGTVRVEPGSLTAVPGRVELGLDVRGTD
FT                   PGEAGELVRLVLERGRGICARRGVSFSARRLSRAAPVALDEGVVGLAERVARREGIPAA
FT                   RCVSFAGHDVQHLARRVPAALLFAASSNGVSHAPGEEVGEEDLERTYRMARALMPELAR
FT                   EYGGER"
FT   gene            613291..614955
FT                   /locus_tag="Rxyl_0583"
FT   CDS_pept        613291..614955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0583"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="KEGG: sth:STH3193 urocanase; TIGRFAM: urocanate
FT                   hydratase; PFAM: Urocanase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03555"
FT                   /db_xref="GOA:Q1AYH3"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1AYH3"
FT                   /protein_id="ABG03555.1"
FT                   /translation="MTDGKTTTVRAPRGTELSCKGWHQEGALRMLMNNLDPEVAERPEE
FT                   LVVYGGTGKAARSWECFWAIVEALRGLDGDETLLVQSGKPVAVFRTHPWAPRVLIANSL
FT                   LVPEWADWETFRELERAGLTMFGQMTAGSWIYIGTQGILQGTYETFAALAEQRFGGTLR
FT                   GRVCLTAGLGGMGGAQPLAITMNEGVALCVEVDPRRIDRRLEHRYLDERIDDLDAAVER
FT                   AEEARREGEPLSIGIPGNAAEVFPALLERGYVPDAVTDQTSAHDPLGGYIPAGYTLEEA
FT                   AELREADPGRYVREARASMARHCAAMVGFMERGAEVFDYGNNLRGEARLGGFERAFSYP
FT                   GFVPAYIRPLFCEGKGPFRWAALSGDPDDIAATDEAVLELFPENGRLVRWIRQARERVR
FT                   FQGLPARICWLGAGERHRAGLRFNELVAGGTISAPIVIGRDHLDSGSVASPYRETEGMR
FT                   DGSDAIADWPVLNALLNTASGASWVAVHHGGGVGIGKSIHAGAQVVVDGTEEGAARIER
FT                   VLTNDPSLGVVRHADAGYERAREAARALGIRMPMLGR"
FT   gene            614952..616214
FT                   /locus_tag="Rxyl_0584"
FT   CDS_pept        614952..616214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0584"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: ade:Adeh_0569
FT                   formiminoglutamate deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03556"
FT                   /db_xref="GOA:Q1AYH2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010252"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYH2"
FT                   /protein_id="ABG03556.1"
FT                   /translation="MRRTLLPDLVLDARGARPGVGVTIEGGRVVSVGPAAEGERLPGRA
FT                   LAPGFANAHSHAFQRGLRGGVERRDPAHPRDDFWTWRERMYALAGSLDPASLREASERC
FT                   YREMLSAGYTSVAEFHYLHHRPDGAPYEDPNALAKAVAAGAEAVGMRLLLLPAAYARGG
FT                   LSRFRDASAGEFLARVEELRAWAEGHPLVEVGLAAHSVRAVPRGWLEEIGEHARGRSLP
FT                   LHVHACEQPREVEECRREHGLRPVELLAEAGFLGPGTVVVHATHASEGELDLLAERGAG
FT                   VCACPTTEGNLGDGFLPAEGLLRRGIGLSVGSDSHVRVDPFEELREIETNARRLSGRRN
FT                   VLVPEGEGSPTPWLLRAGWGREGISAGDPADLVEIDLGHPALADVEPEDLPSALVFGAG
FT                   SGVVCGAWVAGRRVYPEGGGA"
FT   gene            616211..617458
FT                   /locus_tag="Rxyl_0585"
FT   CDS_pept        616211..617458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0585"
FT                   /product="imidazolonepropionase"
FT                   /EC_number="3.5.2.7"
FT                   /note="KEGG: sth:STH3191 imidazolonepropionase; TIGRFAM:
FT                   imidazolonepropionase; PFAM: amidohydrolase Amidohydrolase
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03557"
FT                   /db_xref="GOA:Q1AYH1"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1AYH1"
FT                   /protein_id="ABG03557.1"
FT                   /translation="MSGTTLLIHDLEAAVSPKGSGPLRGRDLGELEVCSPASIAVSGDR
FT                   IAAVGPPGEVLRDHPPGPGCETVDGRGKAALPGLVDCHTHAAFLGDRADEFELRCRGAG
FT                   YEEIHASGGGILSTVRATRAGSEEELRAATERHLDWLLRHGTTTAEVKSGYGLDREAEL
FT                   RLLRAIRAAGDAHPVDVRPTFLGAHTVPPEFSGAAEYVEFVVAEVLPEAAPLAEAADVF
FT                   VERGSFEVPEARRYLEACAGYGLALRLHADQFSERGAVPLAVELGARSADHLESTGGEG
FT                   VRALGQSATAAVLLPACALFLGLPDPPARALLEAGAIVALATDFNPGSSFCSSLPVVLN
FT                   LACTRLGLSPAEALCAATANAAYVLGLEGEVGRLSAGYRADILLLDAPDWRYIAYHLGG
FT                   DHLAAVVKSGGLLPPG"
FT   gene            617974..618378
FT                   /locus_tag="Rxyl_0586"
FT   CDS_pept        617974..618378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0586"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix motif protein of unknown
FT                   function UPF0150; KEGG: ava:Ava_1938 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03558"
FT                   /db_xref="GOA:Q1AYH0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYH0"
FT                   /protein_id="ABG03558.1"
FT                   /translation="MGPKLRQLRRQMGWSQHELARRSGVDRATISAIESGKRDPSGSTM
FT                   RKLADALGVPVAELYKEPLEQLTAIYERTDDGWWIVEVPEIPGAVSQGRTLEEARFMIR
FT                   DAVRLLLEARRELAEQEHEGHEVIREPLTL"
FT   gene            618375..618563
FT                   /locus_tag="Rxyl_0587"
FT   CDS_pept        618375..618563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0587"
FT                   /product="YcfA-like protein"
FT                   /note="PFAM: YcfA-like; KEGG: rba:RB3259 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03559"
FT                   /db_xref="GOA:Q1AYG9"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYG9"
FT                   /protein_id="ABG03559.1"
FT                   /translation="MKRRQLLKHLAAHGVVLAREGANHSIYRDPRTGATVPVPRHAEIS
FT                   DALVRRICKEIGIPPPG"
FT   gene            618751..619429
FT                   /pseudo
FT                   /locus_tag="Rxyl_0588"
FT   gene            complement(619467..619540)
FT                   /locus_tag="Rxyl_R0006"
FT                   /note="tRNA-Arg4"
FT   tRNA            complement(619467..619540)
FT                   /locus_tag="Rxyl_R0006"
FT                   /product="tRNA-Arg"
FT   gene            619658..620347
FT                   /locus_tag="Rxyl_0589"
FT   CDS_pept        619658..620347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0589"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver transcriptional
FT                   regulatory protein-like; KEGG: sth:STH750 two-component
FT                   response regulator, probably involved in phosphate sensing"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03560"
FT                   /db_xref="GOA:Q1AYG8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYG8"
FT                   /protein_id="ABG03560.1"
FT                   /translation="MSGSILLVIGDDEERLRLRRALHGEGWRVLPAGTGAQARQIAGRE
FT                   DFEVAVVDNRLPDERGFQVISAVQKPDVATVALLHDEDTMDRIVGIELGADYYMRSPVN
FT                   PRELVARVKQIFRKRERAAGEPSGKVYVGDLEIDPEQIRVTKGGREVMLSPREFKLLYT
FT                   LARSPGRVFPRGTLLRQVWGEDEYIDERTVNVYVQRLRNKLGDDPSDPKLIETVRGFGY
FT                   RLVRPEG"
FT   gene            complement(620344..620970)
FT                   /locus_tag="Rxyl_0590"
FT   CDS_pept        complement(620344..620970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0590"
FT                   /product="protein of unknown function DUF305"
FT                   /note="PFAM: protein of unknown function DUF305; KEGG:
FT                   tfu:Tfu_0639 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03561"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYG7"
FT                   /protein_id="ABG03561.1"
FT                   /translation="MKRLSREDLAPPAVTLLALALALLAFVLYLQGRPPGEGSAEAGFA
FT                   RDMSVHHAQAVEMAGIVRDKTRDPAIRTLATDITLTQQAQIGQMHGWLAAWGLPLTGTG
FT                   PPMAWMGHAGRMPGMATPEQINRLRDAPPEEADRLFLRLMIEHHRGAIPMAEAALERTD
FT                   RPEVERLAGAILRSQRGEIRLMQQMLRERGGEAPARPHAGRHRGG"
FT   sig_peptide     complement(620872..620970)
FT                   /locus_tag="Rxyl_0590"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.989) with cleavage site probability 0.516 at
FT                   residue 33"
FT   gene            complement(620967..621626)
FT                   /locus_tag="Rxyl_0591"
FT   CDS_pept        complement(620967..621626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0591"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03562"
FT                   /db_xref="GOA:Q1AYG6"
FT                   /db_xref="InterPro:IPR021454"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYG6"
FT                   /protein_id="ABG03562.1"
FT                   /translation="MNGTTAPRRLRASISGGTKSYTAERFGALGRIRREPRGGGRMNAV
FT                   YLVAGGIVLALIVAFAVFAVLDSRRGGGEIAGVRSYDVGPGNRHTRGEVDYEQTPPAGG
FT                   VHSPVWQNCGFYEEPVRDENAVHSLEHGAVWITYRPDLPREQVERLRELARSQTYVLVS
FT                   PYPGLPAPVVASAWGKQLRLDSAEDGRLEQFVRAYRQGPQTPEPGAACTGGVGEPS"
FT   gene            complement(621638..622051)
FT                   /locus_tag="Rxyl_0592"
FT   CDS_pept        complement(621638..622051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0592"
FT                   /product="protein of unknown function DUF1232"
FT                   /note="PFAM: protein of unknown function DUF1232; KEGG:
FT                   mca:MCA1269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03563"
FT                   /db_xref="GOA:Q1AYG5"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYG5"
FT                   /protein_id="ABG03563.1"
FT                   /translation="MRKKGGRMGVAFGRLKGWARRMKAEVHALYLAYRDPRTPPHARLF
FT                   AALVVAYAFSPIDLIPDAIPVLGHLDDVILVPLGVALAVRMIPPHVLAECRKKARERGA
FT                   EVRPAAWAGAAVVAALWLLLLALAAVLLARGVP"
FT   gene            complement(622067..624202)
FT                   /locus_tag="Rxyl_0593"
FT   CDS_pept        complement(622067..624202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0593"
FT                   /product="Heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type,
FT                   K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter Heavy
FT                   metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Heavy
FT                   metal translocating P-type ATPase; PFAM: Haloacid
FT                   dehalogenase-like hydrolase Heavy metal
FT                   transport/detoxification protein E1-E2 ATPase-associated
FT                   region; KEGG: gka:GK0750 cation-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03564"
FT                   /db_xref="GOA:Q1AYG4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYG4"
FT                   /protein_id="ABG03564.1"
FT                   /translation="MARRELPVLGGGRPAPPGARRTVLRVEGMDCAACAASVERSVGRL
FT                   PGVYRATVNFAAGRLDAEHDGSVSREMLEGAVRAAGYRVAGPRREARGALWREARFALT
FT                   GGAALLFAAGAALQLAGGPGAARISLYAAAIAVGGGPIFRAALAALRARSMDMNVLMSA
FT                   AVFGAAGIGAWGEAALVVVLFAAGGSLQAYAVRRTRGAVRALARLVPEEVLVRRDGAER
FT                   AVPAGEVGVGELVVVRPGERFAVDGEVVEGRTSVDESPVTGESAPVEKGPGDAVLSGSL
FT                   NGAGAVLVRAVRRAEDSTLQRVARLVEQAQASRAPAERFVDRFSRVYTPLVVAAAVALA
FT                   TAPPLLGGDFGTWFYRALALLVIACPCSLVISTPVTVVSGIGAAARRGVLVKGGEALEA
FT                   AGGLRALLFDKTGTLTEGRPVLERVLALRGTREEALALAAALERRSEHPLAHAMLSAAG
FT                   ERPLPEVAGFRSIPGRGAEGEVRGRRYTVGSPALFAERGVSLEAALPALREVERAGETP
FT                   VVLGDGAGPIAVFGLADAVRPEAPEAIRALREEGVEELVMLTGDAEAPARRVAGLLGIG
FT                   YRARLRPEEKVAAVRERVARHGAAGMVGDGVNDAPALAAASVGFAMGAAGSDAALEVAD
FT                   VALMHDDLRRLAGAVRLSRAARRAIKQNILASVLVKGLFVALAPFGLVTLWLAVLADMG
FT                   TSLGVTLNGLRLFAGRW"
FT   gene            complement(624251..625195)
FT                   /locus_tag="Rxyl_0594"
FT   CDS_pept        complement(624251..625195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0594"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG: sma:SAV7048
FT                   putative cation efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03565"
FT                   /db_xref="GOA:Q1AYG3"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYG3"
FT                   /protein_id="ABG03565.1"
FT                   /translation="MTHANGHAEGHGREADRRSLAAALAITASYTVAEAVGGFLTGSLA
FT                   LLADAAHMLSDNFSLGLALFALWLSSRPPTPERSFGYKRAEILAALFNGVTLVAVSLWI
FT                   FYEAYRRLLEPREVMGGWVAAVAAAGLLVNAAAAWVLLRPRSESLNLQGALRHVLADLL
FT                   GSLGVLVSGMVVLLTGWYPADPLVSAAIGLLILASSWRLLRDSVNILLEAAPHGMDAAE
FT                   IGRRMASTSGVAEVHDLHVWTITSGFPALSAHVLVAAGEDCHAKRRELEQLLREEYGIS
FT                   HTTLQVDHAGDHAAHGPRFLPLRPKRKTRSPHT"
FT   gene            complement(625238..625615)
FT                   /locus_tag="Rxyl_0595"
FT   CDS_pept        complement(625238..625615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0595"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: dra:DRA0071
FT                   transcriptional repressor SmtB"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03566"
FT                   /db_xref="GOA:Q1AYG2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYG2"
FT                   /protein_id="ABG03566.1"
FT                   /translation="MGGETRQAENLSTCEETGIHPQQVSEALSGMPKPAEIRGASELLK
FT                   AVGDPTRMRILCALADRELCVCDLQAVLGLSQSAVSHQLRTLRNARLVTYRREGKMAYY
FT                   TLADDHVRRLLDLSLEHVRHA"
FT   gene            complement(625625..626515)
FT                   /locus_tag="Rxyl_0596"
FT   CDS_pept        complement(625625..626515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0596"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG: mbo:Mb2050c
FT                   possible conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03567"
FT                   /db_xref="GOA:Q1AYG1"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYG1"
FT                   /protein_id="ABG03567.1"
FT                   /translation="MRDRDALEASEQGIRAVKLSFAVLALTAVLQLAVALVSGSAALLA
FT                   DTAHNFGDALTALPLWLAFALSRRPPSRTHTYGYGRAEDLAGAAIVGIILLSALVCGYE
FT                   SATKLLEGSGVRGAGWVALAAAAGFAGNELAARLRISVGRRIGSAALVADGQHARTDGL
FT                   TSLAVLAGAAGAWLGYPVVDPLVGLGITAAILHIVRDSARPVWRRLMDAVEPGTVEALE
FT                   EAASGMPEVLRVEEVRARWTGHSLQAEVRVRVEPDLPAGRLGDLSGRLAAAARKRLPRL
FT                   ERVLLEPVPDRPGDV"
FT   gene            complement(626512..626940)
FT                   /locus_tag="Rxyl_0597"
FT   CDS_pept        complement(626512..626940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0597"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   pab:PAB0452 virR related"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03568"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYG0"
FT                   /protein_id="ABG03568.1"
FT                   /translation="MSGRVELSPIGYVRTRPGRVPRSWTTSGVEGVLEVLPEYAEGLRD
FT                   LREGERILVVFHFHQSPPFGPEHLRQTPPHREGPVGVFSTCSPLRPNPVGVSVLEVLGV
FT                   EGRCVRVRGLDMLDGTPVLDIKPHVAADPSHPCRRERA"
FT   gene            complement(626937..627449)
FT                   /locus_tag="Rxyl_0598"
FT   CDS_pept        complement(626937..627449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0598"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bha:BH1868 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03569"
FT                   /db_xref="GOA:Q1AYF9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYF9"
FT                   /protein_id="ABG03569.1"
FT                   /translation="MRELRTRRLRLRPFERKDLAALARIASEEETRGFLCDGERGPGEV
FT                   REALEGWLESYREGFGQLAMILQEGGRLIGHCGLERRGERAVLSYALHKDHWCRGLAPE
FT                   ACREVLRYGFEELGLEEVWTATRPENRAWRGMMERLGMGLREEGPGEVRYAVSRGAFLR
FT                   RPAAAGA"
FT   gene            complement(627473..627859)
FT                   /locus_tag="Rxyl_0599"
FT   CDS_pept        complement(627473..627859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0599"
FT                   /product="transcriptional regulator, TrmB / transcriptional
FT                   regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, MarR regulatory protein,
FT                   ArsR transcriptional regulator TrmB; KEGG: nfa:nfa31050
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03570"
FT                   /db_xref="GOA:Q1AYF8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYF8"
FT                   /protein_id="ABG03570.1"
FT                   /translation="MTHFRDAPAGERLLEPRDVLAGGPFPGVDERVAALMGALASPTRL
FT                   RALFALLESGELSAGELSKAVGMRPSATSHQLRVLRDLGLVRRRREGRRCYYSLADAHL
FT                   GVLLREALYHVDHARLGAARREER"
FT   gene            complement(627891..628547)
FT                   /locus_tag="Rxyl_0600"
FT   CDS_pept        complement(627891..628547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0600"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11 Methyltransferase
FT                   type 12; KEGG: rpa:RPA0555 possible methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03571"
FT                   /db_xref="GOA:Q1AYF7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYF7"
FT                   /protein_id="ABG03571.1"
FT                   /translation="MSGRSGKRPAARGPLALIPAALALLAAGYALRARRRPAACPYRYR
FT                   LAVSLPRPFLTRGRLRRALSPSPGERLLEVGPGTGYYALHAARWVAPGGTLHVLDLQQQ
FT                   MLDHTTRAAAAENLGNIIPARGDAQSLPYPEGHFDAAYLVATLGEIPDQDRALRELRRV
FT                   LRPGGRLVVGELLPDPHMVPLATLRARAAAAGLRYEGRLGTRLGYYARFSVPEEI"
FT   sig_peptide     complement(628467..628547)
FT                   /locus_tag="Rxyl_0600"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.930) with cleavage site probability 0.806 at
FT                   residue 27"
FT   gene            complement(628534..629619)
FT                   /locus_tag="Rxyl_0601"
FT   CDS_pept        complement(628534..629619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0601"
FT                   /product="PDZ/DHR/GLGF"
FT                   /note="PFAM: peptidase S1 and S6, chymotrypsin/Hap
FT                   PDZ/DHR/GLGF; KEGG: fra:Francci3_1988 peptidase S1 and S6,
FT                   chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03572"
FT                   /db_xref="GOA:Q1AYF6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYF6"
FT                   /protein_id="ABG03572.1"
FT                   /translation="MIGRYRITLAAAAALLAALLLAGACSEENARQPHAPDQSAAQAAQ
FT                   NIPQDEPVARVAAKVEPSVVQVNTRAIQLTPFGPESQSGVGSGVIYREDGYIITNNHVV
FT                   EGADEVNVAFADGSTERGRVVGSDPRTDIAVVKVDRDSLPAAAFSDAEPVVGQLAVAIG
FT                   SPSGFESTVTAGVVSGLDREIPPQLTGTGYQIPSLTGLIQTDAAISPGSSGGALANRSG
FT                   EIIGINVAYLPPQTGAESIGFAIPASVATSVADQLIESGEVRAPFLGIVPVDLTSQEAE
FT                   LYGLEVTSGALVARVEPGSPADEAGLRRGDIIVALDGTEIRSSGDLYSALRDYRPGDEV
FT                   RLTVVRNGERQRIEVTLGERP"
FT   sig_peptide     complement(629539..629619)
FT                   /locus_tag="Rxyl_0601"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.559 at
FT                   residue 27"
FT   gene            629697..630053
FT                   /locus_tag="Rxyl_0602"
FT   CDS_pept        629697..630053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03573"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYF5"
FT                   /protein_id="ABG03573.1"
FT                   /translation="MYPQGVGAETGTKRFPAELARAGEARHHIAWLAAAAGLRGEALHG
FT                   LAVAAEALLTDVLLGSDGGVMEVFARSEGGLLRIEISHPTATGRVRGLEAVLERFLDGH
FT                   ELSPERSVLVKRLG"
FT   gene            complement(630050..630328)
FT                   /locus_tag="Rxyl_0603"
FT   CDS_pept        complement(630050..630328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03574"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYF4"
FT                   /protein_id="ABG03574.1"
FT                   /translation="MGIRDFIRYLEEHRERLRSGEEIPAEERSEMLKQAEMMVGMAEAA
FT                   IKELDSVLRNRRINLPEEHAVRFAQDVFRHLRDEEEKVKRRLRALSP"
FT   gene            complement(630352..631794)
FT                   /locus_tag="Rxyl_0604"
FT   CDS_pept        complement(630352..631794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0604"
FT                   /product="oxidoreductase/nitrogenase, component 1"
FT                   /note="PFAM: oxidoreductase/nitrogenase, component 1; KEGG:
FT                   cte:CT2151 protochlorophyllide reductase, ChlB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03575"
FT                   /db_xref="GOA:Q1AYF3"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYF3"
FT                   /protein_id="ABG03575.1"
FT                   /translation="MRLLRGVYEGPSAHGILHLAASVRGAQAVLRALPGENYFPAFYAD
FT                   RRRDGSLPPLTLSPMWRRPDDTRAPGELQRDLLRAAGRDGGVRNVLLARSEAALLSGEE
FT                   PPGELTLPPHPETGRSPRLLPCGWQVPGMGETEAAELALEDLVRAHAAPQPRTAEPTAN
FT                   LFGPLALGRDAEAEYAEAERLLGLMGVGVNARVPLGAGEEELSRLTRAWVNVVLYREVA
FT                   ESATLYLQDEFGIPRVTTPMVGTSGTGAALRAAARVCELEARTVRQAIWGELSRTAKLP
FT                   WYARLAPPEVFEDKSVFIFGDFTYALGLGYALSREVGLRVAGCGTYLTHLARDFAFHAS
FT                   TFTDAAFASDDPEEVARRIEGAAPDLLVGTELEREVAGSLGIPFLPFCPPAGERSFAPR
FT                   PLMGYAGSSVLADALDGALRRVEEPREEAGPPEIPWTEEALEELAGVPVFLRGRARRLA
FT                   EERARELGSPEVTRAIFLESRL"
FT   gene            complement(631791..633134)
FT                   /locus_tag="Rxyl_0605"
FT   CDS_pept        complement(631791..633134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0605"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cyb:CYB_1013 light-independent
FT                   protochlorophyllide reductase, N subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03576"
FT                   /db_xref="GOA:Q1AYF2"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYF2"
FT                   /protein_id="ABG03576.1"
FT                   /translation="MTVLNESGVPDVLPPLGAAGGLAERLPGLLVVVAGTRSEAHLLRC
FT                   VPPPPAPGTFPPPRSPRVLSLVLDPEDPPEQGRVASGTVEAAAGFRGLEAVLLVAGRSA
FT                   RRLGVDAGLEARLAARRLELPVLAVDPDEPYPVPGVLATDLEDRALAALAGLCPEGKAG
FT                   VPARREEGGAAKGGGLLASLLGRGGGEERREPLRRPVVLLGAVHSPGSGREVASELARD
FT                   GVEVAGSLPPGGPWELPPLGEGTLVAALDPNLGAALEAAGRRGAGVVRTLCPIGVDGTA
FT                   RFIQEVADAAGSTTSELGRARAVWQELQPLRNRIRGKRIFFAGDTGLEVPLARFLADAG
FT                   AVVLEVGAPRLDRRLLSEELRALGPDVDVVESPDWRGQLERIERSRPDLVVASPGLYAA
FT                   LVARGQLCRCSRDFLRLGVHGYGGARRVLEFLVRALDRAEALDSATNL"
FT   gene            complement(633196..633906)
FT                   /locus_tag="Rxyl_0606"
FT   CDS_pept        complement(633196..633906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0606"
FT                   /product="purine-nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /note="PFAM: purine and other phosphorylases, family 1;
FT                   KEGG: ttj:TTHA1435 purine nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03577"
FT                   /db_xref="GOA:Q1AYF1"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYF1"
FT                   /protein_id="ABG03577.1"
FT                   /translation="MPVHVRAEPGDFAESVLLPGDPLRAEYIARTFFESPRLVTRERGM
FT                   LGYTGSYRGRPVSVQATGMGCPSAAIVVEELVQLGARNLLRVGTCGGYHRELQLGDLVV
FT                   ATAAAPQDGTVSSLTRGVPYAPAAHFDVVHAAYHAAERSGRRTFMGPVVSSDLFYDPVE
FT                   DPAGLWSRLGVLAVEMEAAAIFTIAAMRGARAGCLLTVSDTIGEEVVRISDEDLRAAVD
FT                   NMVELALDTLHGLN"
FT   gene            complement(633965..635230)
FT                   /locus_tag="Rxyl_0607"
FT   CDS_pept        complement(633965..635230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0607"
FT                   /product="thymidine phosphorylase"
FT                   /EC_number="2.4.2.4"
FT                   /note="TIGRFAM: Pyrimidine-nucleoside phosphorylase; PFAM:
FT                   glycosyl transferase, family 3 Pyrimidine nucleoside
FT                   phosphorylase-like; KEGG: dra:DR0443 pyrimidine-nucleoside
FT                   phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03578"
FT                   /db_xref="GOA:Q1AYF0"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYF0"
FT                   /protein_id="ABG03578.1"
FT                   /translation="MSDILEAIERKKRGGELPEPLIRSVVSGYTAGEIPDYQMAALLMA
FT                   IFIRGMSYGETLALTRAMADSGRRYSFPECVDKHSTGGVGDKVSLTALPLAAACGAPVA
FT                   KLSGRGLGITGGTVDKLESIPGLSCALTEERFRRQVEEVGLAIAEAGELAPADRAIYAL
FT                   RDATGTVDSLPLIGSSIVSKKAATGAGHLLYDVKCGSGAFMRTRREARELAGLLVRLSA
FT                   DLGIRASAVISDMSHPLGRAVGNALEVRESLRFLRGEGAPEDLAAVARAVAVRLLELKG
FT                   VPEPERAVERALASGQAYELFARFVRAQGGDEGALERLPLSPRVREVRSPAAGHVERFD
FT                   ALGVGRAALLLGAGRRKKGDPVDHGAGVELLVGPGERVEEGQAVARLYGDRDAERAAGL
FT                   VAGALRLSPEPAPPPPAILDSL"
FT   gene            complement(635227..637164)
FT                   /locus_tag="Rxyl_0608"
FT   CDS_pept        complement(635227..637164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0608"
FT                   /product="peptidase S9, prolyl oligopeptidase active site
FT                   region"
FT                   /note="PFAM: peptidase S15 peptidase S9, prolyl
FT                   oligopeptidase active site region; KEGG: cyb:CYB_2016
FT                   peptidase, S9C (acylaminoacyl-peptidase) family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03579"
FT                   /db_xref="GOA:Q1AYE9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYE9"
FT                   /prot