(data stored in ACNUC7421 zone)

EMBL: CP000388

ID   CP000388; SV 1; circular; genomic DNA; STD; PRO; 5187005 BP.
XX
AC   CP000388; AAKP01000000-AAKP01000084;
XX
PR   Project:PRJNA13454;
XX
DT   29-JUN-2006 (Rel. 88, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 9)
XX
DE   Pseudoalteromonas atlantica T6c, complete genome.
XX
KW   .
XX
OS   Pseudoalteromonas atlantica T6c
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Pseudoalteromonadaceae; Pseudoalteromonas.
XX
RN   [1]
RP   1-5187005
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Saunders E., Brettin T., Bruce D., Han C., Tapia R., Gilna P., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Kim E., Karls A.C.,
RA   Bartlett D., Higgins B.P., Richardson P.;
RT   "Complete sequence of Pseudoalteromonas atlantica T6c";
RL   Unpublished.
XX
RN   [2]
RP   1-5187005
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Saunders E., Brettin T., Bruce D., Han C., Tapia R., Gilna P., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Kim E., Karls A.C.,
RA   Bartlett D., Higgins B.P., Richardson P.;
RT   ;
RL   Submitted (15-JUN-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 86b682546d5670d5d95486486b19b059.
DR   BioSample; SAMN02598305.
DR   EnsemblGenomes-Gn; EBG00001204840.
DR   EnsemblGenomes-Gn; EBG00001204841.
DR   EnsemblGenomes-Gn; EBG00001204842.
DR   EnsemblGenomes-Gn; EBG00001204843.
DR   EnsemblGenomes-Gn; EBG00001204844.
DR   EnsemblGenomes-Gn; EBG00001204845.
DR   EnsemblGenomes-Gn; EBG00001204846.
DR   EnsemblGenomes-Gn; EBG00001204847.
DR   EnsemblGenomes-Gn; EBG00001204848.
DR   EnsemblGenomes-Gn; EBG00001204849.
DR   EnsemblGenomes-Gn; EBG00001204850.
DR   EnsemblGenomes-Gn; EBG00001204851.
DR   EnsemblGenomes-Gn; EBG00001204852.
DR   EnsemblGenomes-Gn; EBG00001204853.
DR   EnsemblGenomes-Gn; EBG00001204854.
DR   EnsemblGenomes-Gn; EBG00001204855.
DR   EnsemblGenomes-Gn; EBG00001204856.
DR   EnsemblGenomes-Gn; EBG00001204857.
DR   EnsemblGenomes-Gn; EBG00001204858.
DR   EnsemblGenomes-Gn; EBG00001204859.
DR   EnsemblGenomes-Gn; EBG00001204860.
DR   EnsemblGenomes-Gn; EBG00001204861.
DR   EnsemblGenomes-Gn; EBG00001204862.
DR   EnsemblGenomes-Gn; EBG00001204863.
DR   EnsemblGenomes-Gn; EBG00001204864.
DR   EnsemblGenomes-Gn; EBG00001204865.
DR   EnsemblGenomes-Gn; EBG00001204866.
DR   EnsemblGenomes-Gn; EBG00001204867.
DR   EnsemblGenomes-Gn; EBG00001204868.
DR   EnsemblGenomes-Gn; EBG00001204869.
DR   EnsemblGenomes-Gn; EBG00001204870.
DR   EnsemblGenomes-Gn; EBG00001204871.
DR   EnsemblGenomes-Gn; EBG00001204872.
DR   EnsemblGenomes-Gn; EBG00001204873.
DR   EnsemblGenomes-Gn; EBG00001204874.
DR   EnsemblGenomes-Gn; EBG00001204875.
DR   EnsemblGenomes-Gn; EBG00001204876.
DR   EnsemblGenomes-Gn; EBG00001204877.
DR   EnsemblGenomes-Gn; EBG00001204878.
DR   EnsemblGenomes-Gn; EBG00001204879.
DR   EnsemblGenomes-Gn; EBG00001204880.
DR   EnsemblGenomes-Gn; EBG00001204881.
DR   EnsemblGenomes-Gn; EBG00001204882.
DR   EnsemblGenomes-Gn; EBG00001204883.
DR   EnsemblGenomes-Gn; EBG00001204884.
DR   EnsemblGenomes-Gn; EBG00001204885.
DR   EnsemblGenomes-Gn; EBG00001204886.
DR   EnsemblGenomes-Gn; EBG00001204887.
DR   EnsemblGenomes-Gn; EBG00001204888.
DR   EnsemblGenomes-Gn; EBG00001204889.
DR   EnsemblGenomes-Gn; EBG00001204890.
DR   EnsemblGenomes-Gn; EBG00001204891.
DR   EnsemblGenomes-Gn; EBG00001204892.
DR   EnsemblGenomes-Gn; EBG00001204893.
DR   EnsemblGenomes-Gn; EBG00001204894.
DR   EnsemblGenomes-Gn; EBG00001204895.
DR   EnsemblGenomes-Gn; EBG00001204896.
DR   EnsemblGenomes-Gn; EBG00001204897.
DR   EnsemblGenomes-Gn; EBG00001204898.
DR   EnsemblGenomes-Gn; EBG00001204899.
DR   EnsemblGenomes-Gn; EBG00001204900.
DR   EnsemblGenomes-Gn; EBG00001204901.
DR   EnsemblGenomes-Gn; EBG00001204902.
DR   EnsemblGenomes-Gn; EBG00001204903.
DR   EnsemblGenomes-Gn; EBG00001204904.
DR   EnsemblGenomes-Gn; EBG00001204905.
DR   EnsemblGenomes-Gn; EBG00001204906.
DR   EnsemblGenomes-Gn; EBG00001204907.
DR   EnsemblGenomes-Gn; EBG00001204908.
DR   EnsemblGenomes-Gn; EBG00001204909.
DR   EnsemblGenomes-Gn; EBG00001204910.
DR   EnsemblGenomes-Gn; EBG00001204911.
DR   EnsemblGenomes-Gn; EBG00001204912.
DR   EnsemblGenomes-Gn; EBG00001204913.
DR   EnsemblGenomes-Gn; EBG00001204914.
DR   EnsemblGenomes-Gn; EBG00001204915.
DR   EnsemblGenomes-Gn; EBG00001204916.
DR   EnsemblGenomes-Gn; EBG00001204917.
DR   EnsemblGenomes-Gn; EBG00001204918.
DR   EnsemblGenomes-Gn; EBG00001204919.
DR   EnsemblGenomes-Gn; EBG00001204920.
DR   EnsemblGenomes-Gn; EBG00001204921.
DR   EnsemblGenomes-Gn; EBG00001204922.
DR   EnsemblGenomes-Gn; EBG00001204923.
DR   EnsemblGenomes-Gn; EBG00001204924.
DR   EnsemblGenomes-Gn; EBG00001204925.
DR   EnsemblGenomes-Gn; EBG00001204926.
DR   EnsemblGenomes-Gn; EBG00001204927.
DR   EnsemblGenomes-Gn; EBG00001204928.
DR   EnsemblGenomes-Gn; EBG00001204929.
DR   EnsemblGenomes-Gn; EBG00001204930.
DR   EnsemblGenomes-Gn; EBG00001204931.
DR   EnsemblGenomes-Gn; EBG00001204932.
DR   EnsemblGenomes-Gn; EBG00001204933.
DR   EnsemblGenomes-Gn; EBG00001204934.
DR   EnsemblGenomes-Gn; EBG00001204935.
DR   EnsemblGenomes-Gn; EBG00001204936.
DR   EnsemblGenomes-Gn; EBG00001204937.
DR   EnsemblGenomes-Gn; Patl_R0001.
DR   EnsemblGenomes-Gn; Patl_R0002.
DR   EnsemblGenomes-Gn; Patl_R0003.
DR   EnsemblGenomes-Gn; Patl_R0004.
DR   EnsemblGenomes-Gn; Patl_R0005.
DR   EnsemblGenomes-Gn; Patl_R0006.
DR   EnsemblGenomes-Gn; Patl_R0007.
DR   EnsemblGenomes-Gn; Patl_R0008.
DR   EnsemblGenomes-Gn; Patl_R0009.
DR   EnsemblGenomes-Gn; Patl_R0010.
DR   EnsemblGenomes-Gn; Patl_R0011.
DR   EnsemblGenomes-Gn; Patl_R0012.
DR   EnsemblGenomes-Gn; Patl_R0013.
DR   EnsemblGenomes-Gn; Patl_R0014.
DR   EnsemblGenomes-Gn; Patl_R0015.
DR   EnsemblGenomes-Gn; Patl_R0016.
DR   EnsemblGenomes-Gn; Patl_R0017.
DR   EnsemblGenomes-Gn; Patl_R0018.
DR   EnsemblGenomes-Gn; Patl_R0019.
DR   EnsemblGenomes-Gn; Patl_R0020.
DR   EnsemblGenomes-Gn; Patl_R0022.
DR   EnsemblGenomes-Gn; Patl_R0023.
DR   EnsemblGenomes-Gn; Patl_R0024.
DR   EnsemblGenomes-Gn; Patl_R0025.
DR   EnsemblGenomes-Gn; Patl_R0026.
DR   EnsemblGenomes-Gn; Patl_R0027.
DR   EnsemblGenomes-Gn; Patl_R0029.
DR   EnsemblGenomes-Gn; Patl_R0030.
DR   EnsemblGenomes-Gn; Patl_R0031.
DR   EnsemblGenomes-Gn; Patl_R0033.
DR   EnsemblGenomes-Gn; Patl_R0034.
DR   EnsemblGenomes-Gn; Patl_R0036.
DR   EnsemblGenomes-Gn; Patl_R0037.
DR   EnsemblGenomes-Gn; Patl_R0038.
DR   EnsemblGenomes-Gn; Patl_R0039.
DR   EnsemblGenomes-Gn; Patl_R0040.
DR   EnsemblGenomes-Gn; Patl_R0042.
DR   EnsemblGenomes-Gn; Patl_R0043.
DR   EnsemblGenomes-Gn; Patl_R0044.
DR   EnsemblGenomes-Gn; Patl_R0045.
DR   EnsemblGenomes-Gn; Patl_R0046.
DR   EnsemblGenomes-Gn; Patl_R0047.
DR   EnsemblGenomes-Gn; Patl_R0048.
DR   EnsemblGenomes-Gn; Patl_R0049.
DR   EnsemblGenomes-Gn; Patl_R0050.
DR   EnsemblGenomes-Gn; Patl_R0051.
DR   EnsemblGenomes-Gn; Patl_R0052.
DR   EnsemblGenomes-Gn; Patl_R0053.
DR   EnsemblGenomes-Gn; Patl_R0054.
DR   EnsemblGenomes-Gn; Patl_R0055.
DR   EnsemblGenomes-Gn; Patl_R0056.
DR   EnsemblGenomes-Gn; Patl_R0057.
DR   EnsemblGenomes-Gn; Patl_R0058.
DR   EnsemblGenomes-Gn; Patl_R0059.
DR   EnsemblGenomes-Gn; Patl_R0060.
DR   EnsemblGenomes-Gn; Patl_R0061.
DR   EnsemblGenomes-Gn; Patl_R0062.
DR   EnsemblGenomes-Gn; Patl_R0063.
DR   EnsemblGenomes-Gn; Patl_R0064.
DR   EnsemblGenomes-Gn; Patl_R0065.
DR   EnsemblGenomes-Gn; Patl_R0066.
DR   EnsemblGenomes-Gn; Patl_R0067.
DR   EnsemblGenomes-Gn; Patl_R0068.
DR   EnsemblGenomes-Gn; Patl_R0069.
DR   EnsemblGenomes-Gn; Patl_R0070.
DR   EnsemblGenomes-Gn; Patl_R0071.
DR   EnsemblGenomes-Gn; Patl_R0072.
DR   EnsemblGenomes-Gn; Patl_R0073.
DR   EnsemblGenomes-Gn; Patl_R0074.
DR   EnsemblGenomes-Gn; Patl_R0075.
DR   EnsemblGenomes-Gn; Patl_R0076.
DR   EnsemblGenomes-Gn; Patl_R0077.
DR   EnsemblGenomes-Gn; Patl_R0078.
DR   EnsemblGenomes-Gn; Patl_R0079.
DR   EnsemblGenomes-Gn; Patl_R0080.
DR   EnsemblGenomes-Gn; Patl_R0081.
DR   EnsemblGenomes-Gn; Patl_R0082.
DR   EnsemblGenomes-Gn; Patl_R0083.
DR   EnsemblGenomes-Gn; Patl_R0084.
DR   EnsemblGenomes-Tr; EBT00001575858.
DR   EnsemblGenomes-Tr; EBT00001575859.
DR   EnsemblGenomes-Tr; EBT00001575860.
DR   EnsemblGenomes-Tr; EBT00001575861.
DR   EnsemblGenomes-Tr; EBT00001575862.
DR   EnsemblGenomes-Tr; EBT00001575863.
DR   EnsemblGenomes-Tr; EBT00001575864.
DR   EnsemblGenomes-Tr; EBT00001575865.
DR   EnsemblGenomes-Tr; EBT00001575866.
DR   EnsemblGenomes-Tr; EBT00001575867.
DR   EnsemblGenomes-Tr; EBT00001575868.
DR   EnsemblGenomes-Tr; EBT00001575869.
DR   EnsemblGenomes-Tr; EBT00001575870.
DR   EnsemblGenomes-Tr; EBT00001575871.
DR   EnsemblGenomes-Tr; EBT00001575872.
DR   EnsemblGenomes-Tr; EBT00001575873.
DR   EnsemblGenomes-Tr; EBT00001575874.
DR   EnsemblGenomes-Tr; EBT00001575875.
DR   EnsemblGenomes-Tr; EBT00001575876.
DR   EnsemblGenomes-Tr; EBT00001575877.
DR   EnsemblGenomes-Tr; EBT00001575878.
DR   EnsemblGenomes-Tr; EBT00001575879.
DR   EnsemblGenomes-Tr; EBT00001575880.
DR   EnsemblGenomes-Tr; EBT00001575881.
DR   EnsemblGenomes-Tr; EBT00001575882.
DR   EnsemblGenomes-Tr; EBT00001575883.
DR   EnsemblGenomes-Tr; EBT00001575884.
DR   EnsemblGenomes-Tr; EBT00001575885.
DR   EnsemblGenomes-Tr; EBT00001575886.
DR   EnsemblGenomes-Tr; EBT00001575887.
DR   EnsemblGenomes-Tr; EBT00001575888.
DR   EnsemblGenomes-Tr; EBT00001575889.
DR   EnsemblGenomes-Tr; EBT00001575890.
DR   EnsemblGenomes-Tr; EBT00001575891.
DR   EnsemblGenomes-Tr; EBT00001575892.
DR   EnsemblGenomes-Tr; EBT00001575893.
DR   EnsemblGenomes-Tr; EBT00001575894.
DR   EnsemblGenomes-Tr; EBT00001575895.
DR   EnsemblGenomes-Tr; EBT00001575896.
DR   EnsemblGenomes-Tr; EBT00001575897.
DR   EnsemblGenomes-Tr; EBT00001575898.
DR   EnsemblGenomes-Tr; EBT00001575899.
DR   EnsemblGenomes-Tr; EBT00001575900.
DR   EnsemblGenomes-Tr; EBT00001575901.
DR   EnsemblGenomes-Tr; EBT00001575902.
DR   EnsemblGenomes-Tr; EBT00001575903.
DR   EnsemblGenomes-Tr; EBT00001575904.
DR   EnsemblGenomes-Tr; EBT00001575905.
DR   EnsemblGenomes-Tr; EBT00001575906.
DR   EnsemblGenomes-Tr; EBT00001575907.
DR   EnsemblGenomes-Tr; EBT00001575908.
DR   EnsemblGenomes-Tr; EBT00001575909.
DR   EnsemblGenomes-Tr; EBT00001575910.
DR   EnsemblGenomes-Tr; EBT00001575911.
DR   EnsemblGenomes-Tr; EBT00001575912.
DR   EnsemblGenomes-Tr; EBT00001575913.
DR   EnsemblGenomes-Tr; EBT00001575914.
DR   EnsemblGenomes-Tr; EBT00001575915.
DR   EnsemblGenomes-Tr; EBT00001575916.
DR   EnsemblGenomes-Tr; EBT00001575917.
DR   EnsemblGenomes-Tr; EBT00001575918.
DR   EnsemblGenomes-Tr; EBT00001575919.
DR   EnsemblGenomes-Tr; EBT00001575920.
DR   EnsemblGenomes-Tr; EBT00001575921.
DR   EnsemblGenomes-Tr; EBT00001575922.
DR   EnsemblGenomes-Tr; EBT00001575923.
DR   EnsemblGenomes-Tr; EBT00001575924.
DR   EnsemblGenomes-Tr; EBT00001575925.
DR   EnsemblGenomes-Tr; EBT00001575926.
DR   EnsemblGenomes-Tr; EBT00001575927.
DR   EnsemblGenomes-Tr; EBT00001575928.
DR   EnsemblGenomes-Tr; EBT00001575929.
DR   EnsemblGenomes-Tr; EBT00001575930.
DR   EnsemblGenomes-Tr; EBT00001575931.
DR   EnsemblGenomes-Tr; EBT00001575932.
DR   EnsemblGenomes-Tr; EBT00001575933.
DR   EnsemblGenomes-Tr; EBT00001575934.
DR   EnsemblGenomes-Tr; EBT00001575935.
DR   EnsemblGenomes-Tr; EBT00001575936.
DR   EnsemblGenomes-Tr; EBT00001575937.
DR   EnsemblGenomes-Tr; EBT00001575938.
DR   EnsemblGenomes-Tr; EBT00001575939.
DR   EnsemblGenomes-Tr; EBT00001575940.
DR   EnsemblGenomes-Tr; EBT00001575941.
DR   EnsemblGenomes-Tr; EBT00001575942.
DR   EnsemblGenomes-Tr; EBT00001575943.
DR   EnsemblGenomes-Tr; EBT00001575944.
DR   EnsemblGenomes-Tr; EBT00001575945.
DR   EnsemblGenomes-Tr; EBT00001575946.
DR   EnsemblGenomes-Tr; EBT00001575947.
DR   EnsemblGenomes-Tr; EBT00001575948.
DR   EnsemblGenomes-Tr; EBT00001575949.
DR   EnsemblGenomes-Tr; EBT00001575950.
DR   EnsemblGenomes-Tr; EBT00001575951.
DR   EnsemblGenomes-Tr; EBT00001575952.
DR   EnsemblGenomes-Tr; EBT00001575953.
DR   EnsemblGenomes-Tr; EBT00001575954.
DR   EnsemblGenomes-Tr; EBT00001575955.
DR   EnsemblGenomes-Tr; Patl_R0001-1.
DR   EnsemblGenomes-Tr; Patl_R0002-1.
DR   EnsemblGenomes-Tr; Patl_R0003-1.
DR   EnsemblGenomes-Tr; Patl_R0004-1.
DR   EnsemblGenomes-Tr; Patl_R0005-1.
DR   EnsemblGenomes-Tr; Patl_R0006-1.
DR   EnsemblGenomes-Tr; Patl_R0007-1.
DR   EnsemblGenomes-Tr; Patl_R0008-1.
DR   EnsemblGenomes-Tr; Patl_R0009-1.
DR   EnsemblGenomes-Tr; Patl_R0010-1.
DR   EnsemblGenomes-Tr; Patl_R0011-1.
DR   EnsemblGenomes-Tr; Patl_R0012-1.
DR   EnsemblGenomes-Tr; Patl_R0013-1.
DR   EnsemblGenomes-Tr; Patl_R0014-1.
DR   EnsemblGenomes-Tr; Patl_R0015-1.
DR   EnsemblGenomes-Tr; Patl_R0016-1.
DR   EnsemblGenomes-Tr; Patl_R0017-1.
DR   EnsemblGenomes-Tr; Patl_R0018-1.
DR   EnsemblGenomes-Tr; Patl_R0019-1.
DR   EnsemblGenomes-Tr; Patl_R0020-1.
DR   EnsemblGenomes-Tr; Patl_R0022-1.
DR   EnsemblGenomes-Tr; Patl_R0023-1.
DR   EnsemblGenomes-Tr; Patl_R0024-1.
DR   EnsemblGenomes-Tr; Patl_R0025-1.
DR   EnsemblGenomes-Tr; Patl_R0026-1.
DR   EnsemblGenomes-Tr; Patl_R0027-1.
DR   EnsemblGenomes-Tr; Patl_R0029-1.
DR   EnsemblGenomes-Tr; Patl_R0030-1.
DR   EnsemblGenomes-Tr; Patl_R0031-1.
DR   EnsemblGenomes-Tr; Patl_R0033-1.
DR   EnsemblGenomes-Tr; Patl_R0034-1.
DR   EnsemblGenomes-Tr; Patl_R0036-1.
DR   EnsemblGenomes-Tr; Patl_R0037-1.
DR   EnsemblGenomes-Tr; Patl_R0038-1.
DR   EnsemblGenomes-Tr; Patl_R0039-1.
DR   EnsemblGenomes-Tr; Patl_R0040-1.
DR   EnsemblGenomes-Tr; Patl_R0042-1.
DR   EnsemblGenomes-Tr; Patl_R0043-1.
DR   EnsemblGenomes-Tr; Patl_R0044-1.
DR   EnsemblGenomes-Tr; Patl_R0045-1.
DR   EnsemblGenomes-Tr; Patl_R0046-1.
DR   EnsemblGenomes-Tr; Patl_R0047-1.
DR   EnsemblGenomes-Tr; Patl_R0048-1.
DR   EnsemblGenomes-Tr; Patl_R0049-1.
DR   EnsemblGenomes-Tr; Patl_R0050-1.
DR   EnsemblGenomes-Tr; Patl_R0051-1.
DR   EnsemblGenomes-Tr; Patl_R0052-1.
DR   EnsemblGenomes-Tr; Patl_R0053-1.
DR   EnsemblGenomes-Tr; Patl_R0054-1.
DR   EnsemblGenomes-Tr; Patl_R0055-1.
DR   EnsemblGenomes-Tr; Patl_R0056-1.
DR   EnsemblGenomes-Tr; Patl_R0057-1.
DR   EnsemblGenomes-Tr; Patl_R0058-1.
DR   EnsemblGenomes-Tr; Patl_R0059-1.
DR   EnsemblGenomes-Tr; Patl_R0060-1.
DR   EnsemblGenomes-Tr; Patl_R0061-1.
DR   EnsemblGenomes-Tr; Patl_R0062-1.
DR   EnsemblGenomes-Tr; Patl_R0063-1.
DR   EnsemblGenomes-Tr; Patl_R0064-1.
DR   EnsemblGenomes-Tr; Patl_R0065-1.
DR   EnsemblGenomes-Tr; Patl_R0066-1.
DR   EnsemblGenomes-Tr; Patl_R0067-1.
DR   EnsemblGenomes-Tr; Patl_R0068-1.
DR   EnsemblGenomes-Tr; Patl_R0069-1.
DR   EnsemblGenomes-Tr; Patl_R0070-1.
DR   EnsemblGenomes-Tr; Patl_R0071-1.
DR   EnsemblGenomes-Tr; Patl_R0072-1.
DR   EnsemblGenomes-Tr; Patl_R0073-1.
DR   EnsemblGenomes-Tr; Patl_R0074-1.
DR   EnsemblGenomes-Tr; Patl_R0075-1.
DR   EnsemblGenomes-Tr; Patl_R0076-1.
DR   EnsemblGenomes-Tr; Patl_R0077-1.
DR   EnsemblGenomes-Tr; Patl_R0078-1.
DR   EnsemblGenomes-Tr; Patl_R0079-1.
DR   EnsemblGenomes-Tr; Patl_R0080-1.
DR   EnsemblGenomes-Tr; Patl_R0081-1.
DR   EnsemblGenomes-Tr; Patl_R0082-1.
DR   EnsemblGenomes-Tr; Patl_R0083-1.
DR   EnsemblGenomes-Tr; Patl_R0084-1.
DR   EuropePMC; PMC3187218; 21840974.
DR   EuropePMC; PMC6262041; 30524390.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP000388.
DR   SILVA-SSU; CP000388.
DR   StrainInfo; 493548; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000130
CC   Source DNA and bacteria available from Anna C. Karls
CC   (akarls@uga.edu)
CC   Contacts: Anna C. Karls (akarls@uga.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5187005
FT                   /organism="Pseudoalteromonas atlantica T6c"
FT                   /strain="T6c"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:342610"
FT   gene            96..1520
FT                   /locus_tag="Patl_0001"
FT   CDS_pept        96..1520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: vpa:VP0011 chromosomal DNA replication
FT                   initiator DnaA; TIGRFAM: chromosomal replication initiator
FT                   protein DnaA; PFAM: Chromosomal replication initiator,
FT                   DnaA-like Chromosomal replication initiator, DnaA; SMART:
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38534"
FT                   /db_xref="GOA:Q15ZZ7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZZ7"
FT                   /protein_id="ABG38534.1"
FT                   /translation="MSLWNRCLERLQQDLPTQQFSMWIRPLVANEEAAAVTLFAPNRFV
FT                   LDWVRDKYIAQIEALFAEFCANDAVPQLRIEVKSAASVQQSYSQNPAPAIHQSSAVENS
FT                   IKSLQKHQAARSNVNVQADNSPPNVKIAASHKSNINFNYKFDNFVEGKSNQLARAASKQ
FT                   VSDNPGKAYNPLFIYGGTGLGKTHLLHAVGNGIIDNKKDATVVYMHSERFVQDMVKALQ
FT                   NNAIEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKE
FT                   IDGVEDRLKSRFGWGLTIAIEPPELETRVAILMRKALENKIVLPDEVAFFIAKRLRSNV
FT                   RELEGALNRVIANANFTGRPITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKMA
FT                   DILSKRRSRSVARPRQMAMALSKELTNHSLPEIGDAFGGRDHTTVLHACRKIVQLREES
FT                   HDIKEDYQNLIRTLSS"
FT   gene            1541..2644
FT                   /locus_tag="Patl_0002"
FT   CDS_pept        1541..2644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: ilo:IL0002 DNA polymerase sliding clamp
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38535"
FT                   /db_xref="GOA:Q15ZZ6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZZ6"
FT                   /protein_id="ABG38535.1"
FT                   /translation="MKFSISRENFLQPLQLVSGAVERRHTLPILSNVLIKVSDSALWLT
FT                   GTDLEVELISNVTLTGDFEEGEITVPAKKLLDIIRGLTEGSEISFHVDGNKAILRCGRS
FT                   KYSLSTLSANDYPNLEDWQGELEFEISQANLKRLIDSVHFSMAQQDVRYYLNGMSLETE
FT                   DNVIRTVATDGHRLALCRLNYTDATLPNRQVIIPRKGVMEITRLIEDSDKSLKVQVGSN
FT                   HIRIFSNDFIFTSKLVDGRFPDYRRVLPKDGDKNIIASKLGLKNAFSRASILSNEKFKG
FT                   VRLNLSSGEVKITANNPEQEEAVEIVDVDYQGGDLEIGFNVAYLIDVLNALNAEEVKFT
FT                   LADSNSSALIEDGSDDSALYVIMPMRL"
FT   gene            2667..3758
FT                   /locus_tag="Patl_0003"
FT   CDS_pept        2667..3758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC protein-like; KEGG: vpa:VP0013 RecF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38536"
FT                   /db_xref="GOA:Q15ZZ5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZZ5"
FT                   /protein_id="ABG38536.1"
FT                   /translation="MKLDSVQIRNLRNLQHVTFKPSHGVNFILGINGSGKSSILEAIHY
FT                   LGFGRSFRTSKHKNVIQNEQESFTVFCECLEDSTTQRLGLSRSINDTVSVSINGIKGNK
FT                   VSDLVSLLPVQIFTPQSSDILLGAPKLRRKYIDWCLFHVEHSFLTCSNAYSRLLKHNNA
FT                   LCRKQQVGYANPQRVYWTDLLAQYGSELTEFRNAMMTRLIPLITSNLAQFLPEFCVEIS
FT                   YYRGWEKGLELNEALTKSADRDYKNGYISVGPHKADVRFKISGKPAQEVLSRGQLRMLV
FT                   AALQLATTQCLMSYTQKTCIFLLDDVGAELDAAKREVFIDRLLESNTQLFVTAIEEHQL
FT                   EFIDKYQNKKMFHVEHGQVREES"
FT   gene            3763..6183
FT                   /locus_tag="Patl_0004"
FT   CDS_pept        3763..6183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: ppr:PBPRA0011 putative DNA gyrase, subunit B;
FT                   TIGRFAM: DNA gyrase, B subunit; PFAM: DNA gyrase, subunit
FT                   B-like ATP-binding region, ATPase-like TOPRIM domain
FT                   containing protein DNA topoisomerase, type IIA, subunit B,
FT                   region 2; SMART: DNA topoisomerase, type IIA, subunit B
FT                   or-like"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38537"
FT                   /db_xref="GOA:Q15ZZ4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZZ4"
FT                   /protein_id="ABG38537.1"
FT                   /translation="MAEENKYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEV
FT                   VDNSIDEALAGHCTNINVKIHTDGSVSVKDDGRGIPTEIHEEEGVSAAEVIMTVLHAGG
FT                   KFDDNSYKVSGGLHGVGVSVVNALSRKLQIMIRRAGEVHEQEYQHGVPQKPLEVIGESD
FT                   TTGTSIRFWPSEETFTGIEFHYDILAKRLRELSFLNSGVSIILEDERDGKKDHFMYEGG
FT                   IRAFVEYLNQNKTPVHQQVFHFNSQRDDGISVEVALQWNDSFQENVFCFTNNIPQRDGG
FT                   SHLAGFRGALTRTLNTFMEKEGHNKKNKTSASGDDAREGLTAVVSVKVPDPKFSSQTKD
FT                   KLVSSEVRPAVETVMGEKLNEFLLENPSASKIIIGKIIDAARAREAARKARDMTRRKGA
FT                   LDLAGLPGKLADCQEKDPSLSELYIVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKA
FT                   RFDKMLSSQEVATLITALGCGIGRDEYDPEKLRYHRIIIMTDADVDGSHIRTLLLTFFY
FT                   RQMPEIIERGYIYIAQPPLYKTKKGKQEQYLKDDDSLTKYLTAIALDNASIHVNEEAPG
FT                   LSGASLEKLVSQYQNGMKMIKRVSRVMPEVILTSLIYSKIITLQDLQDEASLEVVAKSY
FT                   TESLTRNEVDGATYRYEVRLNNERKNYYIALIIRLHGIDTEYKIDQEFIESIEYTRLRE
FT                   LNESINGLIEEGGYVKRNDKVKAISSFAEGLDWLMAESKKGQYIQRYKGLGEMNPGQLW
FT                   ETTMDPASRRMLQVKVEDAIAADQLFTTLMGDHVEPRRAFIEENALRVANLDV"
FT   gene            6298..6996
FT                   /locus_tag="Patl_0005"
FT   CDS_pept        6298..6996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0005"
FT                   /product="aspartate racemase"
FT                   /note="TIGRFAM: aspartate racemase; PFAM: Asp/Glu racemase;
FT                   KEGG: dps:DP1920 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38538"
FT                   /db_xref="GOA:Q15ZZ3"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZZ3"
FT                   /protein_id="ABG38538.1"
FT                   /translation="MKKIGMLGGMSWESTAQYYELINRELNRRLGGLHSARIVLNSVDF
FT                   NDIELLQKAAEWCNLADMLSADALSLEHAGVDFIIICTNTMHKVEPEIAAATSIPILHI
FT                   ADATGQVLKKDRLKRVGLLGTAFTMEQDFYESRLATKFGIDVIVPDDDDRAFIHNVIYD
FT                   ELCKGVINDKSRQGYLRIIDKLYAKGCEGVVLGCTEIPMLVNQSHTQVALYDTTKIHAF
FT                   AAVDLALTKE"
FT   gene            complement(7111..8718)
FT                   /locus_tag="Patl_0006"
FT   CDS_pept        complement(7111..8718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0006"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: conserved
FT                   hypothetical protein histidine kinase, HAMP region; KEGG:
FT                   tdn:Tmden_2088 diguanylate cyclase/phosphodiesterase (GGDEF
FT                   & EAL domains) with PAS/PAC sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38539"
FT                   /db_xref="GOA:Q15ZZ2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZZ2"
FT                   /protein_id="ABG38539.1"
FT                   /translation="MINISGKIYIKVALSIAIGAIGTSLITSVLLYFSAVSSEQSKAEA
FT                   LIEQIGATIRSTASIALYVQDEELGQEIVQGLVINDLIAGAQLTDSLSLKVSFGDLTDT
FT                   DGLIHTNVQHPFIPEQSIGQLLIHPNRHYIQSIARQKATNDALLLLLYSAIVALFVSIL
FT                   VHKLLTQPIQNLTASFLKIDPRNTQTMRTLIHHDNDEIGQLVQGINDLMGELKVTLENE
FT                   TDLRKKTQALESKFRLIFEQASAGICLINSNNLVTAANPAFYHIQPNTSESTPFIDLFE
FT                   NSNQLESLLIRMRNEESVNHLSIDLKCKSHNGAVNKWVHCLFSRITSQRVQQRDIDSSN
FT                   HGPIIEVIMYDVTSRAEKELKTRFEADHDALTHLKNRRAGEFEIVNLLQTVNLLDLSLV
FT                   IFMIDLDKFKPVNDIYGHDAGDRVLIEVSKRLQSVFNGKNELCSRWGGDEFVAAYVVNS
FT                   VNVEEIRALAQSTLSSLSHPIEISDEISCEIGGSIGVVIAPQHANNVKDLLACADMTMY
FT                   KVKENGRGHFKIYDPSWK"
FT   sig_peptide     complement(8605..8718)
FT                   /locus_tag="Patl_0006"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.565 at
FT                   residue 38"
FT   gene            complement(8792..9232)
FT                   /locus_tag="Patl_0007"
FT   CDS_pept        complement(8792..9232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_00343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38540"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZZ1"
FT                   /protein_id="ABG38540.1"
FT                   /translation="MSKLKQLYSLMAICLLSGCASYTVEPYKDVQQLPELYLRGVFTWW
FT                   EADPQYILKKQGGSTYATTIELIADGQPYDFKFADKDWTPGSSCGYKSQYRDQNISLGE
FT                   AVNADCNTTDENFKFVPKETGRYEFSIDFTNIDKPIVMVSKL"
FT   sig_peptide     complement(9161..9232)
FT                   /locus_tag="Patl_0007"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.887 at
FT                   residue 24"
FT   gene            complement(9269..11347)
FT                   /locus_tag="Patl_0008"
FT   CDS_pept        complement(9269..11347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0008"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: pha:PSHAa0006 glycyl-tRNA synthetase subunit
FT                   beta"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38541"
FT                   /db_xref="GOA:Q15ZZ0"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZZ0"
FT                   /protein_id="ABG38541.1"
FT                   /translation="MRYENLLVEIGTEELPPKALGKLAQAFADNLQGALDTAELKYTSI
FT                   KWFASPRRLAVNVIGLAEQQEDKLIEKKGPAVSVAFDESGQATKAAQGWARSNGITVEQ
FT                   AERLTTDKGEWLLFKGEAKGEQVSSLLPAMIDGALKKLPIPKAMRWGSSSIQFIRPVHT
FT                   VTMLFGADVIEGNILGIDSDRVINGHRFHGEKQFSLSHADDYLAQLEAHYVLADFSARK
FT                   DKIRHQVNAAAQKEDAVADMNEDLLDEVTALVEWPVALTASFDDSFLEVPKEALIYTMK
FT                   DDQKYFPLIDQNGQLKSRFVFVTNIESKDPMQIISGNEKVIRPRLADAEFFFNTDKKTT
FT                   LESRLESLKTVLFQKQLGTLYEKSQRISELAGTIANMLSSDISQASRAGLLSKTDLMTN
FT                   MVMEFPDVQGVMGMHYAKHDGEHDKVALALNEQYMPRFAGDQLPTSNISCAVAIADKID
FT                   TLVGIFGIGQVPKGDKDPFALRRAAIGVLRISVEMKLPLDLTTLVQASINSFGTKLTHV
FT                   EDLESQVIDFILGRFRAWYQDQHIDIDVIQAVAARRPTKPADFAARIEAVSAFKSLASG
FT                   LALASANKRVANILAKNKVTDTNSINSSLFESEHEAALADAMSDIEETVNAFVVDANYQ
FT                   GVFTELATLHDKVDAFFDNVMVMAEDENVRNNRLALLSKLRTLFLLVADISILNQQQ"
FT   gene            complement(11351..12256)
FT                   /locus_tag="Patl_0009"
FT   CDS_pept        complement(11351..12256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0009"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /note="PFAM: glycyl-tRNA synthetase, alpha subunit; KEGG:
FT                   cps:CPS_0005 glycyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38542"
FT                   /db_xref="GOA:Q15ZY9"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZY9"
FT                   /protein_id="ABG38542.1"
FT                   /translation="MNKFDSKTFQGLILSLQDYWARQGCVIIQPLDMEVGAGTFHPMTF
FT                   LRSIGPEPISSAYVQPCRRPTDGRYGENPNRLQHYYQFQVMLKPSPSNIQELYLGSLKE
FT                   LGFDPLVHDIRFVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIECSPVTGEI
FT                   TYGLERLAMYIQGVDSIYDLVWTDGPMGKVTYGDVFHQNEVEQSTYNFEYADVDALFGM
FT                   FDHCEKESQKMIEAGLPLPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRTLSKAC
FT                   AEAYYQAREKLGFPMCKKEA"
FT   gene            12372..12944
FT                   /locus_tag="Patl_0010"
FT   CDS_pept        12372..12944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0010"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="KEGG: son:SO0016 DNA-3-methyladenine glycosidase I;
FT                   TIGRFAM: DNA-3-methyladenine glycosylase I; PFAM:
FT                   methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38543"
FT                   /db_xref="GOA:Q15ZY8"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZY8"
FT                   /protein_id="ABG38543.1"
FT                   /translation="MQHIRCAWVSQDPIYQEYHDKVWGRPVRNKYELFAKLCLDGQQAG
FT                   LSWITILKKQQNYYQAFHQFDPQRISEMTEDDVERLMQDKGIVRNRLKINSIIKNAKGF
FT                   LEIEREGTDFSEFIWSFVANEPIINAWAEKSQVPNTSSESDAMAKALKKRGFSFVGSTI
FT                   CYAFMQAVGLVNDHTQDCFCYPVNEKR"
FT   gene            complement(12966..13415)
FT                   /locus_tag="Patl_0011"
FT   CDS_pept        complement(12966..13415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pha:PSHAa2750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38544"
FT                   /db_xref="GOA:Q15ZY7"
FT                   /db_xref="InterPro:IPR019617"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZY7"
FT                   /protein_id="ABG38544.1"
FT                   /translation="MSSITILLILVAFVIIASLAFYAGKLLFMLNKQNKKMARTKQQRI
FT                   ERLMESIHTISMAVEQQQCNLSEGSIRLYHLHESLPIDDKPDYETRYPGLYALYVKVSD
FT                   LATHEARDKLSALERKTQDIAREALERELESQILEDVAKLRAFTP"
FT   sig_peptide     complement(13353..13415)
FT                   /locus_tag="Patl_0011"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.892) with cleavage site probability 0.691 at
FT                   residue 21"
FT   gene            complement(13424..13951)
FT                   /locus_tag="Patl_0012"
FT   CDS_pept        complement(13424..13951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0012"
FT                   /product="protein of unknown function DUF414"
FT                   /note="PFAM: protein of unknown function DUF414; KEGG:
FT                   pha:PSHAa2751 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38545"
FT                   /db_xref="GOA:Q15ZY6"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZY6"
FT                   /protein_id="ABG38545.1"
FT                   /translation="MPRKKKSRKIGQIGTPLAPKANRKPAPASPKRNKKTLGKPSGTRN
FT                   NPEQTSSQSKPSKVQKDPRVGSKKPIPLIVDDKPKAKITKPKFFSPAQELESIEQNERF
FT                   GMLLEKLDSDTALSREERAFVNKLTARHQELCDLLGISNDDDSTANAGNSENSTDDDLY
FT                   DQFESIDINKFK"
FT   gene            complement(14429..15118)
FT                   /locus_tag="Patl_0013"
FT   CDS_pept        complement(14429..15118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0013"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: vfi:VF0076
FT                   cytochrome c4"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38546"
FT                   /db_xref="GOA:Q160A4"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q160A4"
FT                   /protein_id="ABG38546.1"
FT                   /translation="MCKIRSYYSDNGQLISSLMRKNMKMMGLLVSVFLGLSASAMAAGD
FT                   VEAGKTKSASCGACHGADGNSMIDMNPKLAGQHAGYLVKQLKEFKLASQTGGEEGRNNA
FT                   VMNGMAGVLSEQDMLDIAAYFESQTPSEGETPEDAIAAGSKLYRGGDLDRGITACTACH
FT                   GPRGNGTSLSGFPDISGQHTTYLKAQLEAFRSGQRANSHNGMMEDIAKRLTDQDIDVLS
FT                   KYISGLY"
FT   sig_peptide     complement(14990..15118)
FT                   /locus_tag="Patl_0013"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 43"
FT   gene            15261..15881
FT                   /locus_tag="Patl_0014"
FT   CDS_pept        15261..15881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0014"
FT                   /product="cell division checkpoint GTPase YihA"
FT                   /note="PFAM: GTP-binding protein, HSR1-related; KEGG:
FT                   ppr:PBPRA3502 putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38547"
FT                   /db_xref="GOA:Q160A3"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q160A3"
FT                   /protein_id="ABG38547.1"
FT                   /translation="MSHYSQAKFNLSAPDISHLSADQGIEVAFAGRSNAGKSSALNRLT
FT                   RQKSLARTSKTPGRTQLINVFDLDEDRRLIDLPGYGYAKVPMAIKLKWQKSLGEYLQKR
FT                   ESLKGLVVLMDIRHPFKDLDQELIQWAVAADLPVLGLLTKADKLKSGKRKAQLLMAREA
FT                   SLAFCGDVTIHLFSSLNGLGLDNCERVLDKWFGYAQDEELEQE"
FT   gene            complement(16229..19015)
FT                   /locus_tag="Patl_0015"
FT   CDS_pept        complement(16229..19015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0015"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: vfi:VF0074 DNA polymerase I; TIGRFAM: DNA
FT                   polymerase I; PFAM: DNA-directed DNA polymerase 5'-3'
FT                   exonuclease 3'-5' exonuclease; SMART: Helix-hairpin-helix
FT                   motif, class 2"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38548"
FT                   /db_xref="GOA:Q160A2"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q160A2"
FT                   /protein_id="ABG38548.1"
FT                   /translation="MSNTDPATTPVIPNNPFILVDGSSYLFRAFHGMPPLTNSKGQDTG
FT                   AIYGVINMLRSLIKQFSPTHMAVVFDAKGKTFRDDIYKEYKANRPSMPEELRSQIEPLH
FT                   KIIRAMGLPIIVESGVEADDVIGTLADQASKLGIPTLISTGDKDMAQLVNEHVTLINTM
FT                   NNHVMDPQGVVEKFGIPPELVIDFLALKGDKVDNIPGVPGVGDKSALGLLQGIGSINDI
FT                   YENLDKIASLDFRGAKKMADKMREYEEQARLSYTLATIKLDVEMDCNPTSLSPVAADYS
FT                   VLKELFAELEFKRWLKDATDALNNGAETEQAMSASDEPSPKSGVQVTYQTILTQDALEK
FT                   WFAKLQQADLFAFDTETTSLNYMQAELVGMSFSIEEGDAAYLPLAHDYVDAPQQLDRSA
FT                   VLALFKPLLEDKNKAKVGQHLKYDKNVLANYDINLQGIAYDTMLESYVLNSVATRHDMD
FT                   SLAQYYLGLSTVHFEDIAGKGAKQLTFNQIPLDQAAQYAAEDADITLRLHNHIWQKLHQ
FT                   TPELASVLTEIEVPLATVLAKMEQFGVLIDSQKLSQQSQDLATRIMQLEREVHELAGEE
FT                   FNLGSTKQLQEILFNKLSLPVLKKTPKGAPSTSEEVLQELALTYPLPKLLMEFRVLSKL
FT                   KNTYTDKLPKMINPRSGRVHTSYHQAITATGRLSSTEPNLQNIPIRTEQGRRVRQAFIA
FT                   RPGYKIVAADYSQIELRIMAHLSQDEGLLKAFSQGKDIHTATAAEVFNVSLTEVTTEQR
FT                   RNAKAINFGLIYGMSAFGLSKQLNVSRHDAQHYMDLYFERYPGVLKYMEDSRIVAKENG
FT                   YVSTVFGRRLYLPDINASNGLRRKGAERAAINAPMQGTAADIIKKAMLKVDAWIDTLPS
FT                   DQTRMIMQVHDELIFEIKEQNVENDKNTIVDLMEKAVSLDVPLIVEAGVGENWDQAH"
FT   gene            19825..21276
FT                   /locus_tag="Patl_0016"
FT   CDS_pept        19825..21276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0016"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: cps:CPS_0015 Trk system
FT                   potassium uptake protein TrkH"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38549"
FT                   /db_xref="GOA:Q160A1"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:Q160A1"
FT                   /protein_id="ABG38549.1"
FT                   /translation="MQYRTIIRILGLLVALFSVTMIPPAIISLYFKDGSGLPFFLAFLL
FT                   CLGTGLMFWYPNRLHRRDLRAKEGFLIVVLFWTVLASFGALPLLLLEQPEMSVSDAFFE
FT                   AFSGLTTTGATVIQGIDYLPKAVQFYRQQLQWLGGMGIIVLAVAILPILGVGGMQLYRA
FT                   ETPGPVKDSKMTPRIADTAKHLWYIYLTLTICCGVAYWFAGMNWFDALCHAFSTVAIGG
FT                   FSNYDASIGYFDSPWINIVCVIFLWIAALNFALHYAAASGRTLMGYFYDPELRAFFLIQ
FT                   FVLVAVYFFVLMKFSWFDGAGIAFDQALIQSVSFSTTAGFATTDFSHWPAFLPIMLIFS
FT                   SFIGGCAGSTGGGLKVVRVLLLFLQGKREVDRLIHPKAVYTVKLGDRALPDRVVEAVWG
FT                   FFSAYAMIFVIIMVCLIATGMDDVSAFTATAATLNNLGPGLGTVSGSFADVSDTGKWLL
FT                   ILAMLFGRLEVFSLLVLFSPTFWRS"
FT   gene            complement(21516..22262)
FT                   /locus_tag="Patl_0017"
FT   CDS_pept        complement(21516..22262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0017"
FT                   /product="TraT complement resistance"
FT                   /note="PFAM: TraT complement resistance; KEGG:
FT                   pha:PSHAa0591 complement resistance protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38550"
FT                   /db_xref="GOA:Q160A0"
FT                   /db_xref="InterPro:IPR008874"
FT                   /db_xref="UniProtKB/TrEMBL:Q160A0"
FT                   /protein_id="ABG38550.1"
FT                   /translation="MKNYVRSAKIAFVGLAILALTSCAAVHTSIAKKDLDVQTKLSTSI
FT                   FVDAVPPEKRKVYLEVRSAVMEFDRNAFRQALNEQISGSGNGYSFVDSPDKAQYTMSVF
FT                   VRNLEKASPSAAENYLSSGFQGVAAGSAIGYATGGSYRGAAAAGLIGGLASTAANAFVK
FT                   DVTYLLVADIQIRERAKKGVIVRRDSKVNSKISDDGATTQTYSEATNQKEYRTRVVTTA
FT                   NKANLELEEAQPLMFEKTAYAMASFF"
FT   sig_peptide     complement(22176..22262)
FT                   /locus_tag="Patl_0017"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.497 at
FT                   residue 29"
FT   gene            complement(22303..22662)
FT                   /locus_tag="Patl_0018"
FT   CDS_pept        complement(22303..22662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0018"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pha:PSHAa0592 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38551"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZZ9"
FT                   /protein_id="ABG38551.1"
FT                   /translation="MLNINSSLRKSPTLPQVLLSLCCMLLSLFTFAQEETEEEALARMQ
FT                   AQLNGEVMSRPFLAERPKEVDNYIESMLKKNVKPPEYQGTYWRRGYTCRDLLRYNWTQY
FT                   RNCRYYHRYHGRYYY"
FT   sig_peptide     complement(22564..22662)
FT                   /locus_tag="Patl_0018"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 33"
FT   gene            complement(22918..23454)
FT                   /locus_tag="Patl_0019"
FT   CDS_pept        complement(22918..23454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0019"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SO4561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38552"
FT                   /db_xref="InterPro:IPR021302"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZZ8"
FT                   /protein_id="ABG38552.1"
FT                   /translation="MKKLSIVLTVAALSIQPQAHAEGWLDSIKSMLGMETQQEAATPSI
FT                   SGMVSSVTDSLGVTQTQASGGLGAIFNYAKENISSDQYGQLTDALPGVSGLLESVPDIS
FT                   NMTSEGGLGGILDKAASYNESLKAINDVKKQFEALGLKPEMITQFVSKAQAYLDTPEGQ
FT                   QAKQLLTQGLGKLLG"
FT   sig_peptide     complement(23389..23454)
FT                   /locus_tag="Patl_0019"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 22"
FT   gene            complement(23559..24938)
FT                   /locus_tag="Patl_0020"
FT   CDS_pept        complement(23559..24938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0020"
FT                   /product="TrkA-N"
FT                   /note="PFAM: TrkA-N TrkA-C; KEGG: pha:PSHAa0020 potassium
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38553"
FT                   /db_xref="GOA:Q15ZY5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZY5"
FT                   /protein_id="ABG38553.1"
FT                   /translation="MKIIIIGAGQVGATLAENLVGEMNEITVIDSHQDTLRQLQDRLDL
FT                   RVINGVGSHPDVLKKAGAEDADMLIAVTSSDESNMMACQVAYSLFKTPTKIARVRSEQY
FT                   IIYQEQLFKHQDVPVDHLIAPEQLVTKAIKRLIDYPGALQVVEFADGKASLVAVKAYYG
FT                   GLLVGHALSTLKQHMPNVETRVAAIYRRGRPIRPLGTTVIEADDEVFFIAATKHIRAVM
FT                   SELQKLESSYKRIMIAGGGLIGAGLAKLLEHNHNVKLIEYSQERAKYLSAHLDKTIVFC
FT                   GDASDHELLTEENVEQVDAFIAVTNDDEANIMSAMLAKRLGAQKAMVLIQRSAYVDLVQ
FT                   GGEIDIAFSPQQATISALLTHIRRGDIVNVYSLRRGAAEAIEAIAHGDQNTSKVVGREI
FT                   RDIKLPPGTTIGAIVRADEVIIAHSNTKIEANDHVILFLVDKKFISHVEKLFQPSAFFF
FT                   G"
FT   gene            complement(24986..26299)
FT                   /locus_tag="Patl_0021"
FT   CDS_pept        complement(24986..26299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0021"
FT                   /product="16S rRNA m(5)C-967 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun)
FT                   NusB/RsmB/TIM44; KEGG: vfi:VF2545 16S rRNA m(5)C 967
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38554"
FT                   /db_xref="GOA:Q15ZY4"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZY4"
FT                   /protein_id="ABG38554.1"
FT                   /translation="MSQSKGRYQQNLRADAARVLFQILEQGMSARECLPAAQQDHNEKD
FT                   KAWLQEMTYGVLRQLPLLQHWLRLLLDKPLKKNVKVVEHLIMLGFYQLAFSRVSTHAAV
FT                   SECVNACAPLNAIATKGLVNAVLRNFIRQDTAHNLPDNEQVLSGQPKWFYKKLVDAYPD
FT                   NYKTILDAMQVKAPIWLRVNNKHKSTDEYCRLLDDRDVAYERQATQPQGIILSKGCDIT
FT                   TLPGYDEGWFAVQDGAAQLAAGLLGSQPNDRVLDCCAAPGGKTCHIIELQPDLATCVAI
FT                   DIESSRLKRIEENLTRLGHQATLICGDASEPASWWDGQLFDRILLDAPCSATGIIRRHP
FT                   DIKWLRKSSDIDVLVALQSKIIDAMWALLKPGGTMLYATCSILPAENQLQINAFLNRTP
FT                   DALLDDKFDNDAAQKPGRQILPGEKQMDGFYYARLLKA"
FT   gene            complement(26296..27243)
FT                   /locus_tag="Patl_0022"
FT   CDS_pept        complement(26296..27243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0022"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase-like; KEGG: son:SO0031 methionyl-tRNA
FT                   formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38555"
FT                   /db_xref="GOA:Q15ZY3"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZY3"
FT                   /protein_id="ABG38555.1"
FT                   /translation="MKSGLKIVFAGTPEFAANHLSALIESEHQVIAAYTQPDRPAGRGK
FT                   KLHASAVKQLAQQHDIPVYQPASLKSEEAQQQLAALNADVMVVVAYGLILPQIILDTPK
FT                   YGCLNVHGSLLPKWRGAAPIQRAIWAGDAETGVTIMQMDKGLDTGAVLSELRLAITPID
FT                   TSATLYTKLAELGPKGLLETLASLGDLTPQAQDNTLATYAEKLSKQEAKIDWTMTAAQL
FT                   ERNVRAFDPWPVAYFEANGAAIKVRSAEVQQTPICDNAKPGQIIQADKHAIGVQTGDGV
FT                   LLIKTLQLPGKKPLATQDILNGHSDWFSVGTILS"
FT   gene            complement(27253..27762)
FT                   /locus_tag="Patl_0023"
FT   CDS_pept        complement(27253..27762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0023"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: pha:PSHAa0023 N-terminal methionine peptide
FT                   deformylase; TIGRFAM: peptide deformylase; PFAM:
FT                   formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38556"
FT                   /db_xref="GOA:Q15ZY2"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZY2"
FT                   /protein_id="ABG38556.1"
FT                   /translation="MAILDVLRFPDERLRTVATPVDKIDSSIKTLVSDMLETMKDENGI
FT                   GLAATQINVHKRVVVIDVSEEQDKPQVFINPEITHMDGTTISEEGCLSVPNNYAKVERA
FT                   EKVTVKALDENGDAFTLDADGLLAICIQHELDHLKGKLFVDYLSPLKRQRIRTKLEKEA
FT                   RLAAKA"
FT   gene            28001..29080
FT                   /locus_tag="Patl_0024"
FT   CDS_pept        28001..29080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0024"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG:
FT                   pha:PSHAa0024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38557"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZY1"
FT                   /protein_id="ABG38557.1"
FT                   /translation="MLNNLLRLSLVLLLSPFWAHADVIKLKENAPRTYVVKHGDTLWDI
FT                   SNLFLHKPWYWPQIWRTNTQIINPHLIFPGDQLRLTVSAAGKPFVDLIRGEKKPYLVRS
FT                   PSATQINKSNQPIAVLPWHEIEPYFNQELVLSEKLYAELPSIVGSTKGTEYFSNNDLVL
FT                   VNHEKLPLGHYQVVRKQQSLFSAKGEFLGVQVRHVADGQALAPALPKQSLVTLSSANLE
FT                   VKRGDKLLKETPNNNVEALLNITAAIEQRGNIIADVSQYQLSGKFSVVVIDVGSSNIKR
FT                   GTVMGIYQQGAAVIDGEPPKYLAEAQTIEKLFAENDVLPQPWMKVGELLVFSVFDKVSY
FT                   ALVTRSSTVIRKGAIVAKP"
FT   sig_peptide     28001..28066
FT                   /locus_tag="Patl_0024"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            29105..30244
FT                   /locus_tag="Patl_0025"
FT   CDS_pept        29105..30244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0025"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   protein; KEGG: ppr:PBPRA3577 hypothetical Smf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38558"
FT                   /db_xref="GOA:Q15ZY0"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZY0"
FT                   /protein_id="ABG38558.1"
FT                   /translation="MYQENEHAYRETSESEQRQWLILAQLPRFSVAKLATILRKNAIQV
FT                   ADLFNANPKQLAAYGFTDGQIQQLQHPNERRLDKSLQWSEQTSSSLLNITSKHYPKVLL
FT                   QTARPPILLYCLGNKDLLNTHQIAIVGSRNPSIAGKQNAQYFAQGLSQCGWTVTSGLAL
FT                   GIDGLAHDGVLKVQGNTVAVLGTGLNNIYPKRHVKMADSILEQGGALVSEFVPEMPAKP
FT                   ENFPRRNRIISGMSLGTLIIEAAIKSGSLITARYALEQNRDVFAVPGNINNVLSKGCHY
FT                   LIKQGAKLVECVGDINDEYQHLALNFLNIQQSELQKSARQSLASDKLLDSVDFETTPLD
FT                   IVVERCGMPVAEVMSQLLEYELRGLVAAVPGGYLKLGEK"
FT   gene            30246..30722
FT                   /locus_tag="Patl_0026"
FT   CDS_pept        30246..30722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0026"
FT                   /product="protein of unknown function DUF494"
FT                   /note="PFAM: protein of unknown function DUF494; KEGG:
FT                   cps:CPS_0023 smg protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38559"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZX9"
FT                   /protein_id="ABG38559.1"
FT                   /translation="MFDILMYLFENFIHSETEIRVDQDELTDELVRAGFHQDEIYKALS
FT                   WLEKLAALQETDINPYLVKGPTSFVTRIYTHEEEMRLDIECRGFLMFLEQINVLDSTTR
FT                   EMVIDRVMEIDSKEFCLEDMKWVVLMVLFNVPGKENAYAQMEDLLFEEPEGPLH"
FT   gene            30779..31339
FT                   /locus_tag="Patl_0027"
FT   CDS_pept        30779..31339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0027"
FT                   /product="DNA topoisomerase, type IA, zn finger"
FT                   /note="PFAM: DNA topoisomerase, type IA, zn finger; KEGG:
FT                   vch:VC0050 DNA topoisomerase I-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38560"
FT                   /db_xref="GOA:Q15ZX8"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZX8"
FT                   /protein_id="ABG38560.1"
FT                   /translation="MFKIDHSLFSTHESAFDPGPCPVCNAPLQLRHSKNGAFIGCSDYP
FT                   KCEYSKPLHDSDNTELTVIEGSHCPECESELVIRKGRYGMYIACSNFPECHYVKSNKTQ
FT                   DTDKVECPSCHKGHLTKRANKYGKNFYPCDQYPQCHYALNFTPVAHACPKCAWPVMQEK
FT                   KAAAGLIWQCPERKCGYKQPAQE"
FT   gene            31408..31971
FT                   /locus_tag="Patl_0028"
FT   CDS_pept        31408..31971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0028"
FT                   /product="translation factor SUA5"
FT                   /note="PFAM: SUA5/yciO/yrdC-like; KEGG: eca:ECA3996
FT                   putative DNA topoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38561"
FT                   /db_xref="GOA:Q15ZX7"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZX7"
FT                   /protein_id="ABG38561.1"
FT                   /translation="MTANHTDDPFLLDYLAGKVFAYPTEAVFGLGCDPDNEQAVNKLLA
FT                   LKQRDVSKGLILVGDNYSQLLPYVDDSAIKMTKRTEIFSSWPGPITWLLPKSKTAPSWV
FT                   TGESEFIAVRVSAHPLIKDLCQRANKPLVSTSANTAGHPPALSADEVTSYFSNQVILID
FT                   GSLGGSRSPSKIRHGHSGQTIRDN"
FT   gene            31975..32898
FT                   /locus_tag="Patl_0029"
FT   CDS_pept        31975..32898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0029"
FT                   /product="Coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="PFAM: coproporphyrinogen III oxidase; KEGG:
FT                   pha:PSHAa0029 coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38562"
FT                   /db_xref="GOA:Q15ZX6"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZX6"
FT                   /protein_id="ABG38562.1"
FT                   /translation="MPQPHVTDIESVKQFLLDLQDNICQTLEMADGKGSFIEDNWQREL
FT                   GGGGRTRVLTNGQVIEQGGVNFSHVYGGQLPASATASRPELAGRSFQAMGVSLVIHPKN
FT                   PHVPTSHANVRIFIAEKEGEEPIWWFGGGFDLTPFYPVHEDVLHWHQTAKDLCEPFGKD
FT                   VYSKYKKWCDDYFYLKHRDETRGVGGLFFDDLNEWGFERSFAFMQAVGNGFLDAYVPIL
FT                   EKRKDTSFSEQERSFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLARWEY
FT                   DFHPIPGSKEDALYADYLHPRDWLNE"
FT   gene            33101..33784
FT                   /locus_tag="Patl_0030"
FT   CDS_pept        33101..33784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0030"
FT                   /product="OmpW"
FT                   /note="PFAM: OmpW; KEGG: cps:CPS_0029 outer membrane
FT                   protein, OmpW family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38563"
FT                   /db_xref="GOA:Q15ZX5"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZX5"
FT                   /protein_id="ABG38563.1"
FT                   /translation="MKVFKIVLSSLALTATIMGTANAYEPGDIIVRAGLTTVAPDESSS
FT                   NVTVQSVGNVGMGASVNNNTQLGLNAVYMFTSNIGLELLAASPFTHDITLNNTLDNELG
FT                   LGDGKLAESKQLPPTLSALYYFPVSETIQPYVGIGLNYTVFFDEQFVGNREAQSFNNLS
FT                   LDESFGIAAQIGMDYKLDEHWLINASVRYIDIDTEAKFDVLDLPAQVSVDIDPWVYSLM
FT                   LGYKF"
FT   sig_peptide     33101..33172
FT                   /locus_tag="Patl_0030"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            33931..34749
FT                   /locus_tag="Patl_0031"
FT   CDS_pept        33931..34749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0031"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="KEGG: vfi:VF2535 shikimate 5-dehydrogenase; TIGRFAM:
FT                   shikimate 5-dehydrogenase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase Shikimate dehydrogenase substrate
FT                   binding-like"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38564"
FT                   /db_xref="GOA:Q15ZX4"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZX4"
FT                   /protein_id="ABG38564.1"
FT                   /translation="MDRYAVFGNPIEHSKSPLIHTLFAKQTQQVIEYGRQQPDSNGFND
FT                   AINAFFTEGFIGANVTSPFKLDAFRFADELTPRARAAEAVNTLYKRQDGSILGDNTDGA
FT                   GLVQDLQRLWGELNGKRLLLIGAGGATRGVILPLLTAKVQNIHIANRTASKAQQLADRF
FT                   KKEGVITASGFNDLPEIQFDLIVNCTSSSLDGGLPEITPSIFINASYAYDMTYKAQATS
FT                   FMVWAQECTPSIRTADGLGMLVGQAAESFYVWRKVRPKIEPIIEIVREML"
FT   gene            34746..34988
FT                   /locus_tag="Patl_0032"
FT   CDS_pept        34746..34988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38565"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZX3"
FT                   /protein_id="ABG38565.1"
FT                   /translation="MNQAVQIQDGFEILDDIMVIKLIVSGLIMHCHVCGIAIGDMDEFY
FT                   QANQFDLEETISELVENEQWDENGVIHINAKSMEA"
FT   gene            complement(35035..35568)
FT                   /locus_tag="Patl_0033"
FT   CDS_pept        complement(35035..35568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0033"
FT                   /product="carbonic anhydrase/acetyltransferase"
FT                   /note="KEGG: pha:PSHAa0033 carbonic
FT                   anhydrase/acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38566"
FT                   /db_xref="GOA:Q15ZX2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZX2"
FT                   /protein_id="ABG38566.1"
FT                   /translation="MSIRMYKGIKPTLAESCYIDESSVVVGDIECGDDVSIWPLVAARG
FT                   DVNYIKIGARSNIQDGSVLHVSRVTKENPKGHPLIIGEDVTVGHKCMLHGCVLGNRILV
FT                   GMGAIVMDGAIVEDDVFIGAGSLVPPNKRLESGYLYVGSPIKQARPLKDSERAFLKVSA
FT                   DNYVRLKNEYLEEV"
FT   gene            36085..37615
FT                   /locus_tag="Patl_R0001"
FT   rRNA            36085..37615
FT                   /locus_tag="Patl_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            37720..37795
FT                   /locus_tag="Patl_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            37720..37795
FT                   /locus_tag="Patl_R0002"
FT                   /product="tRNA-Ala"
FT   gene            37814..37890
FT                   /locus_tag="Patl_R0003"
FT                   /note="tRNA-Ile1"
FT   tRNA            37814..37890
FT                   /locus_tag="Patl_R0003"
FT                   /product="tRNA-Ile"
FT   gene            38270..41154
FT                   /locus_tag="Patl_R0004"
FT   rRNA            38270..41154
FT                   /locus_tag="Patl_R0004"
FT                   /product="23S ribosomal RNA"
FT   gene            41317..41432
FT                   /locus_tag="Patl_R0005"
FT   rRNA            41317..41432
FT                   /locus_tag="Patl_R0005"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(42057..45148)
FT                   /pseudo
FT                   /locus_tag="Patl_0034"
FT   gene            complement(45151..46605)
FT                   /locus_tag="Patl_0035"
FT   CDS_pept        complement(45151..46605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vpa:VP2035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38567"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZX1"
FT                   /protein_id="ABG38567.1"
FT                   /translation="MQPLWLYLHFPNLQLDSYHVHEGAESKGYIDDTGNHKSISSIPIV
FT                   ILDTAHGIVQLNKCARQAGIQPFMSLGTAAALHGGLQVMPFNPEIEKQQLSIIAQRLYM
FT                   VVSDICFFSEQGLLLRVHNMLRLYSSLNELWSMIKSQLVPLNVSFSYATGHSPLAAKLL
FT                   AVKGWNQITDEPAAIQHALKKVDLSLTELSSKDVTKLNSIGVKTVEQLLIIPFSDLHKR
FT                   FDTQMITYLGQLRGDFKHPVIFFHPQANFKQYIELLYEIERTDLLLKPIQKLLSNLENF
FT                   LLLRDELTQELRIILYQRDKSKIEFTVRAQQGEYRAKDWLGLLALKLENVLLNAPIIAL
FT                   QLSTGKTFVRHPDKQDLFLGKQGVVSRLQLISALQAKLGDDVLFSPQTINDYRPERASQ
FT                   YCSVLTVNERNPIYRSPLRPSFLLAEPSLLTQHVSIVHGPERISTGWWDQQPVLRDYFI
FT                   AVSKEGQWFWVFKTPENTWFLQGIFS"
FT   gene            complement(46615..47304)
FT                   /locus_tag="Patl_0036"
FT   CDS_pept        complement(46615..47304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vvy:VV1296 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38568"
FT                   /db_xref="GOA:Q15ZX0"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR017166"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZX0"
FT                   /protein_id="ABG38568.1"
FT                   /translation="MNSTINQLKNKRLVWRASQASGAHKVLPSGFDALDAHLEGGLPEQ
FT                   GVVDISSPTGIGELRLLLPSFVLRQQNSDKLLVFIGAPARLNAPMLAKMGFELSRILII
FT                   EPKNAKDALWSTEQCLKSGCCDGVLLWHHGLEVHQAKRLQFAAEAGGALNIVLRQQQKQ
FT                   VFSLPVALAMQLSSSSQGIEVTILKRKGGCHSQPFTVNMSKMWPSLTRPIPANNVLPLT
FT                   GLHSLTG"
FT   gene            47478..47951
FT                   /locus_tag="Patl_0037"
FT   CDS_pept        47478..47951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0037"
FT                   /product="protein of unknown function DUF55"
FT                   /note="PFAM: protein of unknown function DUF55; KEGG:
FT                   vpa:VP2976 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38569"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZW9"
FT                   /protein_id="ABG38569.1"
FT                   /translation="MRTQMQYWLFKTEPDAFSIDDLAAKPEQTEHWDGIRNYQARNFLR
FT                   DQVKQGDKVFIYHSSCKDVGIAGLAEVVKEAYPDHTQFDPESHYYDPKSSPDNPRWVMV
FT                   DVRFVEKFPAILSLKKIKSMPEINEIGLIKKGYRLSIMPVNEHEFSALLAASR"
FT   gene            complement(47969..48841)
FT                   /locus_tag="Patl_0038"
FT   CDS_pept        complement(47969..48841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38570"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZW8"
FT                   /protein_id="ABG38570.1"
FT                   /translation="MRFLFLSVFFLIVGCNSTPNRDDYAKHINTMGKAFHGENTLAFSF
FT                   AQNEGIDLRGIHNRDDSTSSSPILYQGGAGLVGMFAQIGAHAAFINSSRNAKLAEEQER
FT                   ADNKISPLINLINGVSIFSLLDRTDSLFVKNNDIDNETLRLKPIFFSNEKMNQVILKLI
FT                   AWLPDEKGRTKNLRYQNMIQVFSPILSEDEHALFVDENNDDVKQMMARQLNTAIHILQS
FT                   DLTGRYTGLNEPQNTFTILRNDSSKVVRGSVVDNKCGFQVVQDLHSWYIAFPTKTPVQQ
FT                   DTPSSPEQC"
FT   gene            complement(48863..49564)
FT                   /locus_tag="Patl_0039"
FT   CDS_pept        complement(48863..49564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38571"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZW7"
FT                   /protein_id="ABG38571.1"
FT                   /translation="MLNFRHSVICLFIAIITLTLTACGSTPQPLVKIESNVFTKPETKV
FT                   GYVYIMPEEKATTHIYGASCLLCYGVASSLTSKLDTHLEGAIDQQELDNIRTLVLEEYS
FT                   IRTSNIKELTLANPISKLSKFKGELGFAKKDFRSLKESLDVDILVVLELHRHGAYRSFS
FT                   SYVPNGDPQGYIAGLLYAVDLNSNAYIQYLELDEKVQPEGEWDEPTTFPSVTTSYYQAV
FT                   ENIKSRIRNAI"
FT   sig_peptide     complement(49490..49564)
FT                   /locus_tag="Patl_0039"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.681 at
FT                   residue 25"
FT   gene            complement(49808..51577)
FT                   /locus_tag="Patl_0040"
FT   CDS_pept        complement(49808..51577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0040"
FT                   /product="protein of unknown function DUF885"
FT                   /note="PFAM: protein of unknown function DUF885; KEGG:
FT                   son:SO4732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38572"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZW6"
FT                   /protein_id="ABG38572.1"
FT                   /translation="MYKRSLMLAAVMLSFCFQAFGASEPSQSRKLSALLEQIWQYQLSV
FT                   DPIKATRYRNNRYNDKLKDLSPEALQTHEQRNQQFLARLKGVDDSGLNHQQKINKLMQM
FT                   RELQNDIDLYRFNAHYMPITSESGFYSSLAFLPASAPFKTQQDYQNYLARLNQFPRYFA
FT                   QQIAWMKKGIETGRVQPKSVLVGFDDTIKKFITEDLHDSQFFAPFKRLAESSFSSAVQA
FT                   SLYTQGETAINQSVWPAYQSFYDFLVNEYIPNAKQDIAANTWQNGAAFYQNRSDYYTST
FT                   NLDVADIHQTGLQEVKRIRSEMQSVLDTLNFEGDINQFIRYLRTSPEFYATSADELLMR
FT                   ASYIAKRIDATLPQLFYTLPRVPYGVAPVPDNIAPKYTTGRYIAPTRDDQPGYYWVNTY
FT                   ALDKRPLYALPALTLHEAVPGHHLQISLASEMQDLPPVRRYTYISAFGEGWGLYSEFLG
FT                   KEVGIYTTPYEEFGRLSYEMWRACRLVVDTGMHMQGWSRQQAIDYMLENTALSEHNVTT
FT                   EVDRYISWPAQALSYKIGELTIKRLRKKAEDALGDKFDLRAFHDAVLAYGSVPLSILEQ
FT                   NIDMFIEVNSKHK"
FT   sig_peptide     complement(51512..51577)
FT                   /locus_tag="Patl_0040"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(51625..51948)
FT                   /locus_tag="Patl_0041"
FT   CDS_pept        complement(51625..51948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38573"
FT                   /db_xref="InterPro:IPR014949"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZW5"
FT                   /protein_id="ABG38573.1"
FT                   /translation="MSKNTSLFRIQFIANGVRYELYVRELCQGSLFGFIEIGDFVWDNH
FT                   TSVVVDPSHEKLKDEFADVTTTYIPMHNVLRIDEVKKQGTAKISELSDKVTAFPSPIYT
FT                   PKK"
FT   gene            52248..53906
FT                   /locus_tag="Patl_0042"
FT   CDS_pept        52248..53906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0042"
FT                   /product="peptidase M28"
FT                   /note="PFAM: peptidase M28; KEGG: ilo:IL1029 probable
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38574"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZW4"
FT                   /protein_id="ABG38574.1"
FT                   /translation="MRQIMYLGMLSAGLMLAGCQSANQNATQDAPVKQSVHADAERIKS
FT                   HLRFLSDDLLEGRDTGSRGHEIASLYIASELEGYGLKPAGDDGSFLQRAPFRQASLDQA
FT                   SPSFVLETAKGSVELAYPKQYITSASPVSEMASVKGQLVFAGYGIIAPELEHDDYADLD
FT                   VKGKVVVVLSGKPASFPSEEGAHFGSTNEKKRHAAEHGAIGYVTITTPTAEKVRPYQNL
FT                   LNYIHTPTVRWLDQNGQPANVYPALKNSAYLSKEAAELLFANADMNLEQIYQLLEEDES
FT                   PKGFSLPVSIDFSKRSVHKSISSPNVAAILEGSDPTLKNEYIVYSAHSDHIGIAKTVKK
FT                   DKINNGAMDNATGTSVLLETARLFSQLAERPKRSILFVAVTAEEKGLLGSDYFAQNPTV
FT                   AKDAMVANVNLDMPILTYEFNDVIAFGADHSDLKESVSLAAQKIGLTLSPDPWPEQALF
FT                   TRSDHYSFVKQGVPSVFLVPGLQSADPAVDGSKKFGEFLATNYHKPGDDFNQPFNWKAA
FT                   TKFAEVNYYIGLTLANQAKRSSWNEGDFFGDTFSK"
FT   sig_peptide     52248..52322
FT                   /locus_tag="Patl_0042"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.444 at
FT                   residue 25"
FT   gene            54077..55933
FT                   /locus_tag="Patl_0043"
FT   CDS_pept        54077..55933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0043"
FT                   /product="protein of unknown function DUF885"
FT                   /note="PFAM: protein of unknown function DUF885; KEGG:
FT                   ilo:IL2415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38575"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZW3"
FT                   /protein_id="ABG38575.1"
FT                   /translation="MKLSIIALSLAAASLSFAALNVQARQDNESTTHTVDTAQTESQRL
FT                   ADFFANNFKQRLHRSPQFQSYLGYKWDYDKWNNISETFIEQSSELAKKQLNTLKGFDES
FT                   QLSAAEKISLALNKVSLERQLANDEFRHHTYIMDQFSAYHTMVPSFLINVHRVTNTEDA
FT                   QAYISRLQGVKTLFSQVIDQLRIRQKIGVFPPKWSYDQMLQASKNVITGAPFDSSDSTS
FT                   SIWQDFQDKVSKLELTDSERKTLLDDASNALLTSVQPAYQALIRELKVQRDLTPEGDGV
FT                   WRLPDGDKWYENRLAWFTTTDLSADEVHNIGLQNVERIHQDMRSIMKKVKFDGSLNEFF
FT                   EFMRTDKQFYYANTDEGRDAYLLEAKALIDTMRDKLPEYFSLIPQAEMVVKRVEPFREK
FT                   SAGKAFYQSPAKDGSRPGIYYANLYDMNDMPTYQMEALAYHEGIPGHHMQRAIAQELEG
FT                   IPEFQKYSSFTAYTEGWGLYTEELAKDMGFYQDPYSDFGRLAMELWRACRLVVDTGIHS
FT                   KKWSREQAINYLIENTPNPKNDSVKAIERYIAMPGQATAYMIGKLKIMELRAWSQAELG
FT                   EQFDIRGFHAQVLKDGPVPLNILEQKVKAWVADVQQSANKAG"
FT   sig_peptide     54077..54151
FT                   /locus_tag="Patl_0043"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.874 at
FT                   residue 25"
FT   gene            complement(56015..56608)
FT                   /locus_tag="Patl_0044"
FT   CDS_pept        complement(56015..56608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0044"
FT                   /product="cell division inhibitor SlmA"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: son:SO4251
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38576"
FT                   /db_xref="GOA:Q15ZW2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZW2"
FT                   /protein_id="ABG38576.1"
FT                   /translation="MAIAKKINRRAQILQALASMLQTNPGQRITTAKLAAHVGVSEAAL
FT                   YRHFPSKARMFEGLIEFIEETLFSRINKIINEEKDSTTRCQLILRLILGFAEKNPGITR
FT                   ILNGDALMGEQDRLRDRIAQLFERLETQLKQVLRERKLREGKSLPAEEAIIANFLICYV
FT                   DGRINLFIRSKFTRRPTEGFNDQWQLISTQFFLN"
FT   gene            complement(56671..57924)
FT                   /locus_tag="Patl_0045"
FT   CDS_pept        complement(56671..57924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0045"
FT                   /product="Phosphopantothenate-cysteine ligase"
FT                   /EC_number="6.3.2.5"
FT                   /note="KEGG: son:SO4249 DNA/pantothenate metabolism
FT                   flavoprotein; TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase; PFAM:
FT                   flavoprotein DNA/pantothenate metabolism flavoprotein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38577"
FT                   /db_xref="GOA:Q15ZW1"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZW1"
FT                   /protein_id="ABG38577.1"
FT                   /translation="MIPMQLAQQKILLGITGGIAAYKTPDLVRKLTALGAQVRCVMSAS
FT                   AAEFVSPLALQAVSGNPVGDDLLDRTAEAAMGHIELAKWADKVLIAPATANFMAKLTHG
FT                   LADDLLSTLCLATSAPMYIAPAMNQQMWHAQATQANLNILQQRGVTILGPAPGEQACGD
FT                   IGLGRMIEPIDIANMLAQSPMEPLLANRHIVITAGPTREEIDPVRFISNHSSGKMGYAL
FT                   AKAAVALGARVTLVSGPVNLTRPVGVDVIDVVSAEQMHNAVMTAVSKSQVNDAQSDSMQ
FT                   LNCDIFIGCAAVADYKPQQKTEQKIKKSDTELTLTFTRNPDILSDVAHLAQPPFTVGFA
FT                   AETQDVAHYAQDKLKRKKLDMIAANDVSQAGLGFNSEQNALNVYWNNGGKNLGVADKSQ
FT                   LAISLLTLVAQRHALKTT"
FT   gene            58059..58733
FT                   /locus_tag="Patl_0046"
FT   CDS_pept        58059..58733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0046"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: noc:Noc_0236
FT                   DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38578"
FT                   /db_xref="GOA:Q15ZW0"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZW0"
FT                   /protein_id="ABG38578.1"
FT                   /translation="MKITQWPAHERPREKLLTQGPDALSDAELLAIFLRTGIKGLSAVD
FT                   LARNLLNTFGSLRGLISASQQDFCLAKGLGEAKFVQLQASIELSQRFFAEQLQRETVFN
FT                   SAQQTKHFLIAQLRDEPNEVFGMLLLDSQHQLIKFRKMFFGTIDSASVYPRVLVKQALE
FT                   DNAAAVILTHNHPSGVAEPSQADEHITARIISAMSLLDIKVLDHLVVGDGVAVSFAERG
FT                   LI"
FT   gene            58861..59673
FT                   /locus_tag="Patl_0047"
FT   CDS_pept        58861..59673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0047"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   bth:BT3365 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38579"
FT                   /db_xref="GOA:Q15ZV9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZV9"
FT                   /protein_id="ABG38579.1"
FT                   /translation="MKISVIFTTYNSPVWLEKVLWGFHYQTDKNFELIIADDGSTSDTK
FT                   ACIDRFIQGSGLDIKHVWQEDDGFQKSRIMNKALLTSTCDYVLFTDGDCIPRRDFVAVH
FT                   KAHARPGKFLSGGYFKLPMPTSDLINQQHIASGQAFERTWLVENGVKRNRKLGKLTTLQ
FT                   WKRTVLNSVTPAKPTWNGHNASGWRDDIFAVNGFDERMQYGGQDRELGERLFNRGVRGI
FT                   QIRYSAACLHLEHDHRYVTPEMIAKNKAIRATTKSNKLTRTAYGIIKD"
FT   gene            59813..60049
FT                   /locus_tag="Patl_0048"
FT   CDS_pept        59813..60049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0048"
FT                   /product="LSU ribosomal protein L28P"
FT                   /note="PFAM: ribosomal protein L28; KEGG: msu:MS1942
FT                   ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38580"
FT                   /db_xref="GOA:Q15ZV8"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZV8"
FT                   /protein_id="ABG38580.1"
FT                   /translation="MSKVCIVTGKRPAVGNNRSHAKNSTRRRFLPNLQTHRFWVESENR
FT                   FVKLRLSAKGMRIIDKKGIDSVLTDIRANGVKI"
FT   gene            60062..60217
FT                   /locus_tag="Patl_0049"
FT   CDS_pept        60062..60217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0049"
FT                   /product="LSU ribosomal protein L33P"
FT                   /note="PFAM: ribosomal protein L33; KEGG: par:Psyc_1711
FT                   ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38581"
FT                   /db_xref="GOA:Q15ZV7"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZV7"
FT                   /protein_id="ABG38581.1"
FT                   /translation="MRDKIKLVSSAGTGFYYTTDKNKRNMPGKMEIKKFDPKVRQHVLF
FT                   KEAKIK"
FT   gene            60368..60898
FT                   /locus_tag="Patl_0050"
FT   CDS_pept        60368..60898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38582"
FT                   /db_xref="GOA:Q15ZV6"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZV6"
FT                   /protein_id="ABG38582.1"
FT                   /translation="MIRLTSRAWNNVLIISMLLLILMFNLTGNLFSGSSVKDETIDKLV
FT                   PTDAMLTSIVTHDYTLERVGRGWRFLMATKESYNNDLVANKNKETSDNEIDKQILTDNV
FT                   MAWQEALLEPIGEATLAGATQVNVWLAGESAPRHYLFFQVGADMLVQYPTQGAQLYKVT
FT                   NKTWSELFFDNRF"
FT   sig_peptide     60368..60466
FT                   /locus_tag="Patl_0050"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.504 at
FT                   residue 33"
FT   gene            60939..61751
FT                   /locus_tag="Patl_0051"
FT   CDS_pept        60939..61751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0051"
FT                   /product="Formamidopyrimidine-DNA glycosylase /
FT                   DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="3.2.2.23"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: ilo:IL0245 formamidopyrimidine DNA
FT                   glycosylase; TIGRFAM: formamidopyrimidine-DNA glycosylase;
FT                   PFAM: Formamidopyrimidine-DNA glycolase zinc finger,
FT                   Fpg-type"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38583"
FT                   /db_xref="GOA:Q15ZV5"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZV5"
FT                   /protein_id="ABG38583.1"
FT                   /translation="MPELPEVEVSRLGISPHLIGQHIEQIIVRHKQLRWWVPDDVHLAE
FT                   GHKVNDVRRRAKYLFIDTDAGSIILHLGMSGKLRIVNSETPVIKHDHIDIVLTNGVCLR
FT                   FNDARRFGACLWQRVGDPEIGMIAALGPEPLTSDFDGQRLYDLSRTKNVPVKNFIMDNK
FT                   VVVGVGNIYANESLFIAGIDPRKAAKKVSKKSYLALGDIIKQVLAKAIEQGGTTLKDFT
FT                   QADGNPGYFAQHLRVYGRKGQACEVCESEIQSVTLGQRNTFFCEQCQK"
FT   gene            complement(61839..62912)
FT                   /locus_tag="Patl_0052"
FT   CDS_pept        complement(61839..62912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0052"
FT                   /product="CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /note="PFAM: CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase; KEGG: son:SO4680 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38584"
FT                   /db_xref="GOA:Q15ZV4"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR016886"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZV4"
FT                   /protein_id="ABG38584.1"
FT                   /translation="MAKHYLFYISENYAFQILRPLQDEIQRRGDTVAWFVEGNNVNRAY
FT                   FKPHETQLPDVQAVIDFHPIAVFVPGNMIPSFIPGLKVCVRHGFIGFKTRKKDGLNYSF
FT                   IIRDCFDLYCTHGPSMTDTFKLLEQKHQFFKVVETGFCKMDPFFDRSMVAEKDAAANTT
FT                   AQRDERPVVLFSSTFSPRMSQAEALLPTIKRLSQDTKWRWLVTFHPKMAQSTVDAYKAA
FT                   QHENLTFIETDNAMPLMLEADLMLGDNSSMLVEFLMLNKPVVTMKNEHPKPHFINVTDA
FT                   EKIEESIEYALTRPPELMDKLDDYAAQTHPYTDGQSSARIVDATQDMLDNPPKLKNKPF
FT                   NLIRSIKMRKKLGYWRW"
FT   gene            complement(63017..63499)
FT                   /locus_tag="Patl_0053"
FT   CDS_pept        complement(63017..63499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0053"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="KEGG: son:SO4684 phosphopantetheine
FT                   adenylyltransferase; TIGRFAM: pantetheine-phosphate
FT                   adenylyltransferase cytidyltransferase-related domain;
FT                   PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38585"
FT                   /db_xref="GOA:Q15ZV3"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZV3"
FT                   /protein_id="ABG38585.1"
FT                   /translation="MHTKAVYPGTFDPITNGHADLIERAANMFAHVIVGIAANPSKKPL
FT                   FSLQERVDLIKEVTEHLPNVEVIGFEGLLADFADSQGATVLIRGLRAVSDFEYEFQLAN
FT                   MNRRLNPNLESIFLTPAEENSFISSTLVKEVALHRGKVDQFCHPAVQAALKEKLQQ"
FT   gene            complement(63548..64951)
FT                   /locus_tag="Patl_0054"
FT   CDS_pept        complement(63548..64951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_4204 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38586"
FT                   /db_xref="InterPro:IPR026950"
FT                   /db_xref="InterPro:IPR038636"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZV2"
FT                   /protein_id="ABG38586.1"
FT                   /translation="MSRYWVIGFLLVASQGWAKGLSPYLPLQISPEIESQIEKVMALTP
FT                   GAPLTKPYKAVDIMRRNKLIATRFPELHRSVDAYLARFKDTLALTHVSASISAGDDESS
FT                   PVPNQRGIKRDSSYQISASGVAFISPYAYVAGGALYADGEDAILYNTHVAFGYEYAQIE
FT                   AGYREHWLSPMQDSALLSSTNAEPSLSVTVSNATPITDWGIRYELFYSKLEDTLGVSQQ
FT                   GELFSGEPNLLGFHLSVSPVEAWTIGYSRTLKYAGANNNLSVGDAFQDLFSPSGEDKTP
FT                   ELYPQALASDQKTAISSKINLPFAFPVSLYGEIAFDHAPESKDQEADDKALAFGVYFPM
FT                   VTNNLSLRYEFTRLDELFYQSSFYTTGYTNEGLSLGHWASDLFASQDQVQKTTHSVNMN
FT                   WKFASDQVIDITFRSADSDMNSNTEQAFKELTVRYSYATQYGFWGIDLDVGEDRFGEQF
FT                   KRVSAFYRW"
FT   sig_peptide     complement(64895..64951)
FT                   /locus_tag="Patl_0054"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.776) with cleavage site probability 0.773 at
FT                   residue 19"
FT   gene            complement(65078..65797)
FT                   /locus_tag="Patl_0055"
FT   CDS_pept        complement(65078..65797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0055"
FT                   /product="lipopolysaccharide kinase"
FT                   /note="PFAM: protein of unknown function RIO1
FT                   lipopolysaccharide kinase; KEGG: vpa:VP0196
FT                   3-deoxy-D-manno-octulosonic acid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38587"
FT                   /db_xref="GOA:Q15ZV1"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022826"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZV1"
FT                   /protein_id="ABG38587.1"
FT                   /translation="MPNIQQTSKERSTIIFDAEIFAAPDLHIFDGHYWQSKQQLTGSAT
FT                   GRGTTYFFRHKNNEYVLRHYRRGGLIGKLIEDSYLFRGLSRTRAWREFTLLEQMHSLGL
FT                   PVPEPVAAQVTRHNVMYRGDIIIKRIPNSQDMFSHLCEAPQPQTTWQAIGTCIRQFHDH
FT                   NVYHHDLNIHNVMLDGAGKIWLIDFDKCAIHASNNWKKANLDRLLRSLHKEQAKQQTFH
FT                   FNEQNWQVLLSAYGEPA"
FT   gene            65951..67027
FT                   /locus_tag="Patl_0056"
FT   CDS_pept        65951..67027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0056"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   cps:CPS_4182 putative lipopolysaccharide core biosynthesis
FT                   mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38588"
FT                   /db_xref="GOA:Q15ZV0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZV0"
FT                   /protein_id="ABG38588.1"
FT                   /translation="MENDVTKTSKQDEVELILGNSNSNFSGVTSTMLQVMSYQQKLINL
FT                   RVMGKHFLPDQSQAMTFWQVVKMCRKPLSNGKYRVFHARRVDEMIQAVLLKYVFGAKIK
FT                   MVFSSAAQRFRSGSTLWLTRKMDAVVAISQSSAKYLAEPPDAIIPHGIQIENFAPAPNK
FT                   GQAWQDLGYGGKYGIGILGRVRKQKGVHLFVDACIEVLPKYPDYTAVVVGAISSSHQEF
FT                   VDELKAKIDKAGLSERIIFTGELPFERIPPIFSALSMVSALSDNEGFGLTVLEAMSCSA
FT                   AVLATQAGAWEEIIREDIDGHVVPVNDLPAVTAKMDSLLSDPEKLKQKGLAGRERVLAH
FT                   YTVEREAKALVDLFKGLQ"
FT   gene            complement(67034..68350)
FT                   /locus_tag="Patl_0057"
FT   CDS_pept        complement(67034..68350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0057"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid
FT                   transferase-like protein"
FT                   /note="PFAM: glycosyl transferase, group 1
FT                   Three-deoxy-D-manno-octulosonic-acid transferase-like;
FT                   KEGG: pfl:PFL_0536 3-deoxy-D-manno-octulosonic-acid
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38589"
FT                   /db_xref="GOA:Q15ZU9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZU9"
FT                   /protein_id="ABG38589.1"
FT                   /translation="MMKSTFTPKAKENYSLWGYTLLLCILLPFVFLHFCYQYLTKKPTT
FT                   PWARIQRFGVNICTAKTGGLLFHCVSVGEVVAAANVIKRIRQFQPEIPVTITTTTATGA
FT                   KQATDLFNDSITHCYLPIDIPWMMRRILKQAAPTHVIITEVELWPNMIDQCWRLNIPVS
FT                   VINARMTDSSMRTYAKISALFSPMLHKLHKVCAQGERDYHNYQQLHAPEQTLVLTNNIK
FT                   FEQPARPEAHQQAKEFSQMFNIASRPIIVAGSSHAPEEDVLLDAHKLILQHIPDALLII
FT                   VPRHPQRFDDVYQICKLSGLCSLRSSDERPCDTDTQVLLVDEMGKLQALYALATIAFVG
FT                   GSIADRGGHNALEPAAFEVPILMGVHRYNNPAICQVLSDNGALFEANTPEQISQKVMLW
FT                   LRNETLRKHAGKAGKQVLQENSGAVSATLQALGFAMSNH"
FT   gene            68610..69029
FT                   /locus_tag="Patl_0058"
FT   CDS_pept        68610..69029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0058"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: noc:Noc_1149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38590"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZU8"
FT                   /protein_id="ABG38590.1"
FT                   /translation="MLALVMLFGVNYAYAEQSQLRVIVNDNVKVNSLSESSVRWIFSMR
FT                   QTTWEDGSAIKVYVLHQQDPAHQNFCKDVLSMFPYQLERTWNKLAYSGLGEKPTLVRDS
FT                   QEMIDMVSQEPGAIGYVLSSSLPPNLHELHISKEG"
FT   gene            69031..70212
FT                   /locus_tag="Patl_0059"
FT   CDS_pept        69031..70212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_0951 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38591"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZU7"
FT                   /protein_id="ABG38591.1"
FT                   /translation="MTKSRVMYLLCTFSFFLTNVSHAGDFVWHGFGAQGVIQSSDSNYI
FT                   NESGDVSFSLTEVGLNTSYRINQKLRVSAQGIYINDGNRFNEGLRLDYLFLDYQLLSTQ
FT                   SWKVNAHLGRYKNYHWLYSATRDVPHTMPTIVLPQSSYFDAFRDASLGSDGISLIAQHH
FT                   NNLGEWDMRWSYGNTSVDQEQTENLMSEFATGELEHDFDTQFSLSFSPFSSGIAMGVSL
FT                   LRTDFSYDAGSNDVFIDGKAKLFRLMLNLTYSAEFWDINAEAMRERTDFIGLLPNGGIK
FT                   DTAAEGIYVQGRLFLTPQVTLLARIDMFDVDKDDRSGRLLQQNSGGTVPDYFAYRDQIT
FT                   FGASWDFHANWRVRAEFHKVKGRARLAPVFIPDTVTNDSEYWDIWALQVIYWF"
FT   sig_peptide     69031..69102
FT                   /locus_tag="Patl_0059"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            70215..72662
FT                   /locus_tag="Patl_0060"
FT   CDS_pept        70215..72662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0060"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: conserved
FT                   hypothetical protein EAL; KEGG: cps:CPS_0952 GGDEF/EAL
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38592"
FT                   /db_xref="GOA:Q15ZU6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZU6"
FT                   /protein_id="ABG38592.1"
FT                   /translation="MRIFVSLPWKIMGLLIGFLLIASVLLTFIWIDKNNQDYLSQHQAL
FT                   HDEDLSQMHLIRDMLSNRLELWFESFIHLHEDITDNPQATADFINEEFDYLQLNWQVKD
FT                   LWLLDSEYKVIFANHQHVPEYVTASAQQTLQNQSSTSNILCAQSCFQLISMPILAANGE
FT                   LLVLTATTSLLEMMAALNRSTLAELALVANIHSLELASLRDAQIQPPISNIRRQELSAL
FT                   LKLIPGGITFDMVLDKGYRLVVNEQAYLINLLPVDEKVTDPAYLLAVHDISDEWARHDS
FT                   YQFGVIIISAITVALCILTFFLMAERLRRRLLIVAKRLPLLAQKEYDEFNAMQFPHSRL
FT                   FLDEIDEVQRSSNLLGEQLESMDVKIEQNTRELENIAMYDRLTGLPNRNMLNFVLRKKI
FT                   ASLARNPEPLVVILLDFDNFRKINDSYGHGIGDEFLIIVAQRLRSNLRESDVISRFGGD
FT                   EFVIVLQEVDEVSNAMTLAEKLVTKFREPIEIGAQRFYTSVSLGITSCDEQHLTVDDLV
FT                   RQADIAMYASKDAGGDRFTLFNEGMSTRVMRHIEIEHDIRDALQQEQFKFALQAQIDIG
FT                   TGKLVGFEALIRWLHPKNGYIMPDEFIPIMENSESMITLGYWGIKRAFAILAHLESMGL
FT                   SGLRVAVNLSASQFLDPNLINFMREQLAKSEQGAEQIELELTERTVVADISHTLRIMYQ
FT                   LKELGFSFSIDDFGTGYSSLAYLSQLPVDIIKIDRSFISGMSVNSADKQIVKSTIAMVR
FT                   KLGMKVVAEGVETAEQLNTLGDMHCDIAQGYYISKPLLEDDLYQKLPSKIKEGVWKNFD
FT                   LSF"
FT   sig_peptide     70215..70298
FT                   /locus_tag="Patl_0060"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.676) with cleavage site probability 0.611 at
FT                   residue 28"
FT   gene            72809..74005
FT                   /locus_tag="Patl_0061"
FT   CDS_pept        72809..74005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0061"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /EC_number="2.3.1.29"
FT                   /note="KEGG: ilo:IL0270 2-amino-3-ketobutyrate CoA ligase;
FT                   TIGRFAM: 2-amino-3-ketobutyrate coenzyme A ligase; PFAM:
FT                   glycine hydroxymethyltransferase aminotransferase, class I
FT                   and II"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38593"
FT                   /db_xref="GOA:Q15ZU5"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZU5"
FT                   /protein_id="ABG38593.1"
FT                   /translation="MKQAFYDRLAQQISDTKAQGLYKTERVIQSQQSADIQVGDNQQVL
FT                   NFCANNYLGLANNAELIDAAKEGLDSHGFGMASVRFICGTQDIHKALEEKISAFLGMQD
FT                   TILYPSCFDANGGLFETILGPEDAIISDALNHASIIDGVRLCKAKRYRYANNDMQALSV
FT                   QLEKAKNDGAQTIVIATDGVFSMDGVIADLAGICDLADQYGALVMVDDCHATGFVGENG
FT                   RGSHEYCEVMGRVDIITGTLGKALGGASGGYTSGKKEVVEWLRQRSRPYLFSNSVAPPI
FT                   VSASLKVFDMLADGHALRAQLKRNSAHFRSRMEQAGFTMSGKDHAIIPVMLGDAKLASE
FT                   MADKMLQKGIYVVGFSFPVVPKGQARIRTQMSAAHSIGQIDRAVDAFIEVGKELGVIK"
FT   gene            74002..75024
FT                   /locus_tag="Patl_0062"
FT   CDS_pept        74002..75024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0062"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /EC_number="1.1.1.103"
FT                   /note="TIGRFAM: L-threonine 3-dehydrogenase; PFAM: Alcohol
FT                   dehydrogenase, zinc-binding Alcohol dehydrogenase
FT                   GroES-like; KEGG: son:SO4673 threonine 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38594"
FT                   /db_xref="GOA:Q15ZU4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZU4"
FT                   /protein_id="ABG38594.1"
FT                   /translation="MKSLAKLKSEKGIWLHDSEMPTVGHNDILIKIRKTAICGTDMHIY
FT                   NWDEWSQNTIPVPMVVGHEYVGEVVEIGEEVRGFAIGDRVSGEGHITCGHCRNCRAGRR
FT                   HLCRNTSGVGVNRAGAFAEYLSIPAFNAFKIPDNISDDLAAIFDPFGNAVHTALSFDLV
FT                   GEDVLITGAGPIGIMAAAVAQHVGARHVVITDVNEYRLDLARKMGASRAVNVAKESLKD
FT                   VMNDLGMSEGFDVGLEMSGVPAAFRDMLDKMNHGGKVAMLGIPSGDVAVDWNKVIFKGL
FT                   VIKGIYGREMFETWYKMASLIQGGLNLAPIITHQFNIDEFQQGFDTMGSGQSGKVILNW
FT                   "
FT   gene            75040..75360
FT                   /locus_tag="Patl_0063"
FT   CDS_pept        75040..75360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0063"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /note="PFAM: Rhodanese-like; KEGG: vvy:VV0117
FT                   rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38595"
FT                   /db_xref="GOA:Q15ZU3"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZU3"
FT                   /protein_id="ABG38595.1"
FT                   /translation="MEQFAHISVQETQQKLAAKEARLVDIRDEQSFVAGHIEGAVHLTN
FT                   GTLVNFTQETDFDTPVIVCCYHGVSSQQAAQFLLHQGFEEVYSMDGGFEAWRQSLPFVS
FT                   GE"
FT   gene            75364..76242
FT                   /locus_tag="Patl_0064"
FT   CDS_pept        75364..76242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0064"
FT                   /product="Rhomboid-like protein"
FT                   /note="PFAM: Rhomboid-like protein; KEGG: cps:CPS_0123
FT                   putative GlpG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38596"
FT                   /db_xref="GOA:Q15ZU2"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023662"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZU2"
FT                   /protein_id="ABG38596.1"
FT                   /translation="MSAPFLLVSFNQERAARLLINYLNSQGIAAQYYVDKNDVNSAEHG
FT                   VQLLSEADKDVASHIASEFVQSPQDEKYQQAAWDSGETVRLRDKNSGISASGIWQQLRD
FT                   IPFTTSVLLTCMIVYLLAMVGFFWPYKVLAIEPLPQLMENHQWWRLIGPALIHFSVLHI
FT                   VFNLLWWWTLGGQIERLLGKTTLIILFLSSALLSNVGQLLVSGEHFGGLSGVVYALVGC
FT                   VWWLGWLRPSWGLMMPKPMVGFLLVWLVVGYADVLWVSMANTAHTVGLISGCAFAFILS
FT                   RSAVNKRSINS"
FT   gene            complement(76249..76662)
FT                   /locus_tag="Patl_0065"
FT   CDS_pept        complement(76249..76662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0065"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="PFAM: flagellar basal body-associated protein FliL;
FT                   KEGG: pha:PSHAa2312 flagellar basal body-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38597"
FT                   /db_xref="GOA:Q15ZU1"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZU1"
FT                   /protein_id="ABG38597.1"
FT                   /translation="MSIVRLFGTCLVLLSTLLSPSFAQEAPSKQFAYFGLEPDIVTNYL
FT                   GTSNRKLGYVRITVELMLEDVDALEQADHHSPLLRATAIEILGRQPEERVKSLTGREDI
FT                   RRTFLDTMRKLMKKETGSNMIKDVIFTKYIYYG"
FT   sig_peptide     complement(76591..76662)
FT                   /locus_tag="Patl_0065"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.967 at
FT                   residue 24"
FT   gene            76790..77368
FT                   /locus_tag="Patl_0066"
FT   CDS_pept        76790..77368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0066"
FT                   /product="chorismate lyase"
FT                   /EC_number="4.1.3.-"
FT                   /note="PFAM: Chorismate lyase; KEGG: son:SO0131 putative
FT                   chorismate--pyruvate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38598"
FT                   /db_xref="GOA:Q15ZU0"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZU0"
FT                   /protein_id="ABG38598.1"
FT                   /translation="MQKTISHAFPLGDVTWSNQGRLSIPNAHLESWLLNTGSLTQRLQT
FT                   RCNDFKVQLVSQRQELATPAEYIQLGVSKMSQQKENWQVREVILHGDNQPWVFARSIIP
FT                   QALCEADFLELGDKPLGHLIFNDDRFKRQPFQLMCLQPDEAFLHEYGLPPLTEIWGRRS
FT                   VFCYQQYAMMVAELFLPKAPAYRDSNFDR"
FT   gene            77409..78230
FT                   /locus_tag="Patl_0067"
FT   CDS_pept        77409..78230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0067"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: sdy:SDY_4534
FT                   4-hydroxybenzoate-octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38599"
FT                   /db_xref="GOA:Q15ZT9"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZT9"
FT                   /protein_id="ABG38599.1"
FT                   /translation="MRADKPVGSYLLLWPTLWALMIAAQGLPPWHITGIFMAGVFVMRS
FT                   AGCVINDYADRKVDGKVDRTKARPLVSGVVTEKQALGLFATLVGVAFLLVLALNWQTIV
FT                   LSLGALALASVYPFMKRYTHFPQVVLGAAFGWAIPMAFMAVTEAVPAIAWWLFAINVLW
FT                   TVAYDTQYAMVDRNDDLQIGVKSTAVLFGQYDRLIIGLLQLSVVVMLLGMGQYLGFTLS
FT                   FYVGVLLASVLFIHQQRLISGRARQACFSAFLNNNYVGMAIALGIAGHYFM"
FT   gene            78268..80214
FT                   /locus_tag="Patl_0068"
FT   CDS_pept        78268..80214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0068"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region chemotaxis
FT                   sensory transducer; KEGG: hch:HCH_01925 methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38600"
FT                   /db_xref="GOA:Q15ZT8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZT8"
FT                   /protein_id="ABG38600.1"
FT                   /translation="MSNLVGTICHPAKTLMSQFRYSVKFTIISFIFLVPLILSLALLQY
FT                   EYGDDIRFMSKERQGVALVSALQDEQHALAVSLIDTHSSFTTSLSDHQASLSALASKRV
FT                   NSAAEHYQQALEKADLQEAIKSLAGLSQAIADATNLELDLALDTSYLITTLVRSLPLMQ
FT                   DQLSMTAALALKVTQAGSFTPDTYIGLSNANQKLPVMLKGLEQSIQVSLQANQEIEKTA
FT                   GEQWLSLQRNLVAYQRTVQQQILDPDNINIATNTLLLSSTSLNQQLSDFATSLVPILDG
FT                   LLEHRIEQAQFKNNVILSVSVIAVLLAVYLFIGMYLSVTENIKNVVHAVHSVADGDLSS
FT                   RVSVSGKDEMRDIASDMNHMTENLQTLVARISDAIDALSQSALNLKGITAKTKVDVTEQ
FT                   KSGTELISHSMTQLTEVAQAVDNNSGTATESAEVAHNEAQQGKQLVSRLQSVMRDMQTE
FT                   SSRSQEALNRLVEDSKNIGQVSSAINGIAEQTNLLALNAAIEAARAGEHGRGFAVVADE
FT                   VRTLAQRTQDQTNQIHDIISKLQQATKDTELSMEQSRVQMDVSVEESAVVEASLQRITE
FT                   VISTINDMSGEISHLATQQSDVTCSVASQVAEITAISESTMRGAQETEHSAEDLLVVVN
FT                   SLKNELGQLQKGR"
FT   gene            complement(80220..80471)
FT                   /locus_tag="Patl_0069"
FT   CDS_pept        complement(80220..80471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0069"
FT                   /product="protein of unknown function DUF526"
FT                   /note="PFAM: protein of unknown function DUF526; KEGG:
FT                   pha:PSHAa2763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38601"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZT7"
FT                   /protein_id="ABG38601.1"
FT                   /translation="MLDPKKLEDIAKQITEAIPPGVKTMAEGAESKVKQVLQSQLNKLD
FT                   FVSREEFEIQSNVLIRTREKLAVLEAKLEALEKSLQEK"
FT   gene            80654..82669
FT                   /locus_tag="Patl_0070"
FT   CDS_pept        80654..82669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0070"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /EC_number="3.6.1.-"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase Rep; PFAM:
FT                   UvrD/REP helicase; KEGG: ppr:PBPRA0091 putative
FT                   ATP-dependent DNA helicase Rep"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38602"
FT                   /db_xref="GOA:Q15ZT6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZT6"
FT                   /protein_id="ABG38602.1"
FT                   /translation="MKLNPGQNDAVNYISGPCLVLAGAGSGKTRVITNKIAYLVRECDI
FT                   PARYIAAVTFTNKASREMKERVAQTLGRKEARGLKVSTFHTLGLRIIKTEVKTLGLKAG
FT                   FSLFDDKDSMALLKDLTDVELGGDKEQLQLLQSCISNWKNDLLLPEQLLKRTSSAGEAE
FT                   FAEFYQRYQNHLRAYNALDFDDLILLPTLLLKHNETVRQKWQSRIRYLLVDEYQDTNTS
FT                   QYELVRLLVGQRARFTVVGDDDQSIYSWRGARPQNLVLLSKDFPDLRVIKLEQNYRSSG
FT                   RILHCANILIQNNPHVFEKKLFSELGYGSELRIITAKNEEHEAERVVAELIAHKFMQGT
FT                   SFKDYAILYRGNFQSRLFEKVLMANRIPYKINGGTSFFGRTEVKDIMAYLRLLVNQDDD
FT                   NALLRIINTPTRGIGRVTLEKLGNYANENHISMFEAACSPMLSTVISGKSLESVERFAR
FT                   WIVELSDEIKRSDSIAAIRQMIKDMGYEEWLYESSTSPKAAEMGMGNISTLFGWVSDML
FT                   EGGELDPPMSLQEVVNRLILRDMMERGEDTEETDQVQLMTLHSSKGLEFPYVFMVGMEE
FT                   GLLPHQSSIDEDNIEEERRLAYVGITRAQKELFFTLAKERRQYGEVIQPEPSRFLHELP
FT                   ADDIHWEVKKPKVSAEARQQKGQTGIAHLRDMMNKK"
FT   gene            complement(82673..85264)
FT                   /locus_tag="Patl_0071"
FT   CDS_pept        complement(82673..85264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0071"
FT                   /product="diguanylate cyclase/phosphodiesterase with GAF
FT                   sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: conserved
FT                   hypothetical protein EAL GAF; KEGG: ilo:IL0206
FT                   intracellular signaling protein (GAF,GGDEF,EAL domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38603"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZT5"
FT                   /protein_id="ABG38603.1"
FT                   /translation="MSNIPDNLSIEELRELVPQLQQLTEKYKHSEAIQKSLFDISELAS
FT                   SVGELSRLYPAIHDIIGRFMNAQNFYVAFYDQVDEVVDFVYFVDQFDEVALRQIPASEL
FT                   MEGFTGYVLRTGDYLFLTEETRETQLNQINVKQIGSGPVDWIGVPLKRGNQVIGAMVVQ
FT                   SYDKSIRYNQEDLDILLFVSQHIVNTVDRVKSREMNEQTIRERTKQLQNINEELQEEIN
FT                   ERQKVESLQNALFEISELSASVDGNMADFYASLHEIIARLISAPNCYIATISADNTRLE
FT                   FPYYSDEINTVIESREIGFGLTEFVLRSGSAELINPSKVKELTANNEIDAITAKNMIEQ
FT                   NNSWLGSPLVVDGEISGVIAIQSYSQTEHYSLRDLELLRFVSHHIAVALERKRSSDAIQ
FT                   AYNQQLTEKVKERTEELNKANQYLQKQIEERKAIQQKLVHDAHHDALTDLPNRTMFNAR
FT                   LSQALANKKRYQHNNFAVVFIDLDRFKQINDTIGHHAGDSFLIEVASRINHCIRGHDLL
FT                   ARLGGDEFVILLDNFDSPEDVEIISTRIIESIATPFVLDGREIFSGASIGIAYLESGYR
FT                   SASEIVRDADAAMYQAKSQGRGQYVVFDLTMRKKLLEELEIETEFRKALKNEAFDVYSH
FT                   PVFNMTDSTHLYDECRVRWVHPKLGIMDRDSFWQIAEHSGLVVEMDNYMLRAAYAMLSQ
FT                   PLTSYANNEYYKVAVNLSIHYLTHSEAAVQLIQDIRDRGIDPKRLIFEFDENDLNRRSQ
FT                   FSLPAIKHLKRSGIKLVLDNFGSGLASLSYLYSYPFDFVKVDHRFVKTIPRSERNLKLI
FT                   QSVYAMSEQLSFRLIVSGISDKEQVDLLRSVGCQLGQGPYLEAPSQVTLPI"
FT   gene            complement(85401..85811)
FT                   /locus_tag="Patl_0072"
FT   CDS_pept        complement(85401..85811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0072"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: vvy:VV0041
FT                   cytochrome c5"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38604"
FT                   /db_xref="GOA:Q15ZT4"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZT4"
FT                   /protein_id="ABG38604.1"
FT                   /translation="MEKIVKRKFLLCMFLGLASIFTANAAVNSDDEIKSRIAPVGKVHV
FT                   AGAKAETASAGGPRSGADVYGAACVACHSSGVLGAPKFQNAADWAPRLEKGFDTVWQNA
FT                   INGINAMPPRGTCADCSDDEIKAAIEHMTEGL"
FT   sig_peptide     complement(85734..85811)
FT                   /locus_tag="Patl_0072"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 26"
FT   gene            complement(85909..86748)
FT                   /locus_tag="Patl_0073"
FT   CDS_pept        complement(85909..86748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0073"
FT                   /product="ATP dependent DNA ligase"
FT                   /note="PFAM: ATP dependent DNA ligase; KEGG: dar:Daro_1235
FT                   ATP dependent DNA ligase, central"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38605"
FT                   /db_xref="GOA:Q15ZT3"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029319"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZT3"
FT                   /protein_id="ABG38605.1"
FT                   /translation="MSVFTPPILIFLISIHSSTVLALTKPEIELANRFNDAVNVSDYLV
FT                   SEKLDGIRARWDGSRLLTRTGNPIFAPQWFTNGLPKHIFDGELWIARQRFEKTASVVLT
FT                   HEPGDDWREVKFMLFDLPEFTGAFSERLRMLEVLVQQANLPHLQVIPQQKLHSKSALMQ
FT                   LLDQVIDGGGEGLMLHHEDALYTPSRSDNVLKLKKHQDAEAIVLAHLPGNGKYQGMMGS
FT                   IRVQMSNGKVFKIGSGFSDQERLSPPPIGAVITFKYYDLTINGIPKFASYIRQKPSY"
FT   sig_peptide     complement(86680..86748)
FT                   /locus_tag="Patl_0073"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.976 at
FT                   residue 23"
FT   gene            complement(87003..87830)
FT                   /locus_tag="Patl_0074"
FT   CDS_pept        complement(87003..87830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0074"
FT                   /product="alpha/beta hydrolase fold familiy"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: rba:RB13257
FT                   probable oxidoreductase-putative hydrolase involved in
FT                   aromatic ring cleavage"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38606"
FT                   /db_xref="GOA:Q15ZT2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZT2"
FT                   /protein_id="ABG38606.1"
FT                   /translation="MSTTKYVTVEGHQIAYEEMGEGTPLLLFHGIPTNRTLWRNVMPQL
FT                   SSQYRVIAPDLLNYGESDMPQDTDVSINAQSRIMSKFMGALGISRANIAGHDIGGGVAQ
FT                   LMAVKHPEKVDAIVLIDSVCFDSWPIPEFTPLLEPGVEEKTTTDELVSILKDFLPKGVY
FT                   DQSVMTEELVRLYVGQWSSDQGKAAMFRNLRRLNKEYTQAIAGELKHLPHKTLILWGDH
FT                   DNFQKPEYAPQLAQTIPNASLVWLENAGHWSIDEQPEKVTKLISDFLQQTENH"
FT   gene            complement(88587..88662)
FT                   /locus_tag="Patl_R0006"
FT                   /note="tRNA-Phe1"
FT   tRNA            complement(88587..88662)
FT                   /locus_tag="Patl_R0006"
FT                   /product="tRNA-Phe"
FT   gene            complement(88840..89112)
FT                   /locus_tag="Patl_0075"
FT   CDS_pept        complement(88840..89112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0075"
FT                   /product="Fe(II) trafficking protein YggX"
FT                   /note="PFAM: Fe(II) trafficking protein YggX; KEGG:
FT                   ilo:IL1984 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38607"
FT                   /db_xref="GOA:Q15ZT1"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZT1"
FT                   /protein_id="ABG38607.1"
FT                   /translation="MSRTVFCQHLNKEADGLDFQLYPGELGKKIFDNISKEAWTEWQKK
FT                   QTMLINEKKLNMMEPTARNFLETQMQAYLFEGKEPDIEGYVPPKS"
FT   gene            complement(89226..90290)
FT                   /locus_tag="Patl_0076"
FT   CDS_pept        complement(89226..90290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0076"
FT                   /product="A/G-specific DNA-adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="KEGG: son:SO3368 A/G-specific adenine glycosylase;
FT                   TIGRFAM: A/G-specific adenine glycosylase; PFAM:
FT                   helix-hairpin-helix motif HhH-GPD; SMART: Iron-sulfur
FT                   cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38608"
FT                   /db_xref="GOA:Q15ZT0"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZT0"
FT                   /protein_id="ABG38608.1"
FT                   /translation="MQSQSQLTSSFANRILTWFDSHGRKDLPWQQGKTPYSVWVSEIML
FT                   QQTQVKTVIPYYQKFMLRFPDILSLANAPQDEVLHHWTGLGYYARARNLQKAAQVIRDE
FT                   YGGVFPPDINDVVALPGIGRSTAGAVLSLACGQHHSILDGNVKRVLARYFAVDGWPGKK
FT                   DVEQALWQYADSLTPSSRTGDYTQAMMDMGATICTRSKPKCDNCPLQQSCLAFAQGRQS
FT                   ELPGKKPKKDIPVRTTVMLIPMWQSQVLIYQRPSTGLWGGLWGFYEADTLEALDKTAQQ
FT                   LGLSDYTRVTLEPFRHTFSHFHLDIQPVILQLAQPTSLQINEKQQIWYDLLNQPNVGLA
FT                   APTKKLLTVCQTQL"
FT   gene            90367..91098
FT                   /locus_tag="Patl_0077"
FT   CDS_pept        90367..91098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0077"
FT                   /product="alpha/beta hydrolase fold familiy"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bba:Bd0910
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38609"
FT                   /db_xref="GOA:Q15ZS9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZS9"
FT                   /protein_id="ABG38609.1"
FT                   /translation="MTTTLPPVASPVTLEQPVIFYPGTLCDERVFMPCWRAIDIPKRAF
FT                   VPLQWAESLDQMLALSRDRLDYFDEPVHLVGFSMGGYVAALTALEQPNRVASLTLIGSY
FT                   PGQFNQQERQARNSIIQAIKNKKYQGMSDSRLKQFVFSIDNTQVVDIIKSMESDLGPAV
FT                   LAAQMAALSEREDLTARLANANFTLHLLVGEQDKIAPPSKITALGEGLSDSRLHIFDDA
FT                   AHMLPLEQPAALAQYFAENFS"
FT   gene            91179..91898
FT                   /locus_tag="Patl_0078"
FT   CDS_pept        91179..91898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0078"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="KEGG: pha:PSHAa0553 tRNA (m7G46) methyltransferase,
FT                   SAM-dependent; TIGRFAM: tRNA
FT                   (guanine-N(7)-)-methyltransferase; PFAM: putative
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38610"
FT                   /db_xref="GOA:Q15ZS8"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZS8"
FT                   /protein_id="ABG38610.1"
FT                   /translation="MSQFKSKEEAAESGVYIRKIQSFVKREGRLTKGQEKAIESNWETM
FT                   GLEHKSGLLDMNEVFGRTAPVVLEIGFGMGKSLVTMAKNEPDKDFIGIEVHRPGIGACL
FT                   ADAQEQGVTNLRVYEHDAVEVLADCIADGSLSRMQLFFPDPWHKKRHHKRRIVQPEFVE
FT                   KLRGKLAIGGVFHMATDWENYAEHMLEIMAVAPGYKNLSSTSDYVPRPEQRPLTKFEQR
FT                   GHRLGHGVWDLMFERVA"
FT   gene            91898..92929
FT                   /locus_tag="Patl_0079"
FT   CDS_pept        91898..92929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0079"
FT                   /product="16S rRNA m(2)G 1207 methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /note="PFAM: methyltransferase small Methyltransferase
FT                   small-like; KEGG: pha:PSHAa0552 ribosomal RNA small subunit
FT                   methyltransferase C"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38611"
FT                   /db_xref="GOA:Q15ZS7"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR013675"
FT                   /db_xref="InterPro:IPR023543"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZS7"
FT                   /protein_id="ABG38611.1"
FT                   /translation="MLSAASQVLLRSEELLEQGKWLLVNPTDGHVFSALSNPEVYGFHQ
FT                   FFDIYEQSIASAKAQGRDTQHQFVAAYDTDASFDGAVLYLPKAKAHGQMLLANIVACLK
FT                   PGGTLLVVGENKGGIKSAAKLLTPYSDNVNKIDSARHCAMFAAVVDKPVASFDITKWQD
FT                   VSEHQVADISFKVCSLPGVFSHGELDTGTQLLLDNIDRVVSGRILDFACGAGIIGCFAG
FT                   LKNPQAQVVMSDVSALAIYCSQKSAELNGVKAQVIPSNGLGALTGKFAQVFTNPPFHTG
FT                   IKTDYSVTEGFMQQLKNHLQDRGSLILVANKFLRYADELDKQFKSVQTLTETTKFSVYC
FT                   CRR"
FT   gene            93048..94478
FT                   /locus_tag="Patl_0080"
FT   CDS_pept        93048..94478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0080"
FT                   /product="glycogen synthase (ADP-glucose)"
FT                   /EC_number="2.4.1.21"
FT                   /note="KEGG: ppr:PBPRB0406 putative glycogen synthase;
FT                   TIGRFAM: glycogen/starch synthases, ADP-glucose type; PFAM:
FT                   glycosyl transferase, group 1 Starch synthase catalytic
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38612"
FT                   /db_xref="GOA:Q15ZS6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZS6"
FT                   /protein_id="ABG38612.1"
FT                   /translation="MKVLFVVSEVEDLVKTGGLADVAKALPIALSEMGHEVCIVMPYYK
FT                   MLAEQHPGEDCAEPQALFASRKPYDFTIKRLQIGNVPVYAIDYPAYFARDGLYSDSYHA
FT                   YPDNAERFAFFAQGALQVAKALDFQPDIVHCNDWHTALTPYFMSIDDSGFFDRSRSIFT
FT                   IHNGAYQGTHRFSDIPFLQPHYLLHSQLDGDALNFVRMGIRYAHKINAVSPNYAQELLT
FT                   PLGSHHLYHEFQQRRNDLSGILNGCDYTQWDPINDPHIIQTYTADDMSGKEKCKIDLQR
FT                   EAQIPQDLGIPLVGMVCRLTEQKGFGYILPMLEQLMQHNVQLVIIGTGDPQISHTLRSV
FT                   AQRHPEKLAFIEAFSVQKAHMLEAGSDFFLMPSLFEPCGLNQMYSLAFGTLPIVRGVGG
FT                   LKDTVTDLADNPEQATGFVFEHPDSDALLACIQRALLFYREYPERFKATQMRAMHSRFT
FT                   WQQAAQQYLALYHEAIGG"
FT   gene            94987..96576
FT                   /locus_tag="Patl_0081"
FT   CDS_pept        94987..96576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0081"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region, ATPase-like histidine
FT                   kinase, HAMP region histidine kinase A-like; KEGG:
FT                   ilo:IL0492 signal transduction histidine kinase (contains
FT                   HAMP domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38613"
FT                   /db_xref="GOA:Q15ZS5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZS5"
FT                   /protein_id="ABG38613.1"
FT                   /translation="MAITSLALLLATCINLYGQISSYRLQLINNVNIFSELISRNAVAT
FT                   IEDELNFNEERNLSTLSASDILENVHIYRFVEDGKLEFFASYNKDGVAPVNAKFDRIEA
FT                   LSQAAIDGSTVEVIREINRDDGQLLGYTYVRASADGLERLISRSVGIAVGVLLLSLLLC
FT                   FLLTLKLQNTITAPIRNLAHLVQRISRHKDYSGRAQPSNIKELDILSDAFNAMMQRTQE
FT                   HLQRQNEAEEEHRRLNSSLEEKVTQRTLALKEANNELIQTLEKLHQFQRQMVQNEKMAS
FT                   LGDMVAGVAHEVNTPIGLGVTASTMMLDRLAGMQKDFENKTLKASSLSKFISEGQENLN
FT                   IIYRNLNRAAELISSFKQVAVDQSSEVDRVFSFSKLMDEILLSMRPKLKSMKHVIHVEC
FT                   PENLYIESKAGPINQIMINLIMNSIIHGFENKDQGEINIKISLIAEKKISVVFSDDGAG
FT                   IPEYLRKRIFDPFVTTKRGQGGSGLGMHLVYNLVTQALNGSIALTSEEGQGVEFTILFP
FT                   VKKATQTLARKN"
FT   sig_peptide     94987..95043
FT                   /locus_tag="Patl_0081"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.671) with cleavage site probability 0.663 at
FT                   residue 19"
FT   gene            96793..97500
FT                   /locus_tag="Patl_0082"
FT   CDS_pept        96793..97500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0082"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver transcriptional
FT                   regulatory protein-like; KEGG: hit:NTHI1047 aerobic
FT                   respiration control protein ArcA"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38614"
FT                   /db_xref="GOA:Q15ZS4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZS4"
FT                   /protein_id="ABG38614.1"
FT                   /translation="MLTPNILIVEDEVVTRTTLKSLFEAEGYNVFEAENGSEMHEFFEN
FT                   HAINLVIMDINLPGKNGLILAREVRDRKNIGLIFLTGRDNDVDRILGLEIGADDYLTKP
FT                   FNPRELTIRARNLLTRTLNNAEDDDLPSRVSFNGWTLDGDSRSLISPSKKEFRLPRSEF
FT                   RALHLFLSNPGKILTREQLIMEMTGRELRPNDRTVDVTIRRIRKHFESEVNADELIVTI
FT                   HGEGYRFCGTVDV"
FT   gene            complement(97568..98053)
FT                   /locus_tag="Patl_0083"
FT   CDS_pept        complement(97568..98053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0083"
FT                   /product="FxsA cytoplasmic membrane protein"
FT                   /note="PFAM: FxsA cytoplasmic membrane protein; KEGG:
FT                   vpa:VP2862 FxsA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38615"
FT                   /db_xref="GOA:Q15ZS3"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZS3"
FT                   /protein_id="ABG38615.1"
FT                   /translation="MFVLLPIVEISLLISVGEQIGGWNTVAIVVATAMIGSYLVRQQGV
FT                   STLIHAQQKMQQGTIPGQEVAEGLLLVIAGVMLVTPGFVTDALGFLFCLPMTRPLIAKG
FT                   LLAKLSVQVVNQAQGGFAGQSRQGFDSRQSSNDDIIEGEYERKDEIKPESERLNKPD"
FT   gene            98333..100111
FT                   /locus_tag="Patl_0084"
FT   CDS_pept        98333..100111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0084"
FT                   /product="Protein-disulfide reductase"
FT                   /EC_number="1.8.1.8"
FT                   /note="PFAM: cytochrome c biogenesis protein, transmembrane
FT                   region Thioredoxin domain; KEGG: cps:CPS_0953
FT                   thiol:disulfide interchange protein DsbD"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38616"
FT                   /db_xref="GOA:Q15ZS2"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZS2"
FT                   /protein_id="ABG38616.1"
FT                   /translation="MKLIASFSIFMLMSIWSFASLGQSNSFDSLFSNEPEFLKVDQAFV
FT                   FDYVQNGDQLVVTWDIADDYYLYQQQFKAVSKNASLGEPIFPTGKMKEDEFFDEPQEVY
FT                   YHKVSVTYPILQSQDDSAVKIRYQGCAEAGLCYPPTTQVVYLNAVNASDDLSNTDEASV
FT                   ESSGSVSQQFELADLLTGDQSLIWVLLIFLALGVGLAFTPCVFPMYPILSGIVIGQGKS
FT                   ISTSRAFVLSFVYVQGMALTYSLLGLVVASAGVQFQAALQHPIILGALIVVFALLALVM
FT                   FGAWEFQLPSSWQEKLNGVSNQQKSGSYLGVLLMGAISGLVASPCTTAPLTGILLYIAQ
FT                   TSDLLLGFSALYALSLGMGIPLILFGITGGKLLPKAGAWMNIIKVTFGFMMLAVALMFV
FT                   ERLVSHMATDILWSLLGLVTFSYFYVMNQASSVTFGKGVRALVIFIGLFASAMYGYQTI
FT                   FGQTSSVAGHTEQSHPRFEVVKNLDDFEQKLAAANAQGKTVMVDLYADWCVACKEFEKY
FT                   TFPDTQVVDALSNTVWMQIDLTDNTATNIAFQEHFSILGLPTILFFDLQGKEISGSRVT
FT                   GFMQASAFAAHAKNIL"
FT   sig_peptide     98333..98401
FT                   /locus_tag="Patl_0084"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.937 at
FT                   residue 23"
FT   gene            100158..101012
FT                   /locus_tag="Patl_0085"
FT   CDS_pept        100158..101012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0085"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CAC3665 alpha/beta superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38617"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZS1"
FT                   /protein_id="ABG38617.1"
FT                   /translation="MLARRFNRYIVSMLLSLMCFASSAATAETERVITLENDMQATHTQ
FT                   ARGEAIASVLLIHGWAGNMNEVGDMYKRLAAQLAEQHIASLRINIRGESEREKSGYRLT
FT                   STFSSRVTDAETGLMFLRQQYPETPTGVVGFSLGGSTTIRLMGLHPTDIDSVVLWSSAG
FT                   DPALVGQSILSPAQMREVLDNGEVKVPTWETLTVTKTHVLGMMGHDIYQNINAYSGPLL
FT                   SIRGSEDYVKPIEKTLLPLTSSVLAEARVIQGADHIFDSFNPESQYDERVIKQTLDWLI
FT                   DTL"
FT   sig_peptide     100158..100241
FT                   /locus_tag="Patl_0085"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.702 at
FT                   residue 28"
FT   gene            complement(101096..101725)
FT                   /locus_tag="Patl_0086"
FT   CDS_pept        complement(101096..101725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0086"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="TIGRFAM: uracil phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: vfi:VF1927 uracil
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38618"
FT                   /db_xref="GOA:Q15ZS0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZS0"
FT                   /protein_id="ABG38618.1"
FT                   /translation="MSVKEINHPLVQHKLGLMREAGISSKNFRELASEVGNLLTYEATR
FT                   ELETETVEINGWNDQPIKVKKIKGKKITIVPILRAGLGMLDGVMQLIPNAKVSVVGLYR
FT                   DEETLQPVAYFDKVVKDVEERTALIVDPMLATGGTLIATIDLLKEKGCQHIMGLFLVAA
FT                   PEGIEAVVSKHPDVDIYTAAVDDKLNEHGYILPGLGDAGDKIFGTR"
FT   gene            complement(101751..102350)
FT                   /locus_tag="Patl_0087"
FT   CDS_pept        complement(101751..102350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0087"
FT                   /product="protein of unknown function DUF479"
FT                   /note="PFAM: protein of unknown function DUF479; KEGG:
FT                   vch:VCA0769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38619"
FT                   /db_xref="GOA:Q15ZR9"
FT                   /db_xref="InterPro:IPR007431"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZR9"
FT                   /protein_id="ABG38619.1"
FT                   /translation="MNYIAHLHLAKHTQTSLVGNFLGDFVKGSALADFPLNIQLGVRLH
FT                   RQIDTFTDSHPRVVALKRDFPRPIRRYAGIALDVYFDHLLIQHWQQFSAPKLPMHTLFK
FT                   QFYRDLEQLNYKVSPHFARVRAGLISHQWLADYENLSACLRAMQTIEKRFSRPTQFAQQ
FT                   AMGYISENDSELRQSFLHFYPDLLRHSELFVSKLIK"
FT   gene            102565..103050
FT                   /locus_tag="Patl_0088"
FT   CDS_pept        102565..103050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0088"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: vfi:VF2385 3-dehydroquinate dehydratase;
FT                   TIGRFAM: 3-dehydroquinate dehydratase, type II; PFAM:
FT                   dehydroquinase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38620"
FT                   /db_xref="GOA:Q15ZR8"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZR8"
FT                   /protein_id="ABG38620.1"
FT                   /translation="MKDNYHFNEDSGVFLKVLLINGPNLNMLGKREPEVYGSRSLQDIV
FT                   NTLNVQAKGMGIELDHVQSNAEHELIDAIHSAYQKVDFIMINPGAFTHTSVALRDALLS
FT                   VSIPFIEVHLSNVHAREPFRHHSYLSDVAVGVICGLGEQGYAFALNAAQQHVNNQTN"
FT   gene            103110..103556
FT                   /locus_tag="Patl_0089"
FT   CDS_pept        103110..103556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0089"
FT                   /product="biotin carboxyl carrier protein"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl
FT                   carrier protein; PFAM: biotin/lipoyl attachment; KEGG:
FT                   vvy:VV3135 biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38621"
FT                   /db_xref="GOA:Q15ZR7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZR7"
FT                   /protein_id="ABG38621.1"
FT                   /translation="MDIRKIKKLIELVEESGISELEITEGEESVRIHRSGQPAAQVQYS
FT                   APIQQAAPVAAAPVVEAAPAAVAETSGHRVKSPMVGTFYRSSSPGSKPFAEVGQSVKVG
FT                   DTLCIIEAMKMMNQIESDKAGVIKEILIDNQEPVEFDQPLFIIE"
FT   gene            103571..104920
FT                   /locus_tag="Patl_0090"
FT   CDS_pept        103571..104920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0090"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /EC_number="6.3.4.14"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase;
FT                   PFAM: Carbamoyl-phosphate synthase L chain, ATP-binding
FT                   Carbamoyl-phosphate synthetase large chain-like biotin
FT                   carboxylase-like RimK-like ATP-grasp; KEGG: ppr:PBPRA3406
FT                   putative acetyl-CoA carboxylase, biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38622"
FT                   /db_xref="GOA:Q15ZR6"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZR6"
FT                   /protein_id="ABG38622.1"
FT                   /translation="MLDKVLIANRGEIALRILRACKELGIKTVAVHSTADESLKHVLLA
FT                   DETICIGKPSATESYLNIPRIIAAAEVTNSVAIHPGYGFLAENADFAEAVERSGFIFIG
FT                   PKAETINLMGDKVSAIKSMKAAGVPCVPGSDGPLNDDEARNKKLAQGIGYPIIVKAAGG
FT                   GGGRGMRVVRSEEELIGAIAATKGEAAAAFNNDVVYMEKFLENPRHVEIQILADGQGSA
FT                   IHLGERDCSMQRRHQKVVEEAPAPGITEEMRAKIGARCCQACIDIGYRGAGTFEFLFEN
FT                   GEFYFIEMNTRIQVEHPVSEMITGVDLIKEQLRIADGQKLTISQEQIQVRGHAIECRIN
FT                   AEDPDTFIPSPGKINMFHPPGGLGVRWDSHIYAGYSVPPNYDSMIGKLITYGETREVAI
FT                   ARMRHALGELVIEGIKTNIPLQQRIMADEAFAAGGANIHYLEKKLGLGGH"
FT   gene            complement(104987..106351)
FT                   /locus_tag="Patl_0091"
FT   CDS_pept        complement(104987..106351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0091"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: cps:CPS_2888
FT                   MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38623"
FT                   /db_xref="GOA:Q15ZR5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZR5"
FT                   /protein_id="ABG38623.1"
FT                   /translation="MPTSRDLTVPPVHQVLVKLTLPMIFGIIAVLSVSLIDTYFVSQLG
FT                   TEHLAALSFSFPITMSISSLAIGLGVGAASAVSRAVGSNDKEQAKRLSTDSLLLGILVV
FT                   MFVAILGYTYVKPLLSLLGATGQVLELGARYMRIWFISVPFLVVPMIANALIRSVGDAF
FT                   WPSLMMIGSALVNIVATPILIFGWGVIPAFNIEGAAYGTLLAQVLTLFASLAILVMREK
FT                   LLSFQLASKEQLVASWRYLLSIAVPAAAGNMVNPLSIAIVTAIVAWFGEKSVAAFGVAT
FT                   RIEFFAVIPMLALSSAIGPLAGQNWGAGKVQRIIDGLKISYWVCIVWALMLSAFLWFTG
FT                   PFIVGAFTDDGKVSAQALSYLRIIPLSVWGYGIVIVAAAAFNSIGKAKVGLGFYVVRSA
FT                   LFYVPLSWLGATFAQIDYAFFGIAVANVVSGIAIGWYSLWRLNRIQAKETADAPG"
FT   gene            106492..107370
FT                   /locus_tag="Patl_0092"
FT   CDS_pept        106492..107370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0092"
FT                   /product="[LSU ribosomal protein L11P]-lysine
FT                   N-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: ribosomal protein L11 methyltransferase;
FT                   PFAM: methyltransferase small ribosomal L11
FT                   methyltransferase Methyltransferase type 12; KEGG:
FT                   cps:CPS_0540 ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38624"
FT                   /db_xref="GOA:Q15ZR4"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZR4"
FT                   /protein_id="ABG38624.1"
FT                   /translation="MPWIQLIIDTKAKYAEQVGDMLSANGAQAVTFVDAKDTPMYEPKP
FT                   GEVMLWPETQVMGLYEADYDMDGVVARMSKSKVLGADFPHKLDQLEDKDWEREWMDNFH
FT                   PMRFGQRLWICPSWRDVPDPSAVNVMLDPGLAFGTGTHPTTALCLRWLDALELSDKLVV
FT                   DFGCGSGILGIAAIKLGAKRVVGIDIDPQALLSSQTNADRNHIGDKIELYLPEHQPELK
FT                   ADVVLANILAGPLRDLREVITAYCKSGGKLVLSGILAEQAQGINDLYSQDFHMEPIEID
FT                   GEWARVSGKRK"
FT   gene            complement(107394..107906)
FT                   /locus_tag="Patl_0093"
FT   CDS_pept        complement(107394..107906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0093"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix, HxlR type; KEGG:
FT                   hch:HCH_00848 predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38625"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZR3"
FT                   /protein_id="ABG38625.1"
FT                   /translation="MKWSQINEQSCSIARSAAIFGDRWTLLILRDIFWKVTKFSELQKS
FT                   LGITKHRLSDRLNRLVDSGVLYKDLYDENRQHFEYKLTEKGLDLYPIMLAIVHWGDKWE
FT                   GDLDGPPVHYFHTTCGEAGTAHVACSICGEAMNVNNTSGALGAGILNKVERGEETGIKL
FT                   DIYAGNS"
FT   gene            108325..108507
FT                   /locus_tag="Patl_0094"
FT   CDS_pept        108325..108507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0094"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cps:CPS_3716 glycosyl hydrolase, family 16"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38626"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZR2"
FT                   /protein_id="ABG38626.1"
FT                   /translation="MRAFDTSTENDIVFILSDAAVTINLAYVPLNLSNLTQIAIFGVGG
FT                   DQGNSIYITDMNLSK"
FT   gene            108792..109910
FT                   /locus_tag="Patl_0095"
FT   CDS_pept        108792..109910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0095"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: ath:At2g36310 inosine-uridine preferring
FT                   nucleoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38627"
FT                   /db_xref="GOA:Q15ZR1"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZR1"
FT                   /protein_id="ABG38627.1"
FT                   /translation="MFQGFSCLSNASLLFVFSIFCSTASAEKVIYDTDMGIDDWSAMLV
FT                   VANHPEIELLGVTSNGVGEGHCADNMVNIPGLLALSNSPDVPFACGDDFPMDGYYAFPA
FT                   PWRQQADTLSGVPVPKTNRKPTELDAVDLIHQLLSQQNEQVVLLSAGSLTNIAQWLQKY
FT                   PQDIPKVSRLVMMGGGFDAPGNIIVPGFTGDHPNKKAEWNIYVDAVAADIVFASDLAVE
FT                   VVGLDLTNQVMVTPEYAKRFKSQVKTQAAEFWDKVLDDNDWFIESDEYYFWDVLAALVV
FT                   VEPELCQGEMQSVWVEYTKVAAGDKWVDTSMPDVTEAGLPRSHYDPATFGITRIGGDNP
FT                   KVKICRHTQPQRAFDALIEILNIEKQSGNKAI"
FT   sig_peptide     108792..108872
FT                   /locus_tag="Patl_0095"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.982 at
FT                   residue 27"
FT   gene            complement(110016..111032)
FT                   /locus_tag="Patl_0096"
FT   CDS_pept        complement(110016..111032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38628"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZR0"
FT                   /protein_id="ABG38628.1"
FT                   /translation="MLDVAEKMSAQGVESFQALQKSSEWPALQSMLKQWEPGLQRIENF
FT                   IPWPKKHISHGFDNMLGRSRHLQVENLGMTAVSNDDFQRVFDLYTAKNKTDKEATRTRW
FT                   EQACLSILGDAPDAKAKINELMGLATEAYHYNFAVCLSSQFSERKILVETRYSRAFADL
FT                   IQLGQPTESELVDIPSIQIPQKLRFDRPQLWKELVDPFSEVAGVQKEYQDVMEQFFAGQ
FT                   ANAKLVEEVSIKYSRALSEHFESDEPDGGIKKVALSIGFLGLGLVAGGPVTAGLLWLAE
FT                   NSLLPTVTRVFKLRDKGFFKKQASAQPLDLSRKNTLSSVSISLPLAKKLAKDIPDFA"
FT   gene            complement(111033..111287)
FT                   /locus_tag="Patl_0097"
FT   CDS_pept        complement(111033..111287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38629"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZQ9"
FT                   /protein_id="ABG38629.1"
FT                   /translation="MQQALTYLGTLDDVVQRYPWNIEMGQPQFNQMLVRKALLGEKVII
FT                   NDGYLLNHPFARHALLNPSSSPLKALIEANFVQIMSRSG"
FT   gene            complement(111594..112109)
FT                   /locus_tag="Patl_0098"
FT   CDS_pept        complement(111594..112109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0098"
FT                   /product="sodium/calcium exchanger membrane region"
FT                   /note="PFAM: sodium/calcium exchanger membrane region;
FT                   KEGG: cef:CE0451 Ca2+:cation antiporter, CaCA family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38630"
FT                   /db_xref="GOA:Q15ZQ8"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZQ8"
FT                   /protein_id="ABG38630.1"
FT                   /translation="MGLSALFCGLVIIGFGTSMPELFVSVNAALNNQPDIAIGNVIGRN
FT                   IANVLLILGLCAMIMPLTVATISLRRDALVVVAASVLCIALSSEGVTSFVEGLFLLGAL
FT                   AAYLTWTYLSKKGQSAPAAELHAAGGQEIENVPQSMFWSVVQSVVGLGLLIAGSQILHK
FT                   GAVALRTV"
FT   gene            112604..114013
FT                   /locus_tag="Patl_0099"
FT   CDS_pept        112604..114013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0099"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cps:CPS_1161 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38631"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZQ7"
FT                   /protein_id="ABG38631.1"
FT                   /translation="MFKGSVLLGVGILLAGCGGGSGSSSTPSSGSTGGGTTPVAKNVSA
FT                   ALEYVNACGMSIPATDAAVIVHNNDMSNKDVFFADQSGNVTIENSQDTLTLSVVFRGQS
FT                   EVAGVKPVHMKTYIDHPAIELGTLKHFTKDASTCECQTTNVVVNLPDSSLFPSSSSLRN
FT                   YKSIGGKSSDFGRVAFSDVEYCKDQDDKWPVLTAFVKVTDDETYGAVLDNISAVSEVDA
FT                   TLTGQALSVNTRAPYKQYSARIGNAQHFSNSVYSSQESIHSFNSDLIEQHYVSAYSIQN
FT                   LDNIPEAEDAFELSIVEKRTQDVNQTFDLTLPILDYPALGAILEESGSYSITHNRDFDF
FT                   VFLAVEAIHDDKPLLDWQVLAPLSGRSIPIDNIDIEQFIPEASLDQSVDSVLITLAAEG
FT                   YDYINSYDEFLRTDIAQRNSQAEPEESMYYFSQRSFVMSELDFSAKAAKVISTDMPRAK
FT                   STISAKALPIR"
FT   sig_peptide     112604..112696
FT                   /locus_tag="Patl_0099"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.694 at
FT                   residue 31"
FT   gene            complement(114100..114525)
FT                   /locus_tag="Patl_0100"
FT   CDS_pept        complement(114100..114525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0100"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: pha:PSHAb0179
FT                   putative OhrR transcriptional regulator, MarR/EmrR family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38632"
FT                   /db_xref="GOA:Q15ZQ6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZQ6"
FT                   /protein_id="ABG38632.1"
FT                   /translation="MSFENLQLKNQLCHRLYMASNNIARAYREPLLALNLTYPQYVVMM
FT                   ALWEKDGITIAQLIEQTAIDGGAMTQILKKMADKELLNIIKDEQDKRKRVIKLSDSGQA
FT                   LKLKATDVPDKVLCQFAAITPAQSKQLMDLLDLVVAV"
FT   gene            114655..115083
FT                   /locus_tag="Patl_0101"
FT   CDS_pept        114655..115083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0101"
FT                   /product="OsmC-like protein"
FT                   /note="PFAM: OsmC-like protein; KEGG: pha:PSHAb0180
FT                   putative organic hydroperoxide resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38633"
FT                   /db_xref="GOA:Q15ZQ5"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZQ5"
FT                   /protein_id="ABG38633.1"
FT                   /translation="MNVLQNVAYTAKATATGGRAGSAKSDDGRLDVTLSTPKGLGGDDG
FT                   QGTNPEQLFAAGYAACFIGALKAVAGQAKIALPSDVYINSEVSIGGIENGFGIAAKLAV
FT                   SLGDMDKRQAQALVEKAHHVCPYSNATRGNIEVEISVI"
FT   gene            115463..116398
FT                   /locus_tag="Patl_0102"
FT   CDS_pept        115463..116398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0102"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities, AAA_5; SMART: ATPase; KEGG: bja:blr6138
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38634"
FT                   /db_xref="GOA:Q15ZQ4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZQ4"
FT                   /protein_id="ABG38634.1"
FT                   /translation="MIIKHQEKIASPEVIQRQFEALGYICSPSVATAIYLACHLQKPIL
FT                   IEGPPGVGKTELAKITAAYLNAPLIRMQCYEGLDESKALYEWKYGKQLLYTQVLKEQLG
FT                   DVLRGARGLDESIARLHDFGDIFYSQDFLEPRPLLQALQSEEGAVLLVDEIDKADQEFE
FT                   AFLLELLSDYQVSIPEIGTVKACSTPIVMLTSNNTRELGDALKRRCLHLYIPFPDTELE
FT                   SRILAAQVDNLDAQLREQIVALMAKLRDMPLKKSPAVSETIDWARALLLLNVEELDPHW
FT                   VKETLNLLLKFQDDIELVEPEITNLLKGLA"
FT   gene            116399..117769
FT                   /locus_tag="Patl_0103"
FT   CDS_pept        116399..117769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0103"
FT                   /product="VWA containing CoxE-like protein"
FT                   /note="PFAM: VWA containing CoxE-like; KEGG: rpb:RPB_0718
FT                   VWA containing CoxE-like"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38635"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZQ3"
FT                   /protein_id="ABG38635.1"
FT                   /translation="MRFIADFIGALREAGLPISPAESLDAIKAIGLLGLGSRATAKSVL
FT                   ALTLVKRQQDQATYHELFELYFANIENEKDGDDGTLESPAATDKQQKQNRENAEAKGGS
FT                   VATASSALGQFLAQQQDMALAIAQAAKAEDLSSIVFFTQKNHFAYKIMQRLGGDELSAE
FT                   LRATPDSPEQKRLQDQLTQARARLLEQVKDYVEQQYLIFARHKGAKFREDHLQQAKLSQ
FT                   LEHTDYALMQRLVQKAARKLATQHSRRRLTRKRGQLDVRKTIAANAAFDGALFHTRWKA
FT                   TRVERPKIMVICDVSGSVSRVARFLLLFLYSLQDVIPKVRSFVFASDMIEVTTLLQQED
FT                   IESALEKIMQRWGGLSTDYGKALAGFQDQALTSIDKKTTVILLGDARNNDGDGRTDIWQ
FT                   KVYRQSKRVLWLNPEQHNSWDTGDSIMSEYSPWCSSVEPCRNLKDIEGIFGRILKYS"
FT   gene            complement(117774..118760)
FT                   /locus_tag="Patl_0104"
FT   CDS_pept        complement(117774..118760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0104"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix, AraC type; KEGG:
FT                   pfl:PFL_5085 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38636"
FT                   /db_xref="GOA:Q15ZQ2"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZQ2"
FT                   /protein_id="ABG38636.1"
FT                   /translation="MADAKWRVALLIFNGAWASTVYGSMELFHSVNLRRPKDQQFHCDL
FT                   VSADSQPVQLYGGQSIQGDAVIGDEPYNLIMLAHYWGDFQHLTEQYPSIPPWLAKQHAK
FT                   GARIAGVNSGIFWAAEAGLLDGGRATTYWRHLREFELRYPKVQWQANQASVEHARIYSS
FT                   NGQNASMDLSLHLVEKFCGASIAAGLARDISFDSRRTYDLNLINIAGFRQHRDVGIHRA
FT                   QDWLDEHFTQSVELQALANQIGMSRRTFIRRFQKATGELPSRYLQRLRIEAAKHRLGNT
FT                   QDSIKTIGMGVGYRDISSFSKVFKSLTDVTPREYRQRLRPTDTKTQA"
FT   gene            118957..120147
FT                   /locus_tag="Patl_0105"
FT   CDS_pept        118957..120147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0105"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase-like; KEGG: ccr:CC1310
FT                   acyl-CoA dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38637"
FT                   /db_xref="GOA:Q15ZQ1"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZQ1"
FT                   /protein_id="ABG38637.1"
FT                   /translation="MQQVDITFSAEELAFRDQVREFLAENWTEDLARRIRGEDEEFKAA
FT                   QIEWQNKLNDKGWLAPGWPVEHGGVAWSVTENFIFETERSLAGAPDVVPFGLKMVAPVI
FT                   YGFGNDEQKKRFLPRILKSQDWWCQGYSEPGAGSDLAALKTKAELDGDDYIVNGAKVWT
FT                   TYAQYADWIFCLVRTDSSGKRQDGISFLLIDMKSPGITVNKISSIDDHHSLNEVVFDNV
FT                   RVPVANRIGEQDKGWTYAKALLAHERTSIAAVADSKRRLRDLRKLLSEEISGGRPLIED
FT                   VQFQNRLSNTEIELMALEYTELRVLASTADGKGPGVESSLLKIKGTEIQQAIQQMYMDL
FT                   AGYYSGVLHGDETAESIGHAFGHDARKAYMYGRAATIYGGSNEVQKNITAKYVLGL"
FT   gene            120150..121289
FT                   /locus_tag="Patl_0106"
FT   CDS_pept        120150..121289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0106"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase-like; KEGG:
FT                   rpb:RPB_1750 acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38638"
FT                   /db_xref="GOA:Q15ZQ0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZQ0"
FT                   /protein_id="ABG38638.1"
FT                   /translation="MNFNLSEEQNMLKDSVARFVQDEYDFEARRSNAANALGFNPDNWQ
FT                   TFAELGWLSIPFEEAYGGFGGGPTDVMAVMEEMGKGLVVEPFVATVLMFGGLLSKSGNA
FT                   ALKDANIEKIIDGSLQGAFAYVERQSRFELADVKTQAKRDGDDFVLSGEKTVVFNGAAA
FT                   NKMIVSARTSGDQCDEAGITLFLIDADAPGVQRTAYRLMDGQLVANIKLTDVRVAANHV
FT                   VGEVDDGYQLIDAVVSDVTIALCAEAMGIMQKLNTTTIEYTKTRQQFGVAISSFQALQH
FT                   RMVDMFMAGEQAKSILYRAVCAAESGAEDLAKNIAALKVMIGRNGKLIGDEAIQLHGGM
FT                   GLTDELDVGHYVKRLMMINTTFGDADYQQQKFNRLAYTD"
FT   gene            complement(123037..123513)
FT                   /locus_tag="Patl_0107"
FT   CDS_pept        complement(123037..123513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0107"
FT                   /product="transcription elongation factor GreB"
FT                   /note="TIGRFAM: transcription elongation factor GreB; PFAM:
FT                   transcription elongation factor GreA/GreB region; KEGG:
FT                   vpa:VP0152 transcription elongation factor GreB"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38639"
FT                   /db_xref="GOA:Q15ZP9"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZP9"
FT                   /protein_id="ABG38639.1"
FT                   /translation="MKTKLITPEGYKKLNDEHDELWLKQRPEITKIVTWAASLGDRSEN
FT                   ADYQYNKRKLREIDRRVRYLRKLLPELQIVNYSPQQAGKVFFGAWVEIENDEGETKQFR
FT                   IVGPEEIYGDAKGYISIDSPMARALIKKEVDDVASVKTPTGYKDWYVTSIEYKK"
FT   gene            complement(123970..124719)
FT                   /locus_tag="Patl_0108"
FT   CDS_pept        complement(123970..124719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0108"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: FKBP-type peptidyl-prolyl isomerase-like
FT                   peptidylprolyl isomerase, FKBP-type; KEGG: pha:PSHAa2901
FT                   periplasmic peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38640"
FT                   /db_xref="GOA:Q15ZP8"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZP8"
FT                   /protein_id="ABG38640.1"
FT                   /translation="MKKTAIAILITSAIGLTACGQQDTDLLKVEEQKLETEAQQQAYAM
FT                   GASVGQFIEQKMNEQEALDVNLDKDLVVKGFVAALQGQSQLDMKEIQTLTLAMEAASRE
FT                   KQKAISDAKAETNIADGEKFLTENAEREGVTVTDSGLQYEVMSEGEGASPTAEDTVTVH
FT                   YKGTLLDGTEFDSSYSRGEPATFPLSRVIPGWTEGVQLMKVGSKFKFFIPSELAYGERA
FT                   TGKITPNSTLVFEVELLDVASAEGAAE"
FT   sig_peptide     complement(124657..124719)
FT                   /locus_tag="Patl_0108"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.953 at
FT                   residue 21"
FT   gene            124838..125812
FT                   /locus_tag="Patl_0109"
FT   CDS_pept        124838..125812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0109"
FT                   /product="WD-40 repeat-containing protein"
FT                   /note="PFAM: WD-40 repeat; KEGG: pha:PSHAa2902 G-protein
FT                   beta WD-40 repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38641"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZP7"
FT                   /protein_id="ABG38641.1"
FT                   /translation="MTVLLRLSLILLLLTGCSGQSSTPVTSWRHADDGAYAADISADAS
FT                   LAVVSSVTGGIAVWDLKKNEKRYTWQHQGEGNNLVANVHIAFDNSYVVTSDRDAFALWN
FT                   VASGEPEGFWRIDESSIRDVAVSNQGRGILVGRGNGKVMFFEPKTGRRLEFLGHQEKVN
FT                   SVDLSPNGFYALTGGNDYTAYLWDTRTGQVIHSFTHSSRVTKVALDDEGRYGFTADSKR
FT                   DARVWDLVTGEEVSNLHYLARQKIFSSAAFSQDGQYLLTGSPAKRLNLWRVTDGKEIQE
FT                   WQVSPREGSRPQTAVVYGVGFAKDKQIVSESSSGLAEFWQINQ"
FT   sig_peptide     124838..124903
FT                   /locus_tag="Patl_0109"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.446 at
FT                   residue 22"
FT   gene            125825..126037
FT                   /locus_tag="Patl_0110"
FT   CDS_pept        125825..126037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0110"
FT                   /product="SlyX"
FT                   /note="PFAM: SlyX; KEGG: vpa:VP2780 SlyX protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38642"
FT                   /db_xref="InterPro:IPR007236"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZP6"
FT                   /protein_id="ABG38642.1"
FT                   /translation="MQHIEADIEQLQMKVAFQEDTIEELNKALIKQQKQLELLEFQLSH
FT                   VINKVKEIDVPSGDSQEVEPPPPHY"
FT   gene            complement(126077..126283)
FT                   /locus_tag="Patl_0111"
FT   CDS_pept        complement(126077..126283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; KEGG:
FT                   cps:CPS_0434 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38643"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZP5"
FT                   /protein_id="ABG38643.1"
FT                   /translation="MTTKIKKRFIAGATCPQCKSMDTLMLYFENNVEKMECVQCHYQQT
FT                   QTDKEVTQASRQSENVIGVFKPE"
FT   gene            126363..128315
FT                   /locus_tag="Patl_0112"
FT   CDS_pept        126363..128315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0112"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   ppr:PBPRA0301 putative ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38644"
FT                   /db_xref="GOA:Q15ZP4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZP4"
FT                   /protein_id="ABG38644.1"
FT                   /translation="MIQISDLSLMRGNKTLLHETNAVLYPGHKAGLIGANGCGKSSLFA
FT                   LIRGELHPEQGECNIPKDWQVVSVAQETPAVERSALDYVIDGDKLYRRLQAELRAAEDA
FT                   HDGVKIAALHGQLDHAGAYDIESRAATILAGLGFANDAIARPVTAFSGGWRMRLNLAQA
FT                   LLCHSDLLLLDEPTNHLDLDAVIWLEKWLQRYAGTLLLISHDKSFLDSTVNEIISVEQQ
FT                   QLVSYTGNYDAFERQRAERLRLQNLQFQKQQDKIAHLESFINRFGAKASKAKQAQSRVK
FT                   QLEKMETLLPALAASQFSFEFFMPPKLPNPLVKMEQVRLGYDDTIILEKLHLNLVPGSR
FT                   IGLLGRNGAGKSTLIKLLAGEKEPMQGIYETSAGLRIGYFAQHQLEYLRADDSALAHIQ
FT                   RLDPKATEQSLRDYLGGFGFRGDDALGRVAPMSGGEKARLVLALTVYQKPNLLLLDEPT
FT                   NHLDLDMRHALNMALQGFEGAMVLVSHDRFLLTSVCDDFYLVDNQQVTMFDGDLDDYRD
FT                   WLLKSDREKQSADKLATAKGAADKEGAENKEPKLDRKIIKRLEAEFRQATQSLRKTVQT
FT                   QEKKMAELEAKLEGIEQKMADPDIYNADKKAELKVLLADQASCKVAQEEAEMLWLDAQE
FT                   QIEAKQAEFDAQVTG"
FT   gene            128355..128924
FT                   /locus_tag="Patl_0113"
FT   CDS_pept        128355..128924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0113"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   reu:Reut_A1932 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38645"
FT                   /db_xref="GOA:Q15ZP3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZP3"
FT                   /protein_id="ABG38645.1"
FT                   /translation="MSQQLETDRLILRNWKASDYEPFYALNSDLEAMRYFPSPYTRAQS
FT                   DHLADKCQSLIQRRGWGLWAVSEKEDEAFIGFVGLHTPNANMPCSPCVEIGWRLLPQYW
FT                   GNGFATEGAKKALEYAFNELGLPEVVSFTSKKNQPSRAVMARIGLQDSLNNFIHPDIAP
FT                   EHPLAEHVLYHITRNAWLEQTSQSGK"
FT   gene            complement(128929..129813)
FT                   /locus_tag="Patl_0114"
FT   CDS_pept        complement(128929..129813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0114"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR LysR,
FT                   substrate-binding; KEGG: cvi:CV0764 probable
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38646"
FT                   /db_xref="GOA:Q15ZP2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZP2"
FT                   /protein_id="ABG38646.1"
FT                   /translation="MNLHALRVFHSVAHLGSFSQAAEALYISQPAVSKALKELEHQLGM
FT                   QLIERAAKGKKLALTQGGQSLFNHARSIFAIEQAALEDVRARTGLKQGTLVIGASTTIA
FT                   GYWLAPYLARFNQQYPKIKVEVQVANTAQIEQALLACTIDFALVEGSASDPHISSQHWQ
FT                   DDPMSIVYSSSLKPADDKEKWLSEQRWLLREPGSGTRQMSFSLLAEQGIAVNDSMQLGS
FT                   NEAIARGVTQGMGVALLPQVVTEDLLALKKLKVISTQKSKLLSRPLYQLEYRDRPSSPA
FT                   ANAFAQILYQAVN"
FT   gene            129932..131038
FT                   /locus_tag="Patl_0115"
FT   CDS_pept        129932..131038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0115"
FT                   /product="conserved hypothetical protein 698"
FT                   /note="PFAM: conserved hypothetical protein 698; KEGG:
FT                   yps:YPTB1338 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38647"
FT                   /db_xref="GOA:Q15ZP1"
FT                   /db_xref="InterPro:IPR004630"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZP1"
FT                   /protein_id="ABG38647.1"
FT                   /translation="MFGAVKRFFITGQDGTSSTRHHYGDSRWWLGLVLVTSIAFIATYL
FT                   SHVSFVQHLGLSALTIGIVLGIIVGNTLFSRMATHTDVGVDYAKSTLLKAGVVLFGFRI
FT                   TFAQVAGVGWQGLITDIAILSLTFWLAVQLGKRVFKLDEQTTILIGAGSAICGAAAVMA
FT                   TEPVVKAQAHKVSVAVATVVVFGTLSMFVYPIAQGYLGLSEHAYGIFAGSTIHEVAQVV
FT                   AAGSAVSPEAANAAVIEKMLRVMMLAPFLVLLSLWQSNKRATGKVVDGASSQGDSGKSN
FT                   IMIPWFALLFIVASGINSSQLVSPDITEQVVHLDGVLLTIAMVALGLRTHIGAIRQAGV
FT                   KPLLLASCLFLFLTLGGYGLNLVIAQWL"
FT   gene            complement(131145..133427)
FT                   /locus_tag="Patl_0116"
FT   CDS_pept        complement(131145..133427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0116"
FT                   /product="putative alpha-1,2-mannosidase"
FT                   /note="TIGRFAM: putative alpha-1,2-mannosidase; PFAM:
FT                   glycosyl hydrolase 92; KEGG: bfs:BF1814 putative outer
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38648"
FT                   /db_xref="GOA:Q15ZP0"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR041371"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZP0"
FT                   /protein_id="ABG38648.1"
FT                   /translation="MKILVNMAVAALTLAGVGCSVAKTPNDVTGETSQKTPAEYVNPFI
FT                   GTSNFGATHPGAQYPHALTSVAPFNVAFEHKKLNEFEKDAAWNSRVYIHENKFLTGFTH
FT                   VNLSGVGCPELGVINIMPTAGNLELDAQQYGSTYSNEQASPGYYQTTLDKYGIKAEATS
FT                   TLRTGLSRYTFPAGQSNIIVNLGLGLTNETGGSLKVVSEQEIEGSRTVGTFCYNPQDVR
FT                   PVYFVARFSKPAKALGTFKKMPAFTGVEGEWMQHNNSIKPYPNYQRVMSGDNIGAYMRF
FT                   DTQANEQVEVKVGISYVSIENARQNLNTEQPDFAFDRTRKDAQDAWNSLLSRIEVQGSE
FT                   HNKTLLYTGLYHSLIHPSIIQDVNGEYPIMSQQHTAKVGNTQGKNRYSVYSLWDTSRNL
FT                   HPLLSLVYPEIQSQMVDSALSMYQESGWLPKWELLSMETQTMVGDPATAMIADTYLRGV
FT                   HTFDVELAYQAMQKSADTVENNPIRPENPDYLNLGYVPVDDEEPFDGSVSTSLEYYVAD
FT                   FALGQLAKRLGRDQDAQKYLAQAQNYKTLFDESTGMLRPKKRSGDWLTPYDPELGRNFE
FT                   PAPGYIEGNAWNYRFYVPFDMPGLIALNGGDSAFIAALNATFDTNNFDMGNEPDITYPY
FT                   LFNYVQGQEHNTAQHVKRLIAKYFTNQSAGLPGNDDAGTMSAWLVFSLLGIYPVSPGDM
FT                   DYALTSTAFDEVTIHLDSKYYAGKTLIITPLSQGQKQPSLNGDPLSKAFISHQQLTQGA
FT                   KLRLKAQ"
FT   sig_peptide     complement(133359..133427)
FT                   /locus_tag="Patl_0116"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 23"
FT   gene            complement(133424..135652)
FT                   /locus_tag="Patl_0117"
FT   CDS_pept        complement(133424..135652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0117"
FT                   /product="putative alpha-1,2-mannosidase"
FT                   /note="TIGRFAM: putative alpha-1,2-mannosidase; PFAM:
FT                   glycosyl hydrolase 92; KEGG: bfr:BF0757 putative
FT                   alpha-1,2-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38649"
FT                   /db_xref="GOA:Q15ZN9"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR041371"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZN9"
FT                   /protein_id="ABG38649.1"
FT                   /translation="MMKQIFITGAVLALCACTQPTPDATVNTPQAIDPLDYVDPFIGTD
FT                   GKGKTYPGATVPYGMVQLSPDNGRTGWDWISGYFYPDNIIAGFSHTHLSGTGAGDLYDI
FT                   SFMPLTRPFHREKTEGGPENGTIVSRFSHQNEQASPGYYQVFLDDYGVNVELTAGLRTG
FT                   FQKYQFADDATQGVVRVDLGYSRNWDKTLETHIQIINDKTIAGYRKSTGWASDQRVFFY
FT                   SQFSQPIDRYTLNTNGVTSQEQSASGENIAAEFDFDFSEVSSQKLVTVRTAISSVSIEN
FT                   AKQNLLAQGPVKTFEQVKTLAQQAWREQLSTVEISADKDDMIQFYTAMYHTALAPRVFS
FT                   DSNGEYKGPDGEVHKSERYPRYEFFSLWDTFRALHPWKTIVEPTRTRALMASIMAHYDV
FT                   AGRLPVWNFQGNETDMMMGYHSVPVLIDAYFKDLLDASGEEVLAAAIQSATQNEFGLES
FT                   YQALGYVPFEERSWNVSLTLEYAFDDWAIAQLASSLGENEVYQTYQSRGQNYRNLFDPL
FT                   SEFMRAKSVNGDFRSDFDPNAYHPEDYCEANAWQYSFFVPQDVTGLIDIMGGAAPFEAQ
FT                   LDAMFEAEQTVGEFPEWISGYIGQYVHGNEPSHHVPYLYQYVGKGYKTQKYVRQVMDEL
FT                   YHTAPDGLSGNEDAGQMSAWYLFSALGFYPVNPVSGEYVLGSPEVSSAKIHLENGKTFS
FT                   VQALNQSKENVYVQSVSLNGQPLQQFFIRHSDILAGGNLVFEMGAQPK"
FT   sig_peptide     complement(135578..135652)
FT                   /locus_tag="Patl_0117"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.946) with cleavage site probability 0.472 at
FT                   residue 25"
FT   gene            complement(135665..136852)
FT                   /locus_tag="Patl_0118"
FT   CDS_pept        complement(135665..136852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0118"
FT                   /product="N-acylglucosamine 2-epimerase"
FT                   /note="PFAM: N-acylglucosamine 2-epimerase; KEGG:
FT                   cps:CPS_2647 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38650"
FT                   /db_xref="GOA:Q15ZN8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR034116"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZN8"
FT                   /protein_id="ABG38650.1"
FT                   /translation="MNYHSPAFLMTHCQDILNFYDPRVKDAQGGYFQNYMDNGDLFDSG
FT                   FKQLVSSTRIVVNYAAAGMLFQRDDYLAMARHGLDFVEQIHWQPDADGYAWTLQDNQPQ
FT                   DMTQQAYGYAFVLLAYAAGRKAGIVTNNDMLLKTYQQLESRFWQDEFGLYADEISPAGE
FT                   LSPYRGQNSNMHLCEAMLAAYEASGEQVFLTRAQTLAENIAFRQADLTDGLIWEHYTTD
FT                   FQPDWEYNKDDPKNLYRPWGFQPGHQTEWTKLLLILHRHAPDQKLVERAKSLFDRAYEK
FT                   CWDATHGGLIYGFAPDGTWCDDDKYFWVQAESFAAAAMLFSVTQDEQYLTQYNALWDYS
FT                   WEHMIDHQYGAWFRVLHRDNSKYSEQKSAAGAKCDYHTLGACFEVLRTLGNTGLK"
FT   gene            complement(136932..138209)
FT                   /locus_tag="Patl_0119"
FT   CDS_pept        complement(136932..138209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0119"
FT                   /product="glucose/galactose transporter"
FT                   /note="TIGRFAM: glucose/galactose transporter; PFAM: major
FT                   facilitator superfamily MFS_1; KEGG: cps:CPS_2649
FT                   glucose/galactose transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38651"
FT                   /db_xref="GOA:Q15ZN7"
FT                   /db_xref="InterPro:IPR005964"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZN7"
FT                   /protein_id="ABG38651.1"
FT                   /translation="MAGPISQSSVTLSEPAKNSHFAFAAMTTLFFIWGFITALNDILIP
FT                   HLKAAFDLNYTQAMLVQFCFFGAYFIISPFAGKLIEKIGYIRGIITGLVTIAIGCGMFY
FT                   PAAEVEVYAVFLLGLFILASGVTILQVSANPYVAVLGPEKTATSRLSLAQAINSVGHTL
FT                   GPMFGAALIFAAVGVASEDADIDAKAVQLPYLLLAGVMIATAIGFKFLKLPTITANETE
FT                   QEVKSTDSIWSHKALIFGTLAIFSYVGAEVSIGSFLVNYFSQPEIAGLNERQASQMVSY
FT                   YWGAAMIGRFVGAALTRIISPIYVLAFNSAVAIILLFTTMNSQGDLAMWSVISIGFFNS
FT                   IMFPTIFTLAIRGLGPLTGRGSGLLCQAIVGGAILPLIQGYVADVTSVQFSFIVPVAAY
FT                   VYIAWYALFGSKVKSADAPTPAPVAS"
FT   gene            complement(138266..140584)
FT                   /locus_tag="Patl_0120"
FT   CDS_pept        complement(138266..140584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0120"
FT                   /product="putative alpha-1,2-mannosidase"
FT                   /note="TIGRFAM: putative alpha-1,2-mannosidase; PFAM:
FT                   glycosyl hydrolase 92; KEGG: bth:BT3962 putative sugar
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38652"
FT                   /db_xref="GOA:Q15ZN6"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR041371"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZN6"
FT                   /protein_id="ABG38652.1"
FT                   /translation="MNYKLIFTIPGLLLLASCGMTTEPKEAVATAPSVDLVDYVNPLMG
FT                   TDSKFSLSNGNTYPAIATPWAMNFWTPMTAPIGDGWTYKYNDDQIRGIKQTHQPSPWLN
FT                   DYGAFSLMAVTGEMKFNQDDRASWYSHKAEQASPDYYSVYLASYDVTAEVTPTERAAQF
FT                   RFTFPDTDNAFIILDAFDKGSMVKIIPEERKIVGYARNNHGGVPDNFHNYFVAEFDKDF
FT                   EISRTWTDEYQLNADAIQSKGEHVGAVIGFKTKRGETVSVKIASSFISPEQAQLNLDRE
FT                   IGQDTFDTTREKAHKYWQDELSRIEIVDDNKDNLRTFYSALYRVLLFPRKFYEYNQAGE
FT                   VVHYSPYNGEVLPGYMFTDNGFWDTFRAVFPFFTLMYPELDAQIMEGLANTYKESGWLP
FT                   EWASPGHRGVMIGSNSAVNIADAYLKGITDIDIDTLYEAIVKNAQVDEGRPVSSVGREG
FT                   VDYYNELGYVPYDVGIHENAARTLEYAFADFNIYRLAERLGKTDDAAKYKQRAMNYKHL
FT                   FDKESGWMRGKNEDGSFQTPFNPLKWGDAFTEGNSLHYTWSVFHDISGLKDMMGGDQAF
FT                   VNKLDSVFSMPPTFDDSYYGFTIHEIREMQIVNMGNYAHGNQPIQHMSYLYNYAGQPWK
FT                   TQYHVRNIMDKLYSATPDGYCGDEDNGQTSAWYVFSALGFYPVAPGSDEYVLGSPLFDK
FT                   ATLHLQNGERFTVKGNNNSKDNVYVNSAKLNGKTFDKTFLSHQQIQQGGEISFDMTNQP
FT                   NKSWATSKEAVPYSMSTAD"
FT   sig_peptide     complement(140519..140584)
FT                   /locus_tag="Patl_0120"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.751) with cleavage site probability 0.553 at
FT                   residue 22"
FT   gene            140937..141944
FT                   /locus_tag="Patl_0121"
FT   CDS_pept        140937..141944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0121"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: vch:VC2677
FT                   transcriptional repressor, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38653"
FT                   /db_xref="GOA:Q15ZN5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZN5"
FT                   /protein_id="ABG38653.1"
FT                   /translation="MTNIKKVSELAGVSTATVSRTLKMPDMVTARTKEKVMKAVREAGY
FT                   RPSWLATSVKTGRTNTIVVLVPNLINPFFMRIIGGIEQAAQERGFTVLLCDTQGESKRE
FT                   SDYASMVLTNRADGLIQLDHSFPFTEDDAKLAETIPMVSVCERIHSDKKYPVVALDNYA
FT                   ASRALAHHLVSYGHTKFAVIVGQVVSQIHKDRLYGLRSVLAEEDIEFDEDMIVGQSYSI
FT                   ENGIEGMRQLLEKPNRPSAVICFNDDIAIGAMHEIHRQGLRVPEDISVVGFDNVKVAAF
FT                   MNPPLTTIDQPAYEMGRRGMEILSDVINGVPLTRSSEMLPFQLLERESSGPAPI"
FT   gene            142237..145131
FT                   /locus_tag="Patl_0122"
FT   CDS_pept        142237..145131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0122"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor TonB-dependent
FT                   receptor, plug; KEGG: pha:PSHAb0165 putative TonB-dependent
FT                   receptor; outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38654"
FT                   /db_xref="GOA:Q15ZN4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZN4"
FT                   /protein_id="ABG38654.1"
FT                   /translation="MNNTSDKIFGKSMLNFAVVCAMGLVPSYALAQQTNQEPSGSDAET
FT                   EVIQVRGIRASAAENLAIKRLSNAVVDAITAEDIGKFPDKNVADSLQRVPGVVIQRNGG
FT                   EGSSVSIRGLSPSLTFTQLNGNFIAASSGNPSRSFSYELLPSNLVGKVELFKSSEARLD
FT                   EGGIGGTVIVHSRKPLDMDKNSGVVSLEYTYADITDSYEPQLSGIYSWKTDEEDFGFLV
FT                   GFTQQDRTNRTQTSRVNIINQNFLYTERRNGQEIEGGAQGYARQSLVQEVLEEDRERTG
FT                   VQFTAQWRPTDNLEVGFNYFQFKLGLDSVLHQLEYPEWHDTNQFWTDVYVDAEAQYVTG
FT                   IDYARGVSGEALDTQIPRMNGEYVVEESTSDTFDFFMEYEGGDFNVKFVAGHTEAEGGP
FT                   TEKYRAAYYSGSTADYWGWRFENENLVTNIDPEMFNRLKAGEGGEADIGATDSSFVGGT
FT                   QEEDYAQIDTDWFVDWGIVETLRFGVKYRKGSIHRDTRNTYYLAKDFDIAAGEARPGGI
FT                   TLDDDYSRNGGIPLLTTVIADQPLGNLGGSINTNLFPVVNWNKYQNELETNFQRYTRFE
FT                   PDFVYDVEEEVKVAYVQADYRWENFRGNFGVRFVDTVNTNTASDRLEFRLDRVNLDGDD
FT                   VAQVNGIVRDVIVNPKENSYSHVLPSFNIAWDINDDWVLRGAAAKVLSRPDYADLGQFQ
FT                   TLTYNSSEWEADSSDRPDYDPLRDSEGWTGSGGNSSLRPLESVQYDLSLEYYYGEGSGV
FT                   SLAVFLKNIDNFVVPFTLDVNSSVPDQTFTLVESGGGTVNVGGDILVRDFDTAANGTDA
FT                   ESKGVEFSFQHFFENGFGVSGNYTRNITSAATVEADGRLVGESPLTGSSKYQGNFSAFY
FT                   ENDDYSLRVSYNRRGPTIGVLAEDWDINRYSDTYDQVDVNASYNINEDITLSASVINLT
FT                   KSEDYVHLGDDTKVRFLTNSYSGRRFFAGVNYRF"
FT   sig_peptide     142237..142332
FT                   /locus_tag="Patl_0122"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 32"
FT   gene            145201..148035
FT                   /locus_tag="Patl_0123"
FT   CDS_pept        145201..148035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0123"
FT                   /product="coagulation factor 5/8 type-like protein"
FT                   /note="PFAM: coagulation factor 5/8 type-like; KEGG:
FT                   sma:SAV2252 putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38655"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZN3"
FT                   /protein_id="ABG38655.1"
FT                   /translation="MKKLKMNKTTVAMLMAMSTLYGCGGSADDPNPSDAVDTRVTTEAT
FT                   LAGEAVKGRLDSAQISVEQMNNSPITIINGELTDASGAVNVVVQSDLGFGINSPFKLTV
FT                   TATDATSMMCDAIDCAGVALGQELSGEPLTGTVLNSLSFVNVPYGSAANSSSLPFHANA
FT                   LTTIATPIVESAVAGGANITQQVLFDSQAVIASELALRALGVATSGVNLFETALISAES
FT                   YDNFVMGEDCAPVTSTDAQGNEVTMDECTDVLVSPAIITLSLANAAFANIATTESFNEQ
FT                   FDAVNTAITTAIEGDTTALTPIRERLLASVSAVPFLSELGVSADSVIDLGLSFALSNDS
FT                   SGPVQEVTTTENLAGATITGRARISDGEAETMAFDKDAQTKWLDNGGVPSVEDPAWVQV
FT                   EFAQAHAVSSVFITSANDAPERDPENFDLLASNDGENWVTVASFLGESFDERFERKEFS
FT                   FSNGLAYSFYRLNITKNKGDTSLMQLAEIQLVGPIYASTDHTDPVGTGAISGRARISDG
FT                   EAETMAFDNDTQTKWLDNGGVPSIEDPSWVQVDFPEAVAVNVLGITSANDAPERDPENF
FT                   TLVGSNDGGTTWTVIGDWLGESFDERFERKLFSASNALAYSSYRLNITKNKGDTSLMQL
FT                   AEIELIGPEMPSVQHSHGPDVTYTERARISDGEAGTMAFDNDTQTKWLDNGGVPSVEEP
FT                   SWVVIALPEAAAVNTLALTSANDAPERDPENFAVWASNDNENWTELASWLGESFDERFE
FT                   RKQYAFSNDVGFSFYRFNITKNKGDTSLMQIAEIELIGPQVASVDISSDAGTTITGRAR
FT                   ISDNEAETMAFDDDTQTKWLDNGGVPSAEDPAWVQLDFVAPRIVNSIAITSANDSPERD
FT                   PENFTVLGSNDGGATWDEVESWIGESFDARFERKLFEMRNGFAYSSYRINISKNKGDSN
FT                   LMQIAEIELIGPAE"
FT   sig_peptide     145201..145284
FT                   /locus_tag="Patl_0123"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.951 at
FT                   residue 28"
FT   gene            148122..148991
FT                   /locus_tag="Patl_0124"
FT   CDS_pept        148122..148991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0124"
FT                   /product="ATPase, BadF/BadG/BcrA/BcrD type"
FT                   /note="PFAM: ATPase, BadF/BadG/BcrA/BcrD type; KEGG:
FT                   cps:CPS_1026 BadF/BadG/BcrA/BcrD ATPase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38656"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZN2"
FT                   /protein_id="ABG38656.1"
FT                   /translation="MAEYYYLGIDAGGTQCKASLYSHDQQLLTTGISGPSNPVNGLEIA
FT                   QNAIVQAAESALSAASLPHVGLNQLCVGAGVAGLHLPSLQEAMEQWQHPFHSFYCTTDL
FT                   HAAVTGMHQGQNGGVIILGTGFSALGMVDGAMHSIGGYGFPINAQGSGSWLGLQAVEAV
FT                   LLAHDGIGPHTSLIAGMTKNEDIMSLATRLNQGTSTEFAAYAPLVFEHAEQGDLLAKGL
FT                   IEQATEFLQRVILRLNDLGVEEVVLVGSVALRLQSRLEATVNQAIVPGKASAEYGAMLL
FT                   AKQHNPNQ"
FT   gene            149032..150015
FT                   /locus_tag="Patl_0125"
FT   CDS_pept        149032..150015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0125"
FT                   /product="asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /note="KEGG: xcb:XC_1195 asparaginase; TIGRFAM:
FT                   Twin-arginine translocation pathway signal; PFAM: peptidase
FT                   T2, asparaginase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38657"
FT                   /db_xref="GOA:Q15ZN1"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZN1"
FT                   /protein_id="ABG38657.1"
FT                   /translation="MTATRRRFLKLSLVSSIASAFAASSKTAFARAEKASKPIVISTWE
FT                   HGIAANKVAWDVLNKNGRALDAVEQGVRVPEADPLVRTVGLGGYPDSEGNVTLDACIMD
FT                   ENMNCGSVAYLQDILHPISVARKVMENTPHVMLVGAGAKKFAVEQGFAEQNLLTEQSKQ
FT                   DWLAWRQSGQQKKQINIENHDTIGMLALDASGNLSGACTTSGAAFKLPGRVGDSPIIGA
FT                   GLYVDNEVGAATATGMGELMMKTVGCHLVVELMRQGASPQEACQKAVERIATRLDNFAE
FT                   FQVGFLALNKAGEYGAYCIQPGFNYAVKDAGGEHLIDGKNLLGEGA"
FT   sig_peptide     149032..149124
FT                   /locus_tag="Patl_0125"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.703 at
FT                   residue 31"
FT   gene            150012..151772
FT                   /locus_tag="Patl_0126"
FT   CDS_pept        150012..151772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0126"
FT                   /product="glycoside hydrolase, family 85"
FT                   /note="PFAM: glycoside hydrolase, family 85; KEGG:
FT                   bha:BH0785 endo-beta-N-acetylglucosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38658"
FT                   /db_xref="GOA:Q15ZN0"
FT                   /db_xref="InterPro:IPR005201"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR032979"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZN0"
FT                   /protein_id="ABG38658.1"
FT                   /translation="MMLKTLGSLLLCTAFFCQAQSTDIRANQAPFALTLEQAMNWTAQS
FT                   DFTSAQNISKQPLARRFGAQLDPSRANLDTQVKVLYAPDGMNNFANYLDTQATFNLYNF
FT                   THWSQIDVLNWFAGTADHVVQIPARPWVDTAHRNGVKVIGSIFLAIAKYGGSPDTAESL
FT                   LKQDAQGRFIMAHRLVDIAQYYGFDGWLMNQETNLTAIKDAENELVEGQKDIRRGAELG
FT                   QKMLAFMQYLTAIAPQGMEIHWYDSMLENGEVRWQNQLNEKNQAFLHQGVSSADAMFMN
FT                   YWWNKAMVERSVSLAQALGRSGYDLYFGADLWPSRNAQRAFSKTQWLEDLFDSDTEQGL
FT                   TSIALFAPNFNFNFSGEPHTPIFSQFKDDPQDSLRFYQTEQRLFVGDDLNLANNDLNGW
FT                   PGIGRYVPAKTTVNSLPFETYFNTGQGKKLIENGQQVLSGWTDMSKQDLLPTWQFAVYG
FT                   NPSMTVAYDFEEVFSGGSSLVFTGSLSAQETRIPLYQTHLVLGKNNTATLTLKGDASAL
FT                   SLYVETADGKRHRFALDAITPSVSQQDWRSYEVSLSALAKQSITQLGMLFSDGTSEENV
FT                   NVNLGQLAIR"
FT   sig_peptide     150012..150071
FT                   /locus_tag="Patl_0126"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.965 at
FT                   residue 20"
FT   gene            151772..152509
FT                   /locus_tag="Patl_0127"
FT   CDS_pept        151772..152509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0127"
FT                   /product="CutC"
FT                   /note="PFAM: CutC; KEGG: hsa:51076 cutC copper transporter
FT                   homolog (E. coli)"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38659"
FT                   /db_xref="GOA:Q15ZM9"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZM9"
FT                   /protein_id="ABG38659.1"
FT                   /translation="MIDIEICLPCDDLAHVAQQIRAAHRGKAARVELCSHMEHQGLTPS
FT                   MNAMQQARAAAQGELILLAMIRPRGGDFCYDEGEILQMQHDIALAAQAGMQGVVLGALT
FT                   PDNKLDQGALTRLIAVANNANLQVTFHRAFDALAEPAQAIDTLIELGVQRILTSGCDWG
FT                   SHDTAQQHSAQIAHYLALAKGQIEIVIGGGIAPVSAKLIAQSIGQQMEQHYHYSFHAYS
FT                   SALIDGVVHEDPVLQLYQGVNDT"
FT   gene            152568..155183
FT                   /locus_tag="Patl_0128"
FT   CDS_pept        152568..155183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0128"
FT                   /product="beta-mannosidase"
FT                   /EC_number="3.2.1.25"
FT                   /note="PFAM: glycoside hydrolase family 2,
FT                   immunoglobulin-like beta-sandwich glycoside hydrolase
FT                   family 2, sugar binding; KEGG: bfr:BF1733 beta-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38660"
FT                   /db_xref="GOA:Q15ZM8"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="InterPro:IPR041447"
FT                   /db_xref="InterPro:IPR041625"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZM8"
FT                   /protein_id="ABG38660.1"
FT                   /translation="MGGPALDSTAHFTTLVFMINEEYMTQMKTLPLTGTWQFCQADKQD
FT                   WRNAEVPGCNFTDLLAHNLIDDPFDRDNESHLQWIEKKDWHYRRSFNVSAAQLAHSEVN
FT                   LVALGLDTFCDIYLNGQHLASGQNMFVGQHLACKSLLVEGENDVEIRFRSPMNEVYPQF
FT                   IANGFTYPAENDKSDEKLSVFCRKAPCHFGWDWGPKFVTSGIWRDIYLAFIDSAEIKDV
FT                   HFVQQALSAQRADFHFALDVSAMTDFDAQLVVKCEQAPQLNQTLDVRLTAQANEQSMLV
FT                   NFTLTDPKRWWPNGLGEAFLYDFSFELVKDKQVIARREQAVGLREIEVVNQADEMGESF
FT                   YFKVNGHPVFMKGANYIPDDSFIHRVNTQRHEQVFDAVVAGNMNMLRVWGGGIYQDDAF
FT                   YELADRNGILIWQDFMFACTLYPADDAFLANVKQEAEYNVKRLRNHPCIAMWCGNNEVD
FT                   MAIEKWQWAEKFGYSDELYGRLKQDYIRLFDDCLPKVINTLDAQRFYLRSSPIGFWEND
FT                   EDNKANHHYWGVWHGEEPFSEYKKRVPRFMSEYGFQSFPIAESTHTFTRPEDRELESAV
FT                   MQVHQKHPRGNKLIRSYMDEEFNAPRDFDQLLYLSQVQQALGLKMAFEAHRKAMPFCMG
FT                   TLYWQLNDTWPAASWSGIDYYGRWKALHYQAKRSFAQQLLVIDQVNDQLEVTLISDDLQ
FT                   PFSAQLHIQVYDFDGLVVYSHEQDVLVPANASLSLTSLAMSELASQAQPSSSVLVARLM
FT                   HQDGRVLSQNSHFFVANKDLALQAADIQCEQVITPECLTLTFSSDTFVRQLYVSAGEQV
FT                   GNFSDNFFDLIPGIDVSIHLALPGLDQQDIERLGAKVSWQSLLDSFASLSNEQRNIAGL
FT                   "
FT   gene            155186..156976
FT                   /locus_tag="Patl_0129"
FT   CDS_pept        155186..156976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0129"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: bth:BT3029
FT                   Na+/glucose symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38661"
FT                   /db_xref="GOA:Q15ZM7"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZM7"
FT                   /protein_id="ABG38661.1"
FT                   /translation="MILSWIDILVIIGYLVLVLMIGLYISRRASRDMDSYFLGGKTIPW
FT                   WALGVSNASGMFDIAGTMWLVSMCFVYGLKSAWLPWIWPIFNQIFLMIYLSIWLRRSNV
FT                   MTGAQWMETRFGTGKGAEMSQMVVVIFALVSAIGFIAYAFKGIGKFAAIFFPWELSPDI
FT                   YALIIFSITTIYVVKGGMYSVVFTEILQFVIMTIAAVSVGIIAMYMVSPEQLAAATPHG
FT                   WDQLFFDWRLDLNWQGLIDSVNVKVEEDGLELFGLMIMMMLFKGVLSSMAGPVPNYDMQ
FT                   RILATKSPKDAAKMSGLVSLVMFFPRYMMVAGLSILAIVYMGPDIQAQGKQFDFEQILP
FT                   FAINNFVPVGLTGLLIAGLLAAFMSTYAASVNAAPAYFVNDIYRRYLRPDADSRTYVRM
FT                   SYIVSIVLVVLGMGLGLMLGSINAIMQWIFAALFGGYAAANLLKWHWWRFNAYGYFWGM
FT                   LAGLIGALVLPIALPDVQPLMAFPLLLVFGLVGSIAGTLLTPPESDEVLCEFYRTVKPW
FT                   GAWGPIRDKVIALDPGFAPNKEFSRDMFNVAIGIVWQIALVVMPIYLVIQQWWSMLAAF
FT                   GVIVVTSWILKKNWLDKLPD"
FT   gene            157009..159252
FT                   /locus_tag="Patl_0130"
FT   CDS_pept        157009..159252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0130"
FT                   /product="putative alpha-1,2-mannosidase"
FT                   /note="TIGRFAM: putative alpha-1,2-mannosidase; PFAM:
FT                   glycosyl hydrolase 92; KEGG: bth:BT3773 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38662"
FT                   /db_xref="GOA:Q15ZM6"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR041371"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZM6"
FT                   /protein_id="ABG38662.1"
FT                   /translation="MKKQFLAGAFSLCAVGSLAGCATSSVSSMQQASVPQATIVQVADE
FT                   QLLQYADPFIGTGGHGHTFPGAVVPFGMVQLSPDNPSKGWDWTSGYNYSDNQLLGFSHT
FT                   HLSGTGVGDLLDVLVMPFRGDYKTRRDNELKHVVSEYSHSDESASPGYYQVGLPEEQVN
FT                   AELTATERTGVHRYTFSGQEDAKVLIDLGYAQNYDKSVATFMRVIDDSTLVGYRISTGW
FT                   SDYQPVYFVAKFNQPFAHQFYKEGEALAGPFINAEKSEVVLNFGDIADKALVAKVGISY
FT                   VSIAGAKQNLAAEVADFDFDNTKRQAQALWAAQLGKFNVTDDNEQAKRKFYTALYHSFL
FT                   APQTFNDVNGSYFGADGSAHNSQQFKRYSLFSLWDTFRALHPLLTISNGERVNDMVSSM
FT                   MAFYDETGLLPSWDLMANETDVMIGYHAVPVIVDAYFKGLTDVDPELLFQALKASAMQT
FT                   RFGIDLFAEYGYVPSDLEVEAVSKTLEYAFDDWAIARMAKALNKNADYAYFTQRAESYK
FT                   TLFDKQTGFMRGKTQQGEWVKNFSPTHVDHRTTDYTEANAWQYTWFVPHDVDGLMALFG
FT                   GEAPFLNKLDTLFSTDSFMEGDVSPDISGLIGQYAHGNEPVHHVPYMYSLTSQKWKGEQ
FT                   RIKEIRETMYRDNPDGLSGNDDVGQMSAWYVFSALGFYPLNPADGQYVLGTPQFDSVQI
FT                   QLPDDKVFTIKRVQSAEDTAGYVKEATLNGQPVNMNTISHSELMQGGELIFTF"
FT   sig_peptide     157009..157107
FT                   /locus_tag="Patl_0130"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.571 at
FT                   residue 33"
FT   gene            159319..160314
FT                   /locus_tag="Patl_0131"
FT   CDS_pept        159319..160314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0131"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="2.6.1.16"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: son:SO3506
FT                   glucosamine-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38663"
FT                   /db_xref="GOA:Q15ZM5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZM5"
FT                   /protein_id="ABG38663.1"
FT                   /translation="MTSIMAREAASASELLAKQLMLNHESCERIAQKIQLLNPSVVYIV
FT                   ARGSSDHAGVFAKYLIEVELGIPVVAAAPSVVTVFHKQLKLDNALVIGISQSGRSPDIL
FT                   QHMQMAKDAGALCIGLVNDESSPLAKLVDQLLPLRVEQEVAVAATKSYLACLSALLQLV
FT                   AHCKKDPELMAAVSEIPKALSLAIEGSKQLHSDMFKGCDKCIVLGRGFGYAIAKEVALK
FT                   LKEVCAIQAEAFSSAEFVHGPVALAQKPLKVLSLGLLDESQVAHEQQIDDVTQRGASVL
FT                   SMKPFPDDVHPRLGALMIMQRFYLDIADISLQLGCDPDSPQGLNKVTLTV"
FT   gene            160684..161109
FT                   /locus_tag="Patl_0132"
FT   CDS_pept        160684..161109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC3767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38664"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZM4"
FT                   /protein_id="ABG38664.1"
FT                   /translation="MLKHTIKKISLTAALLLGSASVFAEVVVIVHPSNSASIDAKTTQR
FT                   IFLGKEKKFSSGEQATPINQAAGTASRNSFDNDTLGRNSAQVSAYWSKLVFTGKGIPPK
FT                   EVANDGEVIAIVAANPNAIGYVDSGSVDASVKAIPLN"
FT   sig_peptide     160684..160758
FT                   /locus_tag="Patl_0132"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            161124..162251
FT                   /locus_tag="Patl_0133"
FT   CDS_pept        161124..162251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_06070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38665"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZM3"
FT                   /protein_id="ABG38665.1"
FT                   /translation="MKNLSKTMVLLTSLGFGCAANAELRINGFANLVGGITSSDDALYG
FT                   YDDSFSFKSESSFALQVSGDINDKMTATGQIIARGEDDYDADFEWAYFTFNATDHVSIS
FT                   AGRLRLPLFKYSASRDVGYSYHWVNTPRSIYDVPFNNLDGLRVDYANYLGDWEYNLQLA
FT                   VGTFSGDNDLGDVEGKNVIVGTAEVQRDWFKARVVAGRGNVTLEADNVDNITNALAQIS
FT                   PVLANELALDDDSGVFLGLGLEADFYDWFISGEITSIDVEDSFSPEDTAFYLTAGMRFG
FT                   AFTPSLTYEKLDGRGDLRFLDQVAALPEAAQPAATAAVVGLQQAVADEYDVVTLGVRYD
FT                   YDTNIALKADISSYTSDVDDSLDTGLLRFAVNYIF"
FT   sig_peptide     161124..161192
FT                   /locus_tag="Patl_0133"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.949 at
FT                   residue 23"
FT   gene            162445..163506
FT                   /locus_tag="Patl_0134"
FT   CDS_pept        162445..163506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0134"
FT                   /product="alpha/beta hydrolase fold familiy"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: pha:PSHAa2908
FT                   enzyme with alpha/beta-hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38666"
FT                   /db_xref="GOA:Q15ZM2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000952"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZM2"
FT                   /protein_id="ABG38666.1"
FT                   /translation="MPQPASSLYSPVNLESDELKPSHGEIAKSAFAAPWWAKNRHIQTI
FT                   WPRFFQRRSKVHWHKERLILPDGDFVNLAWAGDRGNIDSSHGLVVVFHGLEGSNKSHYA
FT                   NDMTANLVEQGYVVVLMHFRGCGGEHNTLPRAYHSGETQDAWYLLNWLTELYPNVAKVA
FT                   MGFSLGANMLLKLLGERPQQTILRAGIAISPPFKLAECSLSINQGMSRMYQSYLLKSMV
FT                   NNLVDKMRTIDYSDHLEIDDVKARTIKSFKEFDQHVTAPLHGFDSADDYYGKCSAISFM
FT                   QTIATPTLIIHAKDDPFMSETVLPNAQDLSSSVRLELSAKGGHVGFMQGTPWRPVIWMQ
FT                   KRVNQYFQEILRD"
FT   gene            163527..163763
FT                   /locus_tag="Patl_0135"
FT   CDS_pept        163527..163763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0135"
FT                   /product="protein of unknown function UPF0270"
FT                   /note="PFAM: protein of unknown function UPF0270; KEGG:
FT                   sec:SC3397 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38667"
FT                   /db_xref="InterPro:IPR010648"
FT                   /db_xref="InterPro:IPR036685"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZM1"
FT                   /protein_id="ABG38667.1"
FT                   /translation="MIIPINEVSPDALSNLIEGFVLREGTEYGEADCSLTDKVEQVRAQ
FT                   LASGEALLVYSELHETVNIIPKDQLGLIDEETE"
FT   gene            complement(163800..164396)
FT                   /locus_tag="Patl_0136"
FT   CDS_pept        complement(163800..164396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0136"
FT                   /product="YceI"
FT                   /note="PFAM: YceI; KEGG: hch:HCH_00246 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38668"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR027016"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZM0"
FT                   /protein_id="ABG38668.1"
FT                   /translation="MTLTKNTTFVKLVAFSSLLVCASASADWQLLNKDSQLNFISTKNI
FT                   KVSEIHHFSNLSGSLTSAGELTVDIDLSSVETGIDIRNARMREKLFMVENFPKATLTAS
FT                   LPKEIVAFTKGQAGTFTIPAKLSVLGQQRDVEVNVQVTKTDHNRFVATSVQPVMISAGD
FT                   YGLQDGIDWLQNVAGLSSISPNVPVTFNLTFIELM"
FT   sig_peptide     complement(164316..164396)
FT                   /locus_tag="Patl_0136"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 27"
FT   gene            complement(164393..165229)
FT                   /locus_tag="Patl_0137"
FT   CDS_pept        complement(164393..165229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0137"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /EC_number="3.1.3.7"
FT                   /note="TIGRFAM: 3'(2'),5'-bisphosphate nucleotidase; PFAM:
FT                   inositol monophosphatase; KEGG: ilo:IL0324
FT                   3'-phosphoadenosine 5'-phosphosulfate (PAPS)
FT                   3'-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38669"
FT                   /db_xref="GOA:Q15ZL9"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZL9"
FT                   /protein_id="ABG38669.1"
FT                   /translation="MPTDQISALLDIAKTAAKEAGKVVMEIYDSGDFKSYQKDDDSPVT
FT                   SADYKANEVILAILQRETPHIPIMSEESENGTLAERKDWQRYWLIDPIDGTQEFIARSG
FT                   DFAVNIALVENNQPIIGVIYWPPGETLYFASKDNGAFKESESENKQIFVRKFDDPETDA
FT                   VMIAISRRQARENVMRSMSDHRTYQTYPTGSCSLKSCFIAEGKADVFLRLGITGEWDTG
FT                   ASQCIVSEAGGSILAHDFSSLSYNERDSVTNPDFIVMGDQRVNWQTIVKYTTGDTE"
FT   gene            complement(165229..165792)
FT                   /locus_tag="Patl_0138"
FT   CDS_pept        complement(165229..165792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0138"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: ilo:IL0323 NTP
FT                   pyrophosphohydrolase, NUDIX family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38670"
FT                   /db_xref="GOA:Q15ZL8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZL8"
FT                   /protein_id="ABG38670.1"
FT                   /translation="MSKIDPNKTLPQIHQRRTVAKSGLFTVEQIDLEFSNGELRTFERM
FT                   AGGGRGAVMIVPFINEHEFLLVREYAAGTHSYQLGFPKGLIDPGEESHEAANRELKEEV
FT                   GFGAHTLHYLQNVSMAPAFFNARMDIFVAQDLYEKTLPGDEPEPLDVITWSINDLDGLL
FT                   AREDFVEARCITALFLAQKWLKEQ"
FT   gene            165887..166570
FT                   /locus_tag="Patl_0139"
FT   CDS_pept        165887..166570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0139"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase-like hydrolase;
FT                   KEGG: cps:CPS_0423 HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38671"
FT                   /db_xref="GOA:Q15ZL7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZL7"
FT                   /protein_id="ABG38671.1"
FT                   /translation="MPDLPWNKIKTVLLDMDGTLLDLHYDSHFWLEHLPKKYAGIKGIS
FT                   EEQGKEYMMAEYRQVFGTIDWYCLDYWADKLQLDIMQAKREVEHLISMRDDTIPLLDAL
FT                   RESGREVILVTNAHPGSLSLKIEHTALDSHIDTLISTHEFGVTKESQLLWQKLQQRVGF
FT                   DSKHTLFVDDSLPILQSAKDFGIAHLLAVSNPDSQLPIKDVTQFLATSDYRTLLDDIRN
FT                   APFTG"
FT   gene            166737..167270
FT                   /locus_tag="Patl_0140"
FT   CDS_pept        166737..167270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0140"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: Inorganic pyrophosphatase; KEGG: eca:ECA3593
FT                   inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38672"
FT                   /db_xref="GOA:Q15ZL6"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZL6"
FT                   /protein_id="ABG38672.1"
FT                   /translation="MSLNDVPAGKNLPEEINVVIEIPAHSDPIKYEVDKDTGAIFVDRF
FT                   MATCMHYPTNYGYINQTLSEDGDPADVLVMTPFPLLAGCVIKCRPVGVLKMTDESGTDA
FT                   KILAVPVDKLSTIYRGIKDIGDVDELTLNQIEHFFSHYKDLEPGKWVKIDGWENAESAK
FT                   AEIVSSVERYKTEG"
FT   gene            167383..168615
FT                   /locus_tag="Patl_0141"
FT   CDS_pept        167383..168615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0141"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   vfi:VFA0729 transporter, MFS superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38673"
FT                   /db_xref="GOA:Q15ZL5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZL5"
FT                   /protein_id="ABG38673.1"
FT                   /translation="MKAMKSLRALTANPQFFLLAMAFVMPLVFSVWNALLNNFVVEKAS
FT                   FDGAQIGMLQSLREVPGFLAFTAVFVLLVLKEQTFALVSLAVMCVGVALTGWLPFELGL
FT                   YCTTVLMSIGFHYFETINQSLTLQWLDKDKSAHFMGQQLAVKSFASLLAYGAIWLLMEW
FT                   VGISYMAMYMLAGGVGLLIVIWLWFAFDKFNQTSVQHKHMFLRKRYWLYYGLVFFSGAR
FT                   RQIFMVFASFMMVEKFGYSVGDISILYMLNYVFNLFFAPKIGRWIHKIGEQRALCIEYL
FT                   GLLCVFVGYALVENSQLAAGLYVIDHLFFAMAIAVKTYFQKIADHRDIASTAGVSFTIN
FT                   HIAAVVIPALLGIVWLTSPSLVFYIGAGFAICSLILALNIPLQPTSGKEVRVNLLRWAN
FT                   MPVGISPKERS"
FT   sig_peptide     167383..167484
FT                   /locus_tag="Patl_0141"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.550 at
FT                   residue 34"
FT   gene            168612..169073
FT                   /locus_tag="Patl_0142"
FT   CDS_pept        168612..169073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pha:PSHAa0449 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38674"
FT                   /db_xref="InterPro:IPR021727"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZL4"
FT                   /protein_id="ABG38674.1"
FT                   /translation="MKYLVLLLTLSSFAAFSQEPEELYWEDMIPKNYIAPQEDVNHNGS
FT                   MVQQSLNAPVVKELDGKVVKIPGFVVPLEGSSDTTTEFLLVPYFGACIHVPPPPPNQIV
FT                   YVKFSSGVPIDNIYDAVWVTGKLATQVWEGDIATVGYTLQGIEVTPYDG"
FT   sig_peptide     168612..168665
FT                   /locus_tag="Patl_0142"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 18"
FT   gene            169158..170777
FT                   /locus_tag="Patl_0143"
FT   CDS_pept        169158..170777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0143"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region chemotaxis
FT                   sensory transducer; KEGG: hch:HCH_06069 methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38675"
FT                   /db_xref="GOA:Q15ZL3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZL3"
FT                   /protein_id="ABG38675.1"
FT                   /translation="MSFLTKMSIAQKLYLIPIIGSIGFLVYLWVTTHTAMNNIELLEDA
FT                   DKVQYPALEATSSALVKMEKVKETLSSAVTTGDEETLAVAKVQAADTKVLLDKIISIEP
FT                   SLSVEANRIKQSFNNYFNLAYKVSESMVNNTADFSKIGELSTRMNKSYDDATTALGAFR
FT                   DARVNGFKQAITESNDALKNMLSFGAIMAGVTIVLLFATAIPIVMGIRGSIDQVVNSLK
FT                   DIAQEDGDLTVRIQSRNQDEIGDLVHWFNQFMEKLQGVVKDIVNASMPLSQLAQNLNQL
FT                   TDDTNRTIDVQQSAASQAKSAVDDMTRSVNAVAESAAEAANAAGDASAAADDGQAVVNH
FT                   TVQSIRELAANVDSSAEVIKQLEADSKQVGVVLDVIKGIAEQTNLLALNAAIEAARAGE
FT                   HGRGFAVVADEVRTLASRTQQSTEQIQQTIEQLQNASRSAVSVMAKGTEQATSSVDTAN
FT                   KAGASLTVITQTISRITQMNDQIAHATGEQQSVAGVISHNVDEIHQRTEETANSSGRLA
FT                   SVSGELAELAKHLEGITQQFKV"
FT   gene            complement(170802..171509)
FT                   /locus_tag="Patl_0144"
FT   CDS_pept        complement(170802..171509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0144"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; SMART: Prolyl
FT                   4-hydroxylase, alpha subunit; KEGG: pha:PSHAa0187
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38676"
FT                   /db_xref="GOA:Q15ZL2"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZL2"
FT                   /protein_id="ABG38676.1"
FT                   /translation="MPKSETFIKVIEHAISDELCDQFVTQFDSSKNILPGRTGGGIDTD
FT                   KKRSSDVSIITHPEFNVPYQALLPILGQHILRYFEEYFFALIGPIGLTVKHPKTGQPVK
FT                   LTHDNFAEVGLPNLSNLMTYLFRLGNINAQKYEKQQGGYPYWHSEVYPQSKSTDALHRI
FT                   LLFMFYLNDVDEGGETEFYYQDVSIKPRKGTMVIAPAYFTHTHRGNVPISNDKYILTSW
FT                   VQFNQGNAIFAQR"
FT   gene            complement(171502..171909)
FT                   /locus_tag="Patl_0145"
FT   CDS_pept        complement(171502..171909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0145"
FT                   /product="thioesterase superfamily"
FT                   /note="PFAM: thioesterase superfamily; KEGG: cps:CPS_0929
FT                   thioesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38677"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZL1"
FT                   /protein_id="ABG38677.1"
FT                   /translation="MFIEDFNVRFCETDALAHVSNTVLVDWFEMAREPIFKIFSPELDL
FT                   KNWPLILASYKVDFLDQMHYGHPVQVRTYISRIGGSSFDAYQELWQNGTKRATGTTTMV
FT                   QYDYAEKKSVVINEEIRAQLTEHAIPRGVNA"
FT   gene            complement(171926..174754)
FT                   /locus_tag="Patl_0146"
FT   CDS_pept        complement(171926..174754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0146"
FT                   /product="Excinuclease ABC subunit A"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: ppr:PBPRA3290 putative
FT                   excinuclease ABC, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38678"
FT                   /db_xref="GOA:Q15ZL0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZL0"
FT                   /protein_id="ABG38678.1"
FT                   /translation="MDKIAVRGARTHNLKNIDLDIPRDKLTVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSMMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTITEI
FT                   YDYLRLLYARVGEPRCPTHHVPLDAQTVSQMVDRVLTMPADEKLMLLAPVVQDRKGEHV
FT                   KTLESLAAQGFIRARIDGEVCDLSDPPELDLHKKHNIEVVVDRFKVREDLALRLAESFE
FT                   TALNLSAGTAKIAFMDDPHKEEVVFSSNFACPHCGYSMAELEPRLFSFNNPAGACQTCD
FT                   GLGTRQFFDPHRIISNDELSLSGGAIRGWDKRSYYYFQMLQAVADHYKFDLTTPFSELD
FT                   EKAKDIVLHGSKGTSINFKYINDRGDIMERKHPFEGIIPNMERRYRETESNAVRDELSK
FT                   YLSQQHCSSCNGTRLRLEARNVFIGDTPLPTITDMSIAESLQFFTDIELTGKREKIADK
FT                   IFKEINDRLNFLVNVGLNYLSLSRSADTLSGGEAQRIRLASQIGAGLVGVMYVLDEPSI
FT                   GLHQRDNERLLTTLEHLRDLGNTVIVVEHDEDAIRAADFVLDIGPGAGVHGGEIVAQGT
FT                   IDDIMKSEHSLTGKYLSGREAIAIPEKRTEIDQDKWIEMCGATGNNLQDVDLRIPFGLM
FT                   TCVTGVSGSGKSTLINDTFYRIAHRELNGATTGEPAPYKTITGMDMLDKVVDIDQSPIG
FT                   RTPRSNPATYAGIFTPVRELFAGTQEARSRGYKPGRFSFNVKGGRCEACQGDGVIKVEM
FT                   HFLPDVYVPCDVCKGERYNRETLEIQYKGLNIHEVLDLTVEDARKFFDVIPAIARKLQT
FT                   LMDVGLSYVRLGQAATTLSGGEAQRVKLAKELSKRDTGQTLYILDEPTTGLHFHDIKQL
FT                   LQVLHRLRDHGNTVVVIEHNLDVIKTADWVIDLGPEGGSGGGQIIAQGTPEQVCEVEIS
FT                   HTARFLKPLLSV"
FT   gene            175046..176389
FT                   /locus_tag="Patl_0147"
FT   CDS_pept        175046..176389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0147"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pha:PSHAa2706 transporter (MFS)"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38679"
FT                   /db_xref="GOA:Q15ZK9"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZK9"
FT                   /protein_id="ABG38679.1"
FT                   /translation="MNRTEIRASLALAAVYVLRMLGLFMVMPVLAILAVHYPDYSALML
FT                   GLAIGGYGLTQAILQIPMGVLSDKIGRKPVIVGGLLMFAIGSGVAATADSMLWIVIGRF
FT                   LQGAGAIAGAIMALAGDVSREQQRPKVMAIIGIAIGFSFYIALLIGPVIADNYGLHGIF
FT                   SITGILAISCIPLVIWVVPSAINYAPKGDTLPVLTDVKILFFDPQLRRLNISVMLLHMM
FT                   ITVLFVQMPILLSALGWQLESHWQLYLPILAASVVGLVALMMLTKRMSQAGVIRLCILL
FT                   LGGALLGLHFSHSTVLAVMVFGWLFFTGFNFLEASFPAMVSSIAPAGKKGSAMGIYASF
FT                   QFLGAFLGGTLSGLASQYIGPQWVFVIAGGACGIWWLGLRKLGTSERLKRFTLKPDFTR
FT                   YSADTIGEQLATLEGVVDVTVVPDEGVVYIKADGKQFSLEKAHILVNG"
FT   sig_peptide     175046..175141
FT                   /locus_tag="Patl_0147"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.778) with cleavage site probability 0.740 at
FT                   residue 32"
FT   gene            176706..177308
FT                   /locus_tag="Patl_0148"
FT   CDS_pept        176706..177308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0148"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: pha:PSHAa2705 single-strand binding
FT                   protein (ssb) (helix-destabilizing protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38680"
FT                   /db_xref="GOA:Q15ZK8"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZK8"
FT                   /protein_id="ABG38680.1"
FT                   /translation="MASKGVNKVILVGNLGQDPEVRYMPNGNAVANLSIATSESWKDQQ
FT                   GQMQERTEWHRLTMYRRLAEVAGEYLRKGSQIYVEGKLQTRKWQDQQGQDKYTTEVIVD
FT                   QMQMLGGKGGGQSEGGFQGQQRQPAQRPAQGGQNAGGQRSGGQNSGGFQQSPNQGYNQA
FT                   PQGGQGNQGFNQAPQGGQNKPAPMAEPDFDFDDDIPF"
FT   gene            177901..180309
FT                   /locus_tag="Patl_0149"
FT   CDS_pept        177901..180309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0149"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor TonB-dependent
FT                   receptor, plug; KEGG: ccr:CC3461 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38681"
FT                   /db_xref="GOA:Q15ZK7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZK7"
FT                   /protein_id="ABG38681.1"
FT                   /translation="MFKRNTQKFRLCAISAAVMGLISTGAMAQQTSAAQNKAQEEDVEQ
FT                   IIVTATKRAESIGDIPFSINAQTQKDFERSGASNLEDIARNVASVAIQNLGPGQSQVSM
FT                   RGVSAGQIVRDQPGVKEQVGVYLDESVISLSLFTPDLDLFDLNRIETLRGPQGTLFGSG
FT                   SIGGTLRYITNQPELDTFEGKFEANLNSVSDGGTGGNVKGMVNLPISDSVAMRAVVYRT
FT                   EYAGFIDAYGPDDAFKEDVNDGDRTGGRVAFVISPNDKLTITPRIIFQELEINGFNRQD
FT                   AFNIFANPYTTTWPAKQLKDREQFLLLEEGFSDDTLIADLTAEYQAEIADFTFVYSYTD
FT                   RDILVSRDASALSGSVSVDLGFPDAAVTLPSNLLDRTEVEQDTFELRAASNDDGALDWI
FT                   VGAFYSSTDRTYKQTLPTPGYDSFTDATLGAGTSAAVANGFDVDSPYNAFLPYDLTQLA
FT                   IFGEVNYQVNDDLKVTAGSRFYDYEEERQFISGGLFANGDNQTDATESDGFTSRILGQY
FT                   RLNDNVNINAQISEGFRLGGVNDPLNRSLCSDQDEAIFGSFQDYEDEQLTNYELGFKSS
FT                   GRGWSANVSAFYNDIEDLQVTLDAGSCSSRVSFNVPDAHTQGLEFELTRQFTDQLFFSL
FT                   SGSIIEAEFDSTVVDGSGAVLGGVEDGNRLASVPEESFSISFTYDLASPLFSSNSTYFQ
FT                   GSYQYVGDRITQPSDQVAGAGTFVSGLAFGGATGQETTELDLVLDAYGTMNLSFGLAYD
FT                   DYEILLYANNVFDENALLSLDRERGGRARLGFTTNQPRTIGATFRYFFE"
FT   sig_peptide     177901..177987
FT                   /locus_tag="Patl_0149"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 29"
FT   gene            180520..180669
FT                   /locus_tag="Patl_0150"
FT   CDS_pept        180520..180669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0150"
FT                   /product="zinc finger protein"
FT                   /note="KEGG: vfi:VF1472 zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38682"
FT                   /db_xref="InterPro:IPR017136"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZK6"
FT                   /protein_id="ABG38682.1"
FT                   /translation="MNKTQLPSKICPVCQRPFSWRKKWQKDWEHVKYCSKRCAGNRKSL
FT                   DDKR"
FT   gene            complement(180712..182199)
FT                   /locus_tag="Patl_0151"
FT   CDS_pept        complement(180712..182199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0151"
FT                   /product="deoxyribodipyrimidine photo-lyase family protein
FT                   (cryptochrome)"
FT                   /EC_number="4.1.99.3"
FT                   /note="PFAM: DNA photolyase, FAD-binding; KEGG: vch:VC1392
FT                   deoxyribodipyrimidine photolyase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38683"
FT                   /db_xref="GOA:Q15ZK5"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZK5"
FT                   /protein_id="ABG38683.1"
FT                   /translation="MDKEHINVVWLKRDLRLRDHQALFAAAQQPLPVVMMYLFEPSVIA
FT                   DPHYDVRHWRFVWQSIVDLNSQLADYNARIIVLFEEAHSVFAQLMQRFHIAGVYSHQEI
FT                   GLACTYKRDKAIARMLDAEGISWHEYNHGGVIRGATHRRDWEQNWDKHMNAQCADTPLH
FT                   EVNWLTFATLMTLDESEALPQEYKTQRPAFQLGGEKRAWYTLHHFLKERGKAYAYSVSS
FT                   PIKSRTACSRLSPYLAWGNISTRQVYQSTASKKHKDGWQRAINAFRSRLHWHCHFIQKF
FT                   ESESDMEFRPVNKAYLAYEYEQGEQKDANLQAWKTGQTGIPIVDASIRCLHQTGYLNFR
FT                   MRAMLVSFLCHHLNIDWREGAIHLAQLFLDFEPGIHYPQFQMQASVTGTNLIRLYNPVK
FT                   QSQDKDPQGQFIRRFIPEISDLPDALIHTPWLLTPMECQIYEVELGRTYPHPMIDLEQT
FT                   GKRARDTLWTFQKRDDVQQETKRILKQHTLVNRPRRI"
FT   gene            complement(182192..183529)
FT                   /locus_tag="Patl_0152"
FT   CDS_pept        complement(182192..183529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0152"
FT                   /product="deoxyribodipyrimidine photo-lyase
FT                   (single-stranded DNA-specific)"
FT                   /EC_number="4.1.99.3"
FT                   /note="PFAM: DNA photolyase, FAD-binding DNA
FT                   photolyase-like; KEGG: ilo:IL0122 deoxyribodipyrimidine
FT                   photolyase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38684"
FT                   /db_xref="GOA:Q15ZK4"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014133"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZK4"
FT                   /protein_id="ABG38684.1"
FT                   /translation="MKKLSSALPKRGIFWFRHDLRLHDNPALVALSEQVDELLCVFIID
FT                   PRWFKSSHFQSAHMGDKRWAFLQQSLSELQRHLQEQGQQLFVLEGETLEVLDALIGSYT
FT                   PDIVASGMHPGVYERQQWQRVKQGNPNTLFIQENGHSLFQPATLPFEIEYLPASFTPFR
FT                   KRVEDLQVAVALPAPTALPPAPDLAWLSSKNVNPPKKAIGLAFTGGEDAALAQLEYTLF
FT                   TSHNIKNYKQTRNGLDGWDYSSKLSPWLANGCLSVRQVFTELRRYESEYEKNDSTYWLY
FT                   FELLWREYFQWHLFKYQSKLFQFSGTQDTRPLTTFVALRFAMWCQGETPYPIVNACMKQ
FT                   LNHTGYMSNRGRQLVASCLVNELGVDWRFGAAYFEQQLVDFDVASNWGNWQYLSGVGVD
FT                   PRGHRRFDLAKQAQQYDPNGEFVRQWAGDTYVSGIDQTDAADWPLG"
FT   gene            complement(183672..185084)
FT                   /locus_tag="Patl_0153"
FT   CDS_pept        complement(183672..185084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0153"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: reu:Reut_A1459
FT                   aldehyde dehydrogenase (NAD+)"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38685"
FT                   /db_xref="GOA:Q15ZK3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZK3"
FT                   /protein_id="ABG38685.1"
FT                   /translation="MQSFSMLINGELVQGNRPLDIVNPATEEVFQRITCADESQFEQAI
FT                   GAAKAAFPQWQTVDMQTRRDCLNKLADTLEEQTNVFAELLTQEQGKPLAESIAEVGFSC
FT                   AFIRYFAQSELPIETYQDDETAKIELHRKPLGVIAGVVPWNFPLMIGSFKLAPAVLAGN
FT                   TFILKPPATTPLCVLKLSEICQQIFPKGVVNIITDNNDLGHILSTHPDVAKVAFTGSTP
FT                   TGKKIMSAASTTLKRLTLELGGNDAGIVLPDVDPKKIAPAIFGTAFMNCGQVCIALKRL
FT                   YVHEDIYDDLVSELSELANNATVGNGLHEGVTFGPIQNKAQFIKVQEYLTDAKENGVIA
FT                   AGGEVLDGPGFFMRPTIVRDVTDGCKVVDEEPFGPILPVIKYKNIDEAVERANNSVFGL
FT                   GGSVWSNDLDKAYDVAKRLECGTTWINQHLNFGPTVPFGGAKESGIGVEFAQEGLLEYT
FT                   QVHVINMAKQTF"
FT   gene            complement(185095..186795)
FT                   /locus_tag="Patl_0154"
FT   CDS_pept        complement(185095..186795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0154"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   son:SO1971 AMP-binding family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38686"
FT                   /db_xref="GOA:Q15ZK2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZK2"
FT                   /protein_id="ABG38686.1"
FT                   /translation="MALKQSYICGKADSQLIYQTIGEYFDYISQKHADSEALVVAHQDV
FT                   RWTYATLKQKVDELATGLLALGIGKGDRVGIWGPNSFEWTVTQFATAKIGAIMVCLNPA
FT                   YRLRELEYALNKVECKAIVCAEQFKSSCYPEMLQQLIPELARCDASNIQCAAAPHLRNI
FT                   IKMGNSTVPGMLNYERVTQMGGDAERNQMATITSQLLPDDPINIQFTSGTTGQPKGATL
FT                   THCNILNNGFLAGEGMRLSPNDRVCIPVPLYHCFGMVLGNLSCIAHGATMIYPNDAFDP
FT                   LTTLQVVEKERCTALHGVPTMFISELDHADFKQFDLSSLRTGIMAGSLCPAEVMKRVIN
FT                   EMHMEHVLIGYGQTELSPLNHLTLPEDPLQKRVETVGRVMSRIEVKLVDEYNRVIPIGE
FT                   RGEVCTRGYSVMRGYWNDPIRTAETIDAGGWLHSGDIGIMDEDGYVTIVGRSKDMIIRG
FT                   GENIYPKEIEEFLYTHPAVQDIQVFGIAHTDFGEEVCAWICLKPGSSACATEITDFCKN
FT                   QIAHFKIPKHIRFVEEFPLTVTGKVQKFKMREVMELEISQVSPPSSPSK"
FT   gene            complement(186821..189145)
FT                   /locus_tag="Patl_0155"
FT   CDS_pept        complement(186821..189145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0155"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor TonB-dependent
FT                   receptor, plug; KEGG: nar:Saro_2601 TonB-dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38687"
FT                   /db_xref="GOA:Q15ZK1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZK1"
FT                   /protein_id="ABG38687.1"
FT                   /translation="MKTLNYSSISTAITLGLASISGLASIRAHADVLEVIEVTAQKRTQ
FT                   SVQEVGISITAFSGDQIDALGYDNAQEVTAMAPGVTAIQPNGPSAFYINIRGVAQNDFS
FT                   GDHQESPVAVYLDEAYISASSGAGFQLFDIERVEILKGPQGTLFGRNATGGLVHYISRK
FT                   PTDTFEGYGKVTLGSYNQVLTEGAIGGALTDTLFSRFSFTTNNHDPYINNTLGKDLNNG
FT                   DDWAARLQFLLEVTDDVEWLVSARRGEQDIDSGFFEHSSARLNPATGLGEHFDGPNLTT
FT                   SAYQEPDNGVYTGSYDRIGFNKVESQGVTSNLQWDFGDILFTSITDIWSLEKDYIEDSD
FT                   ASPQDYYNFFLQSDVDQFSQELRLNGQSENTRWVTGLYYLDIDGTFANGGEVRGFVDQL
FT                   AGAGAGTGPVTGGPVTIWTPFDTTTETYSVFAQVEYDVNEQWTVIGGLRWANEEKSIDY
FT                   SQNYVEIANGSNPSAANIVNPDPLGFGGPLFVFNDDTFDFASLDDDYVTAKAEVDFSPA
FT                   KGTLFYLSYNRGIKSGGYNAPLDITDFLDGNPETGGPEEMKFDKETLHAYEFGIKHQLN
FT                   STTRVNGAVYYYDYDDYQAFRLEGLTTFVFNTGASVSGAELEITSNPIDNLDLLLGVSY
FT                   VDNNVEDAYQLPNGDLIDRRAVVTPEWNINGLARYGWQLADGELAAQIDFVYMSEHYFQ
FT                   LKNSPVGEQSSYALFNARVSYTSDDGKWVFAGFVDNLLDKEYRVMAFDLAGGPEAGGFG
FT                   MVENYYGKPRWWGLSATYKFE"
FT   sig_peptide     complement(189053..189145)
FT                   /locus_tag="Patl_0155"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 31"
FT   gene            complement(189179..189631)
FT                   /locus_tag="Patl_0156"
FT   CDS_pept        complement(189179..189631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0156"
FT                   /product="cytochrome c, class I"
FT                   /note="KEGG: nar:Saro_1690 cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38688"
FT                   /db_xref="GOA:Q15ZK0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZK0"
FT                   /protein_id="ABG38688.1"
FT                   /translation="MPNTIQFKHITSALGLAIMLLQPQVSYANDAHTKMKYTLFCSGCH
FT                   TADGRGSGDPRIPDMRNFVGYFAAVEGGREFLIQVPGVSTAPLKSKELAQIVNWMLRSF
FT                   SADQLPDDFKPFDEQEVERLRQYVLRSELGDTRKALVTRIEEYKKK"
FT   sig_peptide     complement(189545..189631)
FT                   /locus_tag="Patl_0156"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            complement(189646..190203)
FT                   /locus_tag="Patl_0157"
FT   CDS_pept        complement(189646..190203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0157"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /EC_number="1.4.9.1"
FT                   /note="KEGG: nar:Saro_1688 amine dehydrogenase; TIGRFAM:
FT                   Twin-arginine translocation pathway signal; PFAM:
FT                   Methylamine dehydrogenase light chain, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38689"
FT                   /db_xref="GOA:Q15ZJ9"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013504"
FT                   /db_xref="InterPro:IPR016008"
FT                   /db_xref="InterPro:IPR036560"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZJ9"
FT                   /protein_id="ABG38689.1"
FT                   /translation="MKWFDKFFENKTRNIARTSSRRSFLSNVGKAVVGVSVIPALPVAK
FT                   AAGGGASAGAHYPGVAAQPSTNEGDPGDPTTCEYWRYCGIDGFLCSCCGGSQSACPPGT
FT                   EMSPITWIGTCLNPADNKHYIISYNDCCGKAACGRCFCNRNEDDTPMYRAFSNNDTNWC
FT                   VGASSETYVCSTAIILGTSIES"
FT   sig_peptide     complement(190063..190203)
FT                   /locus_tag="Patl_0157"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.900) with cleavage site probability 0.790 at
FT                   residue 47"
FT   gene            complement(190218..190838)
FT                   /locus_tag="Patl_0158"
FT   CDS_pept        complement(190218..190838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0158"
FT                   /product="Redoxin"
FT                   /note="PFAM: Redoxin; KEGG: nar:Saro_1687 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38690"
FT                   /db_xref="GOA:Q15ZJ8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZJ8"
FT                   /protein_id="ABG38690.1"
FT                   /translation="MSNLFLFTFALLWVLVIALGVVVYALARQVGVLYERVAPAGALAM
FT                   NQQLKAGDKAPEISVKTITNQKLFIGKPTKKSTLLFFLSPDCPVCKEYLPVIISLSHAE
FT                   RSHLDVVFVSDGDEPDHQAFIKEKKLENFPYVLSEEVGKKYGVSRLPYATLIDKSGIIS
FT                   SMGLVNSREHIESLLNAQDLNVASIQEFLEKQGNNERTLYKQA"
FT   sig_peptide     complement(190755..190838)
FT                   /locus_tag="Patl_0158"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.855 at
FT                   residue 28"
FT   gene            complement(190845..191366)
FT                   /locus_tag="Patl_0159"
FT   CDS_pept        complement(190845..191366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0159"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reu:Reut_B4079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38691"
FT                   /db_xref="GOA:Q15ZJ7"
FT                   /db_xref="InterPro:IPR009908"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZJ7"
FT                   /protein_id="ABG38691.1"
FT                   /translation="MLINLLLGLLCVFWAACAIHKLADINSFTHNLKQYQWVPHIHSNI
FT                   LVVGLVLVEAICATLLLLPTFQLIGLLLAGALLLAYSGLIALNIYSGNQDFDCGCLFGS
FT                   QEQRLSVSLLWRNAGILLLHVIAAIGVQFATPSASDLLISILFGTVTLLIGVIAQQLFR
FT                   NQSHINAVRR"
FT   sig_peptide     complement(191310..191366)
FT                   /locus_tag="Patl_0159"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.612) with cleavage site probability 0.393 at
FT                   residue 19"
FT   gene            complement(191371..192522)
FT                   /locus_tag="Patl_0160"
FT   CDS_pept        complement(191371..192522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0160"
FT                   /product="Amine dehydrogenase"
FT                   /EC_number="1.4.9.1"
FT                   /note="KEGG: nar:Saro_1685 amine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38692"
FT                   /db_xref="GOA:Q15ZJ6"
FT                   /db_xref="InterPro:IPR009451"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZJ6"
FT                   /protein_id="ABG38692.1"
FT                   /translation="MVSKKILLLSSLLFCSVSHAELPNDTVPKVLTLPQTHGESWLYVQ
FT                   DMNFWGMTEGKVIILDIASSTRNYKGQVSTGFFGSFIPSTERNEMYSAETYYSRGTRGV
FT                   RTDVLSVWDNATLTVKNEIELPHKKRAQTVSEKNATQLIDEDKYMLVFNFTPATSVSVI
FT                   DMLEHKVLNDVDIPGCSLIYPSGERGFSTLCADGSMLSIQLDEQGEVASETRVPSFFNV
FT                   DEDPLFEKYARINNIGYFPTFHGYMQPVDLSGDVAKPQQKWDLLSASEREQNWRPGGWQ
FT                   IISGHPDGRVFVLMHKDGVNGSHKDGGTEVWVYDTQQHKKVKTIPLETHGISLEITKGD
FT                   NPLLAVTNANMMIDVYDAKSAELQRTLSIGGDNANPFTLTAVE"
FT   sig_peptide     complement(192460..192522)
FT                   /locus_tag="Patl_0160"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            192790..193455
FT                   /locus_tag="Patl_0161"
FT   CDS_pept        192790..193455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0161"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: nar:Saro_1684
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38693"
FT                   /db_xref="GOA:Q15ZJ5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZJ5"
FT                   /protein_id="ABG38693.1"
FT                   /translation="MRNIRKGTGESRRGKETLLLILNSAKTILIEQGYSKLSMRKVAVG
FT                   AQISVGNLQYYYPSKNDLLKDMLDHSIDEFMDEFERLRLGTNNDPELHLKSIINFIVLD
FT                   LGNPTTTTFYPELWALANHDEYADKLMDEIYARVRVPLEDSIMRLNPRLDFEQVQKVAL
FT                   FISSSMEGMTMFVGHGKVWNDSIQHMANIATMSFLQLVKNITPEDIQENSFILAADKG"
FT   gene            complement(193549..193977)
FT                   /locus_tag="Patl_0162"
FT   CDS_pept        complement(193549..193977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0162"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory proteins, AsnC/Lrp
FT                   Helix-turn-helix, type 11; KEGG: pha:PSHAb0429 putative
FT                   transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38694"
FT                   /db_xref="GOA:Q15ZJ4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZJ4"
FT                   /protein_id="ABG38694.1"
FT                   /translation="MITKQEQQLLSILRSNARASISDLARVLNLSRSTVQNRMIKLEQS
FT                   GVIKGYAVQYGSEYQDNLVSSHVSIKVRQKLTAKTNAELRQVSEVSELYAISGEYDLIA
FT                   IVQAESLEQLSQILDNIGNLEGVERTNSSVILETKFKR"
FT   gene            194129..195334
FT                   /locus_tag="Patl_0163"
FT   CDS_pept        194129..195334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0163"
FT                   /product="acetylornithine aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.11"
FT                   /note="TIGRFAM: acetylornithine and succinylornithine
FT                   aminotransferases; PFAM: aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase aminotransferase
FT                   class-III; KEGG: pha:PSHAa0194
FT                   N-succinyldiaminopimelate-aminotransferase/acetylornithine
FT                   transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38695"
FT                   /db_xref="GOA:Q15ZJ3"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017652"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZJ3"
FT                   /protein_id="ABG38695.1"
FT                   /translation="MQVTRELFDDVMVPNYAPSAIIPVRGKGSRVWDQNDKEFIDFAGG
FT                   IAVNCLGHCHPALVQALTEQGQKLWHLSNVMTNEPALRLAQRLTQLTFAEKVYFANSGA
FT                   EANEAALKLARRWALDVYGAQKSQIISFNKSFHGRTFFTVTVGGQTAYSDGFGPKPGDI
FT                   AHADYNDLAGLEALISDKTCAVMLEPLQGEGGIISPDADFIKGVRALCDKHNALMIFDE
FT                   VQTGVGRTGAMYAYQNLGVTPDILTTAKALGGGFPIGAMLTTTEIAKHLKIGTHGSTYG
FT                   GNPLACAVAEAVLDVVSHDDVLQGVAKRETLFREGLERINDKYHVFAEIRGKGLLLGAA
FT                   LNEKYKGRAKAFLVAAAEHGLMCLIAGADVVRFTPSLVIPEQDIELGLQRFELAVAQVV
FT                   KG"
FT   gene            195340..196380
FT                   /locus_tag="Patl_0164"
FT   CDS_pept        195340..196380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0164"
FT                   /product="arginine succinyltransferase"
FT                   /EC_number="2.3.1.109"
FT                   /note="PFAM: arginine N-succinyltransferase beta subunit;
FT                   KEGG: pha:PSHAb0427 putative arginine succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38696"
FT                   /db_xref="GOA:Q15ZJ2"
FT                   /db_xref="InterPro:IPR007041"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017650"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZJ2"
FT                   /protein_id="ABG38696.1"
FT                   /translation="MLVIRPICAADFAALKQIAVESGHGFTSLPDNDELLLSKISRAQK
FT                   SFTEQVTSPGQQNYLFVLEDTQSKEIIGVTGIEAAVGLNAPFYHYHIASHVHYSERLGV
FT                   KKVVETLNLCNDYTGASEVCTLFVREKFRRGFAGQLLSRVRYLFMANHPERFSDLVIAE
FT                   MRGVSDENGHSPFWAWLEPNFFGIDFPTADYLVGMGDKSFIAELMPKHPIYVALLSKDA
FT                   QNVIGQVHEKTAPALRLLQKEGFFHRGYVDLFDAGPTVEVALKNIRTVQQSQLATVLIT
FT                   DKSQLPTTDSGAQNYMLCSTDVSQFRATITPCIRYENESNTLLISAEMASELGLMNASD
FT                   VRFIGL"
FT   gene            196451..197257
FT                   /locus_tag="Patl_0165"
FT   CDS_pept        196451..197257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pha:PSHAb0425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38697"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZJ1"
FT                   /protein_id="ABG38697.1"
FT                   /translation="MHTNVNTLFEKLWESYLAVTPSAVTVHDLFGKTQGQEVINDHIAL
FT                   RTFNLPGIGLDALAAHFEALGYKACGEYHFVGKKLYAKHFEHSENPDLPKVFISELLLE
FT                   QCSESLQQTIRNLVSNMSVDAVTQDNFLYSGRHWDIDYATYQQLLQESEFAAWVAAWGY
FT                   RANHFTVSNNHLSEFDSIEQINQAVKAAGLSLNTAGGEIKGSVEVMLEQSSTLADKHPV
FT                   AFSDGEREIPSCFYEFAKRYPKPDGKLFTGFVAESADKIFESTNAR"
FT   gene            197510..198442
FT                   /locus_tag="Patl_0166"
FT   CDS_pept        197510..198442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0166"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SO4114.2 hypothetical biogenesis protein
FT                   MshI"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38698"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZJ0"
FT                   /protein_id="ABG38698.1"
FT                   /translation="MRISWREFIKQYFSKPSKFHSIGIEMGDAELHLNVIQKKSGAYQW
FT                   VEQHTLPMQDWAKHLQEYVANHNLARTPCYIALGLNKYQHFQVDRPEVEEQEIASALKW
FT                   QIKEQLTSTDEHVFDYYDHPAVIGGKKRVNVVAISRAHIHGIIKGITRAELKLNTITIE
FT                   ELATSELLPTDDDAVLTLFQENGGQINLNIVKQGKLFFSRRLKGYENLASFSLEEFQMG
FT                   MGDTLSVEIQRSMDYFESQLRQAPVRKIVVHLNSSIQQELAKVIQELTFMPVTVMALPL
FT                   ASPQPEKMVSLASLGAALSDVKLNTEAAQ"
FT   gene            198439..199050
FT                   /locus_tag="Patl_0167"
FT   CDS_pept        198439..199050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0167"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vvu:VV11433 MSHA biogenesis protein MshI"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38699"
FT                   /db_xref="GOA:Q15ZI9"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZI9"
FT                   /protein_id="ABG38699.1"
FT                   /translation="MKSRINLYLPELHPKLEVLTLSFVLTVWAILFTIVGLVYYHDYSH
FT                   GQSVKADLIAIEVQKQQAEDRLAELNETLANRTKDPKLLAAIESKQLEVSLKQRVIDEL
FT                   SGQEQFKSNGFAGLMLGLAEHHLDGLWLTGIRLDEHHVMLEGAATDSSLIPQWMTQLSL
FT                   TERLKGQEFSTTKLYRDPNQQLMFTLGTKTTSDAQAGEQP"
FT   gene            199047..199739
FT                   /locus_tag="Patl_0168"
FT   CDS_pept        199047..199739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0168"
FT                   /product="MSHA biogenesis protein MshJ"
FT                   /note="KEGG: son:SO4114 MSHA biogenesis protein MshJ"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38700"
FT                   /db_xref="GOA:Q15ZI8"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZI8"
FT                   /protein_id="ABG38700.1"
FT                   /translation="MSQTLKERYNTLFAQFLAITQREQILILLSGVVVIGMVGYLLFIE
FT                   PVNETVTRDEQNIASMRNQVRSVEAQIEVSEHAFSNDPNEQLVASLNKLKQRSLDLDTD
FT                   LQQETVNLVPPKQMPLLLEKVLAESQGVTLISMQSIPPTPVLNMGEKGGDTESVANELA
FT                   DINLYRHGVLLSLKGSYFDIQRYLTGIENLRWQFYWKRFNYVVTDYPDASVEVELYTLS
FT                   TSKAFIGV"
FT   gene            199741..200091
FT                   /locus_tag="Patl_0169"
FT   CDS_pept        199741..200091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38701"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZI7"
FT                   /protein_id="ABG38701.1"
FT                   /translation="MHRNLNFMLGIFVVTLVFTSAAFAQVLVDPTRPFDATPSTSARGE
FT                   IADTLILSAIFINGDHKHAIINGMNVKEGQDVAGKTLISISKGRVILRGAKGSQELYVN
FT                   HSQFIKDANDGF"
FT   sig_peptide     199741..199815
FT                   /locus_tag="Patl_0169"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            200081..201733
FT                   /locus_tag="Patl_0170"
FT   CDS_pept        200081..201733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0170"
FT                   /product="pilus (MSHA type) biogenesis protein MshL"
FT                   /note="TIGRFAM: pilus (MSHA type) biogenesis protein MshL;
FT                   PFAM: type II and III secretion system protein
FT                   Secretin-like Secretin/TonB, short N-terminal; KEGG:
FT                   cps:CPS_4576 MSHA biogenesis protein MshL"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38702"
FT                   /db_xref="GOA:Q15ZI6"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011514"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013358"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZI6"
FT                   /protein_id="ABG38702.1"
FT                   /translation="MDFKLITLSGFLLVLVACQAKHDTQHYEKSLDAAIADTEKTVSPK
FT                   KQGVPDLPDAVHQTLMPRSEQADDALFGEPKFDINAQQIDAVSFFAGIVEDTPFSVAIH
FT                   PSVSGLITLNLKQVTLEQIFDIVTEIYGYDVQRRQNIYRIYPSGMRTETFAVNYLLMKR
FT                   DGATQTSITSGGVSQAQNSSSSSSGSSLNSFSGNSSSGSSNNLNSGSNGNGTSISTSTE
FT                   TDFWTDLLASLQVMIGAEEGRSVMVMPQAGLVTVRAMPSEIRSVKEFLAISEEHVQRQV
FT                   ILEARILEVSLSDGYQQGINWTEVLANSGSTDFQFSTTAGSLGDAISASLGGITSLSFV
FT                   NKDFSGVLNLLQTQGNVQVLSSPRVTAINNQKAVIKVGDDEYFVTDVSSQSTVTAATSS
FT                   TTPNIELTPFFSGIALDVTPQIDAQGGVLLHVHPSVIETEEQEKVVTLNEEQFVLPLAA
FT                   SNIRESDTIIHARSGEIVVIGGLMQSIISETESKTPLLGDIPLLGNLFKNRQETETKKE
FT                   LVILLRPTVVGADTWRQQLIRSRNQMADWLHVD"
FT   sig_peptide     200081..200143
FT                   /locus_tag="Patl_0170"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.889) with cleavage site probability 0.838 at
FT                   residue 21"
FT   gene            201738..202646
FT                   /locus_tag="Patl_0171"
FT   CDS_pept        201738..202646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0171"
FT                   /product="MSHA biogenesis protein MshM"
FT                   /note="KEGG: cps:CPS_4575 MSHA biogenesis protein MshM"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38703"
FT                   /db_xref="GOA:Q15ZI5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZI5"
FT                   /protein_id="ABG38703.1"
FT                   /translation="MYLYHYGIKELPFTLTPNTSYFFGLPSHKEAIEVLLTAIKTGEGF
FT                   IKVTGEVGTGKTLICRKLLNELPEHFVAAYIPNPYLTPSELRRSVAAELNVTLSENADQ
FT                   QEFTQRIQRRLIEINQQNRGVVLIIDEAQALPVESIEALRLITNLETESRKLLQVVLFG
FT                   QPELDDKLALPELRQLKQRVTFSYALKLMNADQLFQYVRHRMSVAGYRGGDIFSNRACK
FT                   LLFKASKGTPRIVNVLCHKALMLAYGEGKQQVEIKHVKLAIADTEAAYKMGFGMGKFVV
FT                   VTLLAICIALGGYMAYQRFTL"
FT   gene            202643..203764
FT                   /locus_tag="Patl_0172"
FT   CDS_pept        202643..203764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0172"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ilo:IL0369 membrane associated TPR repeats
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38704"
FT                   /db_xref="GOA:Q15ZI4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZI4"
FT                   /protein_id="ABG38704.1"
FT                   /translation="MSVVNKMLQDLEARQTGSDAVSADYQPPQRNTTRLAWLILLMVIA
FT                   LLFAAVTFMWPTVTDDVSSQDTSSNMINPALRDIAVVEPTEPDTPAKGGMTWLEPADKA
FT                   NIDLSAGHQKQLETNSQMQAMPKIDKKPESQVAQLQSDESAQSSPVAIDPKSAMSPPYA
FT                   AAEKVIPPKATFSKKANRAQNAQAGLKQSINQALRDGKTLIAIEGLQQLLSQEPDNLRI
FT                   RKKLASLLFAENRMLEAQALLSEGLADAPELHDLRLMLARLFAQQNQQAKALTLLLEVS
FT                   PSLVLHSDYYAYRGALAQQTQNYAQAQQDYQRLVNAEPRKAKWWLGLGIAQDSAGENKQ
FT                   ALMSYQKADDEQQLSPQVITFVRQRLKELVGIE"
FT   gene            203761..205674
FT                   /locus_tag="Patl_0173"
FT   CDS_pept        203761..205674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0173"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E General
FT                   secretory system II, protein E-like; KEGG: pha:PSHAa2692
FT                   mannose-sensitive agglutinin (MSHA) biogenesis protein MshE
FT                   (pilus type IV)"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38705"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZI3"
FT                   /protein_id="ABG38705.1"
FT                   /translation="MKPKAKIRLGDLLVQEGIISEEQLMQTLSAQKQSGRKLGYMLIEL
FT                   GFMTENQLLTFLSQHLGVPLIDVTQYRVSVEAVLLLPEVQARRYRALVLDDKGDHLLVG
FT                   MSDPADLAALDILSGVLPKPVKVAVVSDAQLFQAYDRFYRRTEDIASFAQELAEEYQDD
FT                   EEFDFDTGVDNEQDTAVARLLQSIFEDALQTKASDIHIEPDSEMLRIRLRVDGVLQENI
FT                   IKEKNIASALVLRLKLMSGLDISEKRLPQDGRTNMRIKGHSIDVRVSTMPVQNGESVVM
FT                   RLLDQSAGVLSLEQTGMPAALLKRFRVLLRRPHGMILVTGPTGSGKTTTLYGALSELNQ
FT                   PSAKIITVEDPVEYRLPRINQVQTNSKIGLNFSNVLRTTLRQDPDIIMVGEMRDQETAE
FT                   IGLRGALTGHLVLSTLHTNDAISSAVRLLDMGAPGYLVASSLRAVIAQRLVRKVCESCS
FT                   EAYQPTREESLWLKSIDSQVVNVTFRRGRGCQTCNNTGYRGRVGVFELLEMTESMMNAL
FT                   KTNDSVQFGQAALHSPGFVPLAKVALTYAKMGITTVDEVLKLIEMVADEQAREPGLEEN
FT                   AELVEMTETQSSQAASHEGNAESGASPTSAARSENNKPTPSSGEFSFELEPRDDGPGGN
FT                   NG"
FT   gene            205667..206884
FT                   /locus_tag="Patl_0174"
FT   CDS_pept        205667..206884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0174"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   ilo:IL0371 type II secretory pathway"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38706"
FT                   /db_xref="GOA:Q15ZI2"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZI2"
FT                   /protein_id="ABG38706.1"
FT                   /translation="MANFTYKARNASGELASGSLEASDASSVAQILLGRKFTPIEIKEV
FT                   SDSANVTLNLSIFAPNIKLEDLVIFSRQMYSLTKSGIPIIRSVKGLAETSNSERMTKIL
FT                   NDVCDQLERGRTLSSALHRHNKVFGQLFVSIVHVGENTGRLDEAFLQLSDYMEREQETR
FT                   KQIKAATRYPTFVILAVVAALIIMNIFVIPVFANMFSSFGAELPLMTRVLLATSDFFIT
FT                   KWLHMLICIGLAIFLVFKYINTPKGRFNWDRAKLRLPIVGGIFERTLLSRFARSFSMML
FT                   RSGVPLTTALNLVADAVSNAFMADRIVKMRKNIEKGESLSRVASSSKMFTPLVLQMINV
FT                   GEETGRVDELLGEAAEFYEREVDYDLKSLTSKIEPILIMVVAAMVLVLALGIFTPMWNM
FT                   MGAIQG"
FT   gene            206888..207400
FT                   /locus_tag="Patl_0175"
FT   CDS_pept        206888..207400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0175"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cps:CPS_4571 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38707"
FT                   /db_xref="GOA:Q15ZI1"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZI1"
FT                   /protein_id="ABG38707.1"
FT                   /translation="MRRNEASDERERSLFSNLIVVVVFTSLILGFIVYFNDSSPSIRKV
FT                   ALQNLVEQFTKSTLNAHWQWQNEGRPSSILLIEYDTQGNETGRHPLSMSHLGWPKLEPT
FT                   SEGCAALWRDVLDTELEVEGFKMYAEFYDGVQINNNALSSICRYRLSTGPYFEYKVYTG
FT                   QVSKIIS"
FT   gene            207418..208056
FT                   /locus_tag="Patl_0176"
FT   CDS_pept        207418..208056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0176"
FT                   /product="Prepilin-type cleavage/methylation"
FT                   /note="PFAM: methylation; KEGG: ilo:IL0373 pilin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38708"
FT                   /db_xref="GOA:Q15ZI0"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZI0"
FT                   /protein_id="ABG38708.1"
FT                   /translation="MTKLARSQYQTFAKGGVQRQRGFTLIELVIVVVILGLLAATALPR
FT                   LLDVTEEAEDATVEGVAGGYATGVGLVRAQWEIEGRPKENFATNLSFVTIDDIRIGVDQ
FT                   DTGYPTGQLDTDSSTEDTQISLLDCESIFNLIMQSAPTISSDWNERPFDDHRYFTRQSE
FT                   GNGSGGNDLCYYYLTQTIKNDTNEPVDNTAGNGFIYDPRIGQVIVFSNN"
FT   gene            208160..208720
FT                   /locus_tag="Patl_0177"
FT   CDS_pept        208160..208720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0177"
FT                   /product="Prepilin-type cleavage/methylation"
FT                   /note="PFAM: methylation; KEGG: pha:PSHAa2689
FT                   mannose-sensitive agglutinin (MSHA) biogenesis protein MshA
FT                   (pilus type IV)"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38709"
FT                   /db_xref="GOA:Q15ZH9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZH9"
FT                   /protein_id="ABG38709.1"
FT                   /translation="MQSSKQQGGFTLIELIIVIVILGILAVTAAPKFLDIQGDARASVV
FT                   SGMEGAMKSASDIIHAKSLLNGTNSSAAATITLANTQTIQTDYGYARHDWEDAWDEMLD
FT                   ATVTVRTSGSCVTEFCVDESQDIGTDLTADGFATLPNQSTVALIVYPNGTTNAGACYAY
FT                   YIHDEAATAEGAEPVIGSITTGC"
FT   gene            208803..209369
FT                   /locus_tag="Patl_0178"
FT   CDS_pept        208803..209369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0178"
FT                   /product="Prepilin-type cleavage/methylation"
FT                   /note="PFAM: methylation; KEGG: cps:CPS_4568 MSHA pilin
FT                   protein MshC"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38710"
FT                   /db_xref="GOA:Q15ZH8"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZH8"
FT                   /protein_id="ABG38710.1"
FT                   /translation="MRNVRSKNTLPVIAAHRGFTLVELVVVILIIGVLAVSAASRFDST
FT                   GYAEYSYQSRLLSALRAMQQRAMQDTRADYCFQINFNISNPGFGPPTLSYRNNTPAEHT
FT                   ATCATAINYTTPEFLRTSNGEIAADGIGLSTLDTGNGAFNWIRFDSLGRPLTSAGSCQA
FT                   TCRITFQGTQSPAICVESEGYIREC"
FT   gene            209359..209928
FT                   /locus_tag="Patl_0179"
FT   CDS_pept        209359..209928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0179"
FT                   /product="Prepilin-type cleavage/methylation-like protein"
FT                   /note="TIGRFAM: Prepilin-type cleavage/methylation-like;
FT                   KEGG: pha:PSHAa2687 mannose-sensitive agglutinin (MSHA)
FT                   biogenesis protein MshD (pilus type IV)"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38711"
FT                   /db_xref="GOA:Q15ZH7"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZH7"
FT                   /protein_id="ABG38711.1"
FT                   /translation="MSVNRGAIRFGLNLGFTLIELVIGMLVFAIAMTFFIGLIVPQTTR
FT                   SIDPIFQVRATELAQSLLNEISSKSFDEHSSRNASERCGDGSAPTCTLPNALGPDSENR
FT                   SAYNDVDDFNGLDERDGTILSATGGTIGINGRNLYQGFRANVSVFYDADLNGTNDGAVG
FT                   AAKLITVRITTPSSEEIVFSTYRYNY"
FT   gene            209928..210770
FT                   /locus_tag="Patl_0180"
FT   CDS_pept        209928..210770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0180"
FT                   /product="Prepilin-type cleavage/methylation"
FT                   /note="PFAM: methylation; KEGG: cps:CPS_4566 putative MSHA
FT                   biogenesis protein MshO"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38712"
FT                   /db_xref="GOA:Q15ZH6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZH6"
FT                   /protein_id="ABG38712.1"
FT                   /translation="MTSRHALGRHKGFTLVELVTVIIVLGIVSIGVTSFIRSGVQIFND
FT                   VSERDELLSQSRFVIERLNRELRSSVPNSARVKLENSAQCLEFVPTIWATYYTRLPLEP
FT                   STERTVNTVELGDANDQFSITSGDMAVVYPTDSQDVYDVNEEKRRTVLSCTDSGDGDCT
FT                   TNDSAEHLATLTVDGAFADVSPASRLYIVRNAVSYCIRGGSMFRHQASIGQDQTAFTLG
FT                   GTLMAENIVNDLANPAELPFTIQNATLNRNSLIQILLAFELNDETINLSSDIHVPNVP"
FT   gene            210760..211200
FT                   /locus_tag="Patl_0181"
FT   CDS_pept        210760..211200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0181"
FT                   /product="type II secretory pathway component"
FT                   /note="KEGG: ilo:IL0378 type II secretory pathway
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38713"
FT                   /db_xref="GOA:Q15ZH5"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZH5"
FT                   /protein_id="ABG38713.1"
FT                   /translation="MSHKRLCAEQPRGLRKQRGSMLVIALFIIIVLAILGLAMLRMLAA
FT                   SADSVVSEVYGQRALNAARAGVERSIAAAFPVVGVSNCMASDNFTFTSTPGLANCGYQS
FT                   SCAVVSVVDDGDSYQYFRFTAQGQCIAGDTVVSRNVSVDGIQ"
FT   sig_peptide     210760..210903
FT                   /locus_tag="Patl_0181"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.848 at
FT                   residue 48"
FT   gene            211200..215813
FT                   /locus_tag="Patl_0182"
FT   CDS_pept        211200..215813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0182"
FT                   /product="CUB domain-containing protein"
FT                   /note="PFAM: CUB; KEGG: hch:HCH_06140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38714"
FT                   /db_xref="InterPro:IPR000859"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR035914"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZH4"
FT                   /protein_id="ABG38714.1"
FT                   /translation="MKGIRAIHKRIGRFNSLILLLMLNMLSCSQVLADTLCSDTETSRA
FT                   RGALFDSGGASGNYANNEDCEFTIRAPQGGAITLSFSDFDYEENYDFFSVYDGENVSAP
FT                   LLGTFSGSNLPSVLVATSGTMFIEHSTDGSAVRQGLAATWSISSNSCSTETFNMADHFP
FT                   SASYSASSGSAPWSSDWLEAGESDGPARGYLRVNNSLCSSGNCLRLGVVASENPRSYSA
FT                   RFVYRRLNLSDAVTAQLNFNYRVGHNAGESLIRLGISTNGGSTWTNLKDYTITASNFSS
FT                   TAQSFDISAFIGSNVAIGFQVSGTNSESGFYVDDINVSAAKAEVCDGPAIAFYQFEQEE
FT                   WATTNSVIDSSASGYDASPLGDAFPTFPSIQTSCQVMSVPKNSDANISAGIDTELRVDT
FT                   DIGDKGTISFWYRSALAWSNGRGRQLFDASTWIGNANSKYFNLSLRNGTLRFGLEDTTD
FT                   NDAAASVSGLTFAPYEWVHIAVTYDYSKDSAVIFINGRQASQTSDLGLNGDMPVLDTLY
FT                   IGDNRSLYNFADSPANSADGEFDDVRIYDYAQSQSQVNTDLDNVSPCAVAPVAIYEFEQ
FT                   VEFNGSQSILDSTSNQRHASPLGEVVSVLSTAQVSCRFADVPMNTDATVIDTIDSGFSP
FT                   NDIGQAGTISFWYRSNEDWSSNNARQLFDASTDAGNSNSTAKYFYLSLRASTLYFGLED
FT                   IDDRDAEAIVSGLNFSAGEWVHVAVGYDYAAKTAVIHINGAEAGRSNSLNLNNNIAQFN
FT                   TLYFGDNRSDYIVTNMTANSANGQFDNIRVNAYVQNSTEITQDMNAIATCQSIHHYQLE
FT                   HDGQGLTCETENISIKACADENCTQLYTETSSVELAPDGWRAGNPLVFTGEIINTPLAV
FT                   LEPELATLDIVRANPSAPLRCLNTGSGIESCDINFVDAGFEFIGEQVTDKFLPDQLSQA
FT                   NFVGANLRAVQNDNGVCKALLQGQQDVTFGVNCVSPNRCLTDFSGIDVSASPDGESTGI
FT                   VSLTFDADGVASLGAFNYADAGRVALRAAAEINGVSITSGDASVDIAPTKLTLAVAPPA
FT                   LIYTDTDFSVYPSSADTDVYPAGEEFTFNITAYGVLGDIALPNYQPSTLQIAVERILPF
FT                   ESSAAEGTLVFGDGASVLGNVNKQFADTPELTFVEGQYNYQATFSEVGVIRLDIRDIDY
FT                   LSDNNNPTSVINSQDPITLGEFTPAYFDVQVSTAPELVNQCGNFTYMGQPISFSPTTQV
FT                   ELIAMNALGEATKNFINGYWRYNPDTAAAVVIDDASVHAGASPAVTRITGAASATITAP
FT                   SAFTGITLIDVPDGTFTYEKVATDFAAYPLIEPFVAAVDMTFLATFLSGDNNVCYQSDY
FT                   PVSGCEGFRISDATGSNITGVDVNVRHGRLALGPNFGPEPDFLVTPVSAEHYLNGRWQL
FT                   NQEDNCTNIDLTESSGQIVLSAQGSNDITGQIDSVTSAGTLIGGELLGNSNFALTGSGA
FT                   GNGPGVAGVVEVSLDPSVGNPSWAQYMNFDWSGDGFICPDLALCSGATAVDGPASIITF
FT                   GLYRGNDRIIHWREVFH"
FT   sig_peptide     211200..211301
FT                   /locus_tag="Patl_0182"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 34"
FT   gene            216079..217122
FT                   /locus_tag="Patl_0183"
FT   CDS_pept        216079..217122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0183"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: cps:CPS_4561 rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38715"
FT                   /db_xref="GOA:Q15ZH3"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZH3"
FT                   /protein_id="ABG38715.1"
FT                   /translation="MFKKLRGMFSNDLSIDLGTANTLIYIKDQGIVLNEPSVVAIRQER
FT                   AGGPKSVAAVGGEAKRMLGRTPGNIKAIRPMKDGVIADFYVTEKMLQHFIKQVHDNNFL
FT                   RPSPRVLVCVPCGSTQVERRAIRESALGAGAREVYLIDEPMAAAIGAGLPVSEATGSMV
FT                   VDIGGGTTEVAIISLNGIVYSSSVRIGGDKFDEAIISYIRRNFGSLIGEATAERIKHEI
FT                   GAAYPGEEVKEIEVRGRNLAEGVPRGFTLNSNEILEALQEPLSGIVSAVMVALEQSPPE
FT                   LASDISERGMVLTGGGALLKDLDRLLMEETGIPVVIADDPLTCVARGGGKAFEMIDLHG
FT                   GDLFSYE"
FT   gene            217173..218033
FT                   /locus_tag="Patl_0184"
FT   CDS_pept        217173..218033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0184"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG: ppr:PBPRA3269
FT                   putative rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38716"
FT                   /db_xref="GOA:Q15ZH2"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZH2"
FT                   /protein_id="ABG38716.1"
FT                   /translation="MNSIFLRGPSLHIKLVFALALSAGLIVFDHVFDGFATTRVYLNSV
FT                   VSPIQYLANLPSEMLNASASRLVSHQQLLEENAELQHDAVVLNGKLQRFVLLQEENDRL
FT                   RRLLNTPVRGDIRKEVAELMAVDNNPYSHQIVIDRGAIQGVYEGQPVIDDKGIVGQIMQ
FT                   VGSTNSRVLLISDVTHAIPVRVARNNIRMIASGSGSLNELIIQHVPHSADIEEGDLLLS
FT                   SGLGNVFPEGYPVARITSIVRDEGRPFAQVNAEPVALLDRLKYLLLLWPNNLVGPEQSV
FT                   PDAEQ"
FT   gene            218030..218506
FT                   /locus_tag="Patl_0185"
FT   CDS_pept        218030..218506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0185"
FT                   /product="Rod shape-determining protein MreD"
FT                   /note="PFAM: Rod shape-determining protein MreD; KEGG:
FT                   cps:CPS_4558 rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38717"
FT                   /db_xref="GOA:Q15ZH1"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZH1"
FT                   /protein_id="ABG38717.1"
FT                   /translation="MKLRNNTIGLSIIVALVLQIMPMPAIVEQYRPDWVFLVLGYWALA
FT                   LPERVNVGVAFIVGLVLDILLGTSIGVHSFAMSLSVFVLAANYQRLRNYSVWQQAVVIG
FT                   ILCALYNLVVFWLMHLLTDIYFMLTYMWPVITSMVIWPWIFWLLRRVRRQFRLS"
FT   sig_peptide     218030..218113
FT                   /locus_tag="Patl_0185"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.931) with cleavage site probability 0.920 at
FT                   residue 28"
FT   gene            218526..219104
FT                   /locus_tag="Patl_0186"
FT   CDS_pept        218526..219104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0186"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf-like protein; KEGG:
FT                   vvy:VV2931 nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38718"
FT                   /db_xref="GOA:Q15ZH0"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZH0"
FT                   /protein_id="ABG38718.1"
FT                   /translation="MLILASQSPRRAELLSQIGVPFTTLSADIDETILPGETPEIYVQR
FT                   LAKQKAQAGWQASVDIAENRLALGADTVVVIHEQVLGKPENFDDARRMLQRLSGQKHQV
FT                   FTAVTITSGDQCESILVKTDVTFCDLTTSQIEEYWQTGEPRDKAGSYAIQGIGGKFVTH
FT                   IKGSYSAVVGLPLYETNQLLSRMSLAHEC"
FT   gene            219094..220557
FT                   /locus_tag="Patl_0187"
FT   CDS_pept        219094..220557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0187"
FT                   /product="RNAse G"
FT                   /EC_number="3.1.4.-"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA
FT                   binding S1; KEGG: vch:VC0419 ribonuclease G (cytoplasmic
FT                   axial filament protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38719"
FT                   /db_xref="GOA:Q15ZG9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZG9"
FT                   /protein_id="ABG38719.1"
FT                   /translation="MSAELLINVTPSESRVALIENGILQEVHIERHTKRGLVGNIYRGK
FT                   VSRVLPGMQAAFVDIGLDKAAFLHASDIAIHSEVEDEVSSSHLEKRDIRELVRDGQNIV
FT                   VQVVKDQIGTKGARLTTDITIPSRYLVFMPSVEHVGVSQRIEDEAERERLKSLVQEYCS
FT                   ENGGFILRTAAEGVKAQELRQDADFLRRLWEKIRSRMKKKTHILYEDLPLARRVLRDFV
FT                   GTELDRIRIDSKLSFHELQQFTREYVPELHRLLEYYPGDRPIFDLYDVENESQRSLERR
FT                   VDLKSGGYIIIDQTEAMTTIDINTGAFVGHRNLEETIFNTNIEATSAIARQLRLRNLGG
FT                   MILIDFIDMADADHKRRVIHSLESATSKDRAKINIHGFTALGLIEMTRKRTRESLEHIL
FT                   CGECPVCKGRGSVKTVETVCFEIMREIVRVNRAYDADKFVVYAAPSVVEALLGEESHML
FT                   AELEVFVSKQIKVHTELLYNQDKYDVVMM"
FT   gene            220554..224459
FT                   /locus_tag="Patl_0188"
FT   CDS_pept        220554..224459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; KEGG:
FT                   pha:PSHAa2677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38720"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZG8"
FT                   /protein_id="ABG38720.1"
FT                   /translation="MRSGSFYAAYIIKKLWTCAAILLVLVAVAISVVRYTLPYMDGQKH
FT                   RLEQWVEGRYGVEINIGTITAQWKGAGPAIVLEDLQLVQNAQSPLSLDIKKTIIELDFW
FT                   GSILGRQIRSQRFDLNGLNVKVDVTLMNKEGSDFPVVSALKQLFLEQLQSFSVSDSQFE
FT                   ISTAHDQQVVLVNQLLWSNSGLHHQGVGELQVEELASNSASFTLDLRGDKDSLNGTFYA
FT                   RAHEVDLSPWINQWLATRYDLVESRGNFVVWASIQDGDIKNAQLDLADSRFVWQNEDAE
FT                   ITAAILGGQLNAEPSNDGWVFNLYDLALQANERTQTSNWYGEINHQGQVHIQNADRVDL
FT                   SAITPLLPLVLNPVDFNLLKDLSPNATLNKFNVKFDKSDTYAQVNLSQIGWQQSGNVPG
FT                   VDNLELNVNWHNDMGRVQIRGRNSQWKMDNIVDRNIEFQRVDLDMYIQSLDQGIELYAP
FT                   KLKLGNDWLNIDQHLRYESNTGYLALSGTISGLDVAQVNQLLPGVVMGKDTKAYLQRAL
FT                   KAGYVNGAKILWNGELSQFPYANNQGVFQITVGVEDASFEFAEDWPQLNDLNIDLLFEN
FT                   KGLFMQANAGKLLDVNLSGLSADIPDLDVGAVLTIDAQGSALGTQVNELMKRSSLASSL
FT                   GKVLDEVQVSDALNVDLNLVIPLSGKDVVASGVVHLADNRVYVPRVDMNLTHAKGQVSF
FT                   KNEVVDMSGLQAQLFDQPVEVDFSGRQGKEGYLASIDLLGDWKVKPLVKRFVPSLASYL
FT                   DGKSPWQANVRLTLPEDGFRYQASVYSGLQGIGSQLPEPLNKTVNQNKPLTLDISGDET
FT                   ASTVNLKMGSQVNFDGVLPYETMQFSRAHLAIGESLDMPMGLGFSVAMNLPYVNIDNWY
FT                   YAISSLLHDLTGDESGIASDPNKKPFIGEPQRIFLNADSATVASQQLTDLEAVTKNTND
FT                   SWQINVNAKQVRANVSLYKDWLARGITISADYLDLAGWEKSEGKAVEFEPKLETLPPVE
FT                   FLCERCRFEDKDLGRVDFKLSRAANGMHIDSLRLNNDHGLFYASGDWLFTPRGNQTKIE
FT                   GEFSSSDFGLFLKGFEFDSGIKDSKASAKFNLDWQRAPFEFDFATLNGDIDWRLSDGYL
FT                   TEVTDKGSRIFSLLSLESLVRKLRLDFRDVFAQGFFYDKMKGSFQVAQGTVDTRDTVVD
FT                   GGAGEITMQGYTNLNTREVNYNIAFAPKVTSSLPLIVAYMVNPATALAALALDQVLTSA
FT                   KVISNIKFSLTGTLDDPKLEELERDSKEIRLPAQTAPAPVDTPNVGLAIDPNGHNTDIS
FT                   FPQEIDQERVALEVSDG"
FT   sig_peptide     220554..220643
FT                   /locus_tag="Patl_0188"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.869) with cleavage site probability 0.626 at
FT                   residue 30"
FT   gene            224452..225282
FT                   /locus_tag="Patl_0189"
FT   CDS_pept        224452..225282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0189"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: ilo:IL0387 predicted
FT                   amidohydrolase, nitrilase family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38721"
FT                   /db_xref="GOA:Q15ZG7"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZG7"
FT                   /protein_id="ABG38721.1"
FT                   /translation="MANLIALQMTSTPDVTENLHFVEQQLAQLTVNEPTLVVLPECFAC
FT                   FGGGDKALLSIAESLGDGPIQARLMGMAKQYGVWLVAGSMPLKSENPDKFTASCLLIND
FT                   AGERVTEYQKIHLFDVQVADNTKTYCESKYTQAGSTLVSVPDTPFGHLGLAICYDVRFP
FT                   GLFQAMAEHKALDVIALPAAFTQKTGEAHWQALLSARAIENQCYLVAAGQTGVHANQRQ
FT                   THGHSCIISPWGETLAELPQSVGVINAQLEPAILNRIRRDMPVYAHNKFRSYLV"
FT   gene            225275..226717
FT                   /locus_tag="Patl_0190"
FT   CDS_pept        225275..226717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0190"
FT                   /product="microcin-processing peptidase 2, Unknown type
FT                   peptidase, MEROPS family U62"
FT                   /note="PFAM: peptidase U62, modulator of DNA gyrase; KEGG:
FT                   pha:PSHAa2675 suppressor of CsrA inhibitory activity;
FT                   peptidase; involved in the control of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38722"
FT                   /db_xref="GOA:Q15ZG6"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZG6"
FT                   /protein_id="ABG38722.1"
FT                   /translation="MSNLVEQNLLTAANLDRDHLANALDAIYQHDNDFADLYFQASQHE
FT                   TWVLEDGIIKDGSYNVERGVGVRAVSGEKTGFAYSDDINPEALMQAAKASRNIASAGGK
FT                   HKVTGLKNSKVDPKYHADNPILGMQDEEKIALLRAVDNYIRQQESALSQVVVSISGVYE
FT                   EVLIAATDGTFCTDIRPLVRLNCSVLMEKDARRERGSSGAGGRYAYEYFLSQADGRPLY
FT                   EQIADEAIHMARVNMRAVAAPAGQMPVVLGSGWPGVLLHEAVGHGLEGDFNRKGASTFS
FT                   GRMGEQVASAGCTIVDDGTLANRRGSLSVDDEGTPSQYNVLIKDGILTGYMQDKLNARL
FT                   MGVKPTGNGRRESYAHLPMPRMTNTYMLGGQHEPEAIIASIKNGIYAPNFGGGQVDITS
FT                   GKFVFSTSEAYLIENGKVTKPIKGATLIGNGPEAMQKVSMVGNDLALDKGVGVCGKDGQ
FT                   SVPVGVGQPTLKVDELTVGGTA"
FT   gene            complement(226817..229252)
FT                   /locus_tag="Patl_0191"
FT   CDS_pept        complement(226817..229252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0191"
FT                   /product="Ig-like, group 1"
FT                   /note="PFAM: Ig-like, group 1; KEGG: son:SO4080
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38723"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZG5"
FT                   /protein_id="ABG38723.1"
FT                   /translation="MSKRLPMYVVWLAIFTLTSCGGGVSGENGDDPFGSGGNSGGDTSS
FT                   FTLAVSTYDEQCSTSTQSFTSGQVACVQATLMQNGNPVEGEIITFSGTLGTFSSTTKLT
FT                   DSQGVAQIAISSENSEVGAAVLTATFDDSTSSENYEYLSADTLTGQSAVVNLALLNSGQ
FT                   VVNRFQAGTDIQLQSQILDENDVPIPSVIVTFSAQRGTLNTDSALTDNNGVAQVTLSAE
FT                   DSDIGAGVATATAVVNDVDLASSFNYEIQAAGAISEQIIRLGYFDDNGVFIEGQLGVST
FT                   RNNAGDVEISAGGTLGVSIALVDENDQRILTQTPVTFSSNCVTDGFATIDTLVNTINGV
FT                   ANATFEDQSCAGGDGNTDSIVASVVVNNATLSVSQAISIQAESIGSLAFVSAEPSSLVL
FT                   RGTGGQNSSTVSTLVFQVNGALGNPLAQQAVSFSLNTQTGGLTLSSATGLTNSQGQVST
FT                   RVTAGDVPTSVRVTAEVETESGETIITQSDLLSVNTGLPDQNSMTISADNLNPEAFDIN
FT                   EQEVNLVVRLADTFNNPVPDGTAVSFTTEGGSIDGSCTTVSGACAVTWLSANPKVPDHR
FT                   ITILATAIGHETLFDSNGNNFYDDDDGAGFNDNTDNGLSTSLYGQTGFVDISEAWRDDN
FT                   ENGIRDAGEIFLDYNANGSFDSADNLFNGPQCSGSSCGTGDANTMHVRRALVLVTSSSA
FT                   AQIDIIDNSAAVIASNYQTSTAATAIPRDTSQTFTVVFADTARQPIASGSTVVVNSSAG
FT                   QLNGQTNLTMPSTSVNAASQAIFTLENDVSEATQATLSVTITSPSGLESTTNTIVTLN"
FT   sig_peptide     complement(229172..229252)
FT                   /locus_tag="Patl_0191"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.915) with cleavage site probability 0.653 at
FT                   residue 27"
FT   gene            complement(229258..229785)
FT                   /locus_tag="Patl_0192"
FT   CDS_pept        complement(229258..229785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0192"
FT                   /product="protein of unknown function DUF615"
FT                   /note="PFAM: protein of unknown function DUF615; KEGG:
FT                   ilo:IL0389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38724"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZG4"
FT                   /protein_id="ABG38724.1"
FT                   /translation="MAVSPDKNEFEVEQEDTQLSKTQIKNQMNDLQKLGVSLVDLSPTA
FT                   LAKIPMDQELLDAVMLARRILRKKEGYRRQLQLIGKLMRHRDVAPIEQALLQIQASHQK
FT                   TNQKFHKLEMLRDNLIAQGDSAIEEVLEEHPILERQKLRQLVRQAAKQQADNKPPKAAR
FT                   ELFKYLQSSIDG"
FT   gene            229894..231219
FT                   /locus_tag="Patl_0193"
FT   CDS_pept        229894..231219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0193"
FT                   /product="microcin-processing peptidase 1, Unknown type
FT                   peptidase, MEROPS family U62"
FT                   /note="PFAM: peptidase U62, modulator of DNA gyrase; KEGG:
FT                   vpa:VP2676 PmbA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38725"
FT                   /db_xref="GOA:Q15ZG3"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZG3"
FT                   /protein_id="ABG38725.1"
FT                   /translation="MQQQLTDIQQIVEDVLKLAKEKGATQAEASMSKVRGIAVSSRLKE
FT                   VETVEFTNDGGLGITVYKGQRKGSASTADLSPQALRLTVEKAIEIAKYTGEDACSGLAD
FT                   KELMAFEPQDLDLFHPIELDTDFAIEQVIKAETAALAFDPRITNSDGASYNANLGTKVY
FT                   GNSHGLNVGYNSSRYSMSCVVIGEQDGDMQRDYSYTVERQANLMASPEQIGKESAEFTL
FT                   GRLGARQIKTAKVPVLFDKEIASGLIGHFISAISGGNLYRKSSFLVDKLGEQVLPSWFS
FT                   ISERPFIMRGLASSAFDHEGVRTKDSEIVTDGILNQYLLTSYSARKMKMQTTGHAGGIH
FT                   NWLIKPTGQSDKQMLAELGTGLLVTELMGQGVNVVTGDYSRGAAGFWVENGVIQYPVHE
FT                   ITIAGNLADMLKNIVAVGSEIERRGSIQTGSILIDNMQVAGD"
FT   gene            complement(231294..233210)
FT                   /locus_tag="Patl_0194"
FT   CDS_pept        complement(231294..233210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0194"
FT                   /product="peptidase S9, prolyl oligopeptidase active site
FT                   region"
FT                   /note="PFAM: peptidase S9, prolyl oligopeptidase active
FT                   site region; KEGG: gvi:glr0176 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38726"
FT                   /db_xref="GOA:Q15ZG2"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZG2"
FT                   /protein_id="ABG38726.1"
FT                   /translation="MKMLFFITLLFAQSLLSKEWPYPQDTPQTKPINIGTASDRPYDIS
FT                   RLILARGPYNASLNPQGTIAAYMSDVSGAPQLWLIHIKDKKVTQLTFGNGITHYLWHPN
FT                   GKELIYGADNNGDEREAFNLISIDGLHEKIVLPFTDAYRVPGWFDTSGRHFAYSSTERN
FT                   GRDFDIYVVDFNAQSNKLTPRLMYQAEYFFRPHQWQPNGEHLIVTEAVGEDGANVYLLN
FT                   NSNGKMSSVFKPQIPSSYGNFVWSASGESFYFTSNEGQEMNALRQYDLSSATERTLFSG
FT                   DYDIENVQVCKQGTYLVWTTNENGFDKLHIYHLQRDNQQQIPLPQGVYSLSCAEQGKDL
FT                   LVRITGPATPGSLYLVDLTNQQTELLLAPNMAGVDNAEMLSPIAVSMPARDGVTIFGLL
FT                   YLPISKQDTSPPIIFNVHGGPASQSRASWKPAIQYLLGKGVAVLDINVRGSTGFGKTYA
FT                   QLDNQEKRLDSVRDLVDALAWFKKEGTVNVDRSAVMGRSYGGYMVNAVMGAYPDAFSAG
FT                   ISIVGVADWVTALKTASPALKASDRIEYGDINETRWQKFYAENSPINTVHKINAPMFYE
FT                   HGVNDPRDPVAESDIMVKTLREKGLPVTYLRFPDEGHGISKVVNQVTFYQQLADFLQVH
FT                   LID"
FT   sig_peptide     complement(233157..233210)
FT                   /locus_tag="Patl_0194"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.835) with cleavage site probability 0.785 at
FT                   residue 18"
FT   gene            complement(233297..234409)
FT                   /locus_tag="Patl_0195"
FT   CDS_pept        complement(233297..234409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38727"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZG1"
FT                   /protein_id="ABG38727.1"
FT                   /translation="MADQRPLFKHIRNHDALFSELALLRSEYVTQLGLNHHEFHKTPKF
FT                   ITPDGRRLTIEPERSIVVPNVDVLRGVKSQLEKSIAGFHIIPKSEIGFRYPTAAIAGSD
FT                   APFIKRFRSEFFHKDGENRDICRPINLSYGIKSRGKADNRQEYEVWVQDAHLAQDPSHL
FT                   FIDKYGEDLPDEVRQFALEEPVVHGWMGVKRAAFEAIYYVPSRFGDIAVCVGLSVDAYN
FT                   IGARPDLAYSAEIGSSIAKGNAELEWEVMGYYAPIGQAFEHDQIWHAIDSTIAAIATPL
FT                   ENTYQNDLIATNESKTERILSTVAAVGSTPKQIAAWNLKPWEFLETSSEHRKKAHDPSR
FT                   SVNLLGRLNRLFYQDTQPLPSLNKIHDLIA"
FT   gene            234578..235192
FT                   /locus_tag="Patl_0196"
FT   CDS_pept        234578..235192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0196"
FT                   /product="glutathione S-transferase-like protein"
FT                   /note="PFAM: glutathione S-transferase-like; KEGG:
FT                   cps:CPS_2495 putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38728"
FT                   /db_xref="GOA:Q15ZG0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZG0"
FT                   /protein_id="ABG38728.1"
FT                   /translation="MKIYADAQSGNCYKVKLMCALLNIEHEWIHVDILAGDTNAHAFLA
FT                   KNPNGKIPLLALDDGRHLWESNAIINYLANGSDLLPSDVFALAKVQQWQFFEQYSHEPY
FT                   IAVARFIAKYLGLPESKKAEYEAKQAGGHKALAVMESQLTHTPFLTGQSVTAADVSLYG
FT                   YTHVAHEGGFDLSRYPNVQAWLSRIEALPNYIAMDASKGKA"
FT   gene            complement(235224..235679)
FT                   /locus_tag="Patl_0197"
FT   CDS_pept        complement(235224..235679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0197"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   pha:PSHAb0271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38729"
FT                   /db_xref="GOA:Q15ZF9"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZF9"
FT                   /protein_id="ABG38729.1"
FT                   /translation="MMWLSDNLGIGLISLGLLLLAIEILVLGFSTFVLFFVGCAAVITG
FT                   ILIQFGIVADTALNATLFVSLITAVLAVFLWKPLKNMQKDVDPKKASNDLIGHSFILAT
FT                   DTSAEQPAIYHFSGIDWRLVSEHPITSGTKVEVIAVDVGQFTIAPCA"
FT   gene            complement(235660..236616)
FT                   /locus_tag="Patl_0198"
FT   CDS_pept        complement(235660..236616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0198"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="PFAM: band 7 protein; KEGG: pha:PSHAb0272
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38730"
FT                   /db_xref="GOA:Q15ZF8"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZF8"
FT                   /protein_id="ABG38730.1"
FT                   /translation="MDVLLSYLLSVQTLLLVFVIVLLKSSIKFVPQNRAYVIERFGKYQ
FT                   STKEAGLNFIVPFIDQVAADRSLKEKAVDVPEQSAITKDNISLSVDGVLYFRVLDPYKA
FT                   TYGIDDYVFAVTQLAQTTMRSELGKMELDKTFEERDILNTNIVASINEASGPWGIQVLR
FT                   YEIKDIVPPLSVMEAMEAQMKAERVKRAQILESEGDRQAAINRAEGEKASVVLAAEADK
FT                   SEAVLRAEGEAKAIVAVAAAQAEALRQVGEAAATEEGQKAIQLDLATKAIEAKEAIAKE
FT                   SSVVLLPDSGTDIAGVVAQATTIINSLNRAKHDVAKR"
FT   gene            complement(236751..238082)
FT                   /locus_tag="Patl_0199"
FT   CDS_pept        complement(236751..238082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0199"
FT                   /product="Xaa-Pro dipeptidase, Metallo peptidase, MEROPS
FT                   family M24B"
FT                   /EC_number="3.4.13.9"
FT                   /note="PFAM: peptidase M24; KEGG: pha:PSHAa0013 Xaa-Pro
FT                   proline dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38731"
FT                   /db_xref="GOA:Q15ZF7"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZF7"
FT                   /protein_id="ABG38731.1"
FT                   /translation="MQQLAELYPQHISELQSRTKEALSREGIDGLIIHSGQAKRMFLDD
FT                   NNYPFKCNPQFKAWLPVIDNPNCWLIVNGSDKPKLIFYRPKDFWHKVPPEPNDFWVEQF
FT                   DVVLLTQADAVEKHLPYDRSRFAYIGEYIEVAKALGFDLVNPDRVLNYLHYQRAYKTDY
FT                   ELVCMRQANALAVAGHNAAAAAFKAGKSEFDINQAYLAAVRQSDNQVPYNNIVALNENS
FT                   AILHYMEQDVVAPSESRSFLIDAGASFHGYAADITRTYCNGSIPNSSHFAELINGMHQV
FT                   TLSLADSLKPGVPYSDIHIAAHAQVAQLLHQFDIVNLSPDDILAEQIVSTFFPHGIGHF
FT                   LGLQVHDVAGHVADDRGTPNPPPAEHPFLRTTRMIEARQVFTIEPGLYFIDSLLADLKS
FT                   TEKSKFINWDVVDTFRPFGGIRIEDNIIVHRDKNENMTRDLGLN"
FT   gene            complement(238178..240091)
FT                   /locus_tag="Patl_0200"
FT   CDS_pept        complement(238178..240091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0200"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   cps:CPS_0011 putative soluble lytic murein
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38732"
FT                   /db_xref="GOA:Q15ZF6"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR012289"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZF6"
FT                   /protein_id="ABG38732.1"
FT                   /translation="MLLLVCFSSQATTTLSSAEQKLQHQREIFVEAESLANNPQSADYQ
FT                   RLVAQLVDYPLLPYVQLKALMNNINRKNGPEIEAFLGKYENTPLDRSLRKKWLQYLAKS
FT                   QRKTEFLAAYTNIGNAQLACKNIEYRLSDPAERKVALTEVPRLWIVGQSQPKECDYVFR
FT                   EWKKEGLLTKDMVWQRLVLAATSGKHTLVPYLQKLLPENERYLADLWLAVRRDASYVSR
FT                   SSKFPHKLVSKETQILIYGLKRLAFSQPDLALKSWYALEKRFAFSAPQRKAMTERFAIA
FT                   LAVADHPQADLWLDKASADSTDIELFRWHLAHVLRLGNWQHALELIESAPSGITQDLAF
FT                   QYWLGRTYEQLEAGDLAQQTFNKLADQRHYYGFMASGKLAKQPSLHDKTLNFSPEQLLE
FT                   VANMPQAKRAYEFLQLDRSLSARREWYDLQQGLNEQQSLMAAVLADSWKWHDQAIFTFA
FT                   RVGYLDDLERRFPIAFDKSLINSANKNQVDPAWAFAIVRRESSFMPDANSHAGARGLMQ
FT                   LMPGTANYLAKKKVGGSSLFDPEQNVAFGTQYMRYLMDKMDNNPVLATASYNAGWRKVL
FT                   DWLPERDAVPMDIWVETIPYKETRNYVKAVMAYKQIYAQRLGQPSQVFKELVDMQIAPI
FT                   QQ"
FT   gene            240399..242558
FT                   /locus_tag="Patl_0201"
FT   CDS_pept        240399..242558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0201"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="TIGRFAM: fatty oxidation complex, alpha subunit
FT                   FadB; PFAM: Enoyl-CoA hydratase/isomerase 3-hydroxyacyl-CoA
FT                   dehydrogenase-like 3-hydroxyacyl-CoA dehydrogenase,
FT                   NAD-binding; KEGG: cps:CPS_0393 fatty oxidation complex,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38733"
FT                   /db_xref="GOA:Q15ZF5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZF5"
FT                   /protein_id="ABG38733.1"
FT                   /translation="MIYEGKSLNVTLLPNGIAELVFDAQGSVNKFDRQTVSELDEATQA
FT                   LKSQSDVKGVLVRSNKSTFIVGADITEFTGLFDMPAEEVLTWVAKTSQVFDRFEDLPFP
FT                   TISAINGFALGGGCEMTLACDLRVADTTAAIGLPEVKLGLMPGFGGTVRLPRLIGADNA
FT                   LEWMTTGRDRKAAKALAEGAVDAVVAPEKLRDAALSMLQDAIDGKFGWEARRAQKKAPL
FT                   KLNKNESMMSFSTAKAMVFAQAGKHYPAPHAMVDTVANAARLDRAGALELENQGFTKLA
FT                   KSDAAKAQVGIFLADQLVKSKGKKQAKASTKDVKQTAVLGAGIMGGGIAYQSAVKGTPV
FT                   IMKDINQDALDLGLNEAAKILGKGMQRGKVTPAVMSNTLNNIVPTLEYSAIKDVDLVIE
FT                   AVVENPKVKGIVLKETEQNVSDDTVICSNTSTISINQLAESLEKPERFCGMHFFNPVHK
FT                   MPLVEIIRGEKTTDATIATVVAATLKMGKTPIVVNDCPGFLVNRVLFPYFAGFSKLVMD
FT                   GADFVAVDKVMEKIFGWPMGPAYLLDVVGMDTADHASSVMADGIPERMQKIDNDPVTLL
FT                   YKSERLGQKNGKGFYNFSLDKRGRPAKKAADEAYELFAPHCADKRDFDADEIIARVMIP
FT                   MANEAIRCLEEGIVGSAAEADMALLYGLGFPPFRGGVFRYIETMGLANFVALADKYADL
FT                   GPIYQISDGVREMAASGKSYFSQSA"
FT   gene            242580..243740
FT                   /locus_tag="Patl_0202"
FT   CDS_pept        242580..243740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0202"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: cps:CPS_0392 fatty oxidation complex, beta
FT                   subunit; TIGRFAM: acetyl-CoA acetyltransferases acetyl-CoA
FT                   C-acyltransferase FadA; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38734"
FT                   /db_xref="GOA:Q15ZF4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZF4"
FT                   /protein_id="ABG38734.1"
FT                   /translation="MKEVVVVDCIRTPMGRSKGGIFRNVRAETLSAHLMSKLIERNPNL
FT                   DPNEIEDIIWGCVQQTKEQGFNIARNAQLLTDIPRSVAAVTVNRLCGSSMQALHDATSG
FT                   IMSGRGDVYMIGGVEHMGHVPMDFNIDFHPGIAKTAARASGSMGMTAELLGRQNGISRE
FT                   MQDAFGARSHQKAHAAAVEGRWNEIVATEGHDADGILKLIDADETIRPDSTTESMSGLR
FT                   PVFDPVNGTVTAGTSSALSDGASAMLIMSADKAKALGLTPRAKIRAMAVAGCDAAIMGF
FT                   GPVPATQKALKRAGMTMADIELAEFNEAFAAQALSCIKQLGWLDTYEDKVNLNGGAIAL
FT                   GHPLGCSGSRISTTLINLMEANDKSIGLATMCIGLGQGIATVFERV"
FT   gene            complement(243936..246038)
FT                   /locus_tag="Patl_0203"
FT   CDS_pept        complement(243936..246038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0203"
FT                   /product="TonB-dependent receptor, plug"
FT                   /note="PFAM: TonB-dependent receptor TonB-dependent
FT                   receptor, plug; KEGG: bfs:BF2697 putative exported
FT                   TonB-dependent receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38735"
FT                   /db_xref="GOA:Q15ZF3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZF3"
FT                   /protein_id="ABG38735.1"
FT                   /translation="MPSRAIFSTFVLSVIVAPLTQAQELKPIVYTTNAPLAHPNQTPEQ
FT                   YAQEMKTTEKKKDTHNNDLNIEAHSDEHEHTEQVEKIVVQATRSGRIADDQPIRVELID
FT                   REEIEEKAAMRPGNISMLVAETGGVRVQTTSPALGSANIRLQGLYGRYTQLLADGLPLY
FT                   GNQASSIGLLQIPPTDLGRVEIIKGSASSLYGGSALGGVINLVSRTPGDSLNGEALLNV
FT                   TTRNGQDLTSYVESPLSDDVKGSLTVGAHHQNKEDIDDDGWIDLPSYERYTARPRLFWE
FT                   GENGESLYATAGFMTEQREGGTMPGAVVADGNPYEQTQDSQRIDGGLVFNMPMLDTLTL
FT                   NARASAMVQDHDHTYGVLAEDDKHESYLLESSIAGYSGAADWLVGLAYQTEQFTSETYN
FT                   EFDYTYEVPGIFTQLDYEWNEQLTTSVSARLDEHSEYGTQFSPRISMLYRPGDLTIRGS
FT                   YGQGYFAPTPFVEEIEAAGLSRLEPLQNLEEEQAETASLDVTYRFESIEASVTAFGSNV
FT                   ENVTELQAFSSNNTNELDRVRLINAEGETQIRGSEVLIRYYWRDVKLTASYLYLDATEV
FT                   SPDNSGRREIALTPRHSAGFVAMWEQHGNFRVGFEAYYTGPQRLNDNPYIDESNPYWHL
FT                   GLMGEITVGRASWFINLENLLDVKQTDEHPLLLPSRAASGQWTTDIWSRNDGFIANAGV
FT                   RVKFGS"
FT   sig_peptide     complement(245970..246038)
FT                   /locus_tag="Patl_0203"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            246371..247648
FT                   /locus_tag="Patl_0204"
FT   CDS_pept        246371..247648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0204"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   noc:Noc_1547 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38736"
FT                   /db_xref="GOA:Q15ZF2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZF2"
FT                   /protein_id="ABG38736.1"
FT                   /translation="MPTLLQSMFSLLFSAAILLVGHGLQLTIVPLYAISLGWEPDLIGY
FT                   IGSSYFLGFVLGCLTVPRLVARVGHIRVFTVLIALFTASLLFIGLVDHFALWLIARCLI
FT                   GWGIAGIYMVIESWLNDKTSIEHRGSVLSVYTVISLSAICVGQLLVGFELGYAGLFMLA
FT                   AALLVLGIVPVGLTRRAAPQPIPAVSFSFRRLFAVSQVAMVGAFFGGLVTGGFWALGPV
FT                   IADANQLSAGQVGVFMAVTILGGTALQLPVGRLSDRIDRRYVITGLAVVAVLTSIAAIM
FT                   LDSRTPEVIYVTMFLLGGLSFPLYSLCLAHANDNTDLSIMEVGSGVLMMNSVGSILGPL
FT                   TVSFLLGYTHMALFVVSGVALSILACWTLYRIRFHDVAREHYEPFVNMRNTTQEVVEMG
FT                   LESEEPEEPLNTKVETIETDESLSKT"
FT   sig_peptide     246371..246442
FT                   /locus_tag="Patl_0204"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.758) with cleavage site probability 0.261 at
FT                   residue 24"
FT   gene            247723..248220
FT                   /locus_tag="Patl_0205"
FT   CDS_pept        247723..248220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pha:PSHAa1074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38737"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZF1"
FT                   /protein_id="ABG38737.1"
FT                   /translation="MRLWTALLILLLAGCSSTSQNSGNSLRQPAQFGGESATTDTMAYR
FT                   NLAAVIYPKSFETGGVFKVKATGRLEGRVFLNTEYDYRDPRNITIVLSPEIATEFEKKH
FT                   EMSPEAYFLKKRVLVKGQLVQVKIWFSSNGKRSNKYYYQTHMRVASMDDINLVSTTAAN
FT                   VG"
FT   sig_peptide     247723..247788
FT                   /locus_tag="Patl_0205"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.476 at
FT                   residue 22"
FT   gene            complement(248297..250039)
FT                   /locus_tag="Patl_0206"
FT   CDS_pept        complement(248297..250039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0206"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbo:SBO_1464 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38738"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038732"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZF0"
FT                   /protein_id="ABG38738.1"
FT                   /translation="MSKIRIALIGGGPSALTIIKKLLSNELGQEQSQGASRFSIDIFER
FT                   NSSLGKGMPYSEEGASTEHITNISSDELAPFDETLAQWLGKQSHAYLARHDIDKANLHV
FT                   KHVIPRLLFGDYLNAQFDALIRKGASNGLNINLHVNSEVLDIKPSTNSQTSDVHTVSGW
FT                   IKGFHKVIICTGHAWPRRNEGNVAGYFDSPYPPIKLQHKYNHAVALKGSSLTAIDAIRT
FT                   LSKANGHFYHDQEKLKFKRAQDVPDFKIVMHSLDGLLPNIRFHLDDPLVSEEGMLTEQQ
FT                   IAEHRAENDGFLSLDFTFEHNFKKVLAKRDNTFYQKIANKNLEQFTDWMLESRKAFDPF
FT                   TLFKIECIQAEQSIKHEQTLQWKEVLALLSFTINHPAKYLSGEDTLRLQQKLLPLIGLM
FT                   IANIPQASAVQLLALYESKALEVISVDTNSNVQIEGDHCFTYHYENSAKQSVTEPYQIF
FT                   VDCTGQKHLPMADFPFTSMFDAEPVLPACVRFKEKAQGQKQQRVDRDNVSIGADGEYYL
FT                   TLKGFAINDAYQPILATGKPSERYFLMAVPFISGFNPDYSGFDFCEQVSTIIVEKLCAE
FT                   LPQH"
FT   gene            complement(250329..251219)
FT                   /locus_tag="Patl_0207"
FT   CDS_pept        complement(250329..251219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0207"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /EC_number="3.1.1.45"
FT                   /note="KEGG: vvy:VVA0953 dienelactone hydrolase; TIGRFAM:
FT                   Twin-arginine translocation pathway signal; PFAM:
FT                   dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38739"
FT                   /db_xref="GOA:Q15ZE9"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZE9"
FT                   /protein_id="ABG38739.1"
FT                   /translation="MSHIDPKHIPQQAFDWYDEYAHGDMDRRTFMSRLASLSVAGLSIG
FT                   TLSGALTPNYALAEQVSFNDEAITASYQKFDSPEGHGIGQGYLVVPSDMLKPAPAVLVV
FT                   HENRGLNPYIKDVARRLAKEGFIAFAPDALFPLGGYPGNDDEGKKMQRSMEREKIENDF
FT                   IAAAKFIKQHEKTTDKIGVVGFCFGGYISNFLAAKIPDVISAAVPFYGTPAADNLVSQV
FT                   KGPLLLNFAENDSRVNASWPDYEAVLKANNVTYNAHIYPNTQHGFHNDSTSRYSPEAAE
FT                   LAWSRTVDFFKTHLT"
FT   gene            complement(251449..252048)
FT                   /locus_tag="Patl_0208"
FT   CDS_pept        complement(251449..252048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0208"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: cps:CPS_1681
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38740"
FT                   /db_xref="GOA:Q15ZE8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZE8"
FT                   /protein_id="ABG38740.1"
FT                   /translation="MSGKRTFDDEKALESAMGVFWKKGYAGASLAELTQSMGINKPSMY
FT                   RTFGNKEALFLKATQRYIEQNAMPHFVYLHQAGVSLDKRIKNYMVSVVSEQCTPSDPKG
FT                   CYIFLCQSEIAGGDIPELPSNLLIEAGNKIQEELINIFTTDPEAIALGLDTRAASIALC
FT                   IITTLRGTASMARAGVTLSELEDVIEHSLRGIGLVS"
FT   gene            252198..252932
FT                   /locus_tag="Patl_0209"
FT   CDS_pept        252198..252932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0209"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase
FT                   short-chain dehydrogenase/reductase SDR Male
FT                   sterility-like; KEGG: rba:RB3632 conserved hypothetical
FT                   protein-putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38741"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZE7"
FT                   /protein_id="ABG38741.1"
FT                   /translation="MTDSIQGKVALVTGANRGIGKAIVDSLIENGATKVYLAVRNPEST
FT                   KDIEAQYADKVVTLTADVADTASIQRLATQASDVEILVNNAGIMHVTSPLAENAEESLM
FT                   EQINVNVFGLMRVANAFAETLERNKGVLVQLNSIASIKTFGDIATYCASKAAAYSITQG
FT                   LKDKWADKGIRVLSVHPGPIGTEMGDSAGFEGAPDATVVAQAIVAALESGDFHSFPDPV
FT                   AKQLEAAYQSYSDAIITSDLSL"
FT   gene            253297..254175
FT                   /locus_tag="Patl_0210"
FT   CDS_pept        253297..254175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0210"
FT                   /product="Polyphosphate:AMP phosphotransferase"
FT                   /EC_number="2.7.4.-"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   rpa:RPA4569 DUF344"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38742"
FT                   /db_xref="GOA:Q15ZE6"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZE6"
FT                   /protein_id="ABG38742.1"
FT                   /translation="MKVNPRDFKAPQGELCDLSQRPTAVAPLYTSKVHYKQKLKKQIGK
FT                   MSDLQRMLYAANEHSVLIIFQAMDAAGKDSSIRHVMSGINPQGCQVHSFKHPSQNELEH
FT                   DFLWRSNLALPERGRIGIFNRSYYEEVLIARVHPEILHSQHIPDEAMHKEHIWRERFRS
FT                   INDLEQHLTRNGTRIIKFFLHLSKEEQRKRFLARIDNPDKNWKFSDADIQEREFWPQYM
FT                   HAYEDCIGSTSSKEAPWYVIPADDKRNARLIIAKTIVETFESLDMHYPEVDEQRKQELQ
FT                   RMRGLLVAQAK"
FT   gene            complement(254179..255201)
FT                   /locus_tag="Patl_0211"
FT   CDS_pept        complement(254179..255201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0211"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: wol:WD0565 patatin family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38743"
FT                   /db_xref="GOA:Q15ZE5"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZE5"
FT                   /protein_id="ABG38743.1"
FT                   /translation="MSKLILSLDGGGIRGAATTQFLTHVEKALQEKHQKSLRDCVDFYA
FT                   GTSTGSLIALALATTDMDIQDINKLYSYTNAKKIFVENRGAFELDGINAPKYEAKGKTD
FT                   ILKKSLGQAKIKDVPEGKHILAITYGVEKHRPHVIKSTRSEFQNLLSYQVADASSAGPT
FT                   YFPTQVMNLPPDNEQTWLIDGGVVANNPTMCAIAEACRLWPDANRRVLSIGTGTQTRKI
FT                   NGPDSRNWGALQWMLKGCIIDVLSDEKVVAYQAITITPPGSYIRVNAEMRTQPGLAKAP
FT                   DDAMDDISQTNIKRLKGMGDFWYSQYGEAVVELLNNSYDGPSLDRIDANTGQPIQYKPG
FT                   "
FT   gene            complement(255445..256689)
FT                   /locus_tag="Patl_0212"
FT   CDS_pept        complement(255445..256689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0212"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   mag:amb2464 serine-pyruvate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38744"
FT                   /db_xref="GOA:Q15ZE4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZE4"
FT                   /protein_id="ABG38744.1"
FT                   /translation="MLGIHFFKQSNDSGDPVSICVPQGIISLDNILPDEPLLMMGAGPV
FT                   PIPAKVAAANGIVINHLGDTMAQIIEQVKVMSRYVFQTENGLILGVAGPGSAAMEMAVA
FT                   NLVRPSDKVLSICNGFFSSRLAEMAGRLQADVIKILIDERQAASAEAIEQHIIRTQPNV
FT                   LTIVQGETSNTVHNAEIEQICRVAKKHNCMVIVDAVCTLSTMALDMDDWGIDAVITGGQ
FT                   KGLSCIPGISLVGFSEKAWAFIESRTDQLRHWCLDAKLGHQFWYKKSYHYTAPVSGILA
FT                   IHEALRLVCTETLPVRFARHERCSKALQAAVEGMGLELYVEPHARLASVVGISLPQNIV
FT                   GKDVLSTMSNRYRVEISGSFGPNIVRIGQMGEQCRTHNLFRTIHALGSAFIDLGHKLDL
FT                   PTGMAALESTLDNMR"
FT   gene            256999..257700
FT                   /locus_tag="Patl_0213"
FT   CDS_pept        256999..257700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0213"
FT                   /product="protein of unknown function DUF161"
FT                   /note="PFAM: protein of unknown function DUF161; KEGG:
FT                   hch:HCH_02915 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38745"
FT                   /db_xref="GOA:Q15ZE3"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZE3"
FT                   /protein_id="ABG38745.1"
FT                   /translation="MHSSTHRFYEDVLAILSGTVFVSLGLAIFKALGLLIGGTAGIALL
FT                   LSQFVPVNFGLLFFLVNLPFYYIALKQLGWRFTLNTFVTISLVSLLVENMHLFISLSDI
FT                   QPVFGAVVGGMLIGMGMLILFRHKSSLGGLGILAFYLQGSRGIRAGTFQLVVDSLIVVG
FT                   ALFIMNPILLAISLAGMVTTNVILAVNHKPGRYHSNYAETMAELTSEPAQEAKTIQQIN
FT                   TAKVSDQPANS"
FT   gene            complement(257682..258101)
FT                   /locus_tag="Patl_0214"
FT   CDS_pept        complement(257682..258101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0214"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ilo:IL0221 predicted dioxygenase
FT                   of extradiol dioxygenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38746"
FT                   /db_xref="GOA:Q15ZE2"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZE2"
FT                   /protein_id="ABG38746.1"
FT                   /translation="MSVMPFHLAIPVTSLVASKAFYGELLGCEQGRSSEQWIDWNFFGH
FT                   QLVTHLVAAMPSHPAPNKVDNKAVPVPHFGVVLKMKDWQNLAHRLQAAEVSFVIEPYVR
FT                   FKGQPGEQATLFLLDPCGNALEFKAFNDIAQLFAG"
FT   gene            complement(258225..259523)
FT                   /locus_tag="Patl_0215"
FT   CDS_pept        complement(258225..259523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0215"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG:
FT                   pha:PSHAa0275 adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38747"
FT                   /db_xref="GOA:Q15ZE1"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZE1"
FT                   /protein_id="ABG38747.1"
FT                   /translation="MAKNVVVLGTQWGDEGKGKVVDLLTDKATYVVRYQGGHNAGHTLV
FT                   IDGEKTVLHLIPSGILRENVTCVIGNGVVLSPEALLKESAMLEERGVPVKERLRISEAC
FT                   PLILPFHVELDLAREKARGDKPIGTTGRGIGPAYEDKVSRRGLRVGDLFNPTDFAVKLK
FT                   EVLEYHNFMLTNYYKVEPVSYEKTLADALAVADILKAMVVDVTDVLDRARKRGDEIMFE
FT                   GAQGTLLDIDHGTYPYVTSSNTTVGGVATGAGFGPLHLDYVLGIVKAYTTRVGSGPFPT
FT                   ELGCDVGQHLGIKGHEFGATTGRKRRTGWFDAVAMKRAVQINSITGFCLTKLDVLDGLE
FT                   TLSICTGYKHADGTVKDVPPMAADDYELITPVYEEMPGWSENSFGVTEYDNLPQAAKNY
FT                   IKRLEELTGVPIDIISTGPDRNETIVLRHPFEV"
FT   gene            complement(259605..259790)
FT                   /locus_tag="Patl_0216"
FT   CDS_pept        complement(259605..259790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0216"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vpa:VP2813 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38748"
FT                   /db_xref="GOA:Q15ZE0"
FT                   /db_xref="InterPro:IPR019201"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZE0"
FT                   /protein_id="ABG38748.1"
FT                   /translation="MLHTLLIAFALVLILEGIGPMLFPNKWRNYLQQMLEQPVNQLRSV
FT                   GGVLVTIGAVSLFFLI"
FT   gene            complement(259847..261346)
FT                   /locus_tag="Patl_0217"
FT   CDS_pept        complement(259847..261346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0217"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase-like histidine
FT                   kinase, HAMP region histidine kinase A-like; KEGG:
FT                   cps:CPS_0650 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38749"
FT                   /db_xref="GOA:Q15ZD9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZD9"
FT                   /protein_id="ABG38749.1"
FT                   /translation="MKICFYQRLAISLVAVFMLVMIACFYSTNELQKLTQQEAEQKLHI
FT                   GLAEHLVRDNPLLKEGVYDYDALGNLFHSLMILGPNFEFYYLDPQGKILTYSAKPGKVK
FT                   ATSVDIAPIKHLIGDNRSFPVEGDDPRQLGRHKIFSAAPVYNDDKLQGYLYVIIGGERY
FT                   DSILASLKNSQSMREIAIFLVVGLMLLLIALLVMFKYFTTPLRRLSDDMEKVREADFHR
FT                   EQVPRDLAVWNKNSHNEVDRLGCAFTDMLTHIDHQFEQLSKIDTQRRVLLADLSHDLRT
FT                   PLASLQGYIETLALNGESLSKQDREHFVDVSLKNAKNLKHLIDQIFELAYLEGGQVTLH
FT                   QEPFPLGELLHDVAAKFALEAQSKNIKIRVIPNHFEYHVFADIGKLERVLTNLIANAIR
FT                   HTPEQGKIDLAVAIHNDKLRVDIRDTGVGISDKEIAFIFDARYQASNTEKDTCSHAGLG
FT                   LAICQKLMALLNSDLTVESKLGKGTCFSFELTLVNSHALAH"
FT   sig_peptide     complement(261257..261346)
FT                   /locus_tag="Patl_0217"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.795) with cleavage site probability 0.479 at
FT                   residue 30"
FT   gene            complement(261346..262065)
FT                   /locus_tag="Patl_0218"
FT   CDS_pept        complement(261346..262065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0218"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver transcriptional
FT                   regulatory protein-like; KEGG: cps:CPS_0651 DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38750"
FT                   /db_xref="GOA:Q15ZD8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZD8"
FT                   /protein_id="ABG38750.1"
FT                   /translation="MTDSILIVEDDLDIANLMRVNLLELGVEIDHQVDGETALHQALSN
FT                   EYDVILLDVMLPNMSGLDICRKIRDERPMQIIIMLTSKNSETDRVLGLELGADDYMTKP
FT                   FSVRELQARVRSQLRKVHALRQSHVPSQQPDEALNTGDLRIDQKTHQVFLAEQELVLTA
FT                   TEFELLHHLASHPGQVFSRSQLLESVWGYHHSGYEHTVNSHINRLRAKLENDATSPKIV
FT                   QTVWGVGYKFNPQGVSG"
FT   gene            complement(262171..262890)
FT                   /locus_tag="Patl_0219"
FT   CDS_pept        complement(262171..262890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0219"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_0652 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38751"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZD7"
FT                   /protein_id="ABG38751.1"
FT                   /translation="MPNLIKHYKKALLLALPLALSACGDDTKEVIVEVEVPAPVPTPVD
FT                   VSYDVTVINLTNGQPVSPPAIVLHADGNLWAVGQVPSVELERIAEVGDSESFLTLGMTS
FT                   AGGEGPIMPGDQQTISVTIQDITDAKLTIAAMLGNTNDAFTGLNAWDLSQLEVGDSWTS
FT                   NRPAYDAGTEKNTESAATVPGPAASGEGFNPTRDDTGFISMHPGVVSVDDGLSTSALTV
FT                   EHKFDNPVIRVRITRTE"
FT   sig_peptide     complement(262816..262890)
FT                   /locus_tag="Patl_0219"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.948 at
FT                   residue 25"
FT   gene            complement(262901..263605)
FT                   /locus_tag="Patl_0220"
FT   CDS_pept        complement(262901..263605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_0653 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38752"
FT                   /db_xref="InterPro:IPR009465"
FT                   /db_xref="InterPro:IPR038678"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZD6"
FT                   /protein_id="ABG38752.1"
FT                   /translation="MKRTTILSAAAMLALSSQQSLAADISVEVQNLTHGLYFTPIAAVV
FT                   HTPDVSLFEVGEAASTELQMMAEGGSIDGITTVATAASADMIANPAGGLLAPTMSASGD
FT                   VMTTDGNVMLSVVAMVLPSNDGFVGLDNWEIPTEAGTYTVFLNAYDAGTEANDELRGSG
FT                   APGMPGMPVPPPLDPLLGTGGSGVAGADTNATVHIHRGNIGDDSMTDGTSDVNNSVHRW
FT                   LNPVAKVTVTVR"
FT   sig_peptide     complement(263537..263605)
FT                   /locus_tag="Patl_0220"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(263790..264875)
FT                   /locus_tag="Patl_0221"
FT   CDS_pept        complement(263790..264875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pha:PSHAb0433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38753"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZD5"
FT                   /protein_id="ABG38753.1"
FT                   /translation="MLTKKSITYLVLATTAIFIAVQGYRVWLLNSVKFISFDSRLKEIS
FT                   GIEFDKRQRLWAINDGGDEPRLYQLGDTGDIVRSIKITNAKNSDWEDMTQDYFGHFFIG
FT                   DFGNNHNDREWLTIYKIENPIDIKGDTTTAEIIKFTYPKFKAIKGEKPRKNVHYDVEAF
FT                   IYFKRNLYLFTKNRTSPFDGKTRIYKIGDHAANFDAEYINEFSTCTIIKELCWVTSAAL
FT                   SPDRTKLVLLDSERLWLFENWKGDDFFSGDAYQIDLGIVTQKEAVTFAADNNTIIFTDE
FT                   VFNGIGGNGYSIQLDKAKKIPVRKQMKKSIKVKPKLKPVVPTPKLDTPAVPPSSPAQSP
FT                   EGAPAKLTPTTEPEPAIPRQS"
FT   gene            265252..265473
FT                   /locus_tag="Patl_0222"
FT   CDS_pept        265252..265473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38754"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZD4"
FT                   /protein_id="ABG38754.1"
FT                   /translation="MKFLLGLMLSLTLFGAVADEGDVADAALIAELKQYCNDIAEEDGT
FT                   GGQNLNTFLLECVNNELTNEGYQKVEKI"
FT   sig_peptide     265252..265308
FT                   /locus_tag="Patl_0222"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 19"
FT   gene            complement(265559..266632)
FT                   /locus_tag="Patl_0223"
FT   CDS_pept        complement(265559..266632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0223"
FT                   /product="peptidase M42"
FT                   /note="PFAM: peptidase M42; KEGG: tcx:Tcr_0276 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38755"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZD3"
FT                   /protein_id="ABG38755.1"
FT                   /translation="MPHPFAQVDLPASFIELLSSLMRSPSVVGAEHSFFRVLQRELEER
FT                   GAKVTWYEGLLVAQGNAPDSIMFSAHIDRHGLVCTGPNEFQYAAFVAGARSDLLGNSVS
FT                   ESLMRKIVDRFDDESVYAYEPWSGAYRGRGTIKGAYICENRNNLIFEVDGLEHVVAGTP
FT                   VAFTDKLSITDQALVGQLDNILTTAALVHLFEGGFQGTAFFTAQEEAGKSWRYLLEWFR
FT                   RFGGSTNQLIVVDTSPYPDLPSAAQQNLILRHKDANAVFNPRLTERLMAECQNLGLSYQ
FT                   FKDTYVEAQNAKLIANGDAPYSLGATELGRIISASNGLVDGTTLQIPSSGYHTMQESAP
FT                   LSSVAGFLRMLAVLAKE"
FT   gene            complement(266714..267616)
FT                   /locus_tag="Patl_0224"
FT   CDS_pept        complement(266714..267616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0224"
FT                   /product="Phosphoribulokinase"
FT                   /EC_number="2.7.1.19"
FT                   /note="PFAM: phosphoribulokinase/uridine kinase; KEGG:
FT                   ilo:IL2312 phosphoribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38756"
FT                   /db_xref="GOA:Q15ZD2"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZD2"
FT                   /protein_id="ABG38756.1"
FT                   /translation="MSVKHPIIAITGSSGAGTTSTTNAIRHIFRNLSVNAAVVAGDSFH
FT                   RFTRPEMEVEIRKAQEQGRHISYFGPKANDFVMLEQLFSEYAETGKGKHRHYLHSFDEA
FT                   VPFNQMPGTFTPWQELPTNTDVLFYEGLHGGVVTEEADVATHVDLLVGMVPIVNLEWIQ
FT                   KIVRDTAERGHSREAVMSSIVRSLDDYFQYITPQFSRTHVNFQRVPTVDTSNPFSAREI
FT                   PSQDESFVVVRFRREMKTVNYPYLLQMIDGAFMSRINTLVVPGGKMGLAMELILTPLLE
FT                   EILDKKRRAGFQMDWVSDK"
FT   gene            268013..268735
FT                   /locus_tag="Patl_0225"
FT   CDS_pept        268013..268735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0225"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver transcriptional
FT                   regulatory protein-like; KEGG: cps:CPS_4597 transcriptional
FT                   regulatory protein OmpR"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38757"
FT                   /db_xref="GOA:Q15ZD1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZD1"
FT                   /protein_id="ABG38757.1"
FT                   /translation="MGQETTKILVVDDDMRLRSLLERYLVEQGYQVRAAANAEQMDRML
FT                   ERENFHLMVLDLMLPGEDGLSICRRLRQKENEIPIVMLTAKGDEVDRIIGLEMGADDYL
FT                   PKPFNPRELLARVKAVLRRKVVEAPGAPSHAEQIVEFGKFKLNLGTREMSSEGTPMTLT
FT                   SGEFAVLKSLVTHPREPLSRDKLMNLARGRDYSALERSIDVQVSRLRRMLEEDPANPRY
FT                   IQTVWGLGYVFVPDGGGA"
FT   gene            268761..270059
FT                   /locus_tag="Patl_0226"
FT   CDS_pept        268761..270059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0226"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase-like histidine
FT                   kinase, HAMP region histidine kinase A-like; KEGG:
FT                   son:SO4634 osmolarity sensor protein EnvZ"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38758"
FT                   /db_xref="GOA:Q15ZD0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZD0"
FT                   /protein_id="ABG38758.1"
FT                   /translation="MRFLPKSAFGQTVLLIGMLLLINQVVSYLSVTYYFIRPSYQQINN
FT                   LLATQINLVFIEEIDHKDPELHKRFFAATGMRLLSNEKAQEEGVEQAIYYPYLSRQMSL
FT                   KLGGEAEVRITQGNPYLVWVKPPQDPSVWVTIPMLSHGESDISPLTIYLLVIGILSVAG
FT                   GWIFVRRLNKPLQALQHAAIEVGRGNIPPPLEAQGSTELMAVTQAFNQMAKGIKQLEDD
FT                   RALLTAGISHDLRTPLTRIRLATEMLPEAQDWLKEGIVNDIEDMNEIIDQFINYVRQDQ
FT                   QESMVGVDVNDLIRDAVQVRNIEEHHNIHLHLKPIPTACMRRVALKRVLDNLIENAFRY
FT                   GSEDIEIRSGYDKARNLLFFSIRDFGPGIPDTQIEGLFKPFTQGDKARGSLGSGLGLAI
FT                   IKRIVDMHSGEVTLKNHPEGGLIASIFIPHTCP"
FT   gene            complement(270114..271007)
FT                   /locus_tag="Patl_0227"
FT   CDS_pept        complement(270114..271007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0227"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: son:SO0163 chaperonin
FT                   HslO"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38759"
FT                   /db_xref="GOA:Q15ZC9"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZC9"
FT                   /protein_id="ABG38759.1"
FT                   /translation="MSFDQLHRYLFNQAHVRGELVRLENSYQSILDSYAYPPVIQKLLG
FT                   ELMAATSLLTATLKFEGDIALQLQSDGPVNYAVINGTHDQQLRGVARWDESLAELPTDF
FT                   SQLFTKGILVITITPEDGERYQGMVALDKPTLAECIESYFQQSEQLATKVILRTQQTDS
FT                   GAKACGMFLQILPTSSQATATTDTGFEHLAKLTETIKNEELFSLPAEDILYRLYHQEEI
FT                   EVYPPADIIFKCSCSRERSANALAAVEKAELLDIVATEGAIKMNCQYCHREYRFDEIDV
FT                   HAIHAGTFAMDTQNDQ"
FT   gene            complement(271040..271456)
FT                   /locus_tag="Patl_0228"
FT   CDS_pept        complement(271040..271456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0228"
FT                   /product="heat shock protein Hsp15"
FT                   /note="PFAM: RNA-binding S4; KEGG: ilo:IL2028
FT                   ribosome-associated heat shock protein implicated in the
FT                   recycling of the 50S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38760"
FT                   /db_xref="GOA:Q15ZC8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZC8"
FT                   /protein_id="ABG38760.1"
FT                   /translation="MPNNMQNSKNSFTEQSVRLDKWLWAARFFKTRALAREAVMSGKVS
FT                   YNGQRCKPSKAVELKVTIKVPQGYDVKEIIVVELAEHRRSAPLAQRMFEETPESLAQRE
FT                   KNAEMRKLSAFHSPKPDQRPDKKQRRQIIQLKHQ"
FT   gene            271615..272310
FT                   /locus_tag="Patl_0229"
FT   CDS_pept        271615..272310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0229"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase
FT                   short-chain dehydrogenase/reductase SDR; KEGG: neu:NE0658
FT                   short-chain dehydrogenase/reductase (SDR) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38761"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZC7"
FT                   /protein_id="ABG38761.1"
FT                   /translation="MKTVLVTGANRGLGLGLCQQYFSQGDVVIGVCRASADQTDLLALK
FT                   AQNEDRMHIMHADLHSQASIEQLAERVQGQFKIDVLINNAGVSANEPLGEWTQTAFMNN
FT                   FLVNSVAPSLMCQALHDTLTSQARVIQLSSGVASIAQSDKFAQAPLDAYAMSKAALNMF
FT                   TRRFAIQHQASQQVICALSPGWVQTDMGGQDATSTVQNASRKIVTLIERLTIADTGHFF
FT                   DENGVQLPW"
FT   gene            272455..273309
FT                   /locus_tag="Patl_0230"
FT   CDS_pept        272455..273309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0230"
FT                   /product="general secretion pathway protein C"
FT                   /note="TIGRFAM: general secretion pathway protein C; KEGG:
FT                   cps:CPS_4592 general secretion pathway protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38762"
FT                   /db_xref="GOA:Q15ZC6"
FT                   /db_xref="InterPro:IPR001639"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZC6"
FT                   /protein_id="ABG38762.1"
FT                   /translation="MAVLVIFLLAYLAELTWRLWPKSELAHNDAPLTRLAPIASGNNST
FT                   LNLNAVKRLNLFGDFQASPVAEQTVTDAPETKLNLTLTGVVTSSVQEQGAAIIENRGSQ
FT                   DTYGLGEKIIGTNATLREVFRDRVIIRNGVVNETLMLDGVDFDEANKKRTITPRRPAPA
FT                   ISPSPIQDNVITLSDDVIDATRMLQQQPANFTEFISVAPHSADGELQGYRVSPGKKPAL
FT                   FKAAGLQNGDVITDINGLNLTDPQQAVEAMGELRGAQSLQITVSRDNDLLTLFLELPDA
FT                   EQE"
FT   gene            273315..275384
FT                   /locus_tag="Patl_0231"
FT   CDS_pept        273315..275384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0231"
FT                   /product="general secretion pathway protein D"
FT                   /note="TIGRFAM: general secretion pathway protein D; PFAM:
FT                   type II and III secretion system protein NolW-like; KEGG:
FT                   cps:CPS_4591 general secretion pathway protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38763"
FT                   /db_xref="GOA:Q15ZC5"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZC5"
FT                   /protein_id="ABG38763.1"
FT                   /translation="MNFIQRTSRNILPSLCLIIGAAFFSASTFVAANEYSPNFKNTDIG
FT                   EFINIVGKNLKKTIIVDPNVRGKISVRSYDLLNEEQYYQFFLNVLQVYGYAVVEMPTGI
FT                   VKVVRSKDAKTSNLPVVEGTPFDGDEMITRVMPVYNVPVRELAPILRQLNDQAGGGNVV
FT                   SHDASNVMMLTGRAAVVNRLVEIIERVDKAGDEEVEIVKLKFASATELVRIIESINKTT
FT                   GKASASGKDAPRVVADDRTNSIMVSGDIKARQRIVNLIERMDQELETSGNTRVIFLKYS
FT                   KAEELVKVLQGVSASIQAEEQGAAKSTSKAARDISIEAHEDSNALVITAQPDMMRSLED
FT                   VIRQLDIRRAQVQVEAIIVEVFEGDGTTVGVQWASEKYGAQQFSNGNVVGIGSLAVAAE
FT                   QAEDTTTTTVGFDDDGDPYSFDETTEGDYTALASLLGGVNGFLVGAVKDGWGAVLQAVS
FT                   TDTNSNVLSTPHLTTLDNEEAFFIVGQEVPIITGSTTGSNNTNPFQSVERQEIGIKLKV
FT                   TPQINEGNAVQLLIEQEVSSISGATSVDILINKREIKTTVIVDDGGTIVLGGLIDDDVQ
FT                   ESVSKVPILGDIPYLGNLFKSTTTSKSKRNLMVFIRPTIIRDGVTASDISRKKYNYIRA
FT                   EQLKRQSEGIPLMPFSENPALPEWDDGLALPPSYGEYMEKRAQSEKAAQQKDDE"
FT   sig_peptide     273315..273413
FT                   /locus_tag="Patl_0231"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.921 at
FT                   residue 33"
FT   gene            275387..276964
FT                   /locus_tag="Patl_0232"
FT   CDS_pept        275387..276964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0232"
FT                   /product="type II secretion system protein E (GspE)"
FT                   /note="KEGG: ilo:IL2025 type II secretory pathway, ATPase
FT                   PulE-like; TIGRFAM: general secretory pathway protein E;
FT                   PFAM: type II secretion system protein E; SMART: ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38764"
FT                   /db_xref="GOA:Q15ZC4"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZC4"
FT                   /protein_id="ABG38764.1"
FT                   /translation="MSSDSTITESISTVEAEEQALVAAGTDVDAPIEDAEHKQLAFSFA
FT                   KRHKVLLETAETPALLYHTNETDFAIFAEVRRFLGQPFQLREIESGQFETLLTSAFQRD
FT                   SSAAKQLMEDIGNESDLFALAEELPDTEDLLESEDDAPIIKLINAMLGEAIKEGASDIH
FT                   IETFETQLLVRFRVDGVLREILKPNRKMASMLVSRIKVMSKMDIAEKRVPQDGRITLRI
FT                   AGRAVDVRVSTMPSSHGERVVLRLLDKNNVRLNLEDLGMTKVNRGHFSGLIRKPHGIIL
FT                   VTGPTGSGKSTTLYAGLSEINSKDRNILTVEDPIEFDLQGIGQTQVNAKVDMTFARGLR
FT                   AILRQDPDVVMVGEIRDLETAQIGVQASLTGHLVMSTLHTNTAAGAITRLEDMGIEPFL
FT                   LSSSLLAVLSQRLVRTLCPQCKTTHEPSAQECSILGVAIGSEASHQVCRPKGCAACNHT
FT                   GYRGRTGIHELLIVDEGIRELIHNGHGEQAIEKYIRQNTPSIRDDGCRKVLSGETSLEE
FT                   VLRVTRED"
FT   gene            276966..278186
FT                   /locus_tag="Patl_0233"
FT   CDS_pept        276966..278186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0233"
FT                   /product="general secretion pathway protein F"
FT                   /note="TIGRFAM: general secretion pathway protein F; PFAM:
FT                   type II secretion system protein; KEGG: ppr:PBPRA3479
FT                   putative general secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38765"
FT                   /db_xref="GOA:Q15ZC3"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZC3"
FT                   /protein_id="ABG38765.1"
FT                   /translation="MAAFAYKAIDKSGKNKSGVLEGDNARQIRQQLREKQLIPLEVEQV
FT                   AEKERQSAKQFSLFKPKISASDLALLTRQLATLVESSLPIEEALMAVAQQSEKPRQKNM
FT                   MMAVRSKVVEGYNLADAMAEFPHVFDELFRAMVAAGEKSGHLDTVLNRLADYTEKRQQT
FT                   RSQITQAMVYPTLMMFFAMGIVILLLTVVVPKIVGQFDHMGQDLPTITKVLISVSEWMQ
FT                   NYGLLLIVIFALAAVVLSRVLQQPAMKKRYHHFILGLPLLGKVSKGLNTARFARTLSIL
FT                   TSSSVPLLESMKISSDVLANLYIRDEVKGASVNVKEGSSLRAALERTKMFPPMMMHMIA
FT                   SGERSGELTQMLGRAADNQDREFESLVGVSLKVFEPLLIVSMAGIVLFIVMAILQPILA
FT                   LNNMVNL"
FT   gene            278186..278626
FT                   /locus_tag="Patl_0234"
FT   CDS_pept        278186..278626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0234"
FT                   /product="general secretion pathway protein G"
FT                   /note="TIGRFAM: general secretion pathway protein G; PFAM:
FT                   methylation type II secretion system protein G; KEGG:
FT                   eca:ECA3106 general secretion pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38766"
FT                   /db_xref="GOA:Q15ZC2"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZC2"
FT                   /protein_id="ABG38766.1"
FT                   /translation="MKTLQRTQRGFSLIEVMVVLLIIGIMASMIAPSILGNQEQAQLKK
FT                   AAVDIQQLESALEMYKLRNNVFPTSEQGLDALVTIPTIDPIPRNYQDGGFIKRLPEDPW
FT                   GNPYQLISPGEVGVIDIFSNGPDGEAGTDDDIGNWNLNDYLG"
FT   sig_peptide     278186..278296
FT                   /locus_tag="Patl_0234"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.735) with cleavage site probability 0.514 at
FT                   residue 37"
FT   gene            278669..279277
FT                   /locus_tag="Patl_0235"
FT   CDS_pept        278669..279277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0235"
FT                   /product="general secretion pathway protein H"
FT                   /note="TIGRFAM: general secretion pathway protein H; PFAM:
FT                   methylation; KEGG: cps:CPS_4587 general secretion pathway
FT                   protein H"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38767"
FT                   /db_xref="GOA:Q15ZC1"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZC1"
FT                   /protein_id="ABG38767.1"
FT                   /translation="MTRIQRGFTLLEVMLVLVIMGLLAGTVVFNISGQSGQDRLKQQVQ
FT                   RFQVVFSMASDYAVLNQQQLGLYVDEDKSQYSFVMLDEEQNWQLISGDKTFEAHTLPDE
FT                   FTFELALNDLPWDTDDSLFNESSIDAELSFSDDEISIGDEEEKKLPPPQVFLLSSGDIT
FT                   PFSLAFSFEPDFSSEAASYFRVNVQDSLPVAVEGPLENL"
FT   gene            279274..279669
FT                   /locus_tag="Patl_0236"
FT   CDS_pept        279274..279669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0236"
FT                   /product="general secretion pathway protein I"
FT                   /note="TIGRFAM: general secretion pathway protein I; PFAM:
FT                   type II secretion system protein I/J methylation; KEGG:
FT                   cps:CPS_4586 general secretion pathway protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38768"
FT                   /db_xref="GOA:Q15ZC0"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZC0"
FT                   /protein_id="ABG38768.1"
FT                   /translation="MRSLAGGCHQKGMTLLEVMVALVIFAMTATAIMKAASDHLGSIGQ
FT                   IEEITFATWVANNRLTQLQLSSQWPPKDNAKGEQTMADRTWYWQQKVIKTNDSELMSVE
FT                   VSVALDAKLSAPITSVVTFVAKRDDDV"
FT   gene            279656..280354
FT                   /locus_tag="Patl_0237"
FT   CDS_pept        279656..280354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0237"
FT                   /product="general secretion pathway protein J"
FT                   /note="TIGRFAM: general secretion pathway protein J; PFAM:
FT                   methylation; KEGG: cps:CPS_4585 general secretion pathway
FT                   protein J"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38769"
FT                   /db_xref="GOA:Q15ZB9"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZB9"
FT                   /protein_id="ABG38769.1"
FT                   /translation="MMMCKPALAPTYQLVSPAGCLNASVKRRAEHGFTLLEILIAMAIF
FT                   TLIGIASTGVLTSVIDSDELSTERFEKLQTLQRAMLTLERDILQAVARPVRVEGEANGR
FT                   VMLGGDGVLDSYHDGLVFVHGGWHNPQLRLPRSTLQGVGFRVQERQLQRLYGNYVDNVI
FT                   GYEPKVKVLLENIDDFKVYFIPVDEDEEGDSAWQDDYSDEVLPKAVAIEITSQDFGLIR
FT                   REFLLSGASS"
FT   gene            280351..281355
FT                   /locus_tag="Patl_0238"
FT   CDS_pept        280351..281355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0238"
FT                   /product="General secretion pathway protein K"
FT                   /note="PFAM: General secretion pathway protein K; KEGG:
FT                   son:SO0173 general secretion pathway protein K"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38770"
FT                   /db_xref="GOA:Q15ZB8"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZB8"
FT                   /protein_id="ABG38770.1"
FT                   /translation="MRLSVATVKHQKGVALIIVLLIVALVSVLATQMGSRLQLQVKRAS
FT                   NIKDNNQAYWYAMGAEQYAQKSIKFLLENSDGVIHLDQQWSEPFVYPLEGGGIQAQLFD
FT                   MQSCFNINSLQASAQNSTGSDSNSGVSERQLAFKRLMTNINADISTYDIDTFSDSLVDW
FT                   LDADSQMSQQGAEDSEYESRQFPYLAANSLMAHKSELRLVNGVSNAWLDDILEQVCVIP
FT                   GDDQLKINVNTVNEDSVVVLAALTGLDESGAQDVISNRPNDGYKTKDDFLAVNTVSALN
FT                   MPTEREDWFDVTTQHFLLKVKTTYNNATFSMVTVFTVDDSQNVSILRREFGIQ"
FT   sig_peptide     280351..280443
FT                   /locus_tag="Patl_0238"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.859 at
FT                   residue 31"
FT   gene            281435..282628
FT                   /locus_tag="Patl_0239"
FT   CDS_pept        281435..282628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0239"
FT                   /product="general secretion pathway protein L"
FT                   /note="TIGRFAM: general secretion pathway protein L; PFAM:
FT                   General secretion pathway L; KEGG: son:SO0174 general
FT                   secretion pathway protein L"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38771"
FT                   /db_xref="GOA:Q15ZB7"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZB7"
FT                   /protein_id="ABG38771.1"
FT                   /translation="MEQLIVRLGSNDDDVIHWIVCSSNEDDVIASGELPGVAHLSSLKD
FT                   RAGQRPITALVPTSDVLLKWVTLPSKAGRKALSAIPFMLEDEISGDIDSQFFALGGRKD
FT                   NQQAVAVVSKIRLQAWRTQLADAGLHCERIVPDILAVPEPTSGWAVLELGEQLLIRQDQ
FT                   WAGIQGEKNWLVQAINHHAKQQPIPLSLDNFSRLSSQELNNVLLQEQHVDMPMKILASG
FT                   SQTTQFNLLQGEFKSRKKQGGEFKKWRLAAVLAIVALCTTLIDKVALQQQLSSERALVS
FT                   SQIKAEFTRAFPNAGAYRDVRATMRAKLAALEQGTGGSSMLVMMDQLANAFAKSQVKPS
FT                   SVKFDASRRELRMQAMAANFESLELFKRLAEAQGFEVEQGAINNRNDLVYGSLLVRS"
FT   gene            282630..283109
FT                   /locus_tag="Patl_0240"
FT   CDS_pept        282630..283109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0240"
FT                   /product="General secretion pathway M protein"
FT                   /note="PFAM: General secretion pathway M protein; KEGG:
FT                   son:SO0175 general secretion pathway protein M"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38772"
FT                   /db_xref="GOA:Q15ZB6"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZB6"
FT                   /protein_id="ABG38772.1"
FT                   /translation="MNTLKQKFSQLTEREQRLVLISAVVVVVGMFYWLVWSPLNQAIER
FT                   DQKALDSQKSLLSWVQKSANRAIQLRAAKGVSAGFNGSLAQAANQTAANANIPIARMQP
FT                   QGDELQVWVDQAPFNGVLDWLKSLEEMGVSILDLDIAEADAPGQVKIRRLKLGKS"
FT   gene            283106..283849
FT                   /locus_tag="Patl_0241"
FT   CDS_pept        283106..283849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0241"
FT                   /product="type II secretion system protein N"
FT                   /note="PFAM: type II secretion system protein N; KEGG:
FT                   pha:PSHAa0242 general secretion pathway protein N"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38773"
FT                   /db_xref="GOA:Q15ZB5"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZB5"
FT                   /protein_id="ABG38773.1"
FT                   /translation="MKLVVKWVIACLIIYVVFLIAKLPAVHVIAKVQLPPDITVSGVSG
FT                   TIWNGQADTVTLQGLPIRDVKWQLAFWPLLTGTAAIDVDAGNIREVDDISVKGHVAISN
FT                   GHVQGEDVQVFLPTRLVITSLPLPIPVNASGRFKISLQELDYTEQCQVLTGQGLWLKAK
FT                   VQGTQQDIELGNFEANLKCENKEVVMTINEPNSFGLSAVAHIPSDLAFRINGRFKPDEN
FT                   LPEEVHQAAQFFGKKDAQGYYPVKF"
FT   gene            complement(283943..284914)
FT                   /locus_tag="Patl_0242"
FT   CDS_pept        complement(283943..284914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0242"
FT                   /product="D-fructose 1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /note="PFAM: Inositol
FT                   phosphatase/fructose-1,6-bisphosphatase; KEGG:
FT                   pha:PSHAa0463 fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38774"
FT                   /db_xref="GOA:Q15ZB4"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZB4"
FT                   /protein_id="ABG38774.1"
FT                   /translation="MKRLNSQLQEDGAPMELILLLRTLLAGCKEISFRVSQGALAGVLG
FT                   STLSENVQGETQKKLDVISNQILKDILSESGYVKAISSEEEDDVVACNPNGNYLVSFDP
FT                   LDGSSNTDINSLIGTIFSITHAPQWMDADDPSAFLQPGTQIVAAGYVLYGPSAMLALST
FT                   GRGTHLYTLDKTHGGFLLTQKNIQVPAQTSEFAINASNQRHWEDPVQNYIGDLIAGEDG
FT                   PREKDFNMRWVAAMVGDIHRVLSRGGIFMYPFDRRNPEMPGKLRLLYEANPMAFLMEQA
FT                   GGLASTGQGRILEVMPTEIHQRVPVILGSKEEVETCLSYYKA"
FT   gene            285140..286486
FT                   /locus_tag="Patl_0243"
FT   CDS_pept        285140..286486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0243"
FT                   /product="UDP-N-acetylmuramate"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate; PFAM: cytoplasmic
FT                   peptidoglycan synthetase-like cytoplasmic peptidoglycan
FT                   synthetases-like Mur ligase, middle region; KEGG:
FT                   vfi:VF0265
FT                   UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-
FT                   diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38775"
FT                   /db_xref="GOA:Q15ZB3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZB3"
FT                   /protein_id="ABG38775.1"
FT                   /translation="MHLHILGICGTFMGGIAAIAKAMGHKVTGSDNNVYPPMSTQLEAL
FT                   GIELTQGFGEDQFDPQPDMVVIGNALSRGNLAVEYVLNRGIPYTSGPQWLLENVLKDRW
FT                   VLAVSGTHGKTSTSSMLAWILESAGMSPGFLIGGIPQNFDISARLGETPFFVIEADEYD
FT                   SAFFDKRSKFVHYRPRTLVINNIEFDHADIFDSIADIQKQFHHLIRMIPGNGLVIAPKT
FT                   DNQITQVLDKGCWSPVQFVGSDWKAENGSADGGEFDVIYKGKSFGRVKWSLLGLHNVQN
FT                   AMMAIIAARHAGVLPEVAIEALGSFVNAKRRMEILGTVNGITVYDDFAHHPTAIATTLE
FT                   GLRAKVGDARILAVLEPRSNTMKMGVHKQTLAKSWSAADQVFIYEPSNLSWSMDALLAQ
FT                   SEVTASLHNDLNILEKSILSYVQPGDHVLIMSNGGFGGIHQRLLQKLSQ"
FT   sig_peptide     285140..285214
FT                   /locus_tag="Patl_0243"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.804) with cleavage site probability 0.393 at
FT                   residue 25"
FT   gene            286546..287316
FT                   /locus_tag="Patl_0244"
FT   CDS_pept        286546..287316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0244"
FT                   /product="S1/P1 nuclease"
FT                   /note="PFAM: S1/P1 nuclease; KEGG: pha:PSHAb0342 putative
FT                   S1/P1 nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38776"
FT                   /db_xref="GOA:Q15ZB2"
FT                   /db_xref="InterPro:IPR003154"
FT                   /db_xref="InterPro:IPR008947"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZB2"
FT                   /protein_id="ABG38776.1"
FT                   /translation="MYKFIVGLLMASFSVNVLAWGQIGHRVTGAIAQQHLTPQAQAAIS
FT                   ALLPTEDLAEASTYPDEMRSSPDDFWQKKAGPFHYVTIPKGQTYADVGAPEQGDGVSAL
FT                   KMFTANLTSSQTSKAEKQLALRFIVHIIGDLHQPLHAGNGTDRGGNDFKVNFFWQDSNL
FT                   HRVWDSELLDQRQLSYTEWTAILNRKISAQDINDWNTTDPKVWIAESVKIRDEIYPSQE
FT                   TISWDYLYHHLPQAKQRLKMAGIRIAAYLNEIYK"
FT   sig_peptide     286546..286605
FT                   /locus_tag="Patl_0244"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 20"
FT   gene            complement(287391..288458)
FT                   /locus_tag="Patl_0245"
FT   CDS_pept        complement(287391..288458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0245"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="KEGG: vfi:VF2402 uroporphyrinogen decarboxylase;
FT                   TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38777"
FT                   /db_xref="GOA:Q15ZB1"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15ZB1"
FT                   /protein_id="ABG38777.1"
FT                   /translation="MNSLKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYKATRAQAGD
FT                   FMSLCKNAELACEVTLQPLRRFDLDAAILFSDILTIPDAMGLGLYFEQGEGPKFSKPIT
FT                   SMADIQNLPAPDPEQELQYVMNAVRTIRKNLQGEVPLIGFSGSPWTLATYMIEGGSSKA
FT                   FTKIKKMAFSDPQALHLLLDKLADSVILYLNAQIDAGAQSVMVFDTWGGVLSPRDYQDF
FT                   SLQYMHKIVDGLTRENDGRKVPVTLFTKNAGMWLESIAATGCDGVGLDWTIDIDNAKAR
FT                   VGDKVALQGNMDPSMLYAAPERIEQEVQKILAGFGEGPGHVFNLGHGIHLDVPPENAKV
FT                   FVDAVHKYSAQYHKG"
FT   gene            complement(288710..289525)
FT                   /locus_tag="Patl_0246"
FT   CDS_pept        complement(288710..289525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0246"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: ilo:IL2307 NUDIX family
FT                   pyrophosphohydrolases containing a Zn-finger"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38778"
FT                   /db_xref="GOA:Q15ZB0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZB0"
FT                   /protein_id="ABG38778.1"
FT                   /translation="MIKQNVNINVDTPSIWFIFSAEKLLVPTKQPGPIIETWKKLEFAH
FT                   AYEEQVVQVGEHNGQVCYLVDMGNELIEQAGLQLSHLRSLLLHDEMDIFSVAARAWQVA
FT                   LFLRTHRFCGQCGSTMQKIDWEMAMHCHRCHHRCYPRISPCIIVAIRHEDKILLAQGKP
FT                   QKERNMFSTLAGFVESGETLEDAVHREVFEEVGVAIKNIRYMSSQPWPFPHSLMVGFLA
FT                   DFDSGDINVDGHEIIEAHWFKFDELPNIPPKFSIAGQLIERTIEEICQN"
FT   gene            289860..290291
FT                   /locus_tag="Patl_0247"
FT   CDS_pept        289860..290291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0247"
FT                   /product="zinc uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: pha:PSHAa0493
FT                   zinc uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38779"
FT                   /db_xref="GOA:Q15ZA9"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZA9"
FT                   /protein_id="ABG38779.1"
FT                   /translation="MSIGSQVEKARQYCEQKGARFTHLRETVYALLLEKEGAVGAYDLL
FT                   DTLKETETNAKPATVYRTLDFLLEFGLIHRLESTNAFVACHHFGCSHPVQFLICDNCGL
FT                   VKEIQSEGLQDTLVKHAESHGFKVSKQTIEAHGLCTACQ"
FT   gene            290341..290805
FT                   /locus_tag="Patl_0248"
FT   CDS_pept        290341..290805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0248"
FT                   /product="CheC-like protein"
FT                   /note="PFAM: CheC-like protein; KEGG: ilo:IL1932 chemotaxis
FT                   protein CheX"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38780"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR038756"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZA8"
FT                   /protein_id="ABG38780.1"
FT                   /translation="MNAEFINPFIAALRNVLSTMAQLELVPGKPQKKTDSAAKGDVSGL
FT                   IGMVGDDVKGSLSITFETSIALKVMHNMLGEQLESVNEDVADMVGEITNMICGGAKNEL
FT                   AKLGYNFGMATPVVVFGKNHTLSHTASGRKLIMPFANEHGKVYLEMCFDK"
FT   gene            290795..291232
FT                   /locus_tag="Patl_0249"
FT   CDS_pept        290795..291232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0249"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   vpa:VP2732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38781"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZA7"
FT                   /protein_id="ABG38781.1"
FT                   /translation="MTNSLPIWQQFQLSLRAKPRGFHLITDEIGKQLEVLTTVNIGILH
FT                   LFIQHTSASLTINENADPTVRSDLESHINQAIPENAAYYLHNYEGSDDMPAHIKASVFG
FT                   SNITIPIQNGRLALGTWQGIYLGEHRNHGGERSVIATITGQ"
FT   gene            291321..292427
FT                   /locus_tag="Patl_0250"
FT   CDS_pept        291321..292427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0250"
FT                   /product="OmpA/MotB"
FT                   /note="PFAM: Thrombospondin type 3 repeat OmpA/MotB OmpF;
FT                   KEGG: cps:CPS_0958 OmpA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38782"
FT                   /db_xref="GOA:Q15ZA6"
FT                   /db_xref="InterPro:IPR003367"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZA6"
FT                   /protein_id="ABG38782.1"
FT                   /translation="MKKTMTAMGILLAFTSGAFAQSAPVGDKWVGGFGEYYKTDGELDG
FT                   APTFYDDGVGFGAELGFRFKPQWAARLEWSHLNIDQTNGLGDESGNRFGVDAMYFLPDD
FT                   LMYVFAGVKHLDLADSSRLANVGIGKHWAINDKWRVITEIAAYHDFGEAYNDVSAKIGL
FT                   AYSFGTTSTPVTRDSDNDGVNNSMDKCPGTAPGVKVDAMGCALAAAMTESDSDNDGVVD
FT                   SKDKCANTPSTDQVDATGCSIFTEVEVEETLRILFANNSAEIANRANSDIRDFAAFMKR
FT                   FPSTDTVIEGYASAPGESDYNQWLSEERAKAVRMVLIEDYDIKPARITAVGFGESKLLD
FT                   APTAKEANKINRRIVARVSASKREKLTK"
FT   sig_peptide     291321..291383
FT                   /locus_tag="Patl_0250"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 21"
FT   gene            complement(292531..293967)
FT                   /locus_tag="Patl_0251"
FT   CDS_pept        complement(292531..293967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0251"
FT                   /product="primary replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="KEGG: son:SO3917 replicative DNA helicase; TIGRFAM:
FT                   replicative DNA helicase; PFAM: DnaB-like helicase-like;
FT                   SMART: ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38783"
FT                   /db_xref="GOA:Q15ZA5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZA5"
FT                   /protein_id="ABG38783.1"
FT                   /translation="MAHTSHLFLRINVPSVKAVSAKNKDQKVEKLKVPPHSIEAEQSVL
FT                   GSMLIAPDSWDKVAELVTEEDFYNRSHQVIYGAILRLLKNNHPIDLITVSEDLENLDEL
FT                   EEAGGFAYLGELAKNTPSAANVTAYANIIKERAVVRELIGVAHDIADVGYNPEGRNSGE
FT                   LLDMAESRVFEIAEKRTAKNEGPRGIESVLTKTIDRLEELVKNNKEVTGVSTGYTDLDK
FT                   KTSGLQPSDLIIVAARPSMGKTTFAMNLCENAMLLEEKPVLVFSLEMPAEQIMMRMLAS
FT                   LSRVDQTKIRTAQLDDEDWARMSNTMAMLKDKDNLYVDDSSGLTPMEVRTRARKLARDR
FT                   GGISLIMIDYLQLMQVPGLSDNRTLEIAEISRSLKSLAKELEVPVVALSQLNRGLEQRS
FT                   DKRPINSDLRESGSIEQDADLIMFIYRDEVYNEGSEDKGVAEIIIGKQRNGPIGTSRLT
FT                   FQGQFSRFDNYAGPPRDDEY"
FT   gene            complement(294077..295885)
FT                   /locus_tag="Patl_0252"
FT   CDS_pept        complement(294077..295885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0252"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase, RecQ family
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase-like HRDC
FT                   DEAD/DEAH box helicase-like; KEGG: pha:PSHAa2572
FT                   ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38784"
FT                   /db_xref="GOA:Q15ZA4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZA4"
FT                   /protein_id="ABG38784.1"
FT                   /translation="MPPATSAINSAQSVLKTVFGYDEFRDGQRDVIEKILQGHDVLVLM
FT                   PTGGGKSLCYQIPALVLEGLTIVVSPLIALMKDQVDALVASGVSAAYINSNLSSEEIHN
FT                   VYRGMQDGHYKLIYVAPERLMQFDFIQRLHSLELALFAVDEAHCVSHWGHDFRKEYRRL
FT                   GQLKQQFPTVPVVGLTATADITTRSDILQQLALQDPFIFKGSFDRPNIRYNQLFKYKAT
FT                   DQVIQYVKQQEGSGIIYCNSRKKVDDLSIALARQGINCAGYHAGLEGPIRDKIQRDFIQ
FT                   DNIDIIVATVAFGMGINKSNVRFVVHFDLPRSVEAYYQETGRAGRDGMPAEALLLFDEK
FT                   DAARIRQWIGMGDNPERLDIELQKFAAMEAFAEAQTCRRQVLLNYFSEYSAHDCGNCDI
FT                   CLDPPKRFDGTVPAQMVLSCIYRLGQNVASQYVIDVLRGKKLKRIVEQGHDSLSTFAIG
FT                   KDKSDAHWHNIINQLIHKGFLRIDITQSAVLKLTEEARGVLAGKLELALAVPRLTIDSG
FT                   KKSKLKEMNYDRKLFAKLKHLRKSIAQREDVPPFVVFSDATLADMADKLPQSKTDFLEV
FT                   NGVGQTKLDRYGSEFLAAISAYSQDL"
FT   gene            296014..296487
FT                   /locus_tag="Patl_0253"
FT   CDS_pept        296014..296487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0253"
FT                   /product="uncharacterized domain 1"
FT                   /note="TIGRFAM: uncharacterized domain 1; PFAM:
FT                   thioesterase superfamily; KEGG: pha:PSHAa2571 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38785"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZA3"
FT                   /protein_id="ABG38785.1"
FT                   /translation="MSDNKSLTPEQLAEFVIEFFQSSMPFNQALGFQIETLADHEVQIR
FT                   MPWSNMLMGNPVHKILHGGATAAILDTVGSVVALMYGIKQLKPEEVEEFKNTLANNGTI
FT                   DMRVDYLRPGKGEEFIATASVIRRGRRVAVCRMELHNEKGQHIASGTGTYLVG"
FT   gene            complement(296594..297028)
FT                   /locus_tag="Patl_0254"
FT   CDS_pept        complement(296594..297028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0254"
FT                   /product="globin"
FT                   /note="PFAM: globin; KEGG: hch:HCH_01422 truncated
FT                   hemoglobin"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38786"
FT                   /db_xref="GOA:Q15ZA2"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZA2"
FT                   /protein_id="ABG38786.1"
FT                   /translation="MNAIKPLFVLFLISLAFGISACASNAQPSVYAQMGGQPKVEEVVD
FT                   NFITEIEFDPVIFEYFTDTDVDRFREKLVEHVCHLTGGHCEYTGDTMARVHAGMNITET
FT                   DFNRGVDLFINAMNKAQIPHPIQNKVLAILAKTRKEMIYL"
FT   sig_peptide     complement(296948..297028)
FT                   /locus_tag="Patl_0254"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.844 at
FT                   residue 27"
FT   gene            complement(297028..297876)
FT                   /locus_tag="Patl_0255"
FT   CDS_pept        complement(297028..297876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_01423 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38787"
FT                   /db_xref="InterPro:IPR021393"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZA1"
FT                   /protein_id="ABG38787.1"
FT                   /translation="MLHKIGFRYASAFLLYLLSNVTYSQEGKLIGTAGLVQLEGSGGGG
FT                   IVPWATLSGYDSRDEVSFSALMTQVNMDDYRLNVLGLSASFYDRVEVSVAQHRFDLKEA
FT                   GVDIKQNIYGVKYRAYGDVVYSRLPQISVGIQHKVLEDEGIANAVGANKTNEGTDFYIA
FT                   ATKVHLGALAGYNTVWNLTARATKANEMGLLGFGGANNDDYEVMLEASVGILFSRNLAV
FT                   GIEYRQKPDNLGLGEDDWKDIFITYIPSKHFSVTLAWADLGSIAGAHGQDGVYLSLNGQ
FT                   L"
FT   sig_peptide     complement(297802..297876)
FT                   /locus_tag="Patl_0255"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.927 at
FT                   residue 25"
FT   gene            complement(297866..300202)
FT                   /locus_tag="Patl_0256"
FT   CDS_pept        complement(297866..300202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0256"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: conserved
FT                   hypothetical protein EAL histidine kinase, HAMP region;
FT                   KEGG: hch:HCH_01424 predicted signal transduction protein
FT                   containing a membrane domain, an EAL and a GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38788"
FT                   /db_xref="GOA:Q15ZA0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q15ZA0"
FT                   /protein_id="ABG38788.1"
FT                   /translation="MATRKLNQSIFRLVVGLVVLTATMILINVWTSTSKHAQSQLNSDL
FT                   EVAQNVFEQVLESREDVLYNSASVLTADFGFKQAVASGDIPTINSALYNHGGRITADLM
FT                   ALVSLGGNNITSVPNILPTETPFPYSKIIQNALLNGGAAALLLIDNKLYQVMMLTIDAP
FT                   TPIAVAVIGFEIDHGWAQQLKDVTQLDTTIQVQADGENNLTISTLHSEMLEVALAEQGQ
FT                   TLSWLSLTLFNDAPFVSRQFLLEEEGDFKVMITLSNDLHRLFADFNALQLNILFIALLA
FT                   IILALCFAALFSRKVAKPLVALADTAQRISTGDYNKTIVAHSNSTEVTNLAQALESMQS
FT                   NIRHREEKISYQAQHDILTGLNNRYNMEALLCAKFKENKPFQVLGINVFGFRSINDVFG
FT                   YHNGDICLQILANRLLEHGGIGARLAGGELLWVPDEHLSQKQVVQFINSLEQPIDTGDS
FT                   SIMAKLSIGMLNCPNDATNAEELFRRINIALDETKLSDQPILAYQPEFEHRYLRRLSII
FT                   AELKTALQEQQDELSLFYQPKLDLDTGKVTKVEALIRWNNAILGFVSPEDFISVAEQAG
FT                   FIGKITDWVINQAIKDAVALRNAGIEMSIAINLSAKDVMDQALLPHISSLMEASQLSSK
FT                   ALSFEMTESDLVQEPAKAIQQLQAFRDKGFEIAIDDFGTGYSSMAYLQYLPVTTLKVDK
FT                   SFVLSLDSQQGDQKIVQTVIDLAHSFGLNVVAEGIESQATLLLLKKWGCEFAQGYYMCK
FT                   PIPFDDLITWHNTHQLTNWFEKDAT"
FT   sig_peptide     complement(300107..300202)
FT                   /locus_tag="Patl_0256"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.748) with cleavage site probability 0.598 at
FT                   residue 32"
FT   gene            complement(300203..300925)
FT                   /locus_tag="Patl_0257"
FT   CDS_pept        complement(300203..300925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0257"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pha:PSHAa0455 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38789"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR034242"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z99"
FT                   /protein_id="ABG38789.1"
FT                   /translation="MNKGRTIDTKQTRWITGFFLLMFSLVIDIASATQEIQFKVVDQMG
FT                   NPIANAVVSANGEPTDDIANIAVMDQINSQFSPHVLVIQKNQAVRFPNSDDIRHHIYSF
FT                   SEPKPFEIRLYKGEHSTPITFDKSGVVVLGCNIHDQMLGYIYVAENEVTAITDQDGIAR
FT                   LRTQATEFTFWHANLSASNSERVKKSFARENAQNNESTNRTSNRVSEMKTVTLTLLENK
FT                   KTEVKRRKFSRKFSSREQ"
FT   gene            301220..301822
FT                   /locus_tag="Patl_0258"
FT   CDS_pept        301220..301822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0258"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pha:PSHAa2575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38790"
FT                   /db_xref="GOA:Q15Z98"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z98"
FT                   /protein_id="ABG38790.1"
FT                   /translation="MLKTQWADKILDWAQLYMGSLIWTLVMLFVYVLVTKWTLPRIEKK
FT                   IDESNLKSPEVLRAYHIIRLVVGILTFAIILIAWGIDFSGLLVISTSLITLTGVAFFAS
FT                   WSLLSNITAYFLLLFQTSFRRGNFIRVLDADNYVEGFITEINLFNTKLITEDREIIVYP
FT                   NNLILTRPSIINPRAKWKTVGKFTDRPEKKMPQIRKK"
FT   gene            301976..302893
FT                   /locus_tag="Patl_0259"
FT   CDS_pept        301976..302893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0259"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   pha:PSHAa0358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38791"
FT                   /db_xref="GOA:Q15Z97"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z97"
FT                   /protein_id="ABG38791.1"
FT                   /translation="MSIDFPPVLEHLSLFLNALFSNKVVLTILLAFFILGVKYALVKTV
FT                   RNRAISKGKDKRDLVNNIKNFINFVMLFLLLSLWAGELQNFALSIAAFAVAIVLATREF
FT                   IQCVIGFFYLASTRPFRIGDWVQVGEIVGEVSETDWMKSTLLEVDIHKYEYTGKTLFIP
FT                   NNAMITNTIKNLNFLKRYATHHFNITRDQSVNPYLFIDQLQAKAELYCADFKDVAYRYS
FT                   QTIERRLDVKIAGPDPHINVSTSDVGDSVVTVAIFCPTERAIEIEQKLIKDFMTMWFAA
FT                   RRSGNVLSIQNELDEKNNIDDSAP"
FT   gene            303017..304756
FT                   /locus_tag="Patl_0260"
FT   CDS_pept        303017..304756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0260"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); KEGG: pha:PSHAa1983
FT                   outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38792"
FT                   /db_xref="GOA:Q15Z96"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z96"
FT                   /protein_id="ABG38792.1"
FT                   /translation="MFTLRTVQLSFSWLIALLVLVAPHVLAMSVDIEGADDSRLEENIE
FT                   THIGIIGAPVGCELTPNYRQTVKEAVIKAAQAIGYYQLETLSIRLSKDQECSELYLSVR
FT                   AGTRVKISQRQIELVGSEKPDTVLQGVIDKAQLKEGTFLEQSQYESLKSKLLSMAQVRG
FT                   YFDAKFTTQEIRIDFDAYSASIHLVFAAGKRYAFGKLLIPEDDKAQVLIQEVSTFKEGE
FT                   PYHADKLAEFNQNLKLTGYFQQVVARPLVSKAQGGEVPIELIASAKPRDTFNIGGGIST
FT                   DTGPSLRFKWQRPWVNSKGHSLSADAFISSPEQNISVKYKVPLEDPLNNYLSYQAGLKA
FT                   ENDNDTQSEVITLAIQRHWGEPDNDWKRIGFLRLEQEKFTQGTEDEQTTTLLLPGVTVS
FT                   RRRTRGGLDLNWGDKQQYTLEGATQEVVSDIDLVRISLQSKWLRSYGKHRLFARAELGA
FT                   IATNDFSQVPSSLRYFAGGDQSVRGFALNTLSPEEDDELTGGQYLSVASIEYSYPVATD
FT                   WRLAVFTDVGNASDKPFKDLATGVGLGASWVSPVGPIRFYFARGNSVEETTWRFHFSMG
FT                   PAL"
FT   sig_peptide     303017..303100
FT                   /locus_tag="Patl_0260"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.877 at
FT                   residue 28"
FT   gene            304753..308532
FT                   /locus_tag="Patl_0261"
FT   CDS_pept        304753..308532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0261"
FT                   /product="protein of unknown function DUF490"
FT                   /note="PFAM: protein of unknown function DUF490; KEGG:
FT                   vvu:VV10711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38793"
FT                   /db_xref="GOA:Q15Z95"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z95"
FT                   /protein_id="ABG38793.1"
FT                   /translation="MRLLKYLGIFLCVLVLLIAVIASPWGTRGVLSIADSSVDGLDIDY
FT                   DSGSLLSELSLKRLVFSTPDLSLQIKKLAVDVNWSCVATMQACLSELRAQSIGVNVTPS
FT                   ESSEPESTEPLGRITLPLPVSVDHLDVRNIRIDVVNTVGVTIRSVSSELSMFRTLHIDH
FT                   LAVNGIRVELPEASPEAKSTDNQLLDLQTIANWQYTPITLPAIVFPIVMRGNNLALDDL
FT                   VVSQGKASLIDITKLRATINITPKLLTVKKLQLSSSLGEADLTATLGKQWQHQATLLFN
FT                   TTTNSPYPMNAKLNLKGNLQHSELKLNTTGLVDLTASASADLQSKQLPLALEVNWQPVE
FT                   WPIKQPQLLIEEGQLTLSGDINQYKLALDTALKGASVPQSTLTVRAAGNNRQVQLTRLA
FT                   IDTLGGQIQASGNATLDTLAKWQSQLQFTDIQPQRFWPKLDANIQGELSLDGQYDGQNI
FT                   LAQMRDLVASGKWLDYQLSASGEANFDSQEGLEIPELLVKTGDNQITLVGSLEAFEDVQ
FT                   AQLTVDAQDLSQLYPSFAGRAKFEAQIDGTISAPEANFSGSADNIDIPDMRIAQLATKG
FT                   QVIWDAQKQANIELQLSNSVISQQRIANLNVALNGDAQDHQLSLSLNSNMADVVTKLHG
FT                   SLLDSHWDGALDVLTFASDAGQFGLEDEGPSISANWATDEYRVAPLCLSDNDARVCIRL
FT                   AEYAATGAQFDLAIDDLPLAPLLSANLAQLQKIDTDAKVNLVAKGDWDTKKLPIIEANI
FT                   SLTPSTWTVEGASTPLELDVLDMRVNTIVDKVDAKTAGKNDPPQHVVTQLTLQSKQLGE
FT                   VHSNVDLQLNDQDKPLSGQLTLSNITLGAAAQFVPQLTELAGRIDGQIELGGNLTAPLI
FT                   KGEVTLVEGALAGSMLPSRIHQVEQVITFTGQAATLSGPFQLGNGEGQIDGEFSWQDTP
FT                   SATVNVKGDEMEIDYQNIVRAKLSPDINVQFGEAGLSVKGEVTLPYARIKVRELPPSAL
FT                   SPSSDVVLVNHEQVAKENSLPLDLSLQINIDPDKNNDVKVDAFGLTSDLEGALLLTQAG
FT                   EVLNANGELNLVNGRYQAYGQDLVIREGEIQFSGPIDSPYLAVEAIRDPNKTADDVIAG
FT                   LRIQGSASEPQVSVFSDPSMEQPEALSYLLRGTAINSTDESSSDGALASALIGFGLGKS
FT                   ENKVTNIGRKLGVEDLALNTSGTGDETKLSVSGYIAPGVQIRYGVGVFDSVSEVALRYQ
FT                   LLPKLYLEAVSSLNSELNLYYQFTLDDKEESKPE"
FT   sig_peptide     304753..304821
FT                   /locus_tag="Patl_0261"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.734 at
FT                   residue 23"
FT   gene            308799..310136
FT                   /locus_tag="Patl_0262"
FT   CDS_pept        308799..310136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0262"
FT                   /product="MgtE intracellular region"
FT                   /note="PFAM: CBS domain containing protein MgtE integral
FT                   membrane region MgtE intracellular region; KEGG:
FT                   pha:PSHAa0712 magnesium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38794"
FT                   /db_xref="GOA:Q15Z94"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z94"
FT                   /protein_id="ABG38794.1"
FT                   /translation="MAELLPELIEEVVSAPERGEQDNVVALVAAQDTDDVALLLESLPL
FT                   EQRLKVWEGIPKRRRLDVLVAMRGDPRETLIAATDVSEWEAIFFEVDAEQLLELSDSLP
FT                   NALVDKALDAMDKQQRQYFTDASQFSDDEIGHWLSQDPLVLPLNAKVRDALRLIRRDVP
FT                   THADTIFLVNRAGQFSEAVKLTNVMGLPEHVPLVDLSEEVFDTINASDELTTASLMVQR
FT                   SGFASLPVVDEQNKVLGRLDISTASELLNEFYERQIMATAGMDEDEDLFSSVPKSAKNR
FT                   AVWLGINLLTAFLASGFIGMFEATLQQVVALAVLMPIVASMGGIAGSQTLTLMIRGLAL
FT                   GQVTGSNVKALLKKELSVGGLNGVVWALVIGCIAYFWFSDAMLGLVICLAILLNIIAAA
FT                   AAGVVVPMVLNKFNIDPALSGSVILTTVTDIVGFVAFLGLGTLFLL"
FT   gene            310347..310526
FT                   /locus_tag="Patl_0263"
FT   CDS_pept        310347..310526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0263"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328; KEGG:
FT                   rru:Rru_A0119 protein of unknown function DUF1328"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38795"
FT                   /db_xref="GOA:Q15Z93"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15Z93"
FT                   /protein_id="ABG38795.1"
FT                   /translation="MCMLTWALTFFVLGVIAAVFGFGGVIGVAASIAKVIFLLCVAFVV
FT                   LFSVLAFKQHKRHK"
FT   sig_peptide     310347..310436
FT                   /locus_tag="Patl_0263"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.946) with cleavage site probability 0.413 at
FT                   residue 30"
FT   gene            310695..311258
FT                   /locus_tag="Patl_0264"
FT   CDS_pept        310695..311258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0264"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; KEGG: vpa:VP0081
FT                   putative hyperosmotically inducible periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38796"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z92"
FT                   /protein_id="ABG38796.1"
FT                   /translation="MCEAAMKKILQSITLIAIFSTASVGASAGNYWKASALDGWIDGYV
FT                   EATLLLNGNLDATGIDTDVDNGSVTLRGKVETDLDKALAQELVIGVEGVTGVENMLTVF
FT                   SPGKNEDSEVQAKLTDNKVATVVKTRLLAAPDISSTEIDVNSTKGVVVLQGQVKNDAEK
FT                   QRAVDIAQEAIDVEKVVSKLKVSE"
FT   sig_peptide     310695..310781
FT                   /locus_tag="Patl_0264"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.892 at
FT                   residue 29"
FT   gene            311580..312512
FT                   /locus_tag="Patl_0265"
FT   CDS_pept        311580..312512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0265"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: conserved
FT                   hypothetical protein response regulator receiver; KEGG:
FT                   hch:HCH_00862 response regulator containing a CheY-like
FT                   receiver domain and a GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38797"
FT                   /db_xref="GOA:Q15Z91"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z91"
FT                   /protein_id="ABG38797.1"
FT                   /translation="MQNPESANVLKQTLLVVDNPGEMLKALTRQFSTSFHLLVCNDNEE
FT                   VLKLALNAPIDLVLIRVSPRDSDWLLICTRLKQHPLTIDIPLILYGKDTPKSLILSGLE
FT                   AGALDFVELPTDIAMLNIKIRNHMQVSAKLRTLALISCTDGLTGVPNRMQLDTTYNRFW
FT                   YAAIRGQHELSVLMIDIDFFKGFNDTYGHVAGDECLKKVATTIEASLQRESDAMGRYGG
FT                   EEFLVLLPFTDKVGAQKIAEMILRNIEALDIKNKASTVNGKVTVSVGAATLKLHDINDH
FT                   TFNHPEFLVEQADRCLYQAKKQGRNRLVS"
FT   gene            complement(312664..313947)
FT                   /locus_tag="Patl_0266"
FT   CDS_pept        complement(312664..313947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0266"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: vpa:VP2898 phosphoribosylamine-glycine ligase;
FT                   TIGRFAM: phosphoribosylamine--glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase protein of unknown
FT                   function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38798"
FT                   /db_xref="GOA:Q15Z90"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z90"
FT                   /protein_id="ABG38798.1"
FT                   /translation="MKVLIIGGGGREHALAYKAAQSNGVSQVYVAPGNAGTALEPKLEN
FT                   VAIDVEDISALVTFAKQNAIALTIVGPEVPLVLGVVDAFQAEGLAIFGPSKAAAQLEGS
FT                   KAFTKDFLARHKIPTAEYQNFTEIEPALAYLQQTGAPIVIKADGLAAGKGVIVAMTLDE
FT                   AEDAVRDMLAGNAFGEAGSRVVIEEFLDGEEASFIVMVDGKNVLPFATSQDHKRVGNGD
FT                   TGPNTGGMGAYSPAPVVTDEIHRRVMDEVIYPTVQGMASEGNDYHGFLYAGLMIMADGT
FT                   PKVIEYNCRFGDPETQPIMMRLQSDLVELVQLAVDGKLDQATAKFDPRAAVGVVLAAGG
FT                   YPQAYKKGDVISGLNQNESDVAKVFHAGTKDVNGNVTTNGGRVLCATALGESVTEAQQR
FT                   AYELAKSISWNGMFYRDDIAYRAIAREQ"
FT   gene            complement(314049..314855)
FT                   /locus_tag="Patl_0267"
FT   CDS_pept        complement(314049..314855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0267"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pha:PSHAa0344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38799"
FT                   /db_xref="InterPro:IPR016980"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z89"
FT                   /protein_id="ABG38799.1"
FT                   /translation="MFKRATQLVCSITFLASSFAQADALIDALADEGRPTEQRLRDEYR
FT                   HPQQTLRFFEVQEDMAVAEISPGGGWYSNILAPLLKEKGQFYAAHFYVDENTNEFYKKS
FT                   REQFEQKITALKSYQNVKVTTFHPMKATDFAPAESLDRVLTFRNIHNWYMQDGDEGVEN
FT                   AFKAFYKALKVGGVLGVVEHSLRESQSSALQQSSGYMKQSYVIALAEKAGFTLAGKSEI
FT                   NANKLDSGEHEKGVWTLPPSLRLGEKDEGKYLKIGESNRMTLKFVK"
FT   sig_peptide     complement(314787..314855)
FT                   /locus_tag="Patl_0267"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 23"
FT   gene            complement(315013..316635)
FT                   /locus_tag="Patl_0268"
FT   CDS_pept        complement(315013..316635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0268"
FT                   /product="IMP cyclohydrolase /
FT                   phosphoribosylaminoimidazolecarboxamide formyltransferase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="KEGG: vpa:VP2896
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM:
FT                   AICARFT/IMPCHase bienzyme MGS-like"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38800"
FT                   /db_xref="GOA:Q15Z88"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z88"
FT                   /protein_id="ABG38800.1"
FT                   /translation="MTTQKPIRRALLSVSDKTGIVEFATFLAEQGVELLSTGGTAKLLA
FT                   DHGLTVIEASAYTGHPEIMDGRVKTLHPKIHGGILARRGQDEAVMAENNIQPIDLVVVN
FT                   LYPFAATVANDDCSLEDAIENIDIGGPTMVRAAAKNHNDVTIVVNAKDYARVSEQMLAN
FT                   NGSVTANTRFDLAIAAFEHTAEYDGMIANYFGTMIESDSCTDECSDACADDCGHVHSAF
FT                   PRTFNVQMSKKQDLRYGENSHQDAAFYVENNVQEASVSTATQLQGKELSFNNIADTDSA
FT                   LECVKEFAEPACVIVKHANPCGVALGENILEAYNRAYQTDPTSAFGGIIAFNRELDGPT
FT                   AQAIVDRQFVEVIIAPSVNDEAVAIVAAKKNVRLLACGDWQGQLTDGYDFKRVNGGLLV
FT                   QERDFGMVDMEDLTVVTKVQPTEQQLKDLMFTWKVAKYVKSNAIVYCKNSMTIGVGAGQ
FT                   MSRVYSAKIAGIKAADEGLQVEGSVMASDAFFPFRDGIDAAAAAGISAVIQPGGSMRDN
FT                   EVIAAADEHGIAMVFTGMRHFRH"
FT   gene            complement(316735..317028)
FT                   /locus_tag="Patl_0269"
FT   CDS_pept        complement(316735..317028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0269"
FT                   /product="helix-turn-helix, Fis-type"
FT                   /note="PFAM: helix-turn-helix, Fis-type; KEGG:
FT                   pha:PSHAa0346 DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38801"
FT                   /db_xref="GOA:Q15Z87"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z87"
FT                   /protein_id="ABG38801.1"
FT                   /translation="MFEQNVTSPFTTTVTTPSQTQAQKPLRDSVKQAVNKYLKQLDNTD
FT                   IENLYELVMAEVEAPMLEEIMTFTRGNQTRASIMLGINRGTLRKKLKQYGMN"
FT   gene            complement(317058..318059)
FT                   /locus_tag="Patl_0270"
FT   CDS_pept        complement(317058..318059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0270"
FT                   /product="tRNA-U20-dihydrouridine synthase"
FT                   /note="TIGRFAM: putative TIM-barrel protein, nifR3 family;
FT                   PFAM: dihydrouridine synthase, DuS; KEGG: pha:PSHAa0347
FT                   tRNA-dihydrouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38802"
FT                   /db_xref="GOA:Q15Z86"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z86"
FT                   /protein_id="ABG38802.1"
FT                   /translation="MQIGPYKLENNLILAPMAGVTDRPFRQLCKRMGAGLVVSEMLSSN
FT                   PDVWRSSKSKQRMDHVGEKGIRAVQIAGADPLLMAQAAQFNVDNGAQIVDINMGCPAKK
FT                   VNKKLAGSALLQDPQLVERIVQSVVEAVQVPVTLKIRTGWNTDNRNGVQIAKIAEQNGI
FT                   QSLAVHGRTRACMYKGNAEYDTIKAIKQAVSIPVVANGDITCVHSAKHVLEYTNADALM
FT                   IGRGAQGNPWIFRQIQHFLQTGEILPSPPLGEVRDVLLAHVANVHQFYGEFKGARIARK
FT                   HVGWYLAEHDRERQFRARFNAIDDAAEQLDSLAHYFDHLAGEPTTHLVSPAA"
FT   gene            complement(318371..318676)
FT                   /locus_tag="Patl_0271"
FT   CDS_pept        complement(318371..318676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pha:PSHAa1272 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38803"
FT                   /db_xref="GOA:Q15Z85"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z85"
FT                   /protein_id="ABG38803.1"
FT                   /translation="MSKKYQSFADFYPYYLSEHQDTVCRRLHFVGSSLIIFTIIYAVLN
FT                   AQFALLWLIPVLGYGFAWVGHFFYEHNRPATFTYPFYSFLGDWVMFKDMLTGKIKF"
FT   gene            318844..319689
FT                   /locus_tag="Patl_0272"
FT   CDS_pept        318844..319689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0272"
FT                   /product="Thioredoxin domain"
FT                   /note="PFAM: Thioredoxin domain; KEGG: ilo:IL1994
FT                   thioredoxin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38804"
FT                   /db_xref="GOA:Q15Z84"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z84"
FT                   /protein_id="ABG38804.1"
FT                   /translation="MQNSVDITIENFQQVILQESATKLVMVEFWAQGYEPSEQLAPVLQ
FT                   AIASKQGENLLHARVDCQAQPDITAQFGVQNLPTVMLIKDGQPVDGFAGVESEANIQAM
FT                   LDKHLPKPQDELFAQATAMAEQANYQEAFTLVKQAFDLDPNRADIKLLLADCQVEVGQV
FT                   NQAKELLATIGLVDQDGYYRAILGKIELAEQAAESPEIIALQQALESDPDNLDLKVKLA
FT                   VQLRQANQIEEALGLMHSVLLKDLNFQDAKKLMLDMINALPDGEPLKSQYRRKVYSLLY
FT                   "
FT   gene            complement(319825..320709)
FT                   /locus_tag="Patl_0273"
FT   CDS_pept        complement(319825..320709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0273"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR LysR,
FT                   substrate-binding; KEGG: pha:PSHAa1830 transcriptional
FT                   regulator with periplasmic binding protein domain (LysR)"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38805"
FT                   /db_xref="GOA:Q15Z83"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z83"
FT                   /protein_id="ABG38805.1"
FT                   /translation="MYTINELETFIAIVENKGVVSAASALNISPATVSHRLSKLERILG
FT                   TVLIFRDSRNVRPSAEGEEFYQRVGDILAALYDAEFAIGARDSAISGRLRVTLPPWIFS
FT                   IYILPNLVKFEQQYPDVILDFLVTDQFVNVVDDAQDVAIRVGTLANSGLLARKIVNNKR
FT                   ILCASPHYLAQHPPISDVQALTEHRFVALPWQKQLKLLHNDGSVFALNTKTRFTISNSD
FT                   NMTQALRAGHGIGIKSEIAIKRCIQEGKLVEVLPNVLASPEAPVWFLRPQNSLATRKAE
FT                   AFFEFVKQAFSQC"
FT   gene            320842..321492
FT                   /locus_tag="Patl_0274"
FT   CDS_pept        320842..321492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0274"
FT                   /product="Redoxin"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen Redoxin; KEGG: pha:PSHAa1831
FT                   AhpC-TSA"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38806"
FT                   /db_xref="GOA:Q15Z82"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z82"
FT                   /protein_id="ABG38806.1"
FT                   /translation="MSLQAQIAEYEKQKNATAPKDVLNVMALATSDLMATDISSDALQV
FT                   GDYAPDFSLPNVHGKLVTLAEMLAHGPVVLNFYRGGWCPYCNYELRAFEEVLERIEDLG
FT                   AQLVAVSPETPDNSLTTKDKNELSYAVLSDVGNNVTNDYGLVFSLDERLRPIYSHSGVD
FT                   LPAFNGDDTFNLPMPATYVINQSGQIVYAFVSEDYTKRSEPSEVLKILTTLDN"
FT   gene            321604..322287
FT                   /locus_tag="Patl_0275"
FT   CDS_pept        321604..322287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0275"
FT                   /product="haloacid dehalogenase, type II"
FT                   /note="TIGRFAM: haloacid dehalogenase, type II
FT                   HAD-superfamily hydrolase, subfamily IA, variant 2
FT                   (HAD-like) HAD-superfamily hydrolase, subfamily IA, variant
FT                   3; PFAM: Haloacid dehalogenase-like hydrolase; KEGG:
FT                   pha:PSHAa1832 cryptic haloacid dehalogenase 1 (partial)"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38807"
FT                   /db_xref="GOA:Q15Z81"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z81"
FT                   /protein_id="ABG38807.1"
FT                   /translation="MAHAAPKPKVIIFDVNETLLDLETMRTSVGKALDGQEELTTLWFS
FT                   TMLHHSLVTTVTGDYQDFGKIGVAALMMVAQNNNIDITEEQAVTAIKTPLLSLPAHPDV
FT                   KAGLTALKAQGFKIVSLTNSSNKGVETQFKNAGLTDYFDKRMSIEDIKVYKPDLRSYAW
FT                   ALEQLNIKPEEALMVAAHGWDVAGAKAAGLQTAFVARPGKALYPLAQEPDYIVKDLSEL
FT                   VEILK"
FT   gene            322466..323392
FT                   /locus_tag="Patl_0276"
FT   CDS_pept        322466..323392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0276"
FT                   /product="esterase/lipase/thioesterase family protein"
FT                   /note="KEGG: psb:Psyr_4383 esterase/lipase/thioesterase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38808"
FT                   /db_xref="GOA:Q15Z80"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z80"
FT                   /protein_id="ABG38808.1"
FT                   /translation="MRKIFVMLLVVVVGLLLWLGVCLLQDSRSTGLAIFNNTLKLIDPI
FT                   TVNHDIAFGDEPWQTLDVYPSDNSHPVAPVIVFIHGGGWNWGNKSMYYFVAHAFVARGY
FT                   TVVIPDYIKYPEGHFPQFIEDGAKTLAWVKENISRYNGNPQQIYLAGHSAGAHTGALLM
FT                   TDKHYLTDVGITVGDISGFAGIAGPYAFTPDSPEYIATFGEENFHTMKATSHVDGDEPP
FT                   MLLLHAMGDNAVGEFNQQQLAQALRDANRPVQTRLYGEEINHINILLKLHPWFAGSVDT
FT                   GHDLDEFFQLLSAQQFNELRPTHQGAN"
FT   sig_peptide     322466..322540
FT                   /locus_tag="Patl_0276"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.892) with cleavage site probability 0.739 at
FT                   residue 25"
FT   gene            323423..324010
FT                   /locus_tag="Patl_0277"
FT   CDS_pept        323423..324010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0277"
FT                   /product="pentapeptide repeat"
FT                   /note="PFAM: pentapeptide repeat; KEGG: son:SO4064 mcbg
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38809"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z79"
FT                   /protein_id="ABG38809.1"
FT                   /translation="MGIEYYDDEIGHQHPLASEACWESIRFEQCRFEKLDLREGQWRFC
FT                   VFDECEFVDCDLSLLALNNSQFHSAIFIRCKLLAVDWTQADWTSHLGNPPKFKDCILNS
FT                   GSFFGLALGAIQLIDCKVHDVDFTQASLRKARFVGSELDQSRFHNTTLTSADFTQAQGY
FT                   QIDLRQNRVDKARFSRVEALGLLAALGIELVD"
FT   gene            324848..325192
FT                   /locus_tag="Patl_0278"
FT   CDS_pept        324848..325192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38810"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z78"
FT                   /protein_id="ABG38810.1"
FT                   /translation="MKTLLSLTTVITLAAGGFLLNAQADESVSTQNSAAMSVMPVELQQ
FT                   LEAKLTGMQYDLSDRNTKLRVQRAAYYFGIARKHADSGWSKMAVEQATRGLSLLELSNM
FT                   QYLQSVNVQM"
FT   sig_peptide     324848..324922
FT                   /locus_tag="Patl_0278"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.971 at
FT                   residue 25"
FT   gene            325456..326493
FT                   /locus_tag="Patl_0279"
FT   CDS_pept        325456..326493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0279"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: son:SO1583 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38811"
FT                   /db_xref="GOA:Q15Z77"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z77"
FT                   /protein_id="ABG38811.1"
FT                   /translation="MHLRSRYLMIIMCFITTLANAARSPFELAGNSIPAGEQRSFFANV
FT                   TDTDMQVPITVFHGVDSGPVLTFSAGTHGDEFPAITALQRLRSEVDPAVLKGTLILVHA
FT                   ANLPALHQYGLSALHPNDKKNLNREFPGNAKGSDTERLAHFLTEEIIGSSDYLADLHSG
FT                   SAYQQLWPHIYAPFVGDNALDARTLAWAKASGMRHIILYGDRPRDPANSISYPNTAMTR
FT                   GKPGLTLEIGDRGHNEEVDVLAYLDALRRLIAGIDMLPSTLPASEGQTIYEQLVEVETP
FT                   VKGFFESKCEIGEFVQQGALLGIVRDYFGEPIAELRAPNRGVVLMLQNAPPANKGAALI
FT                   TIGVQ"
FT   sig_peptide     325456..325521
FT                   /locus_tag="Patl_0279"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.985 at
FT                   residue 22"
FT   gene            326636..327058
FT                   /locus_tag="Patl_0280"
FT   CDS_pept        326636..327058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dps:DP1414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38812"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z76"
FT                   /protein_id="ABG38812.1"
FT                   /translation="MINTKIYKAVYGLSEKLMTAANKNDQKAFDRLYDELKALCLEHQN
FT                   TNKDHPEQWETLADFTEDLSDAVLIYQKALDKATAINSKDHMSSIAYSMAKLQIELNRT
FT                   GEAIKNLQAAKISANKIEDKELKAEIDELLTSSLIA"
FT   gene            327084..327299
FT                   /locus_tag="Patl_0281"
FT   CDS_pept        327084..327299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0281"
FT                   /product="tryptophan-rich Ignore"
FT                   /note="TIGRFAM: tryptophan-rich Ignore; KEGG: ilo:IL0283
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38813"
FT                   /db_xref="InterPro:IPR012663"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z75"
FT                   /protein_id="ABG38813.1"
FT                   /translation="MHQINPKKLLNSKWTAVRPQNKEKHFIVSEVEFDEEGAVLICCIE
FT                   AVMTKRATSIDWQELKNSGQWQQGWK"
FT   gene            327666..329345
FT                   /locus_tag="Patl_0282"
FT   CDS_pept        327666..329345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0282"
FT                   /product="toxin secretion ABC transporter ATP-binding
FT                   protein"
FT                   /note="KEGG: xac:XAC1528 toxin secretion ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38814"
FT                   /db_xref="GOA:Q15Z74"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z74"
FT                   /protein_id="ABG38814.1"
FT                   /translation="MSSKNIDLVNLRQTLFALLKPERSFFAVVIAYSVVIGLLTLAVPI
FT                   AVQTLINTIANIASTRAVITLAIVLFSTLLLSGCFAALRMRVMEYYERRIYARLVADLS
FT                   LRTILAPHSYFEGSQNTSITHRYFDIMTLQKNVPSLMVDGIALILQMIVGFTLVSFYHP
FT                   FLLAFNLCVILIMYAIWRLWSTQAKVTAVRLSESKYTTAKWLSNLASANDFLKSSSQFD
FT                   YAGKKTERYVSEYVDNHSRHFSFTFKQVVMFLVLYALASSALLGLGGWLVIIGQLSIGQ
FT                   LVAAELIMAAVFLGLSNFSHYLKLYYELYGTADKIGGAINIPQEALEQTSKPAPAGGAL
FT                   DFNKVIIKRKSESCLIDKQIAQGDKYFVSTQTNWTQRSIVNLLKRYEVPSSGWINLDNS
FT                   DLSDYDTYDLRQAVFVLDRSLIIECTIEEYIHMCVPDVTTSEINATIERVGLADVISSL
FT                   PLKLKTPISSVGTPLQPLEFILLKLVVVMLSKPKVLVINQHFDAIPTIRRERILGVIER
FT                   TDLTVLYFSNAPTPAFFNGIIELESKKEPQPNVNTSQEAEHE"
FT   gene            329338..330366
FT                   /locus_tag="Patl_0283"
FT   CDS_pept        329338..330366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0283"
FT                   /product="membrane fusion protein"
FT                   /note="KEGG: xcv:XCV1570 membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38815"
FT                   /db_xref="GOA:Q15Z73"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z73"
FT                   /protein_id="ABG38815.1"
FT                   /translation="MSNAHTDFMGAMKTLKSLKVPKTHTTIIWLVVTLVIAAVLLLTFT
FT                   PWVQTAYGTGSVNSPDPLYRIQPISALLNGQIETWHVREGDNVKKGEPIVTLVDVDSDR
FT                   LEKLRSQQVAANQRYVSNKLSVQNALSNLSRQKKLLKEGLVSQKEVEAVEIALEKLKAE
FT                   ASKTEEDLDTLKMTLARQETRTKYAPMDGTVVRLQSGGSATYVTAGSILGWFVPANIER
FT                   QISIKINGLDAALATKGKKVRIQFEGWPTFQFSGWPGMSVGTFEGVVSFVEPVADQFGM
FT                   FTVWIAPVNTTVAWPEHESARLGSRVRAWILLEEVRLGYELWRQLNNFPPVRSRETSES
FT                   ST"
FT   sig_peptide     329338..329484
FT                   /locus_tag="Patl_0283"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.837) with cleavage site probability 0.462 at
FT                   residue 49"
FT   gene            330366..331781
FT                   /locus_tag="Patl_0284"
FT   CDS_pept        330366..331781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0284"
FT                   /product="Outer membrane protein-like protein"
FT                   /note="KEGG: xcv:XCV1569 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38816"
FT                   /db_xref="GOA:Q15Z72"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z72"
FT                   /protein_id="ABG38816.1"
FT                   /translation="MYGVLISALVLLGFSASSAAFTLQQYLSSVANNHPEILAIDATTG
FT                   QYGADIQYADGAYDAKLEHNSFSRVAGYYDGLQASQKFSKPLEAYNAEIFSEYRISDGD
FT                   FPVYEQEYATLSGGEASLGVKLSLLQGRDTDKKRTAMASARLKYKMWSEEAKLAQSEFY
FT                   YSAILAYLDWVEAVSYFNKIEQLVAVSVNRQEGIKTRVAEGDVAEFELLEFETRLLERQ
FT                   SSLLAAERKVRANMQKLRYYMHSGEAFDEQSQAPKSAAKITWPASFNLAVKSSDVDNHP
FT                   ALAAKALEMQALKQKMRLAQVALLPKLDIEAKVARDIGSGPTSLQDTEAKIGLYFSVPF
FT                   DRTQAKAKKSRTQYEIYALESKTNALRQSIDAKRQERLVNLSYAKRLHDMQTKQVVLSR
FT                   KLFEQEQRQFEFGSSDFFMLNNREADAFQAELKALTTRINVFREELALLKINAVLDHPF
FT                   IQKTLRAHTLSIR"
FT   sig_peptide     330366..330428
FT                   /locus_tag="Patl_0284"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.771 at
FT                   residue 21"
FT   gene            complement(331820..332266)
FT                   /locus_tag="Patl_0285"
FT   CDS_pept        complement(331820..332266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38817"
FT                   /db_xref="GOA:Q15Z71"
FT                   /db_xref="InterPro:IPR021529"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z71"
FT                   /protein_id="ABG38817.1"
FT                   /translation="MHKTLKKILLVAAMVTLVGGTFTGIMTYSNIGFSDDFSRQWTFSF
FT                   MQAVCVIFPMGVLIMWTMHKVVEAFFGRLSSLHKNLIFGFGMALSMEAVMALSTTYRNI
FT                   GLGDWQQFSQAFLASYLMVLPVALVLSPIMTLLIKPKMEAFLAS"
FT   sig_peptide     complement(332162..332266)
FT                   /locus_tag="Patl_0285"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.540 at
FT                   residue 35"
FT   gene            complement(332361..333713)
FT                   /locus_tag="Patl_0286"
FT   CDS_pept        complement(332361..333713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0286"
FT                   /product="glutamate dehydrogenase (NADP)"
FT                   /EC_number="1.4.1.4"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase, C terminal
FT                   Glu/Leu/Phe/Val dehydrogenase, dimerisation region; KEGG:
FT                   pha:PSHAa1392 glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38818"
FT                   /db_xref="GOA:Q15Z70"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z70"
FT                   /protein_id="ABG38818.1"
FT                   /translation="MTYIQQTITDLKLSTPAQSEFYQAVEEVLHSLEPLLEKNQYYQQQ
FT                   AIIQRIVEPERQIMFRVPWVDDNGDIQVNKGYRVEFNSALGPYKGGLRFHPTVNAGIIK
FT                   FLGFEQIFKNALTGLPIGGAKGGSNFDPKGRSDAEIMRFCQSFMSELYRHIGPTCDVPA
FT                   GDIGVGAREIGYLFGQYKRLTGRYEGVMTGKSLLWGGSLVRKEATGFGAVYFADYMLEE
FT                   RGDNLQGKRCLVSGAGNVAIYAMEKLYQLGATPISCSDSSGTLFHDSGIDLKLIKRLKE
FT                   GRRCDLLEYLKTYPEAQHTAVTDYPLDGHAVWRYQADAAFPCATQNELTLQDAQALIEN
FT                   GCQLVSEGANMPSTNDAVDIFLNAGIAYGPSKAANAGGVATSQLEMAQNASMQTWRFEQ
FT                   VDQRLKQIMKNIFIAASETAKEFGEDGNLVLGANIAGFRRVADAMIEQGVI"
FT   gene            complement(333758..334144)
FT                   /locus_tag="Patl_0287"
FT   CDS_pept        complement(333758..334144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0287"
FT                   /product="GreA/GreB family elongation factor"
FT                   /note="PFAM: transcription elongation factor GreA/GreB
FT                   region; KEGG: ilo:IL0629 transcription elongation factor
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38819"
FT                   /db_xref="GOA:Q15Z69"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z69"
FT                   /protein_id="ABG38819.1"
FT                   /translation="MEKQPDIIISTADLAELEYQLERSKLPDDAIRAIENELDRATIVA
FT                   CKDLPENVVAIGSQVTFKILDSQKVFTKALCLPHDSVKFEDSISVFAPIGSALIGLSTG
FT                   QCIKWQTQRGQQSVEIIKVESRKR"
FT   gene            complement(334620..335567)
FT                   /locus_tag="Patl_0288"
FT   CDS_pept        complement(334620..335567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38820"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z68"
FT                   /protein_id="ABG38820.1"
FT                   /translation="MFSLTTKHLASMLVIASVATSVGCNTRGDSNVHTAQKAMETSPTL
FT                   VTLTHGVDESAGELPAYIVKIANATFYLEKQGGGLSSLLDADGVDWIGFNNIEGTGWKG
FT                   EYRGFPNAVHKQDGSYFHAMNAGTDPSTSKVTIETAEHVQIVFTSSNAKWQGQWDFYPD
FT                   RCDFTMTKVSEGYHYWVQYEGVPGGLMNESDFWYNSADDQPHPINESFKGDLPTPEWFA
FT                   FGDEKSPRMLYLLHHEDEVQPGHKQADKMQLKDKPLEDSHSDDYVSRPYMTVLGFGRSN
FT                   KDKFLNTPQRFSIGFVESTHYADLDEAVKNLVAK"
FT   sig_peptide     complement(335496..335567)
FT                   /locus_tag="Patl_0288"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.549 at
FT                   residue 24"
FT   gene            complement(335571..337343)
FT                   /locus_tag="Patl_0289"
FT   CDS_pept        complement(335571..337343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0289"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: vpa:VPA0087
FT                   putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38821"
FT                   /db_xref="GOA:Q15Z67"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z67"
FT                   /protein_id="ABG38821.1"
FT                   /translation="MFYEYLVIAGYFLLILGIGFAFKNMAKNSTSDYFRGGGRMLWWMV
FT                   GSTAFMAQFSAWTFTGAAGKAFTDGFAISLVFFANTIAYFCGWAYFSARFRQMRVDTPT
FT                   EGIKRRFGSQNEQFFSWALIVFSFINAGVWLNALGVFASAVFEADITLTIIVTGLTVVF
FT                   VSVLSGAWGVVASDFVQTLIVAVISVACAIVALVMVGGPVELVENFPTDFVMGPDMNYG
FT                   VILVGTFIFFLAKQMITIMNMHDAFRFLNAKDSDNARKAALLAMVLMGIGSIVWFIPPW
FT                   ASAILYPDAAASYPELGNKAADAVYLVFTRNAMPMGTVGLLLAGLFAATMSSMDSALNK
FT                   NAGIFVRSIYQPFLLKKKKNVGDKQLLTVSRWVSFISGILVIVVALFFKSLKELSLFEL
FT                   MMSVSVMVQVPLLVPLIFGLFVRKTPNWAPWVTVIIGMLVSYLTANVFTPQVFANWIGL
FT                   EQAFTRRESIDVNLMITIAAHLVITAGFFCSTSFFYQEERDEHKEGTDRFFTDLETPVI
FT                   ADFEQDEYDKQQRHKLGSMVMFMGGGMVVMMLIPNPMWGRMVFGLCAITILVMGYLLRN
FT                   SAKPKRDSLQAEKG"
FT   gene            complement(337355..338494)
FT                   /locus_tag="Patl_0290"
FT   CDS_pept        complement(337355..338494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0290"
FT                   /product="oxidoreductase-like protein"
FT                   /note="PFAM: oxidoreductase-like; KEGG: bcl:ABC0577
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38822"
FT                   /db_xref="GOA:Q15Z66"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z66"
FT                   /protein_id="ABG38822.1"
FT                   /translation="MSKSIKVLIQGTGFAGQGHADAFRSVGAEVVGIVGRTQSVVEQVA
FT                   KDMDIPFAGTNWQEALAECKPDVVSIATPGGAHEEAITQAIEFGCHVFSDKPLTATGES
FT                   AKKLHELALEKNVKTAFAASFRYMPDVIYAKRIVAAGAIGEPLEVECISHFNLERDIPF
FT                   GWSHRKEDGGGRLNNNFTHKLSIVTSIIGEKILSVMGEVRDDLGRAPIVEGVHNFKKRR
FT                   DYIPDDLNDPALKWGESNVEWSYTVLAKLESALAEKPVSVLFKHGGLHPRFNEDHIVIY
FT                   GSKGAIYIKGHYGSGPLYFYDCNNHWTRLPLPDDIVENTPQGEGDTERNWRYLIRELVK
FT                   DIRGEKVLPYQTFKEGAQYQQLIDIIRKNDNWVDVSHLQ"
FT   gene            complement(338546..339817)
FT                   /locus_tag="Patl_0291"
FT   CDS_pept        complement(338546..339817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0291"
FT                   /product="D-mannonate dehydratase"
FT                   /EC_number="4.2.1.8"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   enzyme-like; KEGG: rspA; starvation sensing protein RspA"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38823"
FT                   /db_xref="GOA:Q15Z65"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034589"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z65"
FT                   /protein_id="ABG38823.1"
FT                   /translation="MWGKSLAAHAKMMIRGCQLKITQVKVFVCSPGRNFVTVKVITDEG
FT                   IFGLGDATLNGREMAVVAYLEEHVAPCLVGRNAHDIEDIWQYLYRGVYWRKGAVNMAAI
FT                   AAIDMALWDIKGKAANMPVYQLLGGRSRRGVTLYAHASGETIDDTLDKTAEHIAQGFKA
FT                   VRLQCAVPGLNVTYGVLGDKADYFELQGSRPLPPEEDWSTQKYFNMVVDLFKQARERFG
FT                   NDVHLLHDVHSRLTPIESARLGKLLEPYNLLFLEDASIAENQDSYKIIRQHTTTPLAIG
FT                   ETYNTIWDCKDLIQNQLIDYIRVAATHAGGITPLRRIADFASIYNVKTAPHGAPDLSPV
FT                   CFAAHMHLNLWAPNFGIQEFVGFGNAHSRRIFKHTVEVKDGLANVSEAPGLGIDFDEQA
FT                   AKEYPYKRSYLPVSRLEDGTVWNW"
FT   gene            339963..340988
FT                   /locus_tag="Patl_0292"
FT   CDS_pept        339963..340988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0292"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: bcl:ABC3358
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38824"
FT                   /db_xref="GOA:Q15Z64"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z64"
FT                   /protein_id="ABG38824.1"
FT                   /translation="MAKVKLIDVAQLASVSKSTVSQYLNGRFDYMSKETQIRIRAAIKE
FT                   LDYVPNPIARNLKADKTKTIGVIVRDITGFDTSRTIRGVDDFCKGCDYNALIYNTDFDP
FT                   ETEAKSLEALYQMRVDGIIIASSGQNNTLISEYIDKGMPIVHFQLEHDGSEKNLILSDY
FT                   RQAAFDATEYLIKLGHKRICFMTQDFKNVKSRNERYSGYVAALKKYDIVQDPALIQYWQ
FT                   RETGFDHSPKSVLESAAAPTAFFTQHLAITTELLTHLNQENITIPDDVSLIGFDDIPMA
FT                   EFFKVPVTVIKQEPYIIGKEAAKLLLEKVNDKNRHSQKIMISCSITERQSCTAPKAKKY
FT                   S"
FT   gene            complement(341181..343094)
FT                   /locus_tag="Patl_0293"
FT   CDS_pept        complement(341181..343094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0293"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="TIGRFAM: choline/carnitine/betaine transporter;
FT                   PFAM: BCCT transporter; KEGG: hch:HCH_06292 choline-glycine
FT                   betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38825"
FT                   /db_xref="GOA:Q15Z63"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z63"
FT                   /protein_id="ABG38825.1"
FT                   /translation="MIVALLLFALISPEFADQTFSQVQSTIVDNGSWFYVLTVASILMF
FT                   VLYLAVSRHSQVKLGPDHSEPDYSFISWLSMLFAAGMGIGLMFFGVAEPLMHFLAPPTA
FT                   PPSTIEAAREAMKMTFFHWGLHAWAIYAVVALILAYFSYRHDLPLTLRSALYPIIGEKI
FT                   YGWRGNVVDIFAVISTIFGVATSLGLGVTQISSGLNYLFGFPVSEGYQLLLISAITGLA
FT                   IVSVVSGLDKGIRMLSELNMLLAVGLLLFILLVGPTVFLLQAMLQNTGAYLSDLVRNTF
FT                   NLFAYDKKDWLGGWTIFYWGWWLAWAPFVGVFIARISKGRTIREFLIGVLLIPSMFTLA
FT                   WMTIFGNSAIELVLNQGSTELVKLATDNTPVALFLFLEHFPWSNVISGVAVLMIVVFFV
FT                   TSCDSGAMVVDMLCSNGQNDTPVWQRIYWAGGVGLVAAILSMAGGLSALQTMTIASALP
FT                   FAVILIIAMYGLIKALRVEEFKRASMTLHAPSGQINAGNDSWKERLQTIVDFPNKTTVE
FT                   RFVEQTVKQAFDSVAQELTLKHIEAEISQSTESVTLTVKHGEDAEFIYAVYPTIHHMPE
FT                   YSQSSDSQAEDSADENTYYRADVHLSEGGQNYDIMGWSKVAVINDIIDQYHRHLHFLHL
FT                   AG"
FT   sig_peptide     complement(343044..343094)
FT                   /locus_tag="Patl_0293"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.619) with cleavage site probability 0.616 at
FT                   residue 17"
FT   gene            complement(343545..344942)
FT                   /locus_tag="Patl_0294"
FT   CDS_pept        complement(343545..344942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0294"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: cps:CPS_1901 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38826"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z62"
FT                   /protein_id="ABG38826.1"
FT                   /translation="MTITHKFNLLAVAIGAILLTGCGDAETTLIEKDPIEVPNDDHDDD
FT                   HDHDDNDEFLIDSMGRIAVLSGESNVASIFDLDDSELLDTFSLIHTSNTLTSSADYRFA
FT                   VIASRSEDYVGFIDGGMWQEDHTAHLHDYEQSPAMSDFEVAGSRPTHILSHDGQLAVFF
FT                   DGDADAGTPASVKVATDTQISSETDPLPTLDYTVNMHGVAEARGEYLLATIRRDDAEST
FT                   SAAKILPDQVGVYHLHDDEYEQEQVLDVLCPDLHGAAQNEDYVAFGCTDGVLVAHEHDG
FT                   EYEAEKIANIDILDGLRIGTLYGHEESESLIGVASGHGGGEATLIAVNPSQGTMEELEW
FT                   QPESPADPVSYAFSHEGDAFLVLDSEGYLNVLEAHEEDGGQHWELHARLDITEEDVSTM
FT                   PEGMSFSMTVAQNGHYVYIADPIAQHILQIDLETLTITSDIELDFAPDSITWLGIAEAD
FT                   HDEHDHD"
FT   sig_peptide     complement(344865..344942)
FT                   /locus_tag="Patl_0294"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.974 at
FT                   residue 26"
FT   gene            complement(344976..347369)
FT                   /locus_tag="Patl_0295"
FT   CDS_pept        complement(344976..347369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0295"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor TonB-dependent
FT                   receptor, plug; KEGG: cps:CPS_1902 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38827"
FT                   /db_xref="GOA:Q15Z61"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z61"
FT                   /protein_id="ABG38827.1"
FT                   /translation="MNRISPLAALISVLLPASVLAQTIEGTVVNNDGRAVAGATVEVEG
FT                   VGIETITDQEGRFTFTELTQGKNELHISSPGFAHLHQDISVPEQGTRQIEFILQRSPIE
FT                   VIDVYATPIHMSVMESASPVSVLSGETLRRQQASTLGDSLEKLPGVQSNFHGGVASTPI
FT                   IRGLSGPRVLISQNGLDVSDVSRVGPDHSVASEASTSQQIEVLRGPATLFYGSGAVGGV
FT                   VNVVDGRVPSDNTTRGEWLLETSSVDDKKLGSFNVTTGYESFGFYADGYWRESNDYDVP
FT                   VAPDADSNEPQEHVVKNSSEKSDGITLGASYLMDQGYIGVAVEQFNREYGIPGHSHGGE
FT                   DESVYADLEQTRVQLLGELNLDNEWLSKINLRGGFTDYEHAEIEEGAVGTLFENETHEL
FT                   KLDFIHTPFADWNGGLSIHYKNSDVAAQGEEAFTPPSEAQTIALAIMEEKHFGDVLLQF
FT                   GARIERVTIDANNVLLPTLEAHAHDDEAEEDEHDHDHEHEEEASVTRVFELDHEFTPVS
FT                   LSAGLVWDFTPGYNLGLSISRSERAPSAAELLSFGAHIGTGTYEVGALFALNDEGSSIG
FT                   LTSKDIDLETANNIDLTLRKTQGDIGFVFNAFYNQVDNYYYQTATGLFAESGHDHEHEH
FT                   EESGVEEDEHADELPVYIFQTDDVILHGFEAQIAWQATDEFKATLFSDYVRARLKDGGD
FT                   LPRTPPLRFGTQFSYQTAHLSAHLDITRYQEQDRVSSDETSTSGYTLIDASVSYYLPVF
FT                   SHDIAVFLKGNNLTDTEARVHTSFLKDIAPRPGRSISVGIRGNF"
FT   sig_peptide     complement(347304..347369)
FT                   /locus_tag="Patl_0295"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 22"
FT   gene            347587..348264
FT                   /locus_tag="Patl_0296"
FT   CDS_pept        347587..348264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vvu:VV10717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38828"
FT                   /db_xref="InterPro:IPR021253"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z60"
FT                   /protein_id="ABG38828.1"
FT                   /translation="MIKRITMLTALMNCCFSTTAQVHQHGQGQLFVSQENSDWHVQFIL
FT                   PAADVLGFEHAPENAQQEKILHSLIQRLDKNDAVVDLGEHCTLSEVTHSLSEHSLSDDH
FT                   ESGGNKDLHEDKRYNDHHAHEEHSSSENHHADNHDEDLLADEELSAGKGPSAGKKPSDR
FT                   LKHAEHQDVEVEYHFACDTSHKKLSVPLFQWLPSLGRIQAQWITDAGQGTAVLNPENPN
FT                   LEW"
FT   sig_peptide     347587..347655
FT                   /locus_tag="Patl_0296"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.544 at
FT                   residue 23"
FT   gene            348267..348746
FT                   /locus_tag="Patl_0297"
FT   CDS_pept        348267..348746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0297"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: hch:HCH_01703
FT                   Fe2+/Zn2+ uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38829"
FT                   /db_xref="GOA:Q15Z59"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z59"
FT                   /protein_id="ABG38829.1"
FT                   /translation="MGAVATEDYFKIAKGVCEKAGSRLTDTRQHMLEVLIEVNKPLSAY
FT                   EITEQYNQIIKPKIMTMSVYRILDFLESVHLVHRLQSINKYVVCNHSLGACHHHPPLYM
FT                   ICKSCQHIEEVELPDEVISTLTQQAKSVGFSSVGSQVELYSVCAKCKSTSNQNLS"
FT   gene            348754..349164
FT                   /locus_tag="Patl_0298"
FT   CDS_pept        348754..349164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_1818 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38830"
FT                   /db_xref="GOA:Q15Z58"
FT                   /db_xref="InterPro:IPR004891"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z58"
FT                   /protein_id="ABG38830.1"
FT                   /translation="MTKLQHVSDKAAVGLSLLCMVHCLFLPFVLILLPPLSGVLAFNDE
FT                   LFHRWMMYAVVPISSVALFIGYFHHRSNKVLAICLTGLALLIAATLLGHATLGRYGEVI
FT                   LTVIGTSIIAYGHLLNYHLRRQCNQVDILKQD"
FT   gene            349169..350416
FT                   /locus_tag="Patl_0299"
FT   CDS_pept        349169..350416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0299"
FT                   /product="cobalamin synthesis protein, P47K"
FT                   /note="PFAM: cobalamin synthesis protein, P47K cobalamin
FT                   synthesis CobW-like; KEGG: cps:CPS_1815 cobalamin synthesis
FT                   protein/P47K family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38831"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z57"
FT                   /protein_id="ABG38831.1"
FT                   /translation="MQDSMQEPVQNSSGNAHRKLPVTVLSGFLGAGKTTVLSHVLNNRQ
FT                   GKKVAVIVNDMSEINIDGSLLKNEITLNRNDEKLVEMSNGCICCTLREDLLIEVGKLAN
FT                   SGKFDYLVIESTGISEPLPVAETFTFADEDGVSLSDVATLDTMVTVVDGVNFLKDYDEA
FT                   EYLSQTDESLGEEDERSVADLLIEQVEFADVLLVSKTDLIDSTEVERLNAILKNLNTRA
FT                   RIIPIANGQVNIADIIGTELFDFEQAQQAPGWLQEMRGEHNPETEEYGIQSFSYTARRP
FT                   FYPQKFYDFLHNTKGYGKLLRSKGYFWLASRPEFAGQWNQAGGIARYGFGGLFWKAVPK
FT                   AQWPTDEEYLESIDALWEEPFGDMRQELVFIGQNLDEAAITNALDECLLTDDALLQGKA
FT                   HWKTLADPFPAWENEA"
FT   gene            350413..351114
FT                   /locus_tag="Patl_0300"
FT   CDS_pept        350413..351114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_1816 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38832"
FT                   /db_xref="InterPro:IPR014955"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z56"
FT                   /protein_id="ABG38832.1"
FT                   /translation="MSIATPLHDQEHVTAGQRTNALMSEMTHSHSDEFTVLTDIYQDTH
FT                   NLVVWQRSLSEELLAHVAHCIEENPRLNLEKSIRANAIIEDINELLTPRGFNDEFTDNI
FT                   ASLVDMFCCLFDLKRVGLRLKVLEQAMCPRFHVDWVPCRLVTTFSGTGTQWLPHDKVDR
FT                   TKLGTGNNGMPDDQSGLYAEPNAIQALAVGDVALLKGEGWEGNEGAGLVHRSPPNEANE
FT                   KRLLLTLDFIS"
FT   gene            351274..352194
FT                   /locus_tag="Patl_0301"
FT   CDS_pept        351274..352194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0301"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="PFAM: protein of unknown function DUF198; KEGG:
FT                   hch:HCH_01706 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38833"
FT                   /db_xref="GOA:Q15Z55"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15Z55"
FT                   /protein_id="ABG38833.1"
FT                   /translation="MGMTLPDITSSENVASAAPLKWVGMEGITVPIQVPMSGEVPAYVN
FT                   AKTDVYVSLDKSDAKGIHMSRLFLKLNDILGTELLSSTSLTALLNELILSQQGLSQGAK
FT                   VNLDFALTLRKKALLSNEFGYQSYPIGISTQLVKGVARTVLSLTIAYSSTCPCSSALAQ
FT                   QALSDAISQRFDDEMISKSELTQWITSKTGAVATPHSQRSYAYIKLTLDGDALPNLPEL
FT                   ITLLETTIGTPVQTAVKRQDEQAFAKLNAENLMFCEDAARRLKRALERKENVLDYWFKV
FT                   EHQESLHAHNAVAIDFKDNADEDTM"
FT   gene            352178..353173
FT                   /locus_tag="Patl_0302"
FT   CDS_pept        352178..353173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0302"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   vvy:VVA0896 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38834"
FT                   /db_xref="GOA:Q15Z54"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z54"
FT                   /protein_id="ABG38834.1"
FT                   /translation="MKTLCKAVCLGTLVAMSSGCVMQSQIVSPRLAKQPPIAPASPRVV
FT                   AQDVDIGAAQGSENTSGMDGFKVVTWNTEHFAYPSNAGCKPRTSEDIAAIKAYIAGLGA
FT                   SVIALQEVASREALRLVFPESDWTLVLSARADSPAYECRESGFTSTQQKVAFAIKKGIS
FT                   ILQVQQNAQLGLQKIGLRFGLAVTVDTPLGPTDILNVHLKSGCFVDDYATSDKAACQTL
FT                   AQQVPVLEEWLAAHQTLGVPYMVLGDFNHRLASENNYLASRLTSDEYGIDIATQALRGC
FT                   HPRYPEPIDHILLGGMQSTLIAASAHVHRYKNMDEEAMLSDHCAVSLFLK"
FT   sig_peptide     352178..352249
FT                   /locus_tag="Patl_0302"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.546 at
FT                   residue 24"
FT   gene            complement(353189..353848)
FT                   /locus_tag="Patl_0303"
FT   CDS_pept        complement(353189..353848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_1814 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38835"
FT                   /db_xref="InterPro:IPR021727"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z53"
FT                   /protein_id="ABG38835.1"
FT                   /translation="MSSKIKVTAILLLFFGAGILLTKLPERNWSMQLSKLFSSSVLYVS
FT                   PDTELRERLANDEITPLGWGELLPKSDKEVLAKYQSSSDKSLSEQVTLSLQATTNQRYQ
FT                   SALYSTNVVEDAIGKAVSISGYMVPIDLNEDRSVKRFFLVPYYGACIHYPPPPPNQMIY
FT                   VDLIDGFSKIMMSQAFTLTGVLEKGLFEDHQGTSAYILNVSQIEKFNEQPDEYRTH"
FT   sig_peptide     complement(353780..353848)
FT                   /locus_tag="Patl_0303"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.950 at
FT                   residue 23"
FT   gene            complement(353934..354473)
FT                   /locus_tag="Patl_0304"
FT   CDS_pept        complement(353934..354473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38836"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z52"
FT                   /protein_id="ABG38836.1"
FT                   /translation="MQTQHSLTTSFMAFIGSVTDSMLTAPRAYPLLRKRSVISLLVLSS
FT                   VSIQANACQFHGGRNFGIFPSFHPLQDMLSQEKVSLPISVSHPRSIDTPANTDATLNIQ
FT                   YDIPDGYQNVVITFSGSENVRFLEGVQMPVRGVSGSYPLKYQVSKPGNHKISLHINALE
FT                   KDEPISFQQNIQVSAI"
FT   gene            complement(354474..355055)
FT                   /locus_tag="Patl_0305"
FT   CDS_pept        complement(354474..355055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_1814 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38837"
FT                   /db_xref="InterPro:IPR021727"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z51"
FT                   /protein_id="ABG38837.1"
FT                   /translation="MKIQILSSWVTLLIFNFVLLSTANAAQSTGSYQEIEWIALMPKDD
FT                   LEALMNPPEYLSGIEDGSEQDSVEALGQQEGVDKNTKRFQKALSSTRVINTYENKPIRI
FT                   PGFIVPLASDESQNITEFFIVPYFGACLHMPPPPPNQIIHSKAEQGIKLGSLYDPFWFE
FT                   GTLVIDTTENELGTSAYRLKLNKAYPFEEE"
FT   sig_peptide     complement(354978..355055)
FT                   /locus_tag="Patl_0305"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.955 at
FT                   residue 26"
FT   gene            355161..356015
FT                   /locus_tag="Patl_0306"
FT   CDS_pept        355161..356015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0306"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   cps:CPS_1813 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38838"
FT                   /db_xref="GOA:Q15Z50"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z50"
FT                   /protein_id="ABG38838.1"
FT                   /translation="MKAVNTDDSAHSTGSAHSTGSGHSVESRETAESARSSVSDESAAK
FT                   GKSADNIKNKAPLAINLKGVRHSYGKSSNETVLSIPHWQLAQGERVFLHGDSGSGKTTL
FT                   LNLLSGVLTPTEGSIELLGQPFSSLSARRRDAFRARHIGVVFQQFNLVPYLSVLKNIQL
FT                   ANYFAAKRDKHIEESVSGLLAKLNLPADVMHKPANTLSVGQQQRVAIARALINQPELLL
FT                   VDEPTSALDASARDAFMDILLNMCETAGASLVFVSHDMSLKRFFSTSVDMPSLCQGKGN
FT                   AAC"
FT   gene            356009..357241
FT                   /locus_tag="Patl_0307"
FT   CDS_pept        356009..357241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0307"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   cps:CPS_1812 putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38839"
FT                   /db_xref="GOA:Q15Z49"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z49"
FT                   /protein_id="ABG38839.1"
FT                   /translation="MLISLAWSSLCSRKKSVILTFLSLLISISVLLSVEHIRQQAKTSF
FT                   NRTISGADLIVGAPSGQLNLLLYSVFRMGDPTSNIDYQSYEMLKNDQQVAWAIPISLGD
FT                   SHRGFRVLGTNGDYFTHYQFGDKKSLGFTAGKPFAGMFDTVIGADVAKTLGYQVGDKII
FT                   VAHGIGHTSFSHHDHSPFVISGILKPTGTPVDKTVHVTLPAIEAIHLPPSQLAKILDGE
FT                   EAQKIQPDSVTAVILGLKTKFGTFNLQRDLNNYQDDRLMAVLPGVALAELWQMMGTVEN
FT                   VLRVISVLVLLSSLFGLSTMLLASMNERKGEIAVLRTLGAGPSVIFGLVLLEALMLVVI
FT                   AIASAVSLVSGSIALFSDKLAAHYGLFLSANLLSWETLQIAMIITLASIVTSAIPAFEA
FT                   YKKALQSSLSG"
FT   sig_peptide     356009..356107
FT                   /locus_tag="Patl_0307"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.886) with cleavage site probability 0.413 at
FT                   residue 33"
FT   gene            complement(357305..357682)
FT                   /locus_tag="Patl_0308"
FT   CDS_pept        complement(357305..357682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0308"
FT                   /product="flavoprotein"
FT                   /note="KEGG: ilo:IL2128 predicted flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38840"
FT                   /db_xref="GOA:Q15Z48"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z48"
FT                   /protein_id="ABG38840.1"
FT                   /translation="MSPALANLLNHFGSSLFSYKPSAIVTYSAGQWGGMRAAVGMRTFL
FT                   SELGCLPVSAMIHVPKAQEVFTEDGAPQTGEDQRSWFDYFSRTFTQLAWWAQATKTHGE
FT                   TVNPHEMLKTFNTTPAQRNAP"
FT   gene            complement(357969..358229)
FT                   /locus_tag="Patl_0309"
FT   CDS_pept        complement(357969..358229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pha:PSHAa1603 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38841"
FT                   /db_xref="GOA:Q15Z47"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z47"
FT                   /protein_id="ABG38841.1"
FT                   /translation="MKFLVFLGTVRDSTPPRPARLGLRVAKACMACLDARFHEHKFELI
FT                   DALDYPLEPVFKPHFAYAKNKAPPELNTLAEKIAAADGFIM"
FT   gene            358477..359523
FT                   /locus_tag="Patl_0310"
FT   CDS_pept        358477..359523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0310"
FT                   /product="beta-lactamase-like protein"
FT                   /note="PFAM: beta-lactamase-like; KEGG: bbr:BB4943
FT                   metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38842"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z46"
FT                   /protein_id="ABG38842.1"
FT                   /translation="MTIDFIDVQPPEPGEWQQVSPGILWLRMPLPFELDHINLYLIEDH
FT                   DPVTGDKGYALIDTGFGVSKTQELWDSLLSKLDVPLTKVIVTHMHPDHIGMAGYLVDKY
FT                   RAPLYMSHSEYFVGRAMSAGSRGASDWQDDEYLVRCGMSPEYVATASENRKTNKGVGQV
FT                   IRPIPLHHERLQEGDELTIGQHQWQVLIGRGHSPEHVCLFNPTTNVLISGDHVLPIITP
FT                   NIGVYSTEPNANALKMYLDTLPQFKTLPTDALVLPSHKQPFVGLHKRVDELAEHHHEHL
FT                   ANLKAFCAQGKTIKECLPVLFKRELNEHNMFFAIAEALAHLNYLYFEGEVTRDINEHGH
FT                   YVFALVGD"
FT   gene            complement(359646..361739)
FT                   /locus_tag="Patl_0311"
FT   CDS_pept        complement(359646..361739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0311"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor TonB-dependent receptor, plug;
FT                   KEGG: nar:Saro_1823 TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38843"
FT                   /db_xref="GOA:Q15Z45"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z45"
FT                   /protein_id="ABG38843.1"
FT                   /translation="MKLYNLFSLSLFTLAMQAQAQEATDATEVKQADAEVEHLLISGVR
FT                   QDRISGGATGLTMNISETPQSISVITSDLMDNFAAFNINDALRLATGVTVEAWETNRTN
FT                   YSSRGFEIKNTQIDGVGLPNDWGIVTGAIDAYGYESIEVIRGANGLLTGVGNASGTINY
FT                   VRKRPTNETGGEVSVIAGSYDFKRIQADYNTLLTEDGRWAARFVVAGEDTNSHLDGLSD
FT                   NLGYFYGVVDGQLTDHSTLTVGISHQDANTDGNLWGGLVFNYTDGTQAEWDDSDSTTQD
FT                   WTMWDTQNTNAFVEFTSQLSDNWRLDVNYHKRYFEEQDKLFYAYGTIDKETNLGLLGYP
FT                   GRYDSDIDSDLLEVKTSGFFSAFGFEHEATFGVSYAQSTDTMFNYAADFTEAAWGALPA
FT                   FPYALDAIAEPDWQERTLYSEIKQNLTRVFGSTKITLSDSLFMIAGVNAIDFERSGDNS
FT                   GTTIDNSESELSPYVGFTYAITEDINAYASYSDIYQPQEQYDLSGQYLDPTKGKNTEAG
FT                   IKVQWLDESLLTTFAYFTAEQENLASYAGINPDNGQYYYNGIDVDSKGFEIEMTGQLTD
FT                   DLSVILGYTAIEIEDDQGADANTWAPRDYVNFSLNYTVPVVPSLTVGVSGRWQSETKNT
FT                   DYNVTQDSYFLLNAYASYDITNDLSVRANLNNITDEKYLSSLHSSFFYAAPINGTVSVT
FT                   YSF"
FT   sig_peptide     complement(361677..361739)
FT                   /locus_tag="Patl_0311"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            362341..362946
FT                   /locus_tag="Patl_0312"
FT   CDS_pept        362341..362946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38844"
FT                   /db_xref="GOA:Q15Z44"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z44"
FT                   /protein_id="ABG38844.1"
FT                   /translation="MHYEATLKRQSIAHNLHIIKTTGIPMILLLAIALGLLGCYVLYMS
FT                   WKQHSTRYALAGWGCLLATLPLLIVALGTEYGVVFALGLPALYVWLGILREQKTQMPSK
FT                   HIVKADKSIQFNANKLAKNSGYILYHLVLLMVVSSLLVIASLDILPLERPTQLVTGVII
FT                   LPLVWSGLSFWHLSCENKRNPLIFSIFVSLASSLYLFV"
FT   gene            362950..364440
FT                   /locus_tag="Patl_0313"
FT   CDS_pept        362950..364440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0313"
FT                   /product="PepSY-associated TM helix"
FT                   /note="PFAM: PepSY-associated TM helix; KEGG: pfo:Pfl_0927
FT                   aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38845"
FT                   /db_xref="GOA:Q15Z43"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z43"
FT                   /protein_id="ABG38845.1"
FT                   /translation="MKNSKVDPQKKLVNTPSLSKRSLSAHAWLGLFVSAFMYIICLSGT
FT                   LAVFHQELERWEQPQIPETGKVDIAVIEKAYDNFVETYPEETEHMYVVFPGSGIPRVVV
FT                   ENDHIAHFVNPDGSLGEVEQSHWTKMLVDLHLYLHLPKSFGMILVSAFGALLCALILSG
FT                   FLAHPRIIKDAFRFRRGGTGLQENIDLHNRFSVWAAPFHIMIGVTGAYFGLATVLIGLV
FT                   SQAFYAGDNQAVLDELFTPEPALEQPLQRPQIGRAMEYIEQHNPEGTPLFLTIHEPNTP
FT                   GQFIEAYVKQPGRLIYSENYRFDIQGNFLETAGYRDGGLAKQIIFSMYRLHFGEFAGIA
FT                   SKLLYFVLGMMLTVVSATGINIWLRKRKTTDVINLWWPTLVWGTPLILSVSALLNLFVH
FT                   VRIDLFIWLGLVAALVVATRQQNVQLWVARLKHALAFSLLIFIAAYTAKAGAAAFTIAA
FT                   LQINIPLALYAAYLLARGHRQITLAGNEDRQVSQPEST"
FT   gene            complement(364502..365470)
FT                   /locus_tag="Patl_0314"
FT   CDS_pept        complement(364502..365470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0314"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix, AraC type; KEGG:
FT                   hch:HCH_00884 transcriptional regulator containing an
FT                   amidase domain and an AraC-type DNA-binding HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38846"
FT                   /db_xref="GOA:Q15Z42"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z42"
FT                   /protein_id="ABG38846.1"
FT                   /translation="MLKHVTLFASENAMGLSLGLTHDVLAFASTLQQRLLGQAIEISLV
FT                   TVDGKPTSTFSGLAITPDCALDEVQDTDLIILHSIWGEVDTLLSKQAALYPRLRTWHEQ
FT                   GKPIMAAATGAYFLAEAGLLNDRISTTHWHKQADFAKRYPKVDVRAERFITATGELYCS
FT                   AGMNAGLEILVYLISKLSSSLVGEAVEHAFLVDFRTGYAGEFTSISHQTYHQDDEILSI
FT                   QQWLEMHFMSSILIEQLASKVNMSPRTFKRRFKEATGETPLGYIQQLRIEQGKEHLKHS
FT                   DKSIEEISWAVGYQDAGHFNRLFKRKYRKNASAWRQQYRSY"
FT   gene            365581..366756
FT                   /locus_tag="Patl_0315"
FT   CDS_pept        365581..366756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0315"
FT                   /product="acyl-CoA dehydrogenase-like protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase-like Acyl-CoA
FT                   dehydrogenase, type 2-like; KEGG: pfo:Pfl_3948 acyl-CoA
FT                   dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38847"
FT                   /db_xref="GOA:Q15Z41"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z41"
FT                   /protein_id="ABG38847.1"
FT                   /translation="MLNLERTMQLSEEHDALRKTVKNFVDNEMDPFIEEWESAGIAPLH
FT                   TLFKKMGDLGLLGIHKPEAYGGSGLDYSYNLVFAEELGRAYGGSLPMAIGVQTDMATPA
FT                   LARFGSDELKREFLAPAVAGDMVACIGVSEPGAGSDVAGLKTTAKSDGDDYVINGSKMW
FT                   ITNATQADWICLLANTSDGNVHANKSLIVVPLNTPGIEISKPLNKLGMRASDTGQIFFN
FT                   NVRVPKRNRIGEENKGFTMQMMQFQEERMYAAASAHKGMERMIQDTIGWCKERHTFGQP
FT                   VLNNQVVHFKLAELQTEVEALRALTWRACQQHIDGEDATYLASMAKLKSGRLWREVTDS
FT                   CLQYWGGMGFMWDNPVARAYRDTRILSIAGGSDEMMLGIIAKHMDIFPKRR"
FT   gene            366862..367824
FT                   /locus_tag="Patl_0316"
FT   CDS_pept        366862..367824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0316"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase, NPD; KEGG:
FT                   dar:Daro_1554 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38848"
FT                   /db_xref="GOA:Q15Z40"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z40"
FT                   /protein_id="ABG38848.1"
FT                   /translation="MAIPALFNNKLSLPVICAPMFLVSSPKLVISACKNGIVGSFPTFN
FT                   TRTQDLLDTWLTQISSELAEYAAANPQKPVAPFAVNLVVHPSNTRLESDRAVVKKHQVP
FT                   FVITSQGNPADVVAEVHQWGGLVFHDVIRADHAKKAIQAGVDGIIIVTAGAGGHAGEIN
FT                   PFALVREIREFWNGPLALAGAINDGMGVRAAEILGADFSYMGTRFIATEEAEVDPDYKS
FT                   MLVDSQISDLIYTDTFTGVKCNFLKPSIARAGVDLANFTAKTHVDLDLGESNAWKDFWS
FT                   AGHGIAGIKHVLPMAELVEQLKEEYRGAVAHPAFLNNQV"
FT   gene            367885..369498
FT                   /locus_tag="Patl_0317"
FT   CDS_pept        367885..369498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0317"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: pae:PA2888
FT                   propionyl-CoA carboxylase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38849"
FT                   /db_xref="GOA:Q15Z39"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z39"
FT                   /protein_id="ABG38849.1"
FT                   /translation="MALFHTQLDEHGESFKQNTLVMHEAVLEIRAIEKRVIQLADEKAP
FT                   RYIKRGLIPPRERLSRLLDPGAPFLELSSLCGYMQEGDTDGSAAGGGVIAGIGYVSGAR
FT                   CIVMIDDYLTKGGSITQLGSHKRLRMYQMALQNKLPVIALAQSGGGDLTSLGDWFGFSG
FT                   AAFAMQAKLSAAGIPQITLVHGSATAGGAYQPGLSDYVVMIKGQSTVYLAGPPLLKAAT
FT                   GEIATDEEIGGSQMHSEISGVADYQAKNDADGIRIVREITASLNWNDSAHPQAVNQYQE
FT                   PLHDKEQLLGIVPKEAKTPYDVREVIARIADGSDFLDFKAEYDMGTVCGHMRLHGMVCG
FT                   VIGNNAPITAHGAAKAAQFIQLCEQSGSPIVFLHNTTGFLVGTESERAGIIKHGAKLIQ
FT                   AVTNSSVPKISLVLGGSYGAGNYAMAGRGIEPHFMFAWPRSVVAVMGPAQAGSVLRTVA
FT                   SAKMARANAIDTDKLDALEKRTVEVMQAKSGALANSARLWDDGIIDPRDTREILAFVLD
FT                   ICREGQARKVNTSQFGVPRF"
FT   gene            369583..370395
FT                   /locus_tag="Patl_0318"
FT   CDS_pept        369583..370395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0318"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   pae:PA2890 probable enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38850"
FT                   /db_xref="GOA:Q15Z38"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z38"
FT                   /protein_id="ABG38850.1"
FT                   /translation="MSNVSQKQYREILVSLAQGVLTITFNRPHKKNAMNLALVNDVMAV
FT                   FSDIAEDSSVRAVVIRGSEGNFCAGGDISDMHSDAASEQDKQQAIWHFNRSFGRMVAQV
FT                   NQAPQVVVTQLEGAVLGGGFGLACVSDIAIAHQSAFFAMPETGLGVVPAQIAPFVVTRI
FT                   GLTQARRLALLGERVGADQSQALGIVHFVCETQEALQAQLNEVLKHVRRGAPKANANTK
FT                   ALMLKVGTIALDTLLDEAADVFTQALASDEGKEGTQAFMQKRKPSWCE"
FT   gene            370438..372507
FT                   /locus_tag="Patl_0319"
FT   CDS_pept        370438..372507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0319"
FT                   /product="Carbamoyl-phosphate synthase L chain, ATP-binding
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment Carbamoyl-phosphate
FT                   synthase L chain, ATP-binding Carbamoyl-phosphate
FT                   synthetase large chain-like biotin carboxylase-like; KEGG:
FT                   hch:HCH_05752 acetyl/propionyl-CoA carboxylase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38851"
FT                   /db_xref="GOA:Q15Z37"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z37"
FT                   /protein_id="ABG38851.1"
FT                   /translation="MSTEQMINIQNSDTQAGATQSHGLKKQNQFHKILIANRGEIALRV
FT                   IRTARQMGYRTVAVYSEADKDAAHVLAADQAVCVGPASVSESYLMIDNIIAAAHKTQAD
FT                   AIHPGYGFLSENPAFARACDAAGIQFIGPDASAIELMGSKRLSKVAMLDAGVPCIPGYQ
FT                   GAEQSDQVLVKKAADVGFPIMVKASAGGGGRGMRLVTEQGELAAQIKTARSEALSAFGS
FT                   GELILERAVLAPRHIEIQIFADSHGNTVYLGERDCSIQRRHQKVVEEAPSPFVDEELRE
FT                   RMGQAAVSAAKACGYQGAGTVEFLVDSDKNFYFLEMNTRLQVEHPVTELITGLDLVEWQ
FT                   LRVAAGEALPLTQQEVNFNGHAIEVRLYAEDPRQRFMPQTGNILVWQYPEREGIRVDHG
FT                   INTGDTVSAHYDPMLAKVIAYGPDRATAARRLASGIEDIQLVGVNTNKAFLLNVLRHPA
FT                   FINAETTTAFIEQHFTEHASTQNTAPAIGTLARAAMIYFQHPLFGQHASFDQPTWSSAA
FT                   PQVYHFTLKINEHIYAVQIHKQADRYLVKSETQETELTLVSHGANQAVVIEEDIRQGFS
FT                   YAQQDTTLFLDDGSGHYRIDDITQQPANVSEQNASGEINAVMDGVIIDVLVKEGDAVET
FT                   GQLMVVMEAMKMEHQLKALSTGRVTEVRATTGQQVKSKQLLVSISSNDDTHSDA"
FT   gene            372520..374331
FT                   /locus_tag="Patl_0320"
FT   CDS_pept        372520..374331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0320"
FT                   /product="protein of unknown function DUF1446"
FT                   /note="PFAM: protein of unknown function DUF1446; KEGG:
FT                   hch:HCH_05745 predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38852"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z36"
FT                   /protein_id="ABG38852.1"
FT                   /translation="MSNKTVRIGGASAFYGDSQLSARQLVDDGNIDYLVFDYLAEVTMA
FT                   ILSQAKAKNSDYGYAVDFVTVAMKDVLADCALKGIKVIANAGGMNVPSCIRALEQLCSE
FT                   LDISLNIAGVYGDDLSANRPNLNSDDLAEMQTGQPLPERLASMNAYLGARPIADALAAG
FT                   ADVVVTGRVVDSALVIGPLMHEFNWQENDYDKLAQGALAGHILECGAQCTGGNFTDWHL
FT                   VPDFSSMSYPIAQVSANGAFEVGIVPNTGGMVTEATIGEQVLYEIGDPANYLLPDVACD
FT                   FSNITLTQTGKDRVSVSGAKGRAPGNQYKVCATYVDGYKLISSFFMGGERAADKARVNI
FT                   NALVKRTERAFAAKGLSGYRRTSIEIMGAEDTYGPHAKAQNTREVIAKFGLHHDNKVAL
FT                   HFAASEIAYLATSAAPGMSGFGAGRPKPQPLIRVHSTLIDKSDVPVTVQLNKTVLFTQC
FT                   YLTPESSASIEAAQFSPDAIKADVTSSDAASSESLTSVPLVKLAYARSGDKGDNVNIGL
FT                   MAREAKFLPVLYQQVTEQAVAIYFAHQIEGHVLRYNVPGINGFNFFMTQALGGGGTASL
FT                   RTDTQGKAAAQMLLSMPVRVPKSWEDM"
FT   gene            374405..375277
FT                   /locus_tag="Patl_0321"
FT   CDS_pept        374405..375277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0321"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   pfl:PFL_4195 oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38853"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z35"
FT                   /protein_id="ABG38853.1"
FT                   /translation="MGYQSCLRANSFAGQTYVVTGGGSGIGRCTAHELASLGASVVLLG
FT                   RNLEKLQRTSNEIIDDGGSADYFALDIRDEEQVITTVSAILKAHEHVHGLLNIAGGQFR
FT                   APLEAISKKGFESVVQTNLVGGFLMARELFKQHFKAHGGSIVNITADNKNGMPGMGHSG
FT                   AARAGVENLTKTAAWEWGRYGVRVNTVAPGWVASSGLDTYPQEMQAAINNLKYAVPLGR
FT                   IASEAEISALICFLMSPGANFISGQSMWVDGAASMGSAPALAPLGQTAPVNSTTWDGFH
FT                   RSAPPKVLR"
FT   gene            375310..376905
FT                   /locus_tag="Patl_0322"
FT   CDS_pept        375310..376905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0322"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rpb:RPB_3261 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38854"
FT                   /db_xref="GOA:Q15Z34"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z34"
FT                   /protein_id="ABG38854.1"
FT                   /translation="MNNHALNRNLIERVALGDLLRKRSRDSGEQHAIVDFPEGMRRATS
FT                   YNELNKRVNQLAHGLIEKGVKQGDKLALFSTNQRDMLTVYFACYKLGVIAVPINFMQGV
FT                   DDVRYNLEHSETSAVIYEAMFTELVHASTQGNPHIKLTVQMGNTKGKSDYSLEALLDNQ
FT                   SEQEINDRIIEDRDTAHMIYTSGTTSRPKAVESSHLALTIAALTGVIELELNRYNRMLL
FT                   VLPLFHCAALAVLHPVMMRGGCTVLHAAFDPNVIVGSLEQEKIETAVFMPMMWHALLAT
FT                   PNVEQRDFQHFKLGVYSMAAMNSKSLEKVRKVFGCQMHLGSGQTEFAPVACMYRDKTPT
FT                   EFSEGNYWGVPVCTGEQAIIDKQGNELPNGEAGEIVWRGPQVMRGYYKNEQATAEAGKF
FT                   GWHHTGDIGLIDNQGQLLFIDRIKDTIKSGGENVSSQKVEQALELLEGIERAAAFGVSH
FT                   PHWGEAVCACIISTTFSEADLALIEAHCKAQLGQFEVPKAIFICETLPVTGTGKVRKVE
FT                   LREQYKDVFGDVSD"
FT   gene            complement(377376..378887)
FT                   /locus_tag="Patl_0323"
FT   CDS_pept        complement(377376..378887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0323"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cch:Cag_0738 VCBS"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38855"
FT                   /db_xref="GOA:Q15Z33"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z33"
FT                   /protein_id="ABG38855.1"
FT                   /translation="MKILSVVLPIALLFSSSCFPKTVLDGQLSDSITLESGSRGAILFS
FT                   SVQLESDEPSYTGARFHVVSFSDSVSLTIIESDDISTNLEEVHYQGKSVAEVITSVDQH
FT                   FIIQFYENSDLNIVNSLIQAIGVSTDEEQTSYQFNYYFVSENKRKIYPTISEFDYSKNE
FT                   AVSASLSNLEETLGVPITTPVLVTDLDNDLKNDFLVADTYFDNGIEWFVLDSESALKLK
FT                   AEDTTFDLVPSIVTAILQPMTMADLDGDRDLDMVLAYQDNSFCEGNEDYEYSSCHMYVK
FT                   NEGTVNEPVYDFDNAKPLSELGAMCDTFTDFSIIEFVDLDNDGDIDIACGSNDDPGWLY
FT                   EFYVNVGDKNTPIFEAQYNPFIEINLLESVIPSFVDADLDGDLDVFVGKVDGKSIIYES
FT                   SVNDAGEVVLAESNLTLLGLEEGNGRFADWDNDGDLDYYISGFYESPDVSYFENLAYQE
FT                   VQITLEQSEERVGGAMSFTLLSTLFLTVLTLLRRNRLRNPISKCL"
FT   gene            379504..380575
FT                   /pseudo
FT                   /locus_tag="Patl_0324"
FT   gene            380844..381410
FT                   /locus_tag="Patl_0325"
FT   CDS_pept        380844..381410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38856"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z32"
FT                   /protein_id="ABG38856.1"
FT                   /translation="MPSYTRFIFASNHDQVLKAGGRERRFLVLEPSAKYAQHKEYFDNL
FT                   WKWINEGGANCLLHYLSQYDLNGFDSRRAPVTQALLDEKLQNLSPYQQFFRAELSNDRP
FT                   FGGAVRLSTKDLVNNCRIWLEDNGYPVVIPKVRSSIGKLVQRMGIDRHGKHGRDAMYEF
FT                   PSRSEMQTSFARLLGHEKDEIFNSD"
FT   gene            complement(381516..381950)
FT                   /locus_tag="Patl_0326"
FT   CDS_pept        complement(381516..381950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38857"
FT                   /db_xref="GOA:Q15Z31"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z31"
FT                   /protein_id="ABG38857.1"
FT                   /translation="MTNFENIENLSLNDLEIELLDQIPFKARAEILINNDRTIIESPLN
FT                   GRDVEGLFSFEQRKEISIKLKRYIRSLIDDLNVSFKQKICIELDFCKRLAALEKDRLEL
FT                   FSMLFDLLTAIFTSFPIATLTYLAWYLLKSGMHKYICSCP"
FT   gene            complement(381964..382518)
FT                   /locus_tag="Patl_0327"
FT   CDS_pept        complement(381964..382518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0327"
FT                   /product="dCTP deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="TIGRFAM: deoxycytidine triphosphate deaminase; PFAM:
FT                   deoxyUTP pyrophosphatase; KEGG: mst:Msp_1048 deoxycytidine
FT                   triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38858"
FT                   /db_xref="GOA:Q15Z30"
FT                   /db_xref="InterPro:IPR010550"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z30"
FT                   /protein_id="ABG38858.1"
FT                   /translation="MVLTKEIIKRDLKADNDFWITPLLSEEQFQPASLDVRLGKEFIIF
FT                   KKSRKQCIDLTLVDSKLNNKLIHEFQERIRLSINSPFTLHPGELILASTLEYLSLPNNI
FT                   FASVEGKSTLGRLGLIIATATAVSPGFKGCITLEIVNQGEIPVVVSPGQLIGQIIFMRT
FT                   EGTATYRGRYHYPVGPQFPKI"
FT   gene            complement(382505..383959)
FT                   /locus_tag="Patl_0328"
FT   CDS_pept        complement(382505..383959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38859"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z29"
FT                   /protein_id="ABG38859.1"
FT                   /translation="MEVFSNAIRNIKLQLQEVNSLLTQCEAATYYLTQKIFIDKLREDL
FT                   EECYLDLEDIGVMISDCPDLYPINDVYPQICSLQKQVALISNRTNIVRSSRFELIPWSA
FT                   IGMIHSLKNIIAPAEELVVTSSTLSTYRIWKPIKSDGAQKSDTISILEIPYLYRRNAFL
FT                   HILVAHELFHLRADDFLASIREQALNSIRECWDELIQQKKHSNISVKSDSEVELDNTLL
FT                   FNHTSEQKSKKKEDDKERIVNKTVEIFNSTLKEILCDIGCFAIFGPSAFLALHQLNELN
FT                   TDRSININSDNYHPPFEQRMRILIHLMESHPLFSASLNELKEKINDDARISQIGLRFFD
FT                   KLNSGIKEIKTERKVDSTQSLYYYILHISKSEVDKFIDKACDFVTGVIDHTEESWIGKQ
FT                   TEISDHIYNFSKFSPSGFKKNASDFSMSPSSNGALGLAAWINNLGRDFLPDKEEDLNVF
FT                   LTDCNILFKSWDDAEVIKEWPVNGTD"
FT   gene            complement(383970..384455)
FT                   /locus_tag="Patl_0329"
FT   CDS_pept        complement(383970..384455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38860"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z28"
FT                   /protein_id="ABG38860.1"
FT                   /translation="MSIDTLSEIRNSVYASKYLSRAALLVKNNKYPFRDEENVFRFTEN
FT                   YLKEAIEGKKYFSKEKVDYSHLASLQPARDLNSVSDLESFIKSASGNKNNKDFILELLN
FT                   LSYDVLKEKHNHSEIGQDKAELASKFLKALADIQSSKADEKLFDTNTDRRTEYNLAI"
FT   gene            complement(384670..384746)
FT                   /locus_tag="Patl_R0007"
FT                   /note="tRNA-Arg5"
FT   tRNA            complement(384670..384746)
FT                   /locus_tag="Patl_R0007"
FT                   /product="tRNA-Arg"
FT   gene            384766..385071
FT                   /locus_tag="Patl_0330"
FT   CDS_pept        384766..385071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38861"
FT                   /db_xref="GOA:Q15Z27"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z27"
FT                   /protein_id="ABG38861.1"
FT                   /translation="MLYRYCYSQYKAWGDSFYYGVNTSMMIFPQRVHPVLPFAPLDVML
FT                   NHFSSAAPTGAYPAELRVLHFVSADSNEIQRIFHCYLVLLLGMFAHSQFLSFIVPW"
FT   gene            385210..386595
FT                   /locus_tag="Patl_0331"
FT   CDS_pept        385210..386595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0331"
FT                   /product="protein of unknown function DUF839"
FT                   /note="PFAM: protein of unknown function DUF839; KEGG:
FT                   ccr:CC1375 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38862"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z26"
FT                   /protein_id="ABG38862.1"
FT                   /translation="MVTRRQFTLGASALAFGGLTASYFGKVNAASALASTHGFGPLLAD
FT                   PKQVLDLPAGFNYQVISQLGEKMSDGFTVPDRADGMGCFPLDEERVALIRNHELHPRDL
FT                   IKAEQSIQQHKSTMAYDQTDNGVALPGGTSKLVYNLKTQTLEEQFLTLVGTVRNCAGGA
FT                   TPWNTWLTCEESVLKAGVGVAKSHGYIFEVPATANGLIEPKPLTAMGRFNHEAAAVDPR
FT                   TGIVYLTEDRGDSLFYRFIPHQRGQLDQGGQLQALVLNGTNGVKGSQGYDTRNWEAQQM
FT                   PLQEWVDAHWVNLDNPESPEDDLRARGYKDGAALFARGEGIHWGDNELYFCCTNGGSKQ
FT                   LGQIMRYQPSAFEGQPQEADAPGRLQLFLQSEDESLYNFGDNLTVTPYGHLLVCEDQYT
FT                   DVVENHLRGVTPKGEAYDFARLHMQTELAGACFSPDGSVLFVNLYSPTRTLAIRGPWDK
FT                   FAG"
FT   sig_peptide     385210..385299
FT                   /locus_tag="Patl_0331"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.973 at
FT                   residue 30"
FT   gene            complement(386770..387990)
FT                   /locus_tag="Patl_0332"
FT   CDS_pept        complement(386770..387990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0332"
FT                   /product="N-acylglucosamine 2-epimerase"
FT                   /note="PFAM: N-acylglucosamine 2-epimerase; KEGG:
FT                   xcv:XCV1601 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38863"
FT                   /db_xref="GOA:Q15Z25"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR034116"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z25"
FT                   /protein_id="ABG38863.1"
FT                   /translation="MNITNNAPSFHAPAFLVEHINDTLKFYETNVDDPHGGFYQNFLDN
FT                   GEVFDKGTRHLVSSTRFVFNYARAYQEFRTPKYLERVKSGIEFIRNAHYVPETGGYNWL
FT                   LTVQSGDVTVQDQTNHCYGFAFVILAYSWALRVGVIEAREYLNETWNTMEQHFWDAQAG
FT                   LYKDQCNADFSVCDSYRGQNANMHTCEALIAAYEASGERHFLDRAIALADKMTNQQAAL
FT                   MGGLIWEHYNLNWQVDLEYNKDDPKNLFRPWGFQPGHQTEWSKLLLFIARHDPQPWLVE
FT                   RAKALFDESLAVAWDKEHGGIFYGFAPDMSICDNEKYFWVQAESMCCAAYLYHHTGDAT
FT                   YADWYNKIWQYSWQHMVDHQYGAWFRILTHDNQKIDQLKSPIGKTDYHTMGACYDVLEL
FT                   VRRHPMA"
FT   gene            complement(388003..389298)
FT                   /locus_tag="Patl_0333"
FT   CDS_pept        complement(388003..389298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tth:TTC0614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38864"
FT                   /db_xref="GOA:Q15Z24"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR004888"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z24"
FT                   /protein_id="ABG38864.1"
FT                   /translation="MTTNVNKVHSLETAALIKKAQETLVANDLGGYTVPTHGLYPFQWN
FT                   WDSAITALGWKHFDEPRAWQEIEVLFDGQWDNGMVPHILFHQDSTTYFPGPDIWGSDKR
FT                   VKSTSISQPPVVATVMKDMLDTADDKAFALSKVESLFSSLVDYHLWWYNERDPLNTGLV
FT                   VSYHPWESGMDNSPAWDEALHDVPCVDWAYERRDLGHVNSAQRPHKSEYDRFLFLVDFF
FT                   KKHKFDSKVIFNECPYKVNDIGIISILHRGSKDILALGETLGIKDERLDVIAQRIALTE
FT                   SAINTLWCPEAEYFYCRNVLTDTLCKVRTSAGMLTVFAGLADAKQKDILNSKAKQWNET
FT                   SQYCMASTHPEESRYEPQRYWRGPIWLHINWMIALGFEAEGYQQTADKLRNDCRALVDL
FT                   SGYYEYFNPETGEGCGGKDFSWTAAIALHWLL"
FT   gene            389502..391949
FT                   /locus_tag="Patl_0334"
FT   CDS_pept        389502..391949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0334"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor TonB-dependent
FT                   receptor, plug; KEGG: cps:CPS_3961 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38865"
FT                   /db_xref="GOA:Q15Z23"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z23"
FT                   /protein_id="ABG38865.1"
FT                   /translation="MKMTPIACAVSILFATPLMAQEANTETPDNDEYENIIVTGSSVAR
FT                   TEADTPAKTTLIGKDQIANTGFSSQADILMSVPGIKVEGGGGEVATNAFVRGLPSGGQF
FT                   QFTPLNYDGMPAFQSGMTSSAQDVYYRPDIGIERVEYVGGGVSNLFGPGSVAGIINYIS
FT                   RTGSDDPETTVQVEIAEEGRVRTDFYNSGALSSDENLYYAISGFYRYDEGPLETGLETK
FT                   GYQLRGNIRKEFDDGHITFHGQMIDDQVQFFLPLPLEGDSRERLTGNDGETVYVAQTVA
FT                   AADLRYDTADGTYESPIRNGVLTEGGSFGVDFEKELTDNWRLAGKAKVASYDHQFNLFL
FT                   DGDGIANTPETQEGYANNLGRTANGDVLSSLGSANYTWSETGNALPEDYLLFGNRLLDR
FT                   QRDGDFFSTEFNLTGDIEAGGFDHTVNIGTFFINSSQMDYNIISSYLADFSNGDSARLV
FT                   DLSFTNEAGDTVQYSKNGIVGPGTSYTNKDLTSKRMAFYVTDQMENDQWALDVGMRVER
FT                   AEGTTKSEGSEVVVVNDDPSLAPNLQVNTTGNGRFTYGEVATTEAAFSAAVLYKMDDQD
FT                   LNLYANASTGYFFPQIRSITFNENGEPQSYEGEDITLGAIGFKYFPEDLYIDASLFIAN
FT                   LDNRRSVDFENDGSGGLLEVVKQQSTETTGAEVITRWNMTDEVILEGNVTYQDAEFSEG
FT                   GNVGKQPRRQPEFSGNLAVSYNNGFVDARLGLSYFGDAYANDDNSVELDSHTIATLSAG
FT                   YSWELNNDQQIRVGVSVWNLFDTDGITEGSPRQGNSQVSGGEFFVGRPVLPRRVSLTAR
FT                   YDF"
FT   sig_peptide     389502..389564
FT                   /locus_tag="Patl_0334"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 21"
FT   gene            392102..393682
FT                   /locus_tag="Patl_0335"
FT   CDS_pept        392102..393682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0335"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   PFAM: Na+/solute symporter; KEGG: rba:RB7512 putative
FT                   integral membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38866"
FT                   /db_xref="GOA:Q15Z22"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z22"
FT                   /protein_id="ABG38866.1"
FT                   /translation="MNTLDFLVVALYLVALLVMGFMLREQTNKSDYFLGGKSLGWKPLA
FT                   LSVMATQLSAISFISAPAFVGLREGGGMQWLSYELGVPLAMILILATILPKLYRAGIVS
FT                   IYDYLEMRFGRSTRVLISIVFQFSRAFATGIMIYAVSLILQGTMGIEAWQAILLTGVIT
FT                   VLYSLQGGMKAVVYGDAIQMVIIILGTVACIGYGLYYLGGVDSFVANVDADRLQAVKFD
FT                   SFGFSGDGFGFWPMIFGGVVLYASYYGCDQTQAQRALSAKDPDNLRYMILANGVIRFPI
FT                   TILYCFSGLIVGTLAMTEPSFMAKIPTDNPDWMMPMFILNYLPHGLIGLLVVAILAAAM
FT                   SSLSSAINSLSAVTIEDYCRITNKELSQGGYLKLAKYMGLVWGAITLVLSLYAGNIAPT
FT                   IIEAINKVGSLFYGPILAVFLLAVLTKSTSGLHVNIGLISGVLFNLLISMIAPEIFWFW
FT                   WNFIGFVVTIVMAMMMSKVKPFTYQPSEEEAAAAPVSLSILTTKDIVLLLGMFAAMIAF
FT                   CLYIPTAFV"
FT   gene            393692..394930
FT                   /locus_tag="Patl_0336"
FT   CDS_pept        393692..394930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0336"
FT                   /product="glycerate 2-kinase"
FT                   /EC_number="2.7.1.-"
FT                   /note="PFAM: MOFRL; KEGG: pfl:PFL_1698 hydroxypyruvate
FT                   reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38867"
FT                   /db_xref="GOA:Q15Z21"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z21"
FT                   /protein_id="ABG38867.1"
FT                   /translation="MKYHAFLLELFNTAVAACKPSACMAEQLSKLDTSNGICVVGAGKA
FT                   AAEMAAETYRVLGDKCYGAVVTRYGYESAGDTGKIEVLTANHPTPDNNSLVAGKALLDL
FT                   VRETPATTPILFLISGGGSSLMCLPVDDVPFADKQQLNQFLLRSGASIDEINTVRKQLS
FT                   LVKGGRLAQAAKSKHVTLMISDVVGDNAADIASGPTISDPSTKAQAAAILQKYHWTPVG
FT                   SIANYLAKPEVAPKHSAPSEYHIVANAQHAIDAAIAVAQQQGWQTKVLGYEIQGEARDV
FT                   AKAHAQQALACRANGERVMLFSGGELTVTVGKEYGDGGPNQEYLMALALELDGIEGISA
FT                   MACDTDGVDGSKDVAGAYIDSSTLNRAAAAGVSAAELLASHNSHKFFGAIDDLVITGPT
FT                   NTNVNDFRAIIIE"
FT   gene            395040..396245
FT                   /locus_tag="Patl_0337"
FT   CDS_pept        395040..396245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0337"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: ROK domain containing protein; KEGG:
FT                   xcb:XC_4142 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38868"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z20"
FT                   /protein_id="ABG38868.1"
FT                   /translation="MSFQIGYSNFKVDVLLMFSIDNSQYLRSGFKLGKGSKLFQDIERD
FT                   IIKIVFWEQRVTQSQLVSATKIPQQTVSRLLKGLTQSKVLRQTEEMIPNPKGKPGFGIE
FT                   LNPDYACTFGVSILLDAVGVAVMDFAGNVMATEFREMDDMSIAHVLEATEQLIAELSAR
FT                   CKLDESRVLGIGVGISGFFSSMDGKMNTHHMLEEWSQVDIVQIISSHFTLPTWVVNDGT
FT                   GAAAGEGVAGVGRQYKNFVYLFVSSAFGGGVVTNTEVLRGTYGNAGELGDMLPSKIYAH
FT                   PNLELLKRILKKNGVKFSSIYNLHEEFDPNWPGVEEWIFKVQDSFDLVATCCSALLDAE
FT                   AIIIGGHIPKELAEMVIPRIDVYAQFRRGAKRPMPKIVVSGIEKHPVSIGAATIPLREL
FT                   CL"
FT   gene            complement(396334..397353)
FT                   /locus_tag="Patl_0338"
FT   CDS_pept        complement(396334..397353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0338"
FT                   /product="cyclic-AMP phosphodiesterase"
FT                   /note="PFAM: cyclic-AMP phosphodiesterase, class-II; KEGG:
FT                   vfi:VF1256 3',5'-cyclic-nucleotide phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38869"
FT                   /db_xref="GOA:Q15Z19"
FT                   /db_xref="InterPro:IPR000396"
FT                   /db_xref="InterPro:IPR024225"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z19"
FT                   /protein_id="ABG38869.1"
FT                   /translation="MRHIITKAKWLLTISLFFVISTGLQAETDRTSPAFELIVLGDSGG
FT                   IQDGNLSAFLLRSVTEPNYVALDAGTLVNGINQSVEHGAFDELAIVDDDKWGKAGSILR
FT                   HHVKGYLISHAHLDHINGMLVASPEDSKKSIYAIPSVNTMIGETYFNGKAWANFSDRGI
FT                   PPMLSKYQVVDLLPGKKAAIADTALNVTAFSLSHPVESSAFVIEHGDDIFVYFGDTGPD
FT                   IVEKQGKLDAIWTYLAKQIKHKKLRGMIIETSFENDRPHNLLFGHLTPELLMNELESFA
FT                   AKIGGEKPLKGLNVVISHIKYTLAKNVDPRANIKQQLDEANNLGLNIIIPQQGQKLQF"
FT   sig_peptide     complement(397273..397353)
FT                   /locus_tag="Patl_0338"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 27"
FT   gene            complement(397355..398536)
FT                   /locus_tag="Patl_0339"
FT   CDS_pept        complement(397355..398536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0339"
FT                   /product="HemY-like protein"
FT                   /note="PFAM: HemY-like; KEGG: vch:VC0117 HemY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38870"
FT                   /db_xref="GOA:Q15Z18"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z18"
FT                   /protein_id="ABG38870.1"
FT                   /translation="MIRILMVFVALLIAVLVGSLIFDDKGYVFIDFAGYVVEMNVFSMA
FT                   IMTILVIVGLLLFSWLIKKLIMIISGSKNWLGNWGSRKKKRAFTNGLIALAEQNFLEAR
FT                   KQLASIEQEDFDGLNLLAAAEAELQLQNPAGAQEYWRLATSYPKSAFAARLCLVRDHLQ
FT                   NQHPVKALDILDELDDKQKRQRSVLTLRAQALVQAGKWQELKDRLPSWKKALGEHYEHY
FT                   MQLASKGNFAEIASKEGANQLKENWHSLPKSTRRDPALQAAYVKQLIDQGMHIDAEAAL
FT                   GEYHKNKPHPMLLPLYKELKLSQPTTSLKQLEQWLKADDMNVELLSTLGAVAYNAKDFS
FT                   LAEKALSKAIKLGNRQQDILLLAKIKESQQDNQQALALYKQSLAQPNELTKAE"
FT   gene            complement(398533..399909)
FT                   /locus_tag="Patl_0340"
FT   CDS_pept        complement(398533..399909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0340"
FT                   /product="protein of unknown function DUF513, hemX"
FT                   /note="PFAM: protein of unknown function DUF513, hemX;
FT                   KEGG: ppr:PBPRA3530 hypothetical uroporphyrin-III
FT                   C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38871"
FT                   /db_xref="GOA:Q15Z17"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z17"
FT                   /protein_id="ABG38871.1"
FT                   /translation="MANQSDTNNSSGGKPKSDTPQNKPEQPKDKSSSAPSNAPSSPATS
FT                   TASTAVITPAAPKAESADHGTKKNPTAPLKSDNNVKKTTSASDSSGTPSATSPTKNQKN
FT                   QKPAKTGVLWFVTIVNLLILLLIVAGAYWGWTQWEQQKQTQQSTQSEQQDILTRQAQQN
FT                   LSITDEVKEQNSRLESQLRSVNKELQSALEEAEAANNQSQANKQMLSSIAGRRPADWLL
FT                   AEADFLVRMAGRKLWLEHDLKTAIAMLQSADSRLQDLDDPSLLPVRERLANDIQTLAQV
FT                   NPVSLSSIALQISALLSQVDQLPLNTFERPDIAPQGGEDVSDSVDDWKANLSRAWAAFT
FT                   KDFFSYKKKEIEVQPYMSAQQQWLATEQLKLSLLQAQSAVLKESVELYQQSLQNAQRVL
FT                   DESFAVDESAVVQFDQRIEELAETDIERVYPSQFNAAPALQDIIQQRIDNVFVNGASQP
FT                   "
FT   gene            complement(399910..400632)
FT                   /locus_tag="Patl_0341"
FT   CDS_pept        complement(399910..400632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0341"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4; KEGG:
FT                   vch:VC0119 uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38872"
FT                   /db_xref="GOA:Q15Z16"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z16"
FT                   /protein_id="ABG38872.1"
FT                   /translation="MTVLIFRPEQKCAPSAARFITAGLPAVGVGLISTQASQEALSSLP
FT                   SALGSLSSGDGIIVTSTVVSQLLAQQRIELPNSATIFAVGSSTAQGLRAQGYDVTVPLV
FT                   PTTEGLLALSPLKEIAGHTVVILKGQGGREDLAQQLTQRGATVLLADIYQRIKIATPKA
FT                   TQEWQAEQIRCIIATSGEIIDTAFEHFDAKWLQSLPWIVVSPRTEQIAVKQGIKTIFVS
FT                   DDASDQALIRRAKEFLEH"
FT   gene            complement(400636..401565)
FT                   /locus_tag="Patl_0342"
FT   CDS_pept        complement(400636..401565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0342"
FT                   /product="hydroxymethylbilane synthase"
FT                   /EC_number="2.5.1.61"
FT                   /note="TIGRFAM: porphobilinogen deaminase; PFAM:
FT                   Porphobilinogen deaminase; KEGG: pha:PSHAa0098
FT                   porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38873"
FT                   /db_xref="GOA:Q15Z15"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15Z15"
FT                   /protein_id="ABG38873.1"
FT                   /translation="MSDRVIRIATRKSALAMWQAEYVQAKLLEAHPQLKVELVPMSTQG
FT                   DRILDTPLAKIGGKGLFIKELEVAMSEGRADIAVHSMKDVPVDFPAGFGLHCICERENP
FT                   YDAFVSNTYASIEELPQGAIVGTSSLRRQCQIRSARPDLTIRDLRGNVNTRLAKLDDGQ
FT                   YDAIILAAAGLIRLEMQDRIKTYIEPTVSLPAVGQGAVGIECRNDDAELIELLKPLNHS
FT                   DTESRVKAERAMNAKLNGGCQVPIGSYAVLNGDELYLRGLVGSPDGSVLLQAEKRGNVN
FT                   DALSIGVDVAEQLLEKGAGDILQALYKD"
FT   gene            complement(401752..402231)
FT                   /locus_tag="Patl_0343"
FT   CDS_pept        complement(401752..402231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0343"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   hch:HCH_06509 histone acetyltransferase HPA2/related
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38874"
FT                   /db_xref="GOA:Q15Z14"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z14"
FT                   /protein_id="ABG38874.1"
FT                   /translation="MQINLIPLGEEHSVDISALAMRSKAYWGYSPAFMQQCAHELTYSA
FT                   QQIAHNDFHFVGAFSSFINQNSSPLGFYALQRISREEAELLALFVCPTQIGCGLGQALL
FT                   QHAISAAKSQHFTSLVIYSDPNAAAFYAKNGARRVGTQPSGSIAGRELPVYQIQL"
FT   gene            complement(402259..402738)
FT                   /locus_tag="Patl_0344"
FT   CDS_pept        complement(402259..402738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0344"
FT                   /product="YHS domain-containing protein"
FT                   /note="PFAM: YHS; KEGG: vvy:VV0794 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38875"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z13"
FT                   /protein_id="ABG38875.1"
FT                   /translation="MTINPFVIAHRTAKITVLFIMLSVSHFAFAQDPIETGFFNNKAIY
FT                   GYDTVAYFTSNKAVKGDGAFTTQWRGADWFFSSQAHLDLFKNEPEKYAPQYGGYCAYAM
FT                   ATGDFVGIDEDAFVIDNGKLYLNYSASVQQKWLANKAQYIEQADAQYLMQYPASK"
FT   sig_peptide     complement(402646..402738)
FT                   /locus_tag="Patl_0344"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 31"
FT   gene            complement(402912..403583)
FT                   /locus_tag="Patl_0345"
FT   CDS_pept        complement(402912..403583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0345"
FT                   /product="Carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   pha:PSHAa0096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38876"
FT                   /db_xref="GOA:Q15Z12"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z12"
FT                   /protein_id="ABG38876.1"
FT                   /translation="MSDNNLEYVEVNPSQPHSAVVIWLHGLGDSGNGFAPIVPELKIPD
FT                   ALPIRFVFPHAPVRPITVNNNMEMRAWYDIASLDFNHRADRVGVEESAKQVEALIDAEI
FT                   ANGTPAERIVLAGFSQGGVIALHLGTRINKKLAGIMALSTYMCEPETLASEASDANKST
FT                   PILMAHGQQDNVVPVFMGNAAYKVLEENGYPVTWQDYPMQHSVCLEEINHISAWLQARF
FT                   S"
FT   gene            complement(403630..403956)
FT                   /locus_tag="Patl_0346"
FT   CDS_pept        complement(403630..403956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0346"
FT                   /product="Frataxin-like protein"
FT                   /note="PFAM: Frataxin-like; KEGG: pha:PSHAa0095 iron
FT                   scavenging protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38877"
FT                   /db_xref="GOA:Q15Z11"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15Z11"
FT                   /protein_id="ABG38877.1"
FT                   /translation="MNDSQYHQLIDDLLINLEEMLDDVEADIDYESASSILTLIFVNGS
FT                   KIIINKQPPLHQLWVATKFNGHHFNYQDGLWIDERTGVEFWQFMNDAASKQAEVPVSFP
FT                   RPTE"
FT   gene            404076..404723
FT                   /locus_tag="Patl_0347"
FT   CDS_pept        404076..404723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0347"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="KEGG: son:SO0361 guanylate kinase; PFAM: guanylate
FT                   kinase; SMART: Guanylate kinase/L-type calcium channel
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38878"
FT                   /db_xref="GOA:Q15Z10"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15Z10"
FT                   /protein_id="ABG38878.1"
FT                   /translation="MPQSLGNLFILAAPSGAGKSSLIKALLQNHDATEIHNNEMQVSVS
FT                   HTTRAPRPGEIDGVHYHFVSRKVFQELITQDEFFEWAEVFGNYYGTSKVVIEQTLRKGI
FT                   DVFLDIDWQGARQVKAQIPDTATIFVAPPSREELMRRLTERGQDTPEVIQDRMNKAVSE
FT                   ISHYHEFDYIVVNDDFTAALAELDAIVSSRRLRKEKQVMRHQSLFENLLASD"
FT   gene            404828..405100
FT                   /locus_tag="Patl_0348"
FT   CDS_pept        404828..405100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0348"
FT                   /product="DNA-directed RNA polymerase subunit omega"
FT                   /EC_number="2.7.7.6"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, omega subunit;
FT                   PFAM: RNA polymerase Rpb6; KEGG: vch:VC2709 DNA-directed
FT                   RNA polymerase, omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38879"
FT                   /db_xref="GOA:Q15Z09"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15Z09"
FT                   /protein_id="ABG38879.1"
FT                   /translation="MARVTVEDAVDKIGNRFDLVLVAARRARQLAIEGKVAHVSVGTDK
FT                   PTVVALREIEEGHVTASTLDAENLRDQHAQDQAQFESVANILQEQ"
FT   gene            405241..407370
FT                   /locus_tag="Patl_0349"
FT   CDS_pept        405241..407370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0349"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: cps:CPS_4973 guanosine-3,5-bis(diphosphate)
FT                   3-pyrophosphohydrolase; TIGRFAM: RelA/SpoT family protein;
FT                   PFAM: TGS metal-dependent phosphohydrolase, HD subdomain
FT                   RelA/SpoT; SMART: Metal-dependent phosphohydrolase, HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38880"
FT                   /db_xref="GOA:Q15Z08"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z08"
FT                   /protein_id="ABG38880.1"
FT                   /translation="MYLFEGLKQKLEAYLPPDKVAETQRAFVVAQEAHDGQMRSSGDPY
FT                   ITHPVAVAGILADMRLDHETLMAALLHDVIEDTHHNKESLSEQFGETVGELVEGVSKLE
FT                   KIHFSSKQEAQIENFRKMLMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETL
FT                   EIYSPIAHRLGIHDIKNELEDLGFQAMYPMRHRALKAAVKQARGNRKEIIENIHKEVET
FT                   RLAAFGMNALTIGREKHLYSIYRKMKNKELMFNEVMDIYAFRVVVDSADNCYRALGAMH
FT                   GLYKPIEGRFKDYVAIPRTNGYQSLHTSLIGPHGIPVEIQIRTAEMDKMADIGVAAHWM
FT                   YKDDSESSDTTAQVRARKWMQSLIELQQSASSSFEFIENVKTDLFPDEIYVFTPDGRII
FT                   ELPLGATAVDFAYAVHTGVGNTCVGVKVERRTYSLSKPLENGQTVEIITSPRAKPNASW
FT                   LNFVVSARARSHIRHYLKHQRSEEAFSMGNRLLRHALGKTKLDEIPQADIDRVVEETKH
FT                   ADFNALVADIGLGNELSAIVARRLLGEAAEIPDSGRNVAIRGTEGLLVSYSRCCHPIPG
FT                   DEIVAVLSPGRGMMIHQAGCSNIRKLSKEEPQRVLVMKWDDEPQGEFKAALRIELINHQ
FT                   GTLANLTNNVASCGSNIVGLQTEEKESGIYYIDIELTITDRIQLADVMRKIRIMPEVQR
FT                   VSRHSQSKQNKSPNV"
FT   gene            407392..407778
FT                   /locus_tag="Patl_0350"
FT   CDS_pept        407392..407778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0350"
FT                   /product="putative endoribonuclease L-PSP"
FT                   /note="TIGRFAM: putative endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; KEGG: ilo:IL2379 endoribonuclease
FT                   L-PSP family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38881"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z07"
FT                   /protein_id="ABG38881.1"
FT                   /translation="MSKSVIHTDKAPQAIGTYSQAIKSGTTVYLSGQIPLVAETMEMIS
FT                   DDFAEQAEQVFKNVQAVCQAAGGSTNDLAKVNIFLTDLSNFATVNEIMSKHFKQPYPAR
FT                   AAIGVKELPKGAQIEIDGVMELPE"
FT   gene            407954..408724
FT                   /locus_tag="Patl_0351"
FT   CDS_pept        407954..408724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0351"
FT                   /product="tRNA (guanosine-2'-O-)-methyltransferase"
FT                   /EC_number="2.1.1.34"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   yps:YPTB0034 tRNA (guanosine-2'-O-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38882"
FT                   /db_xref="GOA:Q15Z06"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z06"
FT                   /protein_id="ABG38882.1"
FT                   /translation="MTAIAPMSVERYQRIRKLLSTRQPSLTVCLEQVHKPHNVSAVLRS
FT                   CDAVGINRIHGVWDQKTKIRKGTAMGSEHWVKTEMHTSIGDAVSVLKQQNMQVLVTHLS
FT                   DDSVDFRDIDYTQPTAIILGQEKHGATEEAIAVADKNIVIPMVGMVQSLNVSVAAAVVL
FT                   YEAQRQREVAGMYNSLQLSEEECQRVLFEGGFPVLSNVCRNKGLDYPHIDEGGNIVADA
FT                   SWWQKMQTTAKAMRQLEQEAISEIEYEKSHRGNR"
FT   gene            408761..409405
FT                   /locus_tag="Patl_0352"
FT   CDS_pept        408761..409405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0352"
FT                   /product="Redoxin"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen Redoxin; KEGG: son:SO1381
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38883"
FT                   /db_xref="GOA:Q15Z05"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z05"
FT                   /protein_id="ABG38883.1"
FT                   /translation="MMTNVKATIGCLLLLLAVLSSTVLAFERTTIAEDAQDVTPLLVGH
FT                   FAPNTKLQTADGAPVSLKAITMQKPTVLIFYRGGWCPYCNRQLAGLKDIEKSLDDLGYQ
FT                   ILAISPETPAQLQAQKLQSKFTVQLLSDSKLETIRGFGIGYYVPEDKTAQYKEKKGIEL
FT                   NASAEAGRGVLPAPAVFILDEQGVIKFSYVNPDYKQRLSPEFLYQAAKYSL"
FT   sig_peptide     408761..408838
FT                   /locus_tag="Patl_0352"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            409608..411683
FT                   /locus_tag="Patl_0353"
FT   CDS_pept        409608..411683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0353"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase RecG; PFAM:
FT                   helicase-like nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type type III restriction enzyme, res subunit
FT                   DEAD/DEAH box helicase-like; KEGG: vpa:VP0157 ATP-dependent
FT                   DNA helicase RecG"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38884"
FT                   /db_xref="GOA:Q15Z04"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z04"
FT                   /protein_id="ABG38884.1"
FT                   /translation="MLGLAQTPVTQLKGVGSKVAEKLVKLGLQSVQDLLFHLPHRYEDR
FT                   TRIYPIAELMPHLHTSVEGEVMSSDVQFGRKRMLIVRISDGTGTITLRFFHFSAAQKNS
FT                   LENGTRIRCFGEVRAGKYGLEIMHPEYKTISADSNAQLAESLTPVYPSTEGVKQITLRN
FT                   LTEQALTLLDKGGLAELLPEDVYQQQVGLIEALHLVHRPPPDVTLALLEEGKHPAQQRL
FT                   ALEELLAHHLSVLKVRQQSQLQKGFAITPSEPLLKQLLDSLPFDLTGAQQRVINDIQHD
FT                   MQRPTPMMRLVQGDVGSGKTLVAAMAALSAISAGYQVVMMAPTELLAEQHMNNFQGWFA
FT                   PLGIEVGWLAGKLKGKARNETLENLASGKLQLLVGTHAVFQETVQYQSLALVIVDEQHR
FT                   FGVHQRLALREKGVQQGAFPHQLIMTATPIPRTLAMTAYADLDTSVIDELPPGRRPITT
FT                   VVLPETRRIEVVERVRLATVEQGRQTYWVCTLIEESEVLQSQAAEETAIALATALPELK
FT                   VGLVHGRLKADEKQRLMQQFKDGEMDLLVATTVIEVGVDVPNASLMIIENPERLGLAQL
FT                   HQLRGRVGRGSVESHCVLMYQSPLSKTAAKRLAVLRESHDGFYIAQQDLEIRGPGELLG
FT                   TKQTGLADLRIADLVRDAELIPQVQTLSVKLWEQHPANAQAIINRWLGHKEHFGHA"
FT   gene            411676..412524
FT                   /locus_tag="Patl_0354"
FT   CDS_pept        411676..412524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0354"
FT                   /product="protein of unknown function DUF548"
FT                   /note="PFAM: protein of unknown function DUF548; KEGG:
FT                   ppr:PBPRA3533 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38885"
FT                   /db_xref="GOA:Q15Z03"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15Z03"
FT                   /protein_id="ABG38885.1"
FT                   /translation="MPDNSYINAVTHTVAKSPATAPVKMAPVVTVPENASPELVEKAKN
FT                   LASVWQLNFDGNVRHGLVLMQSEAHLALKQLDEPKVGEVLVDFASDALTFRRLHGGGKK
FT                   EAVAKAVGLKGQSEWRVLDATAGLGRDAFVLASLGCRVDMIERSPVVAALLADGLERAH
FT                   HSAELSAWLPQRMRLHHGIAVDLMANWCNEPANLAPDVVYLDPMFPHRKKSAAVKKEMR
FT                   LFQQLLGPDEDADGLLAPALALAKKRVVVKRPAGAPFLAQQKPHIEMQGKANRFDVYLI
FT                   N"
FT   gene            412575..412970
FT                   /locus_tag="Patl_0355"
FT   CDS_pept        412575..412970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0355"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: vpa:VP1864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38886"
FT                   /db_xref="GOA:Q15Z02"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z02"
FT                   /protein_id="ABG38886.1"
FT                   /translation="MQQSVCNVSVLVDDYDKGIEFYTQSLGFTLLEDIKNGPDSRWVRI
FT                   APNNDAGQIGAALVLMKAAVNQQQWVGNQTGGSVSFFLQTDDFHRDYQNMLQREVVFLE
FT                   EPRDEPYATVAIFQDCFGNKWDLLQPK"
FT   gene            413007..413486
FT                   /locus_tag="Patl_0356"
FT   CDS_pept        413007..413486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0356"
FT                   /product="Redoxin"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen Redoxin; KEGG: vvy:VVA1236
FT                   peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38887"
FT                   /db_xref="GOA:Q15Z01"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z01"
FT                   /protein_id="ABG38887.1"
FT                   /translation="MINVGDTLPEVTFSLRENGEASNPTTVDLFADKKVVLFAVPGAFT
FT                   PTCSNTHLPGYIALADKLAAKGVDSIICLSVNDAFVMEAWGKSQNAENVTMLADGGAAF
FT                   SQAIGLAKDTGTFGGLRSGRYSMLVENGVVKALNIEAPGKFEVSDAQTMLAALNG"
FT   gene            complement(413526..415112)
FT                   /locus_tag="Patl_0357"
FT   CDS_pept        complement(413526..415112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0357"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gvi:glr0437 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38888"
FT                   /db_xref="GOA:Q15Z00"
FT                   /db_xref="UniProtKB/TrEMBL:Q15Z00"
FT                   /protein_id="ABG38888.1"
FT                   /translation="MNWYFWRIVRLDLYNRIHKTNWWLACLCMIATTLFLFPDASAGYA
FT                   VLDINGYRGIYNSAWMGESVALVSSSFLLLFGYYLLSGIVAQEKTSQMQSLLLSSSFTI
FT                   NQYLSTKFVVNVLLLNIIGTLMIAAAMLQQLIAQEQTTIYVTAYLLPYLVLILPVTILA
FT                   SCFALLFDILPEKIRKYSNLIYFFVWASLSTLNIFGLSAHSEFTRQMEQAAPSLTAGQA
FT                   QHISIGISKLNRIQETFDWQGVNYDTFVFIPVILQLLSGLVVFAITLKLANGSCHLLYQ
FT                   SKSTRSTTGSTSKKTSSSSFALTNYLFTLNTRYPLLSAELGMLSTLLNRRFWVIATCLF
FT                   SVSLLVSLDTLRAVILAIIWLLPVVTVCQLSICDERSDTVGLLSAYRNQLTLKLTRVLG
FT                   ASIFTGLCCLGALIRFAIEGDFIAVLHLLGYCLLLPLGSVTSSMILHSQKMFQLIFLFC
FT                   WITSVVNHAPYSDLIGVTASSQGFSTTWMANLTLFILLIGYHANPFTMRCNFLYGKSKK
FT                   AVVEEVRSGAN"
FT   sig_peptide     complement(414984..415112)
FT                   /locus_tag="Patl_0357"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.545 at
FT                   residue 43"
FT   gene            complement(415114..416025)
FT                   /locus_tag="Patl_0358"
FT   CDS_pept        complement(415114..416025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0358"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   sru:SRU_0147 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38889"
FT                   /db_xref="GOA:Q15YZ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YZ9"
FT                   /protein_id="ABG38889.1"
FT                   /translation="MLNARFPKKQVQLEIQKLSKSYDENQTALNNISLTLTPGIIGLVG
FT                   SNGAGKSTLLKLIAQLERPSSGSIQLNGQDVADCPHLIRQRLGLLPQHFAVYENLTAKQ
FT                   FLQYLAAVKQVARTHVEQDISELLHALNLHEFENQKISTFSGGMRQRIGIAQALLGAPD
FT                   ILIFDEPTVGLDPHERVAFRSLLKKLAKDKIIILSSHIISDLASISDNILVLARGEVCA
FT                   FNTPENLLQHMKGKVWDIMVENSEVRQIETLFKVCDTQSFDEKTRLRVIHDTPPNECAS
FT                   SIAPNLEDAYLFFTAPCPLQEH"
FT   gene            416249..416995
FT                   /locus_tag="Patl_0359"
FT   CDS_pept        416249..416995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0359"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein, LuxR Autoinducer-binding;
FT                   KEGG: nmu:Nmul_A2417 transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38890"
FT                   /db_xref="GOA:Q15YZ8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YZ8"
FT                   /protein_id="ABG38890.1"
FT                   /translation="MMQVEEFYELLESVDESSSIDALKETCERFCQLIDIPFYLLGVIG
FT                   QTSSYSPTIRVISNYPEKWLEFYFKESEQQNDPVVKYIFEKQSPIRWDKLVEYQDFSST
FT                   KGLLVFEKAAAYGLYNGLSIPIRSTSENIAVFSVAIDERSDANRVLDNAQMFCHTFATH
FT                   LFERYVLLEISASDETDRRELTKRELECLFWACEGKTAWEISQIINVSERTVLFHLGNS
FT                   NTKLGAINRQHAVALAIKKGIIKPNI"
FT   gene            complement(416992..417951)
FT                   /locus_tag="Patl_0360"
FT   CDS_pept        complement(416992..417951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38891"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YZ7"
FT                   /protein_id="ABG38891.1"
FT                   /translation="MDTAMNNNIFALRSRCLSLVIDKAASISHYCGAAWLFCLKGKILK
FT                   LQGSTQLESEALLLSQIKASGAGADLYLSLPPNALIKDSNALVKSATDAGIVNILYPRI
FT                   PAHFRFSDNHKTNFLSNNINVIAINNALMDLGTVITMQTNEQKKRPWISCITCADLSGR
FT                   KADFSTFDGDIEAINYIKRLVGNMEFVAEEPGCLPFNVSNTKNNANQAVQHHTVNSLLD
FT                   VKKLLAHACEHKMTCGLIIVHTDLAKEMIVSGLVDEMIYYLCLHQTELENTQPINLLNN
FT                   DWKISSSYHFSKGIRFNARPESDMTKQQFNSEHRLYLN"
FT   gene            418168..418761
FT                   /locus_tag="Patl_0361"
FT   CDS_pept        418168..418761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0361"
FT                   /product="autoinducer synthesis protein"
FT                   /note="PFAM: autoinducer synthesis protein; KEGG:
FT                   vfi:VFA0924 LuxI, autoinducer synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38892"
FT                   /db_xref="GOA:Q15YZ6"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018311"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YZ6"
FT                   /protein_id="ABG38892.1"
FT                   /translation="MRQIKVIDKNNNEFGRNPELINDMFKLRSEVFKGRLGWDVESDKG
FT                   LEKDFFDNQQPSYIAMLNESDDIVGGWRAIPTTKSYMLKDIFPELLRGELAPEEKNIWE
FT                   ISRFAISKNRTGKSARVASEDTAALVSSFYSFAIKNGITDYVLVTTTACERILRYLGVN
FT                   MRRMGDGQAMQIGVEKSVALWVKVDNNLNINPIH"
FT   gene            complement(419352..419558)
FT                   /locus_tag="Patl_0362"
FT   CDS_pept        complement(419352..419558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38893"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YZ5"
FT                   /protein_id="ABG38893.1"
FT                   /translation="MKGSAFSVNGVHFYSMTNYYFIVKTDEVENITAIANSDLLNQLYD
FT                   KIDPQIMDAATQASDLISSSTLA"
FT   gene            complement(419607..419822)
FT                   /locus_tag="Patl_0363"
FT   CDS_pept        complement(419607..419822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38894"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YZ4"
FT                   /protein_id="ABG38894.1"
FT                   /translation="MQLNFATQGVNFIAFTDYALVYDAKELGDLTAAVNTDLMNVLADK
FT                   VDPALLDAATHAANSINDIASKVSVS"
FT   gene            complement(419849..420064)
FT                   /locus_tag="Patl_0364"
FT   CDS_pept        complement(419849..420064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38895"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YZ3"
FT                   /protein_id="ABG38895.1"
FT                   /translation="MQLNFATQGVNFIAFTDYALVYDAQELGDLTAAVNTDLMNVLADK
FT                   VDPALLDAATQVANSINDIASNVSVS"
FT   gene            complement(420091..420306)
FT                   /locus_tag="Patl_0365"
FT   CDS_pept        complement(420091..420306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38896"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YZ2"
FT                   /protein_id="ABG38896.1"
FT                   /translation="MQLNFATQGVNFIAFTGYALVYDAQELGDLTAAVNTDLMNVLADK
FT                   VDPALLDAATHAANSINDLASNVSVS"
FT   gene            complement(420333..420548)
FT                   /locus_tag="Patl_0366"
FT   CDS_pept        complement(420333..420548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38897"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YZ1"
FT                   /protein_id="ABG38897.1"
FT                   /translation="MQLNFATQGVNFIAFTGYALVYDAQELGDLTAAVNTDLMNVLADK
FT                   VDPALLDAATQAANSINDLASNVSVS"
FT   gene            complement(420575..420790)
FT                   /locus_tag="Patl_0367"
FT   CDS_pept        complement(420575..420790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38898"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YZ0"
FT                   /protein_id="ABG38898.1"
FT                   /translation="MQLNFATQGVNFIAFTGYALVYDAQELGDLTAAVNTDLMNVLADK
FT                   VDPALLDAATHAANSINDIASNVSVS"
FT   gene            complement(420897..422156)
FT                   /locus_tag="Patl_0368"
FT   CDS_pept        complement(420897..422156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38899"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YY9"
FT                   /protein_id="ABG38899.1"
FT                   /translation="MNKLKSESFRKDIENKIKNIDIWIDENKEYFDLYRISDSETTFLH
FT                   RKSFCEYSLYLLVCNNHTIKSKSKIVEKQFFDQLKDEKFLQLAKANRELFLAFGLPIAV
FT                   AKHLGVNNTEHENYFTDELYSQHARSLELVPFRMMDYIFATQIHGDLAHIFPVKSLYAM
FT                   SNFTRLPDPIHTDESQAYALTHNVFYLTGMRKCHDFLDVGLRFDHGIAGSLEALLIKYI
FT                   AKQDLDVSLELLASLALTGHCKEWHLDLVFCEIAKVIQNDTIIPGPVGRMGDDVKQRHG
FT                   EKFQTWAKNYHTMLVAAMCLRIIYDQLDDIFVDADPVDLKLIYSLGHSLRLADEYNLPL
FT                   LLTVLKSLETDREAIETVGLGHVIDNTIQFVNSQRNERGSIGYFHDEKMKNKSNCFETS
FT                   VHNTIKKIDDCIDWKKLAIA"
FT   gene            422332..423621
FT                   /locus_tag="Patl_0369"
FT   CDS_pept        422332..423621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38900"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YY8"
FT                   /protein_id="ABG38900.1"
FT                   /translation="MNNQNFAESSTTLKYLEKRINKIDNWVDRNLSCFQPLVADCPKGT
FT                   DYRRKAFGEAGLYIYVAAQYEAFGSPTALVESYWETISCNDYLDLARRNLSTYGLYAFP
FT                   VAVANSLGKSTEKLDAYFEDTYLSTHLRSIELPPFRLMDNLFFAKMYGLSEMPYSVEEV
FT                   NRLTNMNRLPDPIQCDEAQAYALTHNIFYLTGMKVNHDFLGLEPTYGHLQLQALEALFV
FT                   RYMANNNLDLALELLMCLILTGLCKRWHLQYALDLVDKNLIDHTIVPGPGEPEGFEKLS
FT                   ETSDEFQTWVKHYHTMLVAGMTFRLAATHIDSIWARGPSLSYFAAYASGQLVRLLNDYN
FT                   LPLALTVLKTLEEQIPDIRRLDIEYILTFSLRFIEQQCQADGKVGFYYDQYHALTTTGK
FT                   TWEEAVDTIQVPLLNIHRQINWQQFDALAS"
FT   gene            423632..424531
FT                   /locus_tag="Patl_0370"
FT   CDS_pept        423632..424531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0370"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcl:ABC3232 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38901"
FT                   /db_xref="GOA:Q15YY7"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YY7"
FT                   /protein_id="ABG38901.1"
FT                   /translation="MQLTIKKFNFLIAVIFFTSISVQCLFAYIDIISFGGVLIVSLMWI
FT                   PLLACLLSGKKCIHLMLNSVKRIDIKWMGIGIFTGFVLLFAEQGSLYFGRLGHLNDQVY
FT                   FLDTVRQQIHITNVALLLGNEPQSYAFFAFNLCLTITVVGVLMAILVVFPFEACWRGVI
FT                   FQELSNLVGIHKAPIFVGLLIGLCAMPLSLFGYINPNSPLLSAFIYMPLLSVGLSYVLA
FT                   GLAINTVSAWPTAIALGIYFIGSRNLFLLPDDAGASMAAKGVVLAIATLWIRSALISRF
FT                   EQAEQQKEDITHQAQACS"
FT   sig_peptide     423632..423715
FT                   /locus_tag="Patl_0370"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.947 at
FT                   residue 28"
FT   gene            424816..425034
FT                   /locus_tag="Patl_0371"
FT   CDS_pept        424816..425034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pha:PSHAa1766 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38902"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YY6"
FT                   /protein_id="ABG38902.1"
FT                   /translation="MMTSHKQDQNEHGIAHFAALKTAIANGEEQTVKELLPNGPMQSLE
FT                   KDYLVELAELNNNRTIIKLLQDMPAKD"
FT   gene            425166..425966
FT                   /locus_tag="Patl_0372"
FT   CDS_pept        425166..425966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0372"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="KEGG: hch:HCH_05423 ABC-type amino acid
FT                   transport/signal transduction systems, periplasmic
FT                   component/domain; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38903"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YY5"
FT                   /protein_id="ABG38903.1"
FT                   /translation="MTLVRLCRLAIILLVLPLNAKLAKATELYELTFAVNTPGSFPYLY
FT                   YDDPSQTYKGIVPDFFANLKRRERVDVTFVDSNQQRSETFVKEGKVDLYLANVGWVSEP
FT                   NKVITSIPIIQHKTFLYSLTPFDDNFDFAVVDSKRVCTQQGYVYTGLQASIDAGRLVRF
FT                   ESSSKVTLGSMLAKGRCDYAVLNNYSAKLVFSRPEFCGVTIYQSPKATSTIPLNIIMRP
FT                   ALHKVKALIDAELTGFKASGKATQSLAAHSSIPRFPMQGQCSSV"
FT   sig_peptide     425166..425228
FT                   /locus_tag="Patl_0372"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.872) with cleavage site probability 0.621 at
FT                   residue 21"
FT   gene            426068..426940
FT                   /locus_tag="Patl_0373"
FT   CDS_pept        426068..426940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0373"
FT                   /product="Heat shock protein, Metallo peptidase, MEROPS
FT                   family M48B"
FT                   /note="PFAM: peptidase M48, Ste24p HtpX-like; KEGG:
FT                   noc:Noc_0377 heat shock protein HtpX"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38904"
FT                   /db_xref="GOA:Q15YY4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YY4"
FT                   /protein_id="ABG38904.1"
FT                   /translation="MFRILMFLATNIAVMVLISLVFSLFGFQGLLAQNGVDLDLQALLV
FT                   YSAVIGFSGSIISLLISKFMAKRSMNVHVLEHPENDTERWLLRTVERQAEQANIGMPEV
FT                   GIFVHASPNAFATGWNKNNALVAVSTGLLENMTQSEVEAVLAHEISHVANGDMVTMTLI
FT                   QGVLNTFVVFLSRVIGHVVDRVVFKVERGHGPAFWIVSIISQVILGILASMIVMWFSRY
FT                   REFRADAGGASIAGRNNMIAALKRLKQNQDAPPMPEEMAAFAISAGKVQKLFSSHPPLD
FT                   KRIEALQKG"
FT   sig_peptide     426068..426166
FT                   /locus_tag="Patl_0373"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.901 at
FT                   residue 33"
FT   gene            complement(426937..427623)
FT                   /locus_tag="Patl_0374"
FT   CDS_pept        complement(426937..427623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0374"
FT                   /product="putative cyclase"
FT                   /note="PFAM: putative cyclase; KEGG: bha:BH0378
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38905"
FT                   /db_xref="GOA:Q15YY3"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YY3"
FT                   /protein_id="ABG38905.1"
FT                   /translation="MTDPRSNKRTFIDLSHRIYDGLITYKGLPAPIMCDYLSREESKKV
FT                   YGDDYQVQIGKIEMVSNTGTYIDTPFHFAADGDDLAQVSLALLADLPTVVIDAKDNIEI
FT                   GLHFFKETDVADKAVLINTNWSKHWNSEQYFENHAYLTEEAAQWLLDNGAKLVGIDSHN
FT                   IDDTRGRKRPVHSLLLANNVLICEHLTNLDKVPTQGARFYAVPPKITGVGTFPVRAFVQ
FT                   IEKSNN"
FT   gene            427750..428931
FT                   /locus_tag="Patl_0375"
FT   CDS_pept        427750..428931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0375"
FT                   /product="HI0933-like protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein-like HI0933-like protein FAD dependent
FT                   oxidoreductase FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: vfi:VF0086 NAD(FAD)-utilizing
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38906"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YY2"
FT                   /protein_id="ABG38906.1"
FT                   /translation="MKKVDVVVIGAGAAGLFCAAQAGKRGRSVAVLDHAKRIGGKILMS
FT                   GGGRCNFTNMYASHENFLCDNKHFCKSALSQYTQWDFISLVAEYGIAYHEKTLGQLFCD
FT                   DSAKDILNMLLSECDKAGATVTNQCDVLQIDKTDAGFTLQTSKGEYQCESLVIATGGLS
FT                   MPKLGASPFGYKVAEQFGLAVKPTRAGLVPFTLHEQDKSVLAELSGISLDASASCNDSS
FT                   FNENILFTHRGLSGPAVLQISSFWEPGQAVDFDLYPNGDLHEELQKAQQSQPDVLLSNA
FT                   LAAFYPKRYVQTVLPYLSIENKPLKQYQGKSLNDVAQAFHQWQLKPNGTEGYRTAEVTL
FT                   GGVDTDSLSSKTMEAKDVKGLYFIGEVMDVTGWLGGYNFQWAWSSGFVAGQVV"
FT   sig_peptide     427750..427818
FT                   /locus_tag="Patl_0375"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.719 at
FT                   residue 23"
FT   gene            complement(428980..429348)
FT                   /pseudo
FT                   /locus_tag="Patl_0376"
FT   gene            429709..432060
FT                   /locus_tag="Patl_0377"
FT   CDS_pept        429709..432060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0377"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor TonB-dependent
FT                   receptor, plug; KEGG: cps:CPS_2088 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38907"
FT                   /db_xref="GOA:Q15YY1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YY1"
FT                   /protein_id="ABG38907.1"
FT                   /translation="MKAQFKLLLLATSIASVFNPLSLNAQEKSTDTKQEITETEESQGI
FT                   EVIMVSATKRSESVQDIPLSVTAFSQQQLDIKGASSLTGIQESTPNLNFSVQSAGQNVA
FT                   RVTLRGVGTETLVGGGDPGVALHIDGIYVGRNSAAAADVFDVDRLEVLRGPQGTLYGRN
FT                   ATGGSVNIITKKPTDELEGSADLTYGNYNEARVRGVINVPLSDNLYSRITMLSESHDGY
FT                   IKNLYEGGRDVDDKDSQSGRAQLLYLADSGDEYLLRGYYSKTGGAGPGSQYLGTDINTE
FT                   NGYPSAYLIGVSSAGVGGAVLADAFGLATTATGDSVLPLPTDLHEVRKDAPEFTDTLIQ
FT                   GIDFDASINLSDTLLLKSITSYQTNDNQILVDADSSELPLETRNRNNMAKQYSQEFNLI
FT                   SQTLGPFQWILGAYYYHEELTERFEVITPSGLVPIDTQLGEGAVAGGGGITQLRIASHE
FT                   VDSTALFAQLSYELNDEWSVTGGLRYTRDEKTQSREIGGQVDITNNVQFLSGDIGPLGP
FT                   DSGTTSFTEPTYRISTDYELSPDNLLFASYAHGYKSGGYDLNGGEVTDEGEQVPYEPEF
FT                   VNAIEIGSKNKFFNNKMILNLTAFRYDYEDLQVFRLLATGPVTDNAAQSTIQGVELELK
FT                   IEPTDNVKFDGSVGYLDATYDEYSIDIPPTDFSGNRLNYAPEWTGHMGAEYVKTIGEGD
FT                   LITRVDWSYRSDTYFDRANTDLDMQEAYSLFNARVRYDTEKYYIDLWAKNLTNEDYVTG
FT                   QVINPPFTCGCRTVNVGAPRTYGVTVGARF"
FT   sig_peptide     429709..429786
FT                   /locus_tag="Patl_0377"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 26"
FT   gene            432193..433590
FT                   /locus_tag="Patl_0378"
FT   CDS_pept        432193..433590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0378"
FT                   /product="oxidoreductase FAD/NAD(P)-binding protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding
FT                   Oxidoreductase FAD-binding region FAD-binding 8 Ferric
FT                   reductase-like transmembrane component-like; KEGG:
FT                   ade:Adeh_0299 oxidoreductase FAD/NAD(P)-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38908"
FT                   /db_xref="GOA:Q15YY0"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YY0"
FT                   /protein_id="ABG38908.1"
FT                   /translation="MNSKLLSRAVGQLPAVKRSPMSFYSLVAIYIILILAPWALSYIEG
FT                   LQIRGWYEELVTLLSISGMAMMLCQFTLLNGRVDAINSRIGVDNSMRVHNKAGEYLAIL
FT                   FFLHPFLIGLPRFIVAPSFALDNLWIMFTSAESATGVYAWSLLIVLVLMAIKKNKVGLS
FT                   YEAWRYTHSVGFVAVIILATHHAVTVGRHGRYNLWFDVLWIALCAVAVSVVGYVYFIRP
FT                   RSVSKRPFTVVDCQKGSADDWYLTIKKDADFQFEFDAGQFVWINTSGSAFKRNEHPFSI
FT                   ASSPRSLPELSFVIRNLGDYTKQLGKLQFGQRVWVDGPHGVFTLNARNAQGIVLLAGGA
FT                   GIGPIIGILRGLNDRGDTRPIRLIYGNRNMAQMMFLDELIDMTKNMNLVTTLVLNDAPD
FT                   DFPPTGFQGHKGFINQSVIEATGQGYNTQNWDYYICGPQPMVKAVERTLQQLEIPQSRI
FT                   LYEQLGF"
FT   gene            433657..435582
FT                   /locus_tag="Patl_0379"
FT   CDS_pept        433657..435582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0379"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein-like FAD dependent oxidoreductase
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: afu:AF1463 fumarate reductase
FT                   flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38909"
FT                   /db_xref="GOA:Q15YX9"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YX9"
FT                   /protein_id="ABG38909.1"
FT                   /translation="MTDEKDIKYQKSSSKSVNQNESASEKIKEGVTRRDVLRAGAYTAA
FT                   ALAAPFIVNTGARVEASTTEPVRKADLIVIGSGFAGTFAALEARKQGLSVVMVDKGVVG
FT                   WSGMSPWASDSRPFDPDIYDRDEWQQNMAMNTEYVNDRKWLDIFMDESLDIFNILHEMG
FT                   AHNTRPFERGSVVFRKELEDAGVSLVERTMITSLLQEDGGKVCGAVGFTYDDTAEPSKA
FT                   VVLRADAVLLCTGAGSYKSPGFPIWGQTFDGDALAFNAGAKIVGKEYNDTHPTFAFAPA
FT                   AAYEGWRWAQSVKGAYVMVGPPDKLDGGLTLGSALGVYQNGVNRQLGVGPGGEPPPPKD
FT                   GPRPESLIVKDNRKYLGKGYLTQPDLILDLGGPPEGAGEDAGFGHRVGGATAGMGVHKS
FT                   EGVFCSDYSGAADSVEGLYAAGDALGSMLCGSLYPGRGFSSYGSAIQGRIAARNAVKYV
FT                   KSLARRPKISQQQIQAKLAEMWAPRNVEQGYSPEWITATLQNTMTPIHILYIKEPRRLD
FT                   GALASIEFLRTQCIPKMIARDGHELRMAHEVKSMLLNAEMKLRTGLYREESRGTHFRED
FT                   FPARNDNDWHCWVTVQKQKDGMLMGKHMLPESWKPDQSKSYRENYPREFPGEMDFLANN
FT                   PQFTRR"
FT   gene            435638..435853
FT                   /locus_tag="Patl_0380"
FT   CDS_pept        435638..435853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0380"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding; KEGG:
FT                   afu:AF1461 iron-sulfur cluster binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38910"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YX8"
FT                   /protein_id="ABG38910.1"
FT                   /translation="MPIEKIHGCIGCEKCVQACPTDVIRMDPESGQAFIAYQQDCQICH
FT                   LCRLSCPVDAITLTPDKAMLPTTSWG"
FT   gene            435956..436861
FT                   /locus_tag="Patl_0381"
FT   CDS_pept        435956..436861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0381"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: chy:CHY_1273
FT                   transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38911"
FT                   /db_xref="GOA:Q15YX7"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YX7"
FT                   /protein_id="ABG38911.1"
FT                   /translation="MILFPKGLSLGRHKRHPLKPAQAAHVQSRQVKKSIKKDKLNAIEK
FT                   SLEILITFTNTNHELSTGEISKLTGFHKATTSRILSTLVEYGLFAHNDQSRKYSLGPLA
FT                   YRLGLSRVSQSIQHFVEVSSPYIDRLRDSTNESISLEVWSGTGTIACYFAESRDPLRVS
FT                   MAQAEILPLHAPAGAKAILSFMHCEQVIKMLDYEFEVLTKNTLTSKSELLRRLETFNRQ
FT                   GYATDNQELHLGIYAIGVPVFDRLSKPVAAVCMVMPATRMTPEKEAEAVRCLKRTANAI
FT                   STELKSLPNASFRFDPMQRS"
FT   gene            436875..438056
FT                   /locus_tag="Patl_0382"
FT   CDS_pept        436875..438056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0382"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:bll6424 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38912"
FT                   /db_xref="GOA:Q15YX6"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YX6"
FT                   /protein_id="ABG38912.1"
FT                   /translation="MRASHIVDAAAFSSRAAMTAMISCHVAGLFFLPMMPLVMGAFVSD
FT                   FSAQTLSLGSIASIQLTTTALGAFSFTIIGARTSCRRIVLAAIASELLLNAATLVSSSF
FT                   SELIVLRGASGFAQGHLLAAAGACAALSRRTEKTFAFYNATLAIFAVVFLFVGALVVPL
FT                   FGHAGVFVLFVVVDTLALAFIYFGLPDFTLQARQASSSARATPLTRAGTYAFIALILFG
FT                   VALSGTQTFIERLGYWHGAALNVIATSLGWGWCIAIVAPFLLIWLIGRCKDNLVLLLPA
FT                   YTLIVGLTIILSLMQTTFIYLVAVALFTPLIMFIEPLQFGVLGQLDDTGRLAALGPGAI
FT                   SIGSGLGPLILSSVVNAFGLISVGITAGCLLMISFLFLYPVCIKANKNVFKKQ"
FT   gene            438300..439991
FT                   /locus_tag="Patl_0383"
FT   CDS_pept        438300..439991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0383"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: pfl:PFL_0205 arylsulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38913"
FT                   /db_xref="GOA:Q15YX5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YX5"
FT                   /protein_id="ABG38913.1"
FT                   /translation="MFGICNEQQAQQQNQRSVNRPNILLIVADDLGYSDLGSFGGEIAT
FT                   PNLDKLAKDGGSKLTNFHVAPTCSPTRSMLMSGTYNHLAGLGAMAEWVADNQRDKPGYE
FT                   GYLNDRVAPLPALLQDAGYRTFMAGKWHLGMLDGQGPDSHGFDNSFAMLPGAGDHYSDR
FT                   GLFPFMAKTPYRENGKAVTLPDDFYSTRFYSDKAIQYIDSAVTNKDQPFFGYLAYTAPH
FT                   WPLQVDKKYSDKYQGKYSIGYEEIKDARLARLADLGLIDEHATHSEGNACYAKWQQLST
FT                   EEQGKQARMMEIYAGMVDALDENIGRVIQHLKDIGQYDNTLIVFISDNGADARPEQGLA
FT                   EEAKYVQETFDNSLQNMGAAGSFVSYGGAWAQVSNTPFSLHKGMVTEGGIRVPAIIHLP
FT                   NNQGQAENRSQTEAQTLTEFASVMDLLPTFLDVAGAELPGSEYKGQKVLPIVGKSILPY
FT                   LYGEQDFVHKDEVYGFSVHGRQGLQYNQWKLVRLPAPYEHGKWQLFNLDEDLGETHDLA
FT                   GDNPKKLQEMIARWDTFAANTGVIISDKNMKTPKECIIEKKGTLAN"
FT   gene            440605..441546
FT                   /locus_tag="Patl_0384"
FT   CDS_pept        440605..441546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0384"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="KEGG: hch:HCH_06743 hypothetical protein; TC
FT                   3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38914"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YX4"
FT                   /protein_id="ABG38914.1"
FT                   /translation="MFFTIPLLSMAIFNYLERLCLFYTLNKKLLCMAVQCVLLLFFDGD
FT                   ALAEPETTILYPKPLSVDDHRPIYPVRLLELAISKLGKPYRLKPSKGLMNQSRALRMVG
FT                   SQNAPDIVWTMTSKEREEAFEPVRIPIYKGLIGWRLFLVHAGNERRFEQINSLAGLQKF
FT                   TAGQVHDWPDTYIMNSSGIDVMSSSMYERLFVMLDGERFDFFPRSLIEIWSELDARPQY
FT                   NLAVEKRLLLRYPAALYYFVNPNNKELAADIERGLQIAIEDGSFDLMFEKHNQWLIDKS
FT                   NLSERIVIDLPNPLLPARTPLKNAALWYQIEP"
FT   gene            441601..442029
FT                   /locus_tag="Patl_0385"
FT   CDS_pept        441601..442029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0385"
FT                   /product="thioesterase superfamily"
FT                   /note="PFAM: thioesterase superfamily; KEGG: sil:SPO0440
FT                   thioesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38915"
FT                   /db_xref="GOA:Q15YX3"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YX3"
FT                   /protein_id="ABG38915.1"
FT                   /translation="MQEEAQEEQALGKLTTRTLAMPADTNAAGDIFGGWVLSQMDIAAG
FT                   ICAGQRAQGRVVTVSVESMSFIRPVHVGDILGLYTRVVKLGRTSMVINVEAWVRRDRIG
FT                   LREKVTQGQFKFVAIDDKGVPMPLPSEDELPDYVLENF"
FT   gene            complement(442111..442671)
FT                   /locus_tag="Patl_0386"
FT   CDS_pept        complement(442111..442671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0386"
FT                   /product="outer membrane protein, porin family"
FT                   /note="KEGG: ilo:IL1417 outer membrane protein, porin
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38916"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YX2"
FT                   /protein_id="ABG38916.1"
FT                   /translation="MKASKIALLAATVISVPTAYAASPDFNYVEGGYAKIDVDNSDYEP
FT                   DGFKVSGSALVGKNVFVNGSYTDTSDEINNSDIDFNQLSLGIGYRMAASSNTDVYGVVS
FT                   YEEAELEDYDENGYGLTAGIRSRVTPNIELDGGVSYIDLDDDDDTYLNLGASYYFTPEA
FT                   AVSVSYRTSDDNDIMGVSARYSF"
FT   sig_peptide     complement(442606..442671)
FT                   /locus_tag="Patl_0386"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            442956..443183
FT                   /locus_tag="Patl_0387"
FT   CDS_pept        442956..443183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38917"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YX1"
FT                   /protein_id="ABG38917.1"
FT                   /translation="MKKYMLILPLVCGLSACGTPSVEDLVDDPELLSEVLATCTEKLMK
FT                   GEEVKTEECQNATEAQKQILNNVMKGLLGN"
FT   sig_peptide     442956..443024
FT                   /locus_tag="Patl_0387"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.468 at
FT                   residue 23"
FT   gene            complement(443295..444002)
FT                   /locus_tag="Patl_0388"
FT   CDS_pept        complement(443295..444002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0388"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pha:PSHAa2209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38918"
FT                   /db_xref="GOA:Q15YX0"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YX0"
FT                   /protein_id="ABG38918.1"
FT                   /translation="MKTLVSLVSFLAILLVALPGPLYKFGILELGTAFAALRFGVYAGI
FT                   AALVLILIQIIFMRKNISWAGVAVSAVLALIAVGLPMSMMSKAKSVPPIHDISTDLVNP
FT                   PKFVAIVALRADAPNPVEYAGEETAKQQRDAYPELTTQKYSQSTEQLFDATQAAINDLG
FT                   WELVNSDKSLGLVEATDTTGWFGFKDDVVVRIRTTGEESFLDVRSKSRVGKSDLGKNAE
FT                   RIHSLIDAINSKL"
FT   sig_peptide     complement(443928..444002)
FT                   /locus_tag="Patl_0388"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.771 at
FT                   residue 25"
FT   gene            444125..444964
FT                   /locus_tag="Patl_0389"
FT   CDS_pept        444125..444964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0389"
FT                   /product="Sterol desaturase"
FT                   /note="PFAM: Sterol desaturase; KEGG: par:Psyc_1393
FT                   possible sterol desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38919"
FT                   /db_xref="GOA:Q15YW9"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YW9"
FT                   /protein_id="ABG38919.1"
FT                   /translation="MQNEAWLRMGTFILVLAVMMIWEALLPNRVSPVARYKRWSSNFFL
FT                   VLCGALTGRLLAPAGLAVVAIYADERQFGVLNILPVPEWAAVTLAVIALDCLIYWQHRV
FT                   FHRVPLLWRLHRVHHADPHLDASTGLRFHPIEIALSLSVKGLGILLLGVPVIAILIFEI
FT                   VLNASAIFNHSNIKLPNWLETPLRKVIVTQAMHRIHHSQVVKETDSNFGFCLSIWDRLF
FT                   HSYTREAKAGDDGLTIGLNEYDKESNNTGIGTVLMMPFRHTPEKERCQKERRQKERR"
FT   gene            complement(444971..445591)
FT                   /locus_tag="Patl_0390"
FT   CDS_pept        complement(444971..445591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0390"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   ilo:IL1156 phosphatidylglycerophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38920"
FT                   /db_xref="GOA:Q15YW8"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YW8"
FT                   /protein_id="ABG38920.1"
FT                   /translation="MLDPILNKLLKKPLCSAAKQLIKRGATADSVTVAGFVIGILAVPA
FT                   IIYGQYVLALCLILLNRLGDGLDGAIARETSPSDAGGFLDITLDFIFYSAIVFAFVCAN
FT                   PVDNAIAGSFLMLSFMGTGGSFLAFAIMASKHGIDSPNYPQKSLHYMGGLAEGFETILV
FT                   LCLFCLFPSQFVLIASVFAAICWLTAIIRIWVGYHTLVATKDS"
FT   gene            complement(445651..446331)
FT                   /locus_tag="Patl_0391"
FT   CDS_pept        complement(445651..446331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0391"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   vvu:VV12861 ABC-type uncharacterized transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38921"
FT                   /db_xref="GOA:Q15YW7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YW7"
FT                   /protein_id="ABG38921.1"
FT                   /translation="MLRINNCQINTVSGQISLPDITLEQGELLVLTGPSGMGKSTFLHW
FT                   LLGDKIQHANISGEIILNEQAINDLNVEQRGIGLLMQDVHLFPHLNVVDNICFALPTAV
FT                   QNQQGKKQNKQQRRKTAINMLDKIELGYVAEHFSDQLSGGERSRVGLVRALANQPQALL
FT                   MDEPFAALDPNTNAKVSQWAFEQLQQQGVPSIMVSHDIDNIPAHAQHIDLGAYFQSASH
FT                   AKSD"
FT   gene            complement(446315..447964)
FT                   /locus_tag="Patl_0392"
FT   CDS_pept        complement(446315..447964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0392"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /note="KEGG: vch:VC1665 ABC transporter, permease protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38922"
FT                   /db_xref="GOA:Q15YW6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YW6"
FT                   /protein_id="ABG38922.1"
FT                   /translation="MATTIRRLTLVVGWLLVALVAGLPVFGIVLGLWLSPPISWEHVSV
FT                   FFDYNGLLSSVLSSLLLSLLAPIIALYVAFTVYSQYRFNPRWQALEQRLAPLLSLPHLA
FT                   VALGIVYLFSSGGMLWSALWELAGSTPPEWLGVGRKSMLTMLIAISIKEVPFFLFIFSA
FT                   LGRQLAIKDWLLQGRALGYSESASWWLLVFPTVLKQSRLALLAAMAFTLSVLDISLLIG
FT                   PNIPELYAVVLYNWQTGFTAAEQAMAFLGNLLLLVMLGVLVAAIYIHEWFATKRIRTLA
FT                   IMANPLKITRFARVFTAWLGLFSLLTLAILLTFLLWSLGWNTQNPFNATSWSTALWQDE
FT                   WFFMQAPLLNSLNIAFFSSIVGVAMTLIALELQRQSKRYLPDYVWLLAILLPQLSMVYG
FT                   WQIAHTDMSASYNTAWIVLSHLPFTFAYSYLVLRGPFQSLDRHYELVAASFGYSYWQRW
FT                   WQVRFMLLRPALISALAIAFSVSVAQYIPTLMMGAGRVSTITTEAVAIASGNEQSITAV
FT                   YLLVQALLPFVAFFIASVLAQRLRGSFDAAHQ"
FT   sig_peptide     complement(447881..447964)
FT                   /locus_tag="Patl_0392"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.935) with cleavage site probability 0.735 at
FT                   residue 28"
FT   gene            complement(447940..449061)
FT                   /locus_tag="Patl_0393"
FT   CDS_pept        complement(447940..449061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0393"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein, putative"
FT                   /note="KEGG: vch:VC1664 ABC transporter, periplasmic
FT                   substrate-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38923"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR027020"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YW5"
FT                   /protein_id="ABG38923.1"
FT                   /translation="MAIGNDALNDLKGNQASPRESSKQWQQTLATARGETVYFYAWGGS
FT                   KPVNNYLRWAAREIASRYQVRLRHVKVADISEAVSRLKAEDGSKSAIDLLWINGENFSY
FT                   LKEQELLLGGLTNAVPNSALLATEQLSLGNDFGVPMDGFEIPWGVGQFNIIANENAFAQ
FT                   ISITPADILSAAKQQPGRMSYPRPPEFHGTTFLKQLLVALSHNDKRLFELATPESQQQL
FT                   LPALWDYLDKLHPLLWQKGSAFPSSNTEQLALFQQDQQTIAVSFNPNQISKEQDEMRIP
FT                   QSAKRVYFAGGAITNSHNLAIPKGAQSPAGAKVVIHFLLSELAQERKLNGTWGDPAVIT
FT                   PLLDKASTLPSQQELHSSWQQIIEDTWQQRYGA"
FT   gene            complement(449144..450022)
FT                   /locus_tag="Patl_0394"
FT   CDS_pept        complement(449144..450022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ilo:IL1167 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38924"
FT                   /db_xref="InterPro:IPR006869"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YW4"
FT                   /protein_id="ABG38924.1"
FT                   /translation="MHTPSNQVTRLIRYTLTAGSLLLASFSFVLHAAEFDHSYANFDQL
FT                   LTQVVQTSDDKKQTRVDYQRLSVQKDTLHISLNAFSAVSKSQFDGWDKQQQLSFLINAY
FT                   NGFTLKLIVDNWEEFKQGDADSIRDLGSLFTTPWEKKFFTLFNEKHNLDDIEHEMVRKW
FT                   FKEPRIHAALVCAAVSCPPLRNEAFVPSELTAQLDSQMQLFLADNSRNEIKVHGQKGEA
FT                   SLSSIFKWYRSDFEKGDQGFNSLFDLLNDYSDALVEGDSNPQEQRNLIKSADYPITFKD
FT                   YDWRLNDVANF"
FT   sig_peptide     complement(449924..450022)
FT                   /locus_tag="Patl_0394"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 33"
FT   gene            complement(450118..452259)
FT                   /locus_tag="Patl_0395"
FT   CDS_pept        complement(450118..452259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0395"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   dimerization region"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase glucose-inhibited division protein A
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region; KEGG: ilo:IL1160 mercuric reductase,
FT                   membrane-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38925"
FT                   /db_xref="GOA:Q15YW3"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YW3"
FT                   /protein_id="ABG38925.1"
FT                   /translation="MNSKRAILVIVIAALIASFFVFDLNQYLTLESLKNNQQDLAQYIE
FT                   ANWLVAFVGYLAIYAAATALSVPGAAILTLGAGALFGFGWGLLLASFASSIGATLAFLA
FT                   SRFLLRDWVKSTFSKKLESIDKGIEKDGAFYLLSLRLVPIFPFFIINLVMGVTGIKTWT
FT                   YYWVSQLGMLIGTAVYVNAGTQLVEINQLSDIISTDLILSFVLLGIFPILAKFILSALQ
FT                   QRRVYKGWKKPKKFDRNLVVIGAGSAGLVTAYIAAAIKSKVTLVERHKMGGDCLNTGCV
FT                   PSKSILHASKLAHIHHTSQNAGVTYDAPKIDFKAVMNKVHSVIKSIEPHDSVERYESLG
FT                   VNVAIGNATIVSPWQVDIQTENGVESLTTRNIVIATGARAFVPDIPGLKDIDYLTADNL
FT                   WEITEQPKRMIVLGGGPIGCELSQAFGRLGTHVTQIERGDQVLSKEDPDAAKHLQIQLE
FT                   KDGIDLRLNTSAMAVETTSEGNVLVVEFEGKEERIPFDKILVAVGRQANLTGFGLEKLG
FT                   IETDRTVITNDFLQTKYPNILAAGDVAGPYQFTHTASHQAWYAAVNALFRPFKIFKVDY
FT                   SVIPWATFAEPEIATVGLNEMSAKQQGIEVEVTRYDIGGLDRALADDHARGFVKVLTKP
FT                   GKDKILGATIVGANAGELLAEFVLAMKHGLGLNKILGTIHIYPTMAEANKNVAGNWKKD
FT                   HAPQKVLDFLERFHTWRRK"
FT   sig_peptide     complement(452182..452259)
FT                   /locus_tag="Patl_0395"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.777) with cleavage site probability 0.465 at
FT                   residue 26"
FT   gene            complement(452281..454680)
FT                   /locus_tag="Patl_0396"
FT   CDS_pept        complement(452281..454680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0396"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor TonB-dependent
FT                   receptor, plug; KEGG: pha:PSHAb0232 putative TonB dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38926"
FT                   /db_xref="GOA:Q15YW2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YW2"
FT                   /protein_id="ABG38926.1"
FT                   /translation="MSILPHSLFVSASLAMAFTVSAQEQSRPAQVGTEANTSNEQDNNL
FT                   EHVTVTGSAQPTLIMSPKNAVIDGPFGKDKNLTEIARTLTSISSDMLEQLSIDDLQDVL
FT                   TLVPNTYSASGFGAPSLPTIRGQLGELFQQGMRRQAGNNGFGIPLSFNSVGQIDVVKGA
FT                   PSVILGTTQRNGGFVNLNNKTATLSGTDLKLQASAGSWEHYRGQVDVNTTIEEGRSGIR
FT                   VSAEYIDNNSYYDFTEFQSEDLFIAYKILPDDKSSWDISFEYYDVEFTDNAGINRPTQN
FT                   LIDNSLYITGQGVQPNGSQVPGAFAVVSPTGEVRIPRSTVLTDPDNINNAQTYVFHSTY
FT                   ERQLNAVHTLTNRSYFQYLDREEIAQNSFVEIIDGAKTAQNRLELTSAWSGDQQTTWGI
FT                   DLRYNDVLGYSQFTTEADLPIDLLGSIEQRRIPLTEAQQARLVELRPGVFVSPGANYDI
FT                   DGDGNNDFSLSDTTDSTTWQTGLFAEQDSDWTSRFSTTVGLRADHYDVTARDALPPQGQ
FT                   VAAEDSFSKWLYSGSASARFKINNDIVTYATYSYSEATSNSMGGGTVLGAENKINPLNF
FT                   ATENELYELGVKFSPVGSPWYADASVFEQSRSLRNRDGSNTGIIAKGFEAQVFYQGSSL
FT                   WANLGYSYLDARYDDSASAQDSQQVADAFDNSRPDIIQGTGIGAPNFAGFAPSNERVQG
FT                   IPQQTVSASAGYQIWDNWDVSGSAIYSKSYPLDYLATVLIRDQITININTNVALTDQSS
FT                   LRLEIRNLTDENNWRPVFEGGYFGSTLVFPELPRNVQLTYTYNFKA"
FT   sig_peptide     complement(454612..454680)
FT                   /locus_tag="Patl_0396"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 23"
FT   gene            455020..456267
FT                   /locus_tag="Patl_0397"
FT   CDS_pept        455020..456267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0397"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   yps:YPTB0668 MFS family transporter, sugar efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38927"
FT                   /db_xref="GOA:Q15YW1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YW1"
FT                   /protein_id="ABG38927.1"
FT                   /translation="MSLVDKDSRYYLAGFLNACIMASLMPVLSLYAYRYLDTTATQLST
FT                   LLGGYALSSIMYAFLIARIVEQVGKHKHWLLGISFLAAGALVVLANTQNYLVVCVVMLG
FT                   VFAPFHASTALLMGLAFRYFRKTQIKRVNARVMATVSAAWVVCPSMAFYTVEEFGFSVF
FT                   LYALALVMPLLTLMFCTLPASNEKTIQSDAEIHQPRGQLGVIKNKGLLAPKTKVKNRLG
FT                   LYLRLLPPVLFFALLSFAINLYQHILPVYFVEQALPVSLVGTLFMCAAIAEIVLIVRCV
FT                   NLLSRFTYFQLFIIASVSGIAFFLLLPLNQSMTYLFLIQVLKALMYGLMAGLGVNLLQH
FT                   LLPNEPTFGATLYQNAFAVGMLFAGFAAGGTIELMPPNWLFSISAMVTLLCLLILLATK
FT                   RAFSITRLPHVENTKG"
FT   gene            complement(456257..457240)
FT                   /locus_tag="Patl_0398"
FT   CDS_pept        complement(456257..457240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0398"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: son:SO1695 sensory box/GGDEF family protein;
FT                   TIGRFAM: PAS sensor protein diguanylate cyclase; PFAM:
FT                   conserved hypothetical protein; SMART: PAS"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38928"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YW0"
FT                   /protein_id="ABG38928.1"
FT                   /translation="MPDANQPKNKNVNSSSLLEALSLPLLNEKMHAFSKMVNVIAEAIF
FT                   IVNGDGVIEVINPLAAKFFGAPQEALIGQKWFQFLHERYREQYEYLFINWNKTSGLPLN
FT                   HGPKEVLINRHDNTWLEADLSVSCLPTSLTASTPLFVGVMHNLTKHKSEYSELRRLAST
FT                   DHLTGLANRHNLEKTLQKSWLDCVNTEQAISLILIDVDYFKLFNDQFGHVNGDKCLQKI
FT                   ARTIEQCLPSNDSLAARYGGEEFAVILPRLRSVSAEIVAKDIQQQINTLNFSDLGLPSS
FT                   FRVSVSQGIATELGGQFRTSEALICASDTALYRAKSDGRNRISISP"
FT   gene            458952..460482
FT                   /locus_tag="Patl_R0008"
FT   rRNA            458952..460482
FT                   /locus_tag="Patl_R0008"
FT                   /product="16S ribosomal RNA"
FT   gene            460587..460662
FT                   /locus_tag="Patl_R0009"
FT                   /note="tRNA-Ala2"
FT   tRNA            460587..460662
FT                   /locus_tag="Patl_R0009"
FT                   /product="tRNA-Ala"
FT   gene            460681..460757
FT                   /locus_tag="Patl_R0010"
FT                   /note="tRNA-Ile2"
FT   tRNA            460681..460757
FT                   /locus_tag="Patl_R0010"
FT                   /product="tRNA-Ile"
FT   gene            461137..464021
FT                   /locus_tag="Patl_R0011"
FT   rRNA            461137..464021
FT                   /locus_tag="Patl_R0011"
FT                   /product="23S ribosomal RNA"
FT   gene            464285..464400
FT                   /locus_tag="Patl_R0012"
FT   rRNA            464285..464400
FT                   /locus_tag="Patl_R0012"
FT                   /product="5S ribosomal RNA"
FT   gene            465515..467716
FT                   /locus_tag="Patl_0399"
FT   CDS_pept        465515..467716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfl:PFL_1302 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38929"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YV9"
FT                   /protein_id="ABG38929.1"
FT                   /translation="MTTKTQMDLPAVDETTEQVIEKKSDAKKITSESAPSPPSTSDTLV
FT                   TDPYMYFTERDLDKILANIDALRNSVFPVINPDADIESRSPQNFPSVCLIGLGRCGSNI
FT                   ALDVASLVYNARNFYLNEFENEERETREQEYRPMRWIKRGLHLSSAQDVKPVFLIEPLV
FT                   MLGDLDKDIEGRVRFSNKGEKASFLQEYTKMKIMDLSEVHAGGAGNAPILGQYLAKIIL
FT                   NKDTQRFANKDWKYIHSYLIDSCGIKANQSRLYFYIFSAGGGTGSGMASEFGLAQQYAY
FT                   MSKTFETRAVNESEDNRGHSFVFEPIFTSGICILPNISDHGVEMSEALHINAGRLLCKY
FT                   MAEEWDFSYNFDKEDSSDASAMHRIRPWNAMMLISNDIMRYAEETDDSGIQYIDVNAME
FT                   KHANQYISQQIFNILTAQAVTTDYDENYFRRAGIDIGETIRLDANDLFMSLAGPVALAY
FT                   AESVVPVENVSAVDKIKILDRGANDLDIDDLFFRSIDLPHFNKVTQAIEGISLLPIEST
FT                   RYRERLSEYVKSGYDATHLKDLHFFKNCSSVVSIISLPKDYKLSYMDLNRLKSHLNALF
FT                   PNTTLKRYALVIGASANISLTTLVVKSPCLSDDFLTLIVAYIKRCFAKDNYRFDEQLDQ
FT                   AMLDFIRGETFDEDALDAMLEEHENPAKILDTNWYAIKPMYEKKYRELIREKDKFVSIN
FT                   DIRLSRDSVKKAIKYLREIYRHKISKTKVISLNDDSSGM"
FT   gene            complement(467916..468995)
FT                   /locus_tag="Patl_0400"
FT   CDS_pept        complement(467916..468995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0400"
FT                   /product="Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit; KEGG: vch:VC1061 cysteine synthase/cystathionine
FT                   beta-synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38930"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YV8"
FT                   /protein_id="ABG38930.1"
FT                   /translation="MTLPTEKKKWLAAALTIINADFNRSSDTHLIKVDLPCFVDVSLYL
FT                   KDESTHPTGSLKHRLARSLFLYGLCNGLIHQNTTIVESSSGSTAISEAYFARLLGLRFI
FT                   AVVPKSTASEKIKQIEFYGGECFKVEPSDLYAKAQQLADELNGHYMDQFTYAERATDWR
FT                   GNSNIAESIFAQMAMETHQIPSWIVVSAGTGGTSATIGRYLRYNPALHLKTQLAVVDPD
FT                   NSVFYDYYRDRDSAISNNKGSRIEGIGRPRVEPSFLPDVVDHMIQVPDAASIATIRWLE
FT                   GILGRKCGGSTGTNVYGALKLIAQMIENKQQGSVVSMICDAGERYLNSYYDDDWVAQQQ
FT                   LDLTPYTQQLENFMLTGEM"
FT   gene            complement(469395..469790)
FT                   /locus_tag="Patl_0401"
FT   CDS_pept        complement(469395..469790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38931"
FT                   /db_xref="InterPro:IPR015078"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YV7"
FT                   /protein_id="ABG38931.1"
FT                   /translation="MFPQIKKIKSRVFTSQEGEPVVQFYDSEQKSWDEEIVLDFNRSGM
FT                   AIFTLDTDDSADPYIFFGALQKTEDGCNPDTNWDFMINGAGNIICFNNDCQSAQDISVR
FT                   LTLIQRGDDEFANAIISADPKFKNRPT"
FT   gene            complement(469824..473198)
FT                   /locus_tag="Patl_0402"
FT   CDS_pept        complement(469824..473198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0402"
FT                   /product="lysine decarboxylase transcriptional regulator,
FT                   CadC"
FT                   /note="PFAM: transcriptional regulatory protein-like; KEGG:
FT                   son:SO1699 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38932"
FT                   /db_xref="GOA:Q15YV6"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YV6"
FT                   /protein_id="ABG38932.1"
FT                   /translation="MNAKKISNIFYIGDWQVTPQTNSVRAGDAVTQLEPKAMDVLLLLC
FT                   QQRRDNGHEHALSADDIASQCWGSEIGDNPVHKAITQLRKAFNDKPSTPKYIETIRKRG
FT                   YRIVAKLDFPDEALTNDPQESTNDWQGGSPFPGLSAFEPDESNVFFGRSAQITALLTRV
FT                   SKLVSAKHAFCLVLGPSGSGKSSLINAGVLPRLTHQNGHDGIGVVSYTSVDLADVSQSR
FT                   LFIDLASSLLDWDINDIPVFEGLSAETLADMLQEDCPQVAVLCNKALASIQQQTPASRY
FT                   AQPQLFLFIDRLEVLLSSPVFNDDERKRFLKCLDTLATSGSILIFSACRNDFYPLVVAH
FT                   PSLMAGKDQGAHFDLLPPSSSELSQMIRLPAKAANLSWTNEPNSTNPLDEILCHEAVNH
FT                   PDALPMLQYTLQELYEQRSANNEMQYSVYRHLGGIEGAIGKKAEQIYLQLSKDQQSQLE
FT                   YILSLLVTLSPDGENITSRAARWSQLDDNPIKHSSQHELVQAMVESRLLVSHLQHGEPC
FT                   FSLAHEALLRKWPRASNWINEHRDALRIKSQLQQLAGRWQFEERNKAYLLPEGKPLLEA
FT                   VNLQKSAVFKLDEEECALIKASQKSGNVKRWLKRTTVTLLCVLTFTALFMSVKSQQAEN
FT                   LAQQKRLEAESLLGFMVGEFADKLRSVKRMDLLDGISNKALEYFSQQDEEVEVSFFPSL
FT                   TDTAQNFKTRFQHAQTLAAMGEVAYSRNKNDEAKQAFSSAKTILDKLYKIQPENSELLK
FT                   ALGANAFWLGQLASDKAEFTLAKPHFEEYLSYSKLMNQLEPNSDDAKLELSYAYLAMGG
FT                   VNSKLQELGVAKMAFEKALAIQYELTEDLAKTDMSQVDIADTLEWLAEIEEQLGSLEQA
FT                   VRTRERVQNIITDILATHVGNANLLESIAYSYLNNANVLYYLGLYKAAKQAVLSAKINL
FT                   DTLLLQDPSNEIWQLDLLGAHALNLYLSSLTSSAPSNQSIALSDFKRILTRAERLYSSI
FT                   PIIIEGYQLNGNWDLAERAIRLATSKFKQLSREQPANQLLLTALSNVYLLAAKQDEHAQ
FT                   NQVGAASITNATSNTHSDKRQACQQAANLLRPIVTDNSGYEVLLPFVQAHDCLQLRDKV
FT                   KPFADKLALMQIKNYRF"
FT   gene            complement(473437..476646)
FT                   /locus_tag="Patl_0403"
FT   CDS_pept        complement(473437..476646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0403"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   pha:PSHAa2957 multidrug resistance protein, AcrB/AcrD/AcrF"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38933"
FT                   /db_xref="GOA:Q15YV5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YV5"
FT                   /protein_id="ABG38933.1"
FT                   /translation="MSTEDSAPRPDVPHEDPELPNPFEPKQTGLIAFFANNSVAANLMM
FT                   IFIIIMGVFSYFTIQRQMFPNIEINYINISAVYRGASPQEIEESILIKIEESLKDITEI
FT                   KKATSRAFRGSGRVTLEIQENKELTDVLDKVKARVDSIATFPADMEPPDISQIEFQQDV
FT                   IEMSLVGDLPITQLKPIAKKIEDELLHLSNISLVSVDAPEDEIAIEIQPDVLRKYNLTL
FT                   GDVQLAIQNYSANISAGELRTDSGIVAVRVENQMYSGDEFRRIPIKISETGAKVYLGDV
FT                   ATIEDGFEEGQRYYKYSGVNAIYMSVKATKDQSTIPVSKTVKEYIEMRNKTLPAGLQLK
FT                   VLVDMTYYLNARLDMMLSNLFQGAILVAIMLTIFLRFRLAFWVMLGLPVCFLGAIMMMP
FT                   VFGVTINILSLFAFIMVLGIVVDDAIVIGESAYSEIEERGGGAESVIRGAKRVATPATF
FT                   GVLTTIAVFAPALFSTGPEGQFFYVIACVVILCLVFSLIESKLILPAHLAHMKFTPVKE
FT                   TSWRARFNQRFFGFVNGKYKRFVERCTEWRWFVFCIFIAVLVISWGLVSANYVRMIPSP
FT                   KVPHDFPGISFEMNENVPDEAVINALITIESMVINVDKQIIEEYGSSMMRDIMVFNRGR
FT                   TEGRVQVPLVDEEDRHFDAFELARRWREQLPEIPGMKSITIIDDINGGGNDDGEFGYML
FT                   FGSDIDTLNAAGREFISMLQQTNGLFDISSSIDPASKEVQMQLLPVAYDLGLNLADIAR
FT                   QVGASFYGGEAQRVIRGGDEVRVMVRYPKLTRERFAELKYAVITTPAGREVMLGDVVSL
FT                   TEKPGINYIRREGGYRSVYVFGSIDEEEVEPNEVVQTVEEDLLPLMKEKFPGVKTELGG
FT                   TIEEQQAQQSQQLMFLVAGLIMVYILLAAPLKSYGQPLIIMSVIPFSLTGAIWGHFLFG
FT                   IDLSMMSTFGIIAAAGVVINDSLVMTDFVNQQRAMGVRIKDSVVNAGCARFRAITLTSI
FT                   TTFAGVLPIMFETSLQARFVIPMAVALGFAVMYATMVTLILVPCLYLILEDIKNIFRAI
FT                   FAAIGRLFSRKREKHQAIKNS"
FT   gene            complement(476655..477818)
FT                   /locus_tag="Patl_0404"
FT   CDS_pept        complement(476655..477818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0404"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: pha:PSHAa2958 multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38934"
FT                   /db_xref="GOA:Q15YV4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YV4"
FT                   /protein_id="ABG38934.1"
FT                   /translation="MNNRWMKVLLPFLALIAGFGGMTLIEVSASEDEKKELVDTRPTIT
FT                   VETAHAEDYQVVISNHGEVQPLERTMISAQVSGEVISWHPSFVAGGLVLRGSVLFSIEK
FT                   DAYEAALLQAQANVSLAQSQLIEEKARADVAEQEARSLPSSKVSDLYLRKPQLLSAQAN
FT                   LKSAQASLKIAQRDLDNCEVIAPYDALVISRNIGVGQFISQGTSVGEIYNVEAAEVIFP
FT                   IAGFDREFLPDDLAEKEAKVVTNGYSPIERTGLISRDLGVVDQATRMSQLVVRVNDPYS
FT                   LKSNLPALKFGNYVQVSFPGRTLEHIYRLPQALVNNQTVWIMDKDSKLQPKKVEILREE
FT                   GEYLLISKGISDNDNIVTTLPEYPQTGMEVKVSSGKSASELTAQKAK"
FT   sig_peptide     complement(477729..477818)
FT                   /locus_tag="Patl_0404"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.451 at
FT                   residue 30"
FT   gene            478069..479721
FT                   /locus_tag="Patl_0405"
FT   CDS_pept        478069..479721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0405"
FT                   /product="peptidase M28"
FT                   /note="PFAM: peptidase M28; KEGG: pha:PSHAa1017
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38935"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YV3"
FT                   /protein_id="ABG38935.1"
FT                   /translation="MNCSMLHHKFYKLVKASAMLGLVLAPFSLSAQDKEHDVNLINVAH
FT                   HIETLASDTFQGRGPLTEGETLTINYLAKQYQAMGLQGGNPHAQKSSPVAQFLQPVPMA
FT                   QITPDQNMRLQIGELSFLAGSDFTARTEQMNPQITLNDSELVFVGYGINAPEYQWNDYA
FT                   NVDVRGKTVIVLVNDPGFATQNPSVFTGNAMTYYGRWTYKYEEATRQGAKAVLIVHETA
FT                   PAAYPWSVVESSNTGSKYTLVDNEQNKSKLPIMGWIQLAATEQVFEQSGLNYQQLKAQA
FT                   LQSNFSPVTLKQTANLRLKNTISQATSHNVLATITGSKYPDEYVLVGAHWDHFGTKQTA
FT                   DGDIIYNGAVDNASGVAGTLEMARMLKAQHDVKPFERSILFINFTAEETGLIGSEQFSK
FT                   GDIIPTKKMVALLNIDGMNVLDKVDYILQYGDGLSDMEDYLANAANAQGRRVKLDPRPQ
FT                   NGLFFRSDHFSMAKQGVPSLLFMSLGDTDPDYIAHKYHKAADDFSADWSLGGVEQDIKL
FT                   MVNITATLANSRDWPKWKMASDFKASREADLAK"
FT   sig_peptide     478069..478164
FT                   /locus_tag="Patl_0405"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 32"
FT   gene            479793..480335
FT                   /locus_tag="Patl_0406"
FT   CDS_pept        479793..480335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eli:ELI_10435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38936"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YV2"
FT                   /protein_id="ABG38936.1"
FT                   /translation="MMGKVRFVVLAIIGSVTWGNAFAEGFADGPVIFGYGQHAPVKQDV
FT                   TLPKDTVFKLTFDIDQAGKEGALNRGIDTVARFINMHVANGVPLENQHLAMVIHGSASN
FT                   EMLNTKAYKQKYGKPNPNAELLSTLIANGVQIMLCGQSAYYHQIANDDLIDGVDMVLSA
FT                   MTAHMLLNQQGYYVNPF"
FT   sig_peptide     479793..479864
FT                   /locus_tag="Patl_0406"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.991 at
FT                   residue 24"
FT   gene            480642..480914
FT                   /locus_tag="Patl_0407"
FT   CDS_pept        480642..480914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0407"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; PFAM:
FT                   protein of unknown function DUF167; KEGG: vfi:VF0427
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38937"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YV1"
FT                   /protein_id="ABG38937.1"
FT                   /translation="MHLRIYTQPKASRDEVVGLHGDELKVAITAPPVDGKANTHLIKYL
FT                   AKQCGVAKSKVVITKGQLNRHKTVLISKPLIIPKAIQQHVADHSS"
FT   gene            481037..481906
FT                   /locus_tag="Patl_0408"
FT   CDS_pept        481037..481906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0408"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lpp:lpp1627 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38938"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YV0"
FT                   /protein_id="ABG38938.1"
FT                   /translation="MKRCAFLSTDNLEGYFVYDELLYEPLKQQGWQVEAVSWHDNTVDW
FT                   DRFDVVVVRSTWDYQQHAKAFMRCLQRIEDSSAILANSLRLLTWNISKEYLKDIASQGI
FT                   AIVPTLWLDTFDLAQVSAGFERFNCDRLVIKPCVSANADHTYMLDREQLLAQSKTLAEV
FT                   FNGRAFMVQPFVEAVVTQGEYSLFYFNGHFSHAILKTPEPGDFRVQEEHGGSLQAVEPD
FT                   EEMLTQARHTMASLPDDALYARIDLLRYQGEYVVIEIELIEPSLYFNMDANASANFVEA
FT                   FMESFGKG"
FT   gene            complement(481967..482434)
FT                   /locus_tag="Patl_0409"
FT   CDS_pept        complement(481967..482434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0409"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory proteins, AsnC/Lrp; KEGG:
FT                   ccr:CC2887 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38939"
FT                   /db_xref="GOA:Q15YU9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YU9"
FT                   /protein_id="ABG38939.1"
FT                   /translation="MKKQVLDKSSIKIINALEKDGRMSFANLGDTLGISKTPCWNKVQQ
FT                   LQSAGVIEGYSAQLNTKALGLSIRALVHVVVDFEHYQAFEKAIIEHASVRSCHAVTGDS
FT                   DYVLEILATDIEAFDELLRAQLSRLPGVQRFNTSISTRMVKNNGPYSNMLP"
FT   gene            482576..483394
FT                   /locus_tag="Patl_0410"
FT   CDS_pept        482576..483394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0410"
FT                   /product="Tryptophan 2,3-dioxygenase apoenzyme / Tryptophan
FT                   2,3-dioxygenase holoenzyme"
FT                   /EC_number="1.13.11.11"
FT                   /note="KEGG: plu:plu1434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38940"
FT                   /db_xref="GOA:Q15YU8"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YU8"
FT                   /protein_id="ABG38940.1"
FT                   /translation="MNKPVTPDTIFRQKYHALLDKPEMLDYGTYLHCQQLLSAQKPLTE
FT                   LCNGDELQFQIVHQVEELWMKLAIYTLVDVLEFMQQENTLRVVTLMKRVSFIQRMMSQQ
FT                   LDLLETMSPKEYQQIRLQLGNGSGQESPGFRTLLKMPTDLWSVFNEQYLVGRNKNIEQV
FT                   YDSQYSHDESYVVAECLAEFDEQLQKFRSLHIFLIQRSIGLEAKSLKGRAVTLLENGAK
FT                   HRFFPELWRVRSSMTDSWGSAYGEVRESIHEVNNQVGGGCPFHQNPSEAL"
FT   gene            483463..484536
FT                   /locus_tag="Patl_0411"
FT   CDS_pept        483463..484536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0411"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V; KEGG: pha:PSHAa0055
FT                   pyridoxal phosphate dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38941"
FT                   /db_xref="GOA:Q15YU7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YU7"
FT                   /protein_id="ABG38941.1"
FT                   /translation="MPVLTRSLVGQTYFEPWQQKGGDAWPQWLTIIEQFCEELGTLFNA
FT                   SSADFCPQPSVSSGLNQYLQSLGSVQLKNAGKPATHKRTVLMHASAFPSMGFVVQGLSA
FT                   YGFELTLIDKDIDPNDVAAWQAHLTEDVEVALITHVHSNSGVLSNVADISALCRAKNIR
FT                   VVVDVAQSVGVVPIDLQTWNVDVILGSCVKWLCGGPGAGFMWINPKHINALEPKQLGWF
FT                   SHQNPFEFDIEHFAFADAAKRFWGGTPSILPYATALVGVQQVNQIGSQSLFEHSKTLQR
FT                   VVLADAAEHVLTPIDVAQTGGTLCMHLSEPKLTQLESDLHAANAYFDRRGDCLRLSWHI
FT                   YNTEQEAQRVAQMFKDL"
FT   gene            complement(484604..485233)
FT                   /locus_tag="Patl_0412"
FT   CDS_pept        complement(484604..485233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0412"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3 HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase-like hydrolase; KEGG:
FT                   pha:PSHAb0059 putative hydrolase/phosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38942"
FT                   /db_xref="GOA:Q15YU6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YU6"
FT                   /protein_id="ABG38942.1"
FT                   /translation="MINRTSPTNPHPINQIKGFIFDLDGTLVTSKLDFIYLREQVGCPP
FT                   KQDILRFIEGLDEAQQIVANRIVADYELQDAQNALWIDGALPLIQCLASSQQPVAIVTR
FT                   NSQPATQHKLKHHASLFDPIVTREDAAPKPDPQALLHIATLWQLPVHQLAYVGDYLYDI
FT                   QAAKNAGMLACLYAPDELPEYADQADWVFNHFSEFLAALKTSKVRR"
FT   gene            485568..485984
FT                   /locus_tag="Patl_0413"
FT   CDS_pept        485568..485984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0413"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pha:PSHAb0233 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38943"
FT                   /db_xref="GOA:Q15YU5"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YU5"
FT                   /protein_id="ABG38943.1"
FT                   /translation="MSEAVSNDVRTRLQWSLLALRLGVFIVMFIWTMDKFVNPGHSIAI
FT                   FDKFYSIPGLGETVAYIMGALQLLLVLAFVTGIKKRFTYGLIFLMHGGSTLSAFAQYFD
FT                   AFNNLLFFAAWPMWAACFALYLLRDEDTKFTLGK"
FT   gene            486270..488621
FT                   /locus_tag="Patl_0414"
FT   CDS_pept        486270..488621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0414"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor TonB-dependent
FT                   receptor, plug; KEGG: ilo:IL2177 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38944"
FT                   /db_xref="GOA:Q15YU4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YU4"
FT                   /protein_id="ABG38944.1"
FT                   /translation="MTTITSSIFTVSKLALLVAGVIGTNAYGQTSRNQHQIEEITVTAQ
FT                   KRDQSIQDVPVSISAYDGALLESLGVAELDTLSEITPGLVIQEQSPNNPGFVIRGITSD
FT                   SGSSQAAPRVSIYYNGADVSRSRGSYFELFDIERIEVVKGPQATLFGTAASVGALSVIT
FT                   RKPQEEFGAEIKASVGNYSAETLSGFVTGGNSQVQGRLAFSYRQRDGFIRNIAGEAGSQ
FT                   NPDGFDQEDMHGIERTAFRPSLRFTPSDELTIDLVYTHEKNDDTGTSFKNGLFAPTGGD
FT                   TSAFSFVEMSGSPLSQEVFGRKDLGVERTVDDLNLTVNWDINQDLTFTSISASRRFDSL
FT                   EVFDADGTQAWFLEFAEDATGDQFSQEFRMIHQGDKLTTIAGVSYFTEDGSQAVPFSSE
FT                   ESVFLNCLGAFAALAQPCVANDGSVPVLTPILTEGAAQLLPYRLEFENYGETDAYSAFA
FT                   DVTYAVNEALELTAGLRYVREDKKSGYRSDAPASVLTGSELFTVDTEGQIFRAEEDYDD
FT                   WLPRFNMLYVLNEDINMYATISKGRRSDVLNVTSVRGEDGSGEKSVTEIPAEIIWNYEA
FT                   GIKGQAFDKSVNYNASVFYQDYSNFQVTLLDDEGVAYAADAGSATNVGAEAEVRALLGA
FT                   DFELFANLAYLDATIDDDSTNGDLAGNRFRLQPEWTASVGMFYATALSQGYNLTSSLVY
FT                   SYRSDVFFEPANAPISGLDISEDSVSLVSARIGIAGADEDWAVNLFASNLLDKEYLVDA
FT                   GNTGGGFGNPTFVAGAPRFYGIEFKMRFGE"
FT   sig_peptide     486270..486356
FT                   /locus_tag="Patl_0414"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.973 at
FT                   residue 29"
FT   gene            488828..489574
FT                   /locus_tag="Patl_0415"
FT   CDS_pept        488828..489574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0415"
FT                   /product="oxidoreductase FAD/NAD(P)-binding protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding
FT                   Oxidoreductase FAD-binding region FAD-binding 9,
FT                   siderophore-interacting; KEGG: ppr:PBPRA0238 hypothetical
FT                   ferredoxin-NADP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38945"
FT                   /db_xref="GOA:Q15YU3"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YU3"
FT                   /protein_id="ABG38945.1"
FT                   /translation="MAQWLDAKVTKRIDWNDHLFSLRFQCADFPEYTPGQFTKVGIAQD
FT                   DTVISRPYSLVSHPRSSELEIMAVPVEEGILSPKLHELREGDGLKVMAPATGFLVLNEV
FT                   PDSDNIWLIATGTGVGPFLSILAGEEIWQRYKKVVLVYAARYQNDLAYGEFIQQCKSQH
FT                   SVQFSYLPIVSREEGKGALHGRIPELLQSGAIINTANTPLSAQQSQVMLCGNPQMIEEA
FT                   MATLKNMGLKKHLRRSPGQITQERYW"
FT   gene            489774..490454
FT                   /locus_tag="Patl_0416"
FT   CDS_pept        489774..490454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tcx:Tcr_1008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38946"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YU2"
FT                   /protein_id="ABG38946.1"
FT                   /translation="MTPWTQINSAQIPNNGGELTLHQRGKEFSIRIAGKRGELMNSRVF
FT                   NSEKVLSRVGCGHLKDVDNANVLVGGLGMGYTLTAALSVLNKSASVTVAELIPDVVTWN
FT                   QGPLGQCSGYPLKDPRTQVKVGDVTKLLTLQSETYDAILLDVDNGPRGLTHADNNWIYS
FT                   EVGLKAILQMLRPKGVLAIWSAGPDYLFEVRLKNVGYKVDTRIASARADKGIKHTIFLA
FT                   KKPE"
FT   gene            complement(490492..491880)
FT                   /locus_tag="Patl_0417"
FT   CDS_pept        complement(490492..491880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0417"
FT                   /product="precorrin-2 dehydrogenase"
FT                   /EC_number="1.3.1.76"
FT                   /note="TIGRFAM: uroporphyrin-III C-methyltransferase
FT                   siroheme synthase; PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: nmu:Nmul_A2313
FT                   uroporphyrin-III C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38947"
FT                   /db_xref="GOA:Q15YU1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR019478"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037115"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YU1"
FT                   /protein_id="ABG38947.1"
FT                   /translation="MQYFPIFVDTKELNCLVVGAGEVAARKVELLLKTSATITVVAPWA
FT                   CDTVQRLADEGQVTLHTRGYESSDLTAKQLVFVATDDSQLNIDIHHQAKAQNILVNVVD
FT                   NTPLCQFITPSIVDRSPIIIAMSSGGVAPVLLRYLRQKLESVIPQKVSLLGQFSEKFRE
FT                   TVKARFNSVTKRRYFWEDILDGDVAEQVLQGNNSKAEQMMQDKLALDEHDSGKGEVYLV
FT                   GAGPGDPDLLTFRALRLMQKADVVVYDRLVSKEILELVRRDAEKIYVGKARSLHTVPQD
FT                   EINALLADLALKGNRVVRLKGGDPFIFGRGGEEIETLVEKGVSFQVVPGITAASGAASY
FT                   AGIPLTHRDHAKSVVFATGHLRDNSINLNWPMLAQPEQTTVFYMGLTGLPVICEKLIQH
FT                   GLPDTTEIALVQSATTTEQKVVAGNLANIQQKVAEAGIKPPALIIVGSVVSLREKLNWF
FT                   GADA"
FT   gene            complement(492124..493863)
FT                   /locus_tag="Patl_0418"
FT   CDS_pept        complement(492124..493863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0418"
FT                   /product="ATP-dependent RNA helicase CsdA"
FT                   /EC_number="5.99.1.-"
FT                   /note="PFAM: helicase-like DbpA, RNA-binding DEAD/DEAH box
FT                   helicase-like; KEGG: tcx:Tcr_2009 DEAD/DEAH box
FT                   helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38948"
FT                   /db_xref="GOA:Q15YU0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028618"
FT                   /db_xref="InterPro:IPR034415"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YU0"
FT                   /protein_id="ABG38948.1"
FT                   /translation="MTDTVELTFKDLNLPAELLQALEKVGYEKPTPIQAQCIPLIMEGH
FT                   DLLGTAQTGTGKTAAFALPMLANVDANNSNTQLLVLAPTRELAIQVAEAFQVYASFSRK
FT                   LNVLPIYGGSSYDNQIRQLRRGAQVVVGTPGRVIDHIKKGTLKLDNLKFLVLDEADEML
FT                   RMGFIDDVEWILSHAPAERQTALFSATMPDPIRKITKRYLSDPKQVKIESKVATASTIK
FT                   QRYCQVAGHHKLEALTRIMEVEEFDAVIIFVRTKTATMELSEKLSARGYAVEPLNGDIP
FT                   QNSRERTVERLKRGKIDILVATDVVARGLDVERVSHVINYDVPYDTESYVHRIGRTGRA
FT                   GRQGDAILFISHREKRMLFSIERATRQSIDPMPIPSISQLNETRLSRFKSSVIEAIGDS
FT                   SIETLIPIVESIQAETEAAPEVIMAALAKIAQGDEPLILKEGDRPDLNSAPPRGDRNDR
FT                   GGRDDRGGRGRERGGDRGGDRPQRARKSSTPEEGMQRYRIEVGHTHGAKPGNIVGAIAN
FT                   EANISSKNIGAIEIYDNFSTVDLPKNMPRATQDTLQKTRVAGQRLNMREWSDQPPRRRG
FT                   KPE"
FT   gene            494407..497160
FT                   /locus_tag="Patl_0419"
FT   CDS_pept        494407..497160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0419"
FT                   /product="TPR repeat"
FT                   /note="PFAM: TPR repeat Tetratricopeptide TPR_4
FT                   Tetratricopeptide TPR_2; SMART: Tetratricopeptide region;
FT                   KEGG: cps:CPS_0309 TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38949"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014266"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YT9"
FT                   /protein_id="ABG38949.1"
FT                   /translation="MMNKMRKTIIALSLGMLISCGQQTSEEHIQAAQEFIAQNDSASAI
FT                   ISLKTAVQLAPKSPEARFELGKVYLDEKQFESAEKELSRALEYGYDGAKVLPLLTRAYQ
FT                   RTGAYAAISEMEDNNVDLSNEDKAEIGYFKIVSLVRLNKPDDARAIIADQSQLQTDSVF
FT                   KSLSQAYKDILDKDYPLALQSLSNIKDSHPDHPEVLKLLAQLHLSLGDPKAAAQAFDRY
FT                   VSLYPDDLQTTFVLAKLWVDLGETAKAEPYLDQLLAVNAKNGLLNQLKAAARIADKDYG
FT                   EAQKYAELGIQNGMNDPSLRLIAGYAAYQQKDFEAAQQHLSLVASSLPSNHPGLRLLAA
FT                   SQLQLGLNAEAGDVLERMEQINEQDAQLFSKASYELLRQGNVKDAQELVEKSSSISTTA
FT                   EDLTRLGLLKLSLNNLDGIVNLEEALEKSPELESAKKTLATAYITTKQYDKALELAQQW
FT                   KAEDANDISAYLLAGEVFSKQQDLSNAKAEFEQVMRIDPEHKGAALGLVNIAITEKDVV
FT                   RAQSGLTALLNRFPDYTPALATAYLFNKQQGKTQQGIEVIESALNKAPDNQELSMLYAR
FT                   VLLLEKQYDQALQQFVKFDQNESLPPAYWQGKGQALIRSGDLQGAQDHYDKWLSIAPND
FT                   KQAVVGKLLLLDNTGKFAEGVKLSEGFLAVRNDTQMQLLNTHFLLMNKDMDAGRKAYEA
FT                   IPQELKSMPIVKGFRARLLIVDGDFEQAEPNAHAAYEGLPNGRNLVLWVFTLERLNKKE
FT                   QALSAIKAHLNVSPNDGAALMMLAERQINSGDDEAVASYQTLLQKNPNNFVALNNLAYL
FT                   YLQQNQLDKALEYAESAVKQRPDNAAAVDTYAQVLVAKEEYRKAVKQYDAVVNDKMRNE
FT                   EIYLNYVEALFLEGSTLLGKRKLEQREMKTEENIARQAQLKAKYAD"
FT   sig_peptide     494407..494481
FT                   /locus_tag="Patl_0419"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.443 at
FT                   residue 25"
FT   gene            complement(497258..497686)
FT                   /locus_tag="Patl_0420"
FT   CDS_pept        complement(497258..497686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0420"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: cps:CPS_2236 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38950"
FT                   /db_xref="GOA:Q15YT8"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YT8"
FT                   /protein_id="ABG38950.1"
FT                   /translation="MHIVCPHCYAINNVPESKDHTQANCGKCQQKLHTHQPCQLTQHQF
FT                   YRYIERNHLPVLVDFWASWCGPCKSFAPVFAKLANQTDSVLFAQLNTEQAQQISSEAGI
FT                   RSIPTLILFHQGKEIDRISGALGEAQLKQWIVQAVQKC"
FT   gene            complement(497687..498535)
FT                   /locus_tag="Patl_0421"
FT   CDS_pept        complement(497687..498535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0421"
FT                   /product="Ion transport protein"
FT                   /note="PFAM: Ion transport protein; KEGG: ilo:IL1436
FT                   Kef-type K+ transport system, NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38951"
FT                   /db_xref="GOA:Q15YT7"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YT7"
FT                   /protein_id="ABG38951.1"
FT                   /translation="MNALSLQAKFIRIRSNKLFEIFVISVIIFSALLVGAKTYEMSVTM
FT                   YHVTQFLDWFISAFFLTEITIRFLAEERKRDFFKNFWNIFDTLIVIVSLIPAEDADLAV
FT                   IARLVRVFRVLRMISIIPELRILLVSLVKALPQLGYVMLLMFIIFYIYAAIGSTLFESI
FT                   NPDLWGDIAISLLTLFRVMTFEDWTDVMYETMEVYPLSWVFYLTFIFFTAFAFLNMVIG
FT                   IVVSVMEQENELARKQKAKEDAAEHDLEEEPTLSDLLVHIKDLQLQVKQLSPHTMKQEK
FT                   E"
FT   sig_peptide     complement(498425..498535)
FT                   /locus_tag="Patl_0421"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.810) with cleavage site probability 0.751 at
FT                   residue 37"
FT   gene            498909..499550
FT                   /locus_tag="Patl_0422"
FT   CDS_pept        498909..499550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0422"
FT                   /product="heme oxygenase"
FT                   /note="PFAM: Haem oxygenase; KEGG: dra:DRA0052m heme
FT                   oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38952"
FT                   /db_xref="GOA:Q15YT6"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YT6"
FT                   /protein_id="ABG38952.1"
FT                   /translation="MMNTQAEAISIGHLLKTSTQGLHREVEGRLSKILFHRDLSAQVYL
FT                   QVLMAMQAAYVSMERALLTFPESKAAYKNRSKQAFINNDIAYMKQTLLDLEHDIPMRAS
FT                   KKDDLSQNVKPNVELHSTAQAMGMMYVLEGATLGGEHIQARLTRHDWLDTHHGVAFFNS
FT                   YQEQRMVRWGEFLTVLQQYYLRNPDVCDEIMQGAELAFEYIHDCLEGISL"
FT   gene            499547..501946
FT                   /locus_tag="Patl_0423"
FT   CDS_pept        499547..501946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0423"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: GAF ATP-binding region, ATPase-like histidine
FT                   kinase A-like Phytochrome, central region PAS fold-2; KEGG:
FT                   ana:all2899 phytochrome-like protein, two-component sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38953"
FT                   /db_xref="GOA:Q15YT5"
FT                   /db_xref="InterPro:IPR001294"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013515"
FT                   /db_xref="InterPro:IPR013654"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YT5"
FT                   /protein_id="ABG38953.1"
FT                   /translation="MNKPFDVTLDNCHKEPIHIPGSIQPHGYLLLFEPETLILQYCSEN
FT                   VADLMQCSLDALLGQSLDSIFDREFATKVKALDFDKGFHEVNPQQTTPIAALAQALNSN
FT                   TTGPVTDAQAESIKTQSTYNAILSLHDDLLAIELEPALSASSSSFNPVKNLINLSLNDL
FT                   AQSQDLNNVFAYSVNEIRKVTGFDRVMLYKFDADYNGEVVAEAKKPELNSFLKQHFPES
FT                   DIPKQARELYVKNPIRLLADVNAKQSMLYPNDRPVDLSKVTLRSVSPIHCQYLRNMGVN
FT                   ASMSISIVVSGKLWGLIACHHYRSHVVPFETREVALYMGLMLSYLISLKVQADAEHRDS
FT                   AVLSLNASITAKMAERIFFTDGLREETDNLMRMMNASGVAWRLEEDIECFGKTPSPDRI
FT                   EALFNWATSTKLVTDTIYHTKTLGKDNPDFMDISDVASGVFILSVSSVSNLFLIWFRQE
FT                   VEQTKDWGGKPEKTIEFLDDGSHRLMPRSSFRLWRENVKNQSLAWEAVELSSALKFRDT
FT                   IVNYVLSKSERLELLNEALEHKVAVRTDELKKEIANKEKMQDELVEALAASEESNRELE
FT                   RFAFVASHDLQEPLRKIQSFGGRIQQTEATLSDRGHDYLTKMMNSAERMQALIKGVLSF
FT                   SRIHRSNDEFVPLNFDDIIEDVIMDLEVLVTEQKAAFSIDHIGTVYGDKNQLRRVAQNI
FT                   IQNALKFTKEDVPPHIVIALNDKDEDFVTIEFKDNGVGFAKTHEQKIFGLFERLHSKAE
FT                   YSGTGLGLAICKKIINRHQGKIWAESQFGQGASFFITLPIRSEAVE"
FT   gene            502155..502607
FT                   /locus_tag="Patl_0424"
FT   CDS_pept        502155..502607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0424"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   pha:PSHAa2395 two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38954"
FT                   /db_xref="GOA:Q15YT4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YT4"
FT                   /protein_id="ABG38954.1"
FT                   /translation="MNKDSGVISKKLRAVNYILVADDDLDDQELIQDALADNAIGTDKL
FT                   RFVNDGEELTRFLADAKTLPSIILLDLNMPRKSGREALDDIKQNPSFKHIPVVMFTTSD
FT                   SDIDIKECHMLGCNAYLTKPNNYLDLVGSMKDLVSFWFFQAQILHD"
FT   gene            502924..504084
FT                   /locus_tag="Patl_0425"
FT   CDS_pept        502924..504084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0425"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   atc:AGR_pAT_199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38955"
FT                   /db_xref="GOA:Q15YT3"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YT3"
FT                   /protein_id="ABG38955.1"
FT                   /translation="MHTNNDFEFKTVGDIRFGVNAALSLPALLISRFDAKSILVITDKG
FT                   LLNAGVLDPVFAELDVAGITFSVFDGVQADPPEAIILAAAEQAKKAEVVIGIGGGSSMD
FT                   SAKLAAVLAMEQQNLADMYGVDLVTSQRKPLVLIPTTAGTGSEVTPISIVTTGESTKAG
FT                   VVSPVLYPDVALLDPCLTVGLPAHITAETGVDAMVHAIEAFTSKHKKNPLSDNLAIKAL
FT                   QLLSTHLPRCYVNGKDLDHRGATLLGAMLAGQAFANSPVAAVHALAYPLGGIYHMAHGL
FT                   TNALMLPHVMRFNLAHAEQEYAQLGVVVNPQLAGLSVREQALGFIEYMQQFCHDLGITK
FT                   RLRDYGIEQAALTDLANAAMLQTRLLTNNPRTVTFDDALALYQEAW"
FT   gene            504223..504690
FT                   /locus_tag="Patl_0426"
FT   CDS_pept        504223..504690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0426"
FT                   /product="thioesterase superfamily"
FT                   /note="PFAM: thioesterase superfamily; KEGG: pfl:PFL_0291
FT                   thioesterase family protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38956"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YT2"
FT                   /protein_id="ABG38956.1"
FT                   /translation="MTTSTTDKKSPPTRSDFRYFDTIDTRWSDNDVYGHVNNVAYYSFF
FT                   DTVVNRLLIDNGWLHLDGQGPIGLVVETRCQYYASVSYPAVLDIGLTVLKLGNSSVVYQ
FT                   LAVFSEGSEQASAVGQFVHVYVDRPSHMPTPLPTDLRAGLSHYLVGGDEPE"
FT   gene            complement(504787..505974)
FT                   /locus_tag="Patl_0427"
FT   CDS_pept        complement(504787..505974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0427"
FT                   /product="3-hydroxy-3-methylglutaryl-coenzyme A reductase"
FT                   /EC_number="1.1.1.34"
FT                   /note="PFAM: hydroxymethylglutaryl-coenzyme A reductase;
FT                   KEGG: nph:NP0368A hydroxymethylglutaryl-CoA reductase
FT                   (NADPH) 1"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38957"
FT                   /db_xref="GOA:Q15YT1"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004554"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YT1"
FT                   /protein_id="ABG38957.1"
FT                   /translation="MSDNKAAPSIPRDKEHDHSQNMAQQRRTFVKEHTQSELSHVGHYS
FT                   LSPEQTAGNIENFIGVAQVPIGLAGPVKVNGEYAKGEFYVPLATTEGTLVASYNRGMRV
FT                   LSAAGGVKVTVVDDVMQRAPVFIFEDARQAQTFGNWVTDNFEDIKAQAETTTSVGKLRN
FT                   IEQYAAARMQYLRFNFTTGDAAGQNMVGKATFAACEWMKANFPGVGLQRYNLSGAMDTD
FT                   KKHSQLNTLHSRGKRVIAEATISSEILESKLGVSAQMLFKMRQISNMGSFMAGSINNGS
FT                   HSANGITAMFIACGQDAANVAESSAALSFVDVDEQGNFYIAITLPSLIVATFGGGTALA
FT                   TQKECLEMMDCFGEGKARKLAEIIGATVLAGELSLSAAVLAGDWVTSHDALGRNR"
FT   gene            complement(506131..506454)
FT                   /locus_tag="Patl_0428"
FT   CDS_pept        complement(506131..506454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0428"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding; KEGG:
FT                   aci:ACIAD1498 7-Fe ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38958"
FT                   /db_xref="GOA:Q15YT0"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022569"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YT0"
FT                   /protein_id="ABG38958.1"
FT                   /translation="MTFVVTDNCIKCKYTDCVAVCPVDAFFEGPNFLVIDPDICIDCAL
FT                   CEPECPAKAIFQDDKLPPGQEAFNELNAELSKIWPNIIEVIPPPADAKEWDGVPNKIEY
FT                   LET"
FT   gene            506675..508288
FT                   /locus_tag="Patl_0429"
FT   CDS_pept        506675..508288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0429"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   pha:PSHAb0412 putative uncharacterized dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38959"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YS9"
FT                   /protein_id="ABG38959.1"
FT                   /translation="MLRLTDIKLPLDHQDADLTQAILDKLGCGAEQLTQVSVFKRGFDA
FT                   RNKFDIQLIYTLDVDVAEQEALLAKFENDPHVRLSPDTRYKFVGHAPEALTERPVVIGL
FT                   GPCGLFAGLLLAQMGFKPIILERGKEVRERTKDTFGFWRKKPLNTESNVQFGEGGAGTF
FT                   SDGKLYSQVKDRKHYGRKVLTEFVDAGAPDEIMYVSKPHIGTFKLVAMVERMRAQIIEL
FT                   GGEIRFSTRVDDVHIEQGQLTGLSLSTGEHLSCRHAVLAVGHSARDTFKMLYERDVYIE
FT                   AKPFSVGFRIEHEQSMIDECRFGPSAGHPILGAADYKLVHHCKNGRAVYSFCMCPGGTV
FT                   VAAASEEGRVVTNGMSQYSRHERNANSAIVVGIEPNKDFPGHPLAGIDLQRKLEEQAYA
FT                   LGGSNYDAPAQLIGDFLTGKASAELGDVKPSYTPGVKLTDLSKVLPDYAISAIREAIPA
FT                   FDKQIKGFAKADGLLTGVETRTSSPISIKRGADFQSVNVNGLYPAGEGAGYAGGILSAG
FT                   IDGIKVAEAVALSMLASSHA"
FT   gene            complement(508359..509669)
FT                   /locus_tag="Patl_0430"
FT   CDS_pept        complement(508359..509669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0430"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family"
FT                   /note="TIGRFAM: type I secretion outer membrane protein,
FT                   TolC family; PFAM: outer membrane efflux protein; KEGG:
FT                   son:SO3904 outer membrane protein TolC"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38960"
FT                   /db_xref="GOA:Q15YS8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YS8"
FT                   /protein_id="ABG38960.1"
FT                   /translation="MKKTLLSLLIGFGVSNNAFADDLLSVYQQALQNDPATLQSKANRE
FT                   AAFSDIEISRAGLLPQVSLSLQAAETYGDLDRSTNDVTVNLSQTIYDRSLWVGLDRAEL
FT                   VASQSDASLALTMQNLILRTVSAYFDTLQAQDDLAFARAEKRAIARQLEQTKQRFEVGL
FT                   TAITDVHEAQAQYDTSVAAEISAENAVETNLEALREITGVYYPDLNVLNTEQFSASLPT
FT                   PANVNDWLKTAEQRNLELLVSNASVDIAKFDIKSARAGHYPTVGISGSANSNDTDGFAI
FT                   NPGAGGSDRFNTYGVTLSVDVPLYTGGRVSANVDSAKHRFVATSEDRERIHRSVIRNVR
FT                   SNYNDIKAAISRIKAFEQAVVSAQSALKATEAGFDVGTRTIVDVLDSTRNLFDARRNLS
FT                   SARYGYVVSTLNLKLAAGTLSIEDVTDINQGLSAQIK"
FT   sig_peptide     complement(509607..509669)
FT                   /locus_tag="Patl_0430"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            509893..510513
FT                   /locus_tag="Patl_0431"
FT   CDS_pept        509893..510513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0431"
FT                   /product="Nucleoside diphosphate pyrophosphatase"
FT                   /EC_number="3.6.1.13"
FT                   /note="KEGG: vfi:VF2232 ADP-ribose pyrophosphatase;
FT                   TIGRFAM: Nucleoside diphosphate pyrophosphatase; PFAM:
FT                   NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38961"
FT                   /db_xref="GOA:Q15YS7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YS7"
FT                   /protein_id="ABG38961.1"
FT                   /translation="MSKIQQFSSKDVEVTRKEPLYDGFFKMVKYHFKHKLYKGGWSDLI
FT                   QREIFERGHAVAVLPYDPHLKEFVMIEQIRIGAMATSDSPWLLEIVAGIIDPGETPEAV
FT                   CYREAHEEAGVTITHLKKAISYLASPGGTTERLHIYVAQVDASQAKGVHGLDHESEDIL
FT                   VHRVPEEQALEWINQGKIDNAATLIALQWFAMNKQRVLDDWKE"
FT   gene            510497..510952
FT                   /locus_tag="Patl_0432"
FT   CDS_pept        510497..510952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0432"
FT                   /product="protein of unknown function DUF1249"
FT                   /note="PFAM: protein of unknown function DUF1249; KEGG:
FT                   yps:YPTB3398 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38962"
FT                   /db_xref="InterPro:IPR009659"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YS6"
FT                   /protein_id="ABG38962.1"
FT                   /translation="MTGKNEQDLRRKYVPHLPSIQRVCAMNYVRLIKLLPDCDTEDLEY
FT                   QFKVNKSLNYSIKIVECSRYTSTVIMSQESINGPDFMRPVVRARLYHDAQLAEVIESQH
FT                   IGALQPSYEYPNIKMHQRNEKEMVNLFLSEWLLFCSKHKDQLQAASA"
FT   gene            510968..511720
FT                   /locus_tag="Patl_0433"
FT   CDS_pept        510968..511720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0433"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: pfo:Pfl_0497
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38963"
FT                   /db_xref="GOA:Q15YS5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YS5"
FT                   /protein_id="ABG38963.1"
FT                   /translation="MSFKVAQISDCHLFADKRHAGYQNINPYTTLQAVLKNVGLCHPDM
FT                   VIVSGDVSAENDAVKGLASYQLFSQLWQQSKISAPLLVIPGNHDHLEALNNELNHLAGW
FT                   PLSTSAGPYWKVHGLNTKTDDSSGEISMRQLQYLNEQVNLHPQQHHLLVVHHHPYACGG
FT                   WMDNHPWRNRDEFIQNVEQQPQIKAVIYGHIHQASETRSQDCVFMSAPSTCWQWANSKE
FT                   FSASGEAPGYRVIELADNGQVDSHIIRI"
FT   gene            511731..512324
FT                   /locus_tag="Patl_0434"
FT   CDS_pept        511731..512324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0434"
FT                   /product="protein of unknown function UPF0227"
FT                   /note="PFAM: protein of unknown function UPF0227; KEGG:
FT                   vpa:VP0429 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38964"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YS4"
FT                   /protein_id="ABG38964.1"
FT                   /translation="MTDSKPEQVVIYLHGFLSSPQSVKAQQTKAFVDEHYPDIVFYIPQ
FT                   LDNHPKPAAKMLDELVARHPNADFGFIGSSMGGYFSSYLLERYGGKAVLINPAVQPYNL
FT                   LADYLGEHINPYTKKRFSLDESHTQDLTTFDTKTLASPQNYWVLLQTADETLDYRQAEQ
FT                   KYMGAKLTIEEGGDHSFQGYERFLADIFQFLLHD"
FT   gene            512409..514298
FT                   /locus_tag="Patl_0435"
FT   CDS_pept        512409..514298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0435"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: ilo:IL1954 DNA topoisomerase IV subunit B;
FT                   TIGRFAM: DNA topoisomerase IV, B subunit; PFAM: DNA gyrase,
FT                   subunit B-like ATP-binding region, ATPase-like DNA
FT                   topoisomerase, type IIA, subunit B, region 2; SMART: DNA
FT                   topoisomerase, type IIA, subunit B or-like"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38965"
FT                   /db_xref="GOA:Q15YS3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YS3"
FT                   /protein_id="ABG38965.1"
FT                   /translation="MSNQYNADAIEVLNGLDPVKRRPGMYTDTTRPNHLSQEVIDNSVD
FT                   EALGGFASSIKVVLHPDQSLEVTDDGRGMPVDIHAEEGISGVELIMTKLHAGGKFSNKN
FT                   YQFSGGLHGVGISVVNALSKRVEVSIRRDGSVYQIAFENGEKVEDLKVVDTCGKRNSGT
FT                   RVHFWPDEQYFDSAKFSVTKLLHVLRAKAVLCPGLRIRFDDKVSKETHEWYFEDGLKDY
FT                   LYQSVGDSISLPADAPFVGAVSGNTEAVDWAVIWLPEGGEMITESYVNLIPTAQGGTHV
FT                   NGLRQGLLESMREFCEFRNLLPRGIKLTPEDIWDRCSYVLSTKMQDPQFAGQIKERLSS
FT                   RQAAAFVSGIVKDAFSLWLNQHTAIAEQLAEMCISNAQTRLRQSKKVARKKVTQGPALP
FT                   GKLTDCSTQDTGRSELFLVEGDSAGGSAKQARDREFQAIMPLRGKILNSWEVDSSQVLA
FT                   SQEIHDISVALGIDPDSDDLSGLRYNKVCILADADSDGLHIATLLCALFVKHFRTLVEN
FT                   GHAYVAMPPLFRIDVGKEVFYALDEGEKQGILDRIAAEKKRGKVNVQRFKGLGEMNPLQ
FT                   LRETTMDPNTRRLVQLTIEDPTEMLETMDMLLAKKRAGDRKSWLESKGNMADV"
FT   gene            514351..515640
FT                   /locus_tag="Patl_0436"
FT   CDS_pept        514351..515640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0436"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_0773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38966"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YS2"
FT                   /protein_id="ABG38966.1"
FT                   /translation="MLRFFKYLLIVLVLLIGLGVALFIASVEDEPLVVATSATQVDDAD
FT                   SVKELIEQIKQSVRDRTLDQQIPLTENQLNSLVGFLQRAKAQFHGQANITPLASSLSAS
FT                   YQLPPNPVGRYVNFSALILPGQGLQLDEVRLGSIVLPGKQTLATLVWLADWWTNSTIAS
FT                   QFVQQIDSIRMFQGSMVIAMRPLDAFLRNLKDLKRDIGEETDLSLATAHYLRFLAELDV
FT                   GQRPTAQSLARFIQPLFAEALSRSNQATAAEENEAAIMALATFAGHHRFASFIGDIQPK
FT                   PKRVAVPRNMPTLMHRTDLSQHFIFSAAIKVLSEQGLTAAIGEFKELMDRGAGGSGYSF
FT                   VDLAADHAGVKFALVATDEKTAFALQRLLSENASESSFFPDTSGLPENLNKSEFTKTFK
FT                   QVDSPEYKRLLDEIDQRISLLPVSRLPPAR"
FT   sig_peptide     514351..514434
FT                   /locus_tag="Patl_0436"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.720 at
FT                   residue 28"
FT   gene            complement(515663..516004)
FT                   /locus_tag="Patl_0437"
FT   CDS_pept        complement(515663..516004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0437"
FT                   /product="small multidrug resistance protein"
FT                   /note="PFAM: small multidrug resistance protein; KEGG:
FT                   reu:Reut_A2364 small multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38967"
FT                   /db_xref="GOA:Q15YS1"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YS1"
FT                   /protein_id="ABG38967.1"
FT                   /translation="MGITTGYWYLGAAIMAEVIGTLALKASEGFNNTISSAVCVIGYAT
FT                   AFYFLSLVLKTVPVGIAYAIWAGMGIVLIALFSAIFYKELPDLAAIAGMSLILSGVVII
FT                   NVFSKTTGH"
FT   gene            complement(516023..516334)
FT                   /locus_tag="Patl_0438"
FT   CDS_pept        complement(516023..516334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pha:PSHAa0471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38968"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YS0"
FT                   /protein_id="ABG38968.1"
FT                   /translation="MQTIIEKLTENAQLIYRKSIDADATIAKLQSAGKGKFQAIFPEDA
FT                   GFNASGRFFKPYVEELAMDIASLSQLDTEEQKQALPKVVKKIELLHSTLSQFQVSIKD"
FT   gene            516387..516638
FT                   /locus_tag="Patl_0439"
FT   CDS_pept        516387..516638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38969"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YR9"
FT                   /protein_id="ABG38969.1"
FT                   /translation="MTKSGRFCLLFNFATSNRGSGMEIQGGAASGASGATLEIKSLQMA
FT                   KSQQERDGQATLQLLESAADVPSSSSNPNLGSVVNTFA"
FT   gene            complement(516639..517664)
FT                   /locus_tag="Patl_0440"
FT   CDS_pept        complement(516639..517664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0440"
FT                   /product="L-lysine 2,3-aminomutase"
FT                   /EC_number="5.4.3.2"
FT                   /note="TIGRFAM: lysine 2,3-aminomutase YodO family protein;
FT                   PFAM: Radical SAM; KEGG: vch:VC2661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38970"
FT                   /db_xref="GOA:Q15YR8"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YR8"
FT                   /protein_id="ABG38970.1"
FT                   /translation="MTQIIPKKLIAVENNWQKELSSAFSDPVALLKYLDLDPTEFIDDI
FT                   AARRLFPMRVPLPFAARIKKGDPNDALFKQVFPSEKEFLTDLNYVLDPLQEQQNEKPGV
FT                   LHKYKSRVLLLVRGGCAVNCRYCFRRHFPYSDNHLNKHEWQETLDYIKQDKNINEVIYS
FT                   GGDPLMAKDDFLAWLTDEIAEITHIKRIRIHTRLPVVIPARITPQLIEWFTKTRLKPVM
FT                   VLHINHPQEIDFALQEVLQELTKAGVTLLNQGVLLKDINDSADVQVALSERLFDAGVMP
FT                   YYLHVMDKVQGAQHFDQDDKIAKDIMAKMIKRLPGFLVPKLVREIGGQPGKTPIDLNLH
FT                   P"
FT   gene            517702..518271
FT                   /locus_tag="Patl_0441"
FT   CDS_pept        517702..518271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0441"
FT                   /product="translation elongation factor P (EF-P)"
FT                   /note="TIGRFAM: translation elongation factor P; PFAM:
FT                   elongation factor P/YeiP Elongation factor, KOW-like; KEGG:
FT                   pha:PSHAa0474 elongation factor P (EF-P)"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38971"
FT                   /db_xref="GOA:Q15YR7"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YR7"
FT                   /protein_id="ABG38971.1"
FT                   /translation="MANISTNEFKGGVKIMLDGEPCNILENEYVKPGKGQAFNRVKLKK
FT                   LISGKTLEKTFKSGESFEAADVMDMELSYLYTDGEFWHFMNNESFEQIAADDKAVGDSV
FT                   KWLVENDSCTITLWNGTPIVVTPPNFVELEITETDPGLKGDTAGTGGKPATLTTGAVVR
FT                   VPLFVQTGEVVKVDTRSGEYASRAQK"
FT   gene            518341..519324
FT                   /locus_tag="Patl_0442"
FT   CDS_pept        518341..519324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0442"
FT                   /product="lysyl-tRNA synthetase-related protein GenX"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase-related protein GenX;
FT                   PFAM: tRNA synthetase, class II (D, K and N); KEGG:
FT                   spt:SPA4161 lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38972"
FT                   /db_xref="GOA:Q15YR6"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YR6"
FT                   /protein_id="ABG38972.1"
FT                   /translation="MKPEPSPCWQPTADVATLKQRAAIITNIRQFFAQRDVWEVETPSL
FT                   SNATVSDVHMRVFDTQFVDPMSPQQRTLYLQTSPEYAMKRLLCAGSGAIFQIAKAFRNE
FT                   EAGKHHNPEFTMLEWYRPGFDHNQLMDELDELMQSVVGCLPAKRMSYQDAFIQYLAIDP
FT                   LSAPLSALQTKGCELGYEHICRDEQDKDTILQLLFSHEVEPHIANKSPCFIFDFPASQA
FT                   ALARVSVQDERVAERFELYYKGLELANGFHELANAPEQRQRFERDNQQRKSAGLSTVPI
FT                   DELFLDALDAGLPDCSGVAVGVDRLVMLALEKSDIQHVLAFNYQNA"
FT   gene            519409..520545
FT                   /locus_tag="Patl_0443"
FT   CDS_pept        519409..520545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0443"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: conserved
FT                   hypothetical protein; KEGG: ilo:IL2366 signaling protein
FT                   with a acyltransferase and GGDEF domains"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38973"
FT                   /db_xref="GOA:Q15YR5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YR5"
FT                   /protein_id="ABG38973.1"
FT                   /translation="MQIVPKPSAHLAVAYQQASIKSNLTLVWYFSIVALIGFGVHLLHH
FT                   LRLGTGAYSPDMMPYLAVYLCNVLYALVNLLLLPSARANNNISWRTGLLELMYPAFLAF
FT                   VATVLSIYTSVQGHGPVPFIMGMMVIAMLVQGHLIFLYALLFACWLVVSAGMLKMLPLE
FT                   EASSPILTCFTTMLIAFFIARLAERTRVDQFEMLQELHEKNSLLGELAVQDPLTKLNNR
FT                   RYFSNKLEVETARSLRYQHPLSLLVVDVDDFKKINDNDGHLVGDEVLIEISQLIAQQLR
FT                   AGDVVCRYGGDEFVILLVEACAEQSREIADRICQSVDRTKFGRASHKVTVSIGYAQYVG
FT                   QPLGDFMQQADKMMYTSKKRGKNQVAFFGFGIGSESTE"
FT   gene            520668..521117
FT                   /locus_tag="Patl_0444"
FT   CDS_pept        520668..521117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_0236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38974"
FT                   /db_xref="GOA:Q15YR4"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YR4"
FT                   /protein_id="ABG38974.1"
FT                   /translation="MQPTHNDIRNAYQQEWITLQNQYDSYEKVAVAIKLVGTALVVVLL
FT                   LAATEILAVAIILLFWVQEAIWKTFQGRIETRLLETELMLAQDAELMLPDAAPMQFNRY
FT                   WLSSRPGGMGLLVEYVKSALRPTVAMHYVLMLLVTLVFYFAAFKG"
FT   gene            521125..521655
FT                   /locus_tag="Patl_0445"
FT   CDS_pept        521125..521655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0445"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   hch:HCH_04390 acetyltransferase, including N-acetylases of
FT                   ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38975"
FT                   /db_xref="GOA:Q15YR3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YR3"
FT                   /protein_id="ABG38975.1"
FT                   /translation="MPVKCPHLRTARLTMRLLTDDDAEFILGLVNEPSWIKYIGDRNIH
FT                   TLDDAKHYIQTGPLTMYEQHGYCLNLVERSADNVPVGMCGLLKRETLEWPDIGFAFCAE
FT                   FHGQGFGYEAAKATLKHAQDALGLTQIAAVTALDNDPSIALLNKLGFALVKQIGFEPQG
FT                   EASHLFLKALDGR"
FT   gene            complement(521641..522237)
FT                   /locus_tag="Patl_0446"
FT   CDS_pept        complement(521641..522237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0446"
FT                   /product="peptidyl-prolyl cis-trans isomerase, cyclophilin
FT                   type"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin type; KEGG: ilo:IL1866 peptidyl-prolyl
FT                   cis-trans isomerase (rotamase), cyclophilin family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38976"
FT                   /db_xref="GOA:Q15YR2"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YR2"
FT                   /protein_id="ABG38976.1"
FT                   /translation="MLRALCISIFIISISAVAKPKDDGSQIQADNFYPRVKIETSMGDI
FT                   TVELDRSKAPIAVNNFLRYVDKRSYEDTIFHRIVANFVVQGGGYDVDFAEKPSFPNIIN
FT                   ESGNGLKNEMYTIAMARQKDPHSSNRQFFFNMNDNVSLDPGRNWGYTVFGYVVEGTDIL
FT                   DAISLVETDYDTTWGWADVPVEPVLIKRVSVLPPV"
FT   sig_peptide     complement(522181..522237)
FT                   /locus_tag="Patl_0446"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.996 at
FT                   residue 19"
FT   gene            complement(522251..523405)
FT                   /locus_tag="Patl_0447"
FT   CDS_pept        complement(522251..523405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0447"
FT                   /product="23S rRNA m(2)G-1835 methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /note="PFAM: methyltransferase small Methyltransferase type
FT                   11; KEGG: pha:PSHAa2245 ribosomal RNA small subunit
FT                   methyltransferase D"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38977"
FT                   /db_xref="GOA:Q15YR1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017237"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YR1"
FT                   /protein_id="ABG38977.1"
FT                   /translation="MKTELTLLDHSYELLRYPAENQHVSWQAWDSADEYLMEYVAQNIT
FT                   DLNGLNIHIYNDDFGALGVWFATNNAPLWISDSFVAHKALALNLERNHLPIENVNVQNS
FT                   LYKANQKADLVLIKVPKTLALLEQQLIDLQSSVTPETRIIAAGKANAIQKSTLALFEKH
FT                   LGLTTTSLAKKKSRLIFCQYDGVKQSVSPYPTKWKTDNTQFIMSNLANVFSRQQLDIGA
FT                   RVLLAHLPDANHKCIVDLGCGNGVLGLHVLHKSPGAHVIFVDESFMAIASAKMNIEQNM
FT                   PDKLDQCKFIVSNCLDECLSSGENEATVDIVLCNPPFHQQNTITDHIALQMFKDSKRIL
FT                   KHAGELRVVGNRHLDYPQTIKRLFGHYKVLASDRKFSILSAIKK"
FT   gene            523431..524063
FT                   /locus_tag="Patl_0448"
FT   CDS_pept        523431..524063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0448"
FT                   /product="DNA-N1-methyladenine dioxygenase"
FT                   /EC_number="1.14.11.-"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; KEGG: vvy:VVA0455
FT                   alkylated DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38978"
FT                   /db_xref="GOA:Q15YR0"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YR0"
FT                   /protein_id="ABG38978.1"
FT                   /translation="MQQSSLFPSGSSDEAEILPLPDGDFRYFQHFLSSQEADNYYKRLL
FT                   ESLAWRQDDIKMYGKQVKIPRLQAWYGDEDALYQYSGLNLPPIPWTEELHALKVQCEKA
FT                   SESVFNSVLANCYRDGQDSMAWHSDDEPELGTRPVIASLSLGQVRNFDLKHRTSGQRHR
FT                   LPLEHGSLFIMAGNSQTHWLHSLAKTTKSLAPRINLTFRLVTPNLRR"
FT   gene            524109..524423
FT                   /locus_tag="Patl_0449"
FT   CDS_pept        524109..524423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0449"
FT                   /product="transcriptional regulator, BolA protein family"
FT                   /note="PFAM: BolA-like protein; KEGG: ppr:PBPRA0820
FT                   putative cell division protein BolA"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38979"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YQ9"
FT                   /protein_id="ABG38979.1"
FT                   /translation="MTIQQSIERKLQAGFTPVHLEVVNESFMHNVPEGSESHFKVVIVS
FT                   DEFGGKRLIGRHRAVNQVLADELANDIHALAIHTYTQEEWNTLQQQSPDSPNCLGGSKS
FT                   "
FT   gene            524521..524691
FT                   /locus_tag="Patl_0450"
FT   CDS_pept        524521..524691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0450"
FT                   /product="protein of unknown function UPF0057"
FT                   /note="PFAM: protein of unknown function UPF0057; KEGG:
FT                   dps:DP1039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38980"
FT                   /db_xref="GOA:Q15YQ8"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YQ8"
FT                   /protein_id="ABG38980.1"
FT                   /translation="MQKVNPLNLILAIFIPPLGALLQVGLSAHFFLNILLTLFGVLPGV
FT                   IHAVWLVLKNK"
FT   gene            524787..525968
FT                   /locus_tag="Patl_0451"
FT   CDS_pept        524787..525968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0451"
FT                   /product="short-chain alcohol dehydrogenase"
FT                   /note="PFAM: short-chain alcohol dehydrogenase; KEGG:
FT                   ilo:IL1051 short-chain alcohol dehydrogenase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38981"
FT                   /db_xref="GOA:Q15YQ7"
FT                   /db_xref="InterPro:IPR010758"
FT                   /db_xref="InterPro:IPR024906"
FT                   /db_xref="InterPro:IPR024910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YQ7"
FT                   /protein_id="ABG38981.1"
FT                   /translation="MVIKPKIRGFICTNAHPEGCAASVAQQIEYVSSQGDLGSGPKNVL
FT                   VIGSSTGYGLASRIVSAFGYGANTLGVCFEKAPSERKTATAGWYNTAAFHKEAKEKGLF
FT                   AQTINGDAFSKEIKAQAIETIKREMGQVDLVIYSLASPRRTDPETGEVYKSTLKPVGQA
FT                   YTTKTYDTDKDRIHDISLEPANEDEIAQTIKVMGGEDWELWLDALAEADLLAYGCKTTA
FT                   YTYIGKELTWPIYGQATIGKAKEDLDRAAAAIVSKNQEKHIEAYVSSLKALVTQASSAI
FT                   PVMPLYISLIYKVMKEEGTHEGCIEQIKGLFTERLFAQSPALDEQGRLRMDGKETNEAT
FT                   QAKIKALWDQVTQENFHELSDYAGYHHEFLKLFGFDVEGVDYEKEQNTLADWD"
FT   gene            526413..527786
FT                   /locus_tag="Patl_0452"
FT   CDS_pept        526413..527786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0452"
FT                   /product="NADH:ubiquinone oxidoreductase, subunit A"
FT                   /note="TIGRFAM: NADH:ubiquinone oxidoreductase, subunit A;
FT                   PFAM: Na-translocating NADH-quinone reductase subunit A;
FT                   KEGG: son:SO1103 NADH:ubiquinone oxidoreductase, Na
FT                   translocating, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38982"
FT                   /db_xref="GOA:Q15YQ6"
FT                   /db_xref="InterPro:IPR008703"
FT                   /db_xref="InterPro:IPR022615"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YQ6"
FT                   /protein_id="ABG38982.1"
FT                   /translation="MCIDFRVVLLRMIKIKKGLDLPITGAPEQKIHDGPAITKVAVLGE
FT                   EYIGMRPTMHVQVGDKVQKGQMLFEDKKNPGVKFTAPASGSVIEVNRGAKRVLQSVVIQ
FT                   VEGDDAVEFDKYAESELSSIAADKVQHNLVESGLWTALRTRPYSKTPALDSKPHSIFVS
FT                   AMDTNPLAGDPAVIIAPRSADFINGLRVISRLTEGKVFVSKAPGADIPVGDVKADVNEF
FT                   AGPHPAGLVGTHIHHLDTVGAAKKVWHINYQDVIAVGALFTTGKLNNERVIALGGPAAK
FT                   NPRLIKTVLGASVSELTSGETTEGEVRTISGSVLQGNNAHGVHGYVGRYHVQLSLLSEG
FT                   REKEFLGWIKPGANQHSVTRAYLAHFSPKKLFNMTTTTNGSDRSMVPIGNYERVMPLDI
FT                   LPTLLLRDLISGDTDSAQTLGCLELDEEDLALCTYVCPGKYNYGPILRESLDKIEKEG"
FT   gene            527790..529001
FT                   /locus_tag="Patl_0453"
FT   CDS_pept        527790..529001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0453"
FT                   /product="NADH:ubiquinone oxidoreductase, subunit B"
FT                   /note="TIGRFAM: NADH:ubiquinone oxidoreductase, subunit B;
FT                   PFAM: NQR2 and RnfD; KEGG: pha:PSHAa2240
FT                   Na(+)-translocating NADH-quinone reductase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38983"
FT                   /db_xref="GOA:Q15YQ5"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR010966"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YQ5"
FT                   /protein_id="ABG38983.1"
FT                   /translation="MGLKAYLEKIEPNFEAGGKYEKWYALYEAAATIFYTPGKVNKAGT
FT                   HVRDSIDLKRIMIMVWAATFPAMFYGMYNIGQQAHNVILNGGASLPDMWQAALFTALGG
FT                   QIGLESTGGLAMFLYGACFFLPIYAVTFIVGGFWEVLFASVRKHEVNEGFFVTSVLFAL
FT                   TLPATIPLWQVALGITFGVVIAKEVFGGTGRNFLNPALSGRAFLYFAYPAQISGDAIWT
FT                   AADGFSGATWLSQAAAGNVTDWSLNADWWDAFFGNIQGSVGEVSSLAILLGGLFIIYMR
FT                   IASWRIVLGVLLGGAVFSTLLNVIGSDTNAMFAMPWYWHVVTGGFAFGMFFMATDPVSA
FT                   SFTNSAKWAYGFLIGLMCVLIRVLNPAFPEGMMLAILFANLWAPLFDYFVAQSNIKRRM
FT                   ARVG"
FT   gene            528991..529752
FT                   /locus_tag="Patl_0454"
FT   CDS_pept        528991..529752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0454"
FT                   /product="NADH:ubiquinone oxidoreductase, subunit C"
FT                   /note="TIGRFAM: NADH:ubiquinone oxidoreductase, subunit C;
FT                   PFAM: FMN-binding; KEGG: yps:YPTB0889 Na+-translocating
FT                   NADH-quinone reductase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38984"
FT                   /db_xref="GOA:Q15YQ4"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010204"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YQ4"
FT                   /protein_id="ABG38984.1"
FT                   /translation="MSAKKETLGKTVGVVIAVCLVCSVIVSTAAVSLRSQQQANAKLDK
FT                   QTNILESAGLLEAGQSKEQIAATYADRVQEKFVDLATGQYVEKEAGYDMYKAARDPEES
FT                   IKPVPDTAGILRRPNVASVYLISNPDGEVTRIVLPINGSGLWNLMYAMLAVDSDGNTVR
FT                   ELVYYDQQETPGLGGEVQNPEWKAKWDGKKLYKNGEVAIDVTKGAKANDPYEVDALSGA
FT                   TLTSNGVQNTLDYWLGENGFGPYLKNQPWKS"
FT   sig_peptide     528991..529080
FT                   /locus_tag="Patl_0454"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.584 at
FT                   residue 30"
FT   gene            529764..530396
FT                   /locus_tag="Patl_0455"
FT   CDS_pept        529764..530396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0455"
FT                   /product="NADH:ubiquinone oxidoreductase, subunit D"
FT                   /note="TIGRFAM: NADH:ubiquinone oxidoreductase, subunit D;
FT                   PFAM: RnfA-Nqr electron transport subunit; KEGG: son:SO1106
FT                   NADH:ubiquinone oxidoreductase, Na translocating,
FT                   hydrophobic membrane protein NqrD"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38985"
FT                   /db_xref="GOA:Q15YQ3"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011292"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YQ3"
FT                   /protein_id="ABG38985.1"
FT                   /translation="MADTKEMKKVLFGPILDNNPIALQILGVCSALAVTTKLETALVMS
FT                   LALTAVTAFSNLFISMIRSQIPSSVRIIVQMTIIASLVIVVDQILKAYSYEISKQLSVF
FT                   VGLIITNCIVMGRAEAFAMKSPPFISFLDGIGNGLGYSFVLIVIGTIKELFGFGTILGF
FT                   EILPLIQNGGWYQGNGLLILPFSSFFLIGGLIWFIRTIKPEQVEPKE"
FT   gene            530401..531009
FT                   /locus_tag="Patl_0456"
FT   CDS_pept        530401..531009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0456"
FT                   /product="NADH:ubiquinone oxidoreductase, subunit E"
FT                   /note="TIGRFAM: NADH:ubiquinone oxidoreductase, subunit E;
FT                   PFAM: RnfA-Nqr electron transport subunit; KEGG: ilo:IL1046
FT                   Na+-transporting NADH:ubiquinone oxidoreductase, subunit
FT                   NqrE"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38986"
FT                   /db_xref="GOA:Q15YQ2"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YQ2"
FT                   /protein_id="ABG38986.1"
FT                   /translation="MEQYLSLFIRSIFLENMALFYFLGMCTFLAVSKKVKTAMGLGVAV
FT                   IVVLTISVPVNQLVYANILAPGALGWAGFPDTDLSFLSFLTFIGVIAALVQILEMTLDK
FT                   FFPALYNALGIFLPLITVNCAIFGGVAFAVQRDYTFTESIFYGAGSGAGWALAITLLAA
FT                   VREKLKYADMPEGVRGLGSVFMIAGLMALGFQSFSGVSI"
FT   gene            531034..532260
FT                   /locus_tag="Patl_0457"
FT   CDS_pept        531034..532260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0457"
FT                   /product="NADH:ubiquinone oxidoreductase, subunit F"
FT                   /note="TIGRFAM: NADH:ubiquinone oxidoreductase, subunit F;
FT                   PFAM: ferredoxin oxidoreductase FAD/NAD(P)-binding
FT                   Oxidoreductase FAD-binding region; KEGG: ilo:IL1045
FT                   Na+-transporting NADH:ubiquinone oxidoreductase, subunit
FT                   NqrF"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38987"
FT                   /db_xref="GOA:Q15YQ1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR010205"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YQ1"
FT                   /protein_id="ABG38987.1"
FT                   /translation="MLDIYLGVGMFIAIVLALVLIIMFAKSKLVPEGEVTISINGDPDK
FT                   AITAQPGDKLLGALANSGIFVSSACGGGGSCGQCRVDIKAGGGEILPTELDHISKREAK
FT                   EGCRLSCQVSIKQDMDIELPEEIFGIKKWDCEVISNDNKATFIKELKLKIPNGESVPFR
FT                   AGGYIQIEAPPHHVKYKDFDVPEEYRGDWERFGFFDIESKVDDETIRAYSMANYPEEEG
FT                   IIMLNVRVASPPPNNLSLPAGKMSSYIWSLKEGDKATISGPFGEFFAKKTDAEMVFIGG
FT                   GAGMAPMRSHIFDQLRRLKTDRKISFWYGARSLREMFYVEDFDMLQKENDNFKWHVALS
FT                   DPQPEDNWEGMTGFIHQVLLENYLKDHPAPEDCEFYMCGPPMMNAAVISMLKDLGVEDE
FT                   NIMLDDFGG"
FT   gene            532348..533373
FT                   /locus_tag="Patl_0458"
FT   CDS_pept        532348..533373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0458"
FT                   /product="ApbE-like lipoprotein"
FT                   /note="PFAM: ApbE-like lipoprotein; KEGG: vch:VC2289
FT                   thiamin biosynthesis lipoprotein ApbE"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38988"
FT                   /db_xref="GOA:Q15YQ0"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YQ0"
FT                   /protein_id="ABG38988.1"
FT                   /translation="MIKGDSGKAKFLGLILWIWLLCSCSQAPTETHLAGHTMGTTYNVK
FT                   FVNRNNVNEQKLHDDIDAALVKVNELMSTYDANSELSRFNQWKSEAPFALSSETLKVMQ
FT                   EAKRLGELSHGVLDVTVGPLVNLWGFGPDAKPEKRPSKQTVAEVKARIGLDKLTLLDNG
FT                   AQKSEIDLYVDLSTIAKGYGVDVVAELLDEKGLHDYLVEVGGEMRVSGHKATGREWRIA
FT                   VEKPVSVERAVQEIISIGTNAIATSGDYRNYFEEDGVRYSHLIDPRTGAPITHNLVAVT
FT                   VVHSSSMTADGLATALIVMGKEEAFNVALQNDLAVLMITRENGEFKEYTTPKFEPFINR
FT                   Q"
FT   gene            533408..533641
FT                   /locus_tag="Patl_0459"
FT   CDS_pept        533408..533641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0459"
FT                   /product="protein of unknown function DUF539"
FT                   /note="PFAM: protein of unknown function DUF539; KEGG:
FT                   ilo:IL1043 uncharacterized conserved membrane or secreted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38989"
FT                   /db_xref="InterPro:IPR007495"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YP9"
FT                   /protein_id="ABG38989.1"
FT                   /translation="MSTFILAFVFFLVVAVAMSLGYLVQRKAIAGSCGGLGALGIDKAC
FT                   DCPEPCDRKKARLEREEARQAKLNEWKQNQIL"
FT   sig_peptide     533408..533473
FT                   /locus_tag="Patl_0459"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.329 at
FT                   residue 22"
FT   gene            533737..534807
FT                   /locus_tag="Patl_0460"
FT   CDS_pept        533737..534807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0460"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC-like DNA-repair protein; KEGG:
FT                   ppr:PBPRA0832 putative DNA-damage-inducible protein P"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38990"
FT                   /db_xref="GOA:Q15YP8"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YP8"
FT                   /protein_id="ABG38990.1"
FT                   /translation="MRKIIHIDMDCYYAAVEMRDNPQYRDIPLAIGGSADRRGVISTCN
FT                   YVARKYGVRSAMATAYARKLCPDLVLVPGRMALYSEISQQIRKIFLRYTDKIEPLSLDE
FT                   AYLDVTDSELFSGSATLIAQDIRRAIFEETQLTASAGVAPCKFVAKIASDENKPNGICV
FT                   ITPDTQDAFVKTLALGKIPGVGKVTLQKLNNMGLFTCQDVRDYPLDAFVKAFGKFGPVI
FT                   WDRSHGIDERELSVSRKRKSVGVERTLAQDITTDEECLAMLESLYPKLLSRLEAASPKL
FT                   AIQSQGVKLKFNDFQQTTVEHRHQVLDKTYFKTLLSEALERRGTRGIRLVGLSVGLPET
FT                   ADVQQMVFNFEHEQNR"
FT   gene            534913..535146
FT                   /locus_tag="Patl_0461"
FT   CDS_pept        534913..535146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0461"
FT                   /product="protein of unknown function DUF1653"
FT                   /note="PFAM: protein of unknown function DUF1653; KEGG:
FT                   psp:PSPPH_3208 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38991"
FT                   /db_xref="InterPro:IPR023387"
FT                   /db_xref="InterPro:IPR037135"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YP7"
FT                   /protein_id="ABG38991.1"
FT                   /translation="MYLESSMSIAVGKYRHYKGNDYEVIGVATHSEDDSELVVYRPMYG
FT                   DRGLWVRPLSMFEETVEVNGQTMPRFRFIESE"
FT   gene            535225..536103
FT                   /locus_tag="Patl_0462"
FT   CDS_pept        535225..536103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0462"
FT                   /product="beta-lactamase-like protein"
FT                   /note="PFAM: beta-lactamase-like; KEGG: ilo:IL0617
FT                   Zn-dependent hydrolase, glyoxylase family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38992"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YP6"
FT                   /protein_id="ABG38992.1"
FT                   /translation="MFKSKVNALRFAMATLTLFGSTTLSADDDRFADVHISTQAVSGST
FT                   YMLTGAGGNIGVSAGDDGILIIDDQFAPLADKIALAIGDIAKQPMKYVINTHYHGDHTG
FT                   SNAYFKEVQGSTIFAHDNVRKRLAAEDGHKHAALPVVTYEQGLTFHFNGDTIKVLHLPA
FT                   GHTDSDSVVWFEQANVLHAGDLFFQGRFPYIDLAGGGTVKGYISNVSTVIDMINNDTKV
FT                   MPGHGELADKKAYQASLEMMQQTANYVSDRKSKGASLDSLIEEGLDDKWQDWAWNFITE
FT                   EKWITTLYNGQ"
FT   sig_peptide     535225..535305
FT                   /locus_tag="Patl_0462"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.925 at
FT                   residue 27"
FT   gene            complement(536200..537858)
FT                   /locus_tag="Patl_0463"
FT   CDS_pept        complement(536200..537858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0463"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: ilo:IL1207 predicted
FT                   metal-dependent amidohydrolase with the TIM-barrel fold"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38993"
FT                   /db_xref="GOA:Q15YP5"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YP5"
FT                   /protein_id="ABG38993.1"
FT                   /translation="MKHSVLILLGYLLSTATLAAPTHLTNVHGYTLSDTEEMVTFTDMV
FT                   FDGGRVLAIGGTSLKNTYPDADMIDGKKRVLLPGLIDAHGHILGLGETLLAVDVRDIPS
FT                   AKASAQKVRDYAQQNPDLTWILGGGWNQVLWADNAFPTSEMLDEYIQDRPVWISRIDGH
FT                   AGWANSKALQIAGVTKDSLDPPGGQIVRDKNGVPTGVLIDNAMNMLVEKIPQDTEQDLQ
FT                   RKLDAAAAHLLSLGITSTHDAGINYATYQYYIKRSQQLDLNMRIYAMLAATDPKLADML
FT                   NAGPIHDQYDYLSIRSVKVYGDGALGSRGAAMLSGYSDDHENIGLLLTPIKQLKPLFDL
FT                   IIGNGFQLNIHEIGDRGNRLALDQFEETFSRIKGQHLRNRVEHAQVIDVTDIPRFKTLG
FT                   IIPSMQPTHATSDMNMAQDRIGEARLKGAYAWQTFEEQGSIVPFGSDFPVELANPFFGL
FT                   HAAVTRQNRNNQPEAGWIKEEAVTVEQAFKGFTYSGAYAAHQENSIGTLSSGKWADFIL
FT                   VDQDIFTISPQDIWKTKVLETWVGGVKRYDSALND"
FT   sig_peptide     complement(537799..537858)
FT                   /locus_tag="Patl_0463"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 20"
FT   gene            complement(538040..540127)
FT                   /locus_tag="Patl_0464"
FT   CDS_pept        complement(538040..540127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0464"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: translation elongation factor G small
FT                   GTP-binding protein; PFAM: elongation factor G-like protein
FT                   synthesis factor, GTP-binding elongation factor Tu, domain
FT                   2 elongation factor G, domain IV; KEGG: cps:CPS_0875
FT                   translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38994"
FT                   /db_xref="GOA:Q15YP4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YP4"
FT                   /protein_id="ABG38994.1"
FT                   /translation="MKDLARYRNIGIFAHVDAGKTTTTERILKLTGQIHKTGEVHDGES
FT                   TTDFMEQEAERGITIQSAAVSCFWKDHRFNVIDTPGHVDFTVEVYRSLKVLDGGIGVFC
FT                   GSGGVEPQSETNWRYANDSEVARIIFVNKLDRMGADFYRVVDQTKKVLGANPLVMVLPI
FT                   GIEDDFVGVVDLLTRKAFIWDDTGLPENYEITDVPADMVDKVEEYREMLIETAVEQDDD
FT                   LMMAYMDGEEPSMEDIKRCIRKGTRTMDFFPTYCGSAFKNKGVQNILDAVVDYLPSPTE
FT                   VDPQPLTDEEGEPNGKYAIVSPDETFKALAFKITDDRFGALTFVRIYSGTLKKGDTILN
FT                   AATGKTERIGRMCEMQADDRNELTSAQAGDIIAIVGMKSNVQTGHTLCDPKDPIILEAM
FT                   VFPEPVISISVTPKDKGSTEKMGLAIGKMVAEDPTFRVETDQDSGETILSGMGELHLDI
FT                   KVDILKRTYGVELEVGEPQVAYRETITQEVEDSYTHKKQSGGSGQFGKIDYRIKPGEPN
FT                   SGFTFSSVVVGGNVPKEFFPAIEKGFASMMESGVLAGFPVLDVEVELYDGGFHAVDSSA
FT                   VAFEIAAKGAFRQSIPKAGPQLIEPIMKVDVFTPDDHVGDVIGDLNRRRGMIKDQEAGV
FT                   TGVRVKADIPLSEMFGYIGSLRTMTSGRGQFSMEFSHYSPCPNNVAEKVIADTKERNAK
FT                   K"
FT   gene            complement(540401..541423)
FT                   /locus_tag="Patl_0465"
FT   CDS_pept        complement(540401..541423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0465"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: conserved
FT                   hypothetical protein; KEGG: son:SO2197 GGDEF family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38995"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YP3"
FT                   /protein_id="ABG38995.1"
FT                   /translation="MKNHDLENSFKHLKNTIPLLLKHKIPAVPLNYALWYTYASNESES
FT                   LNETLDHALQRNLPISDSKTRDLYRKHVADEQDVDVWELRHSLESMVIELSQSVQDTRS
FT                   ETRNFKSTMDTCMDDLAKVEREGLSMEEVMDLVRTLVSQTKQIRGSTLSFSTALNDAER
FT                   EITRLRNQLEQSQQAALYDVLTGLCNRRYFDEELAAHAMRPNMCLILADLDHFKKINDT
FT                   HGHVMGDLVLKASAKKLQAACREGAQAFRFGGEEFAIIVPNSKLSVARQIAETMRRSIE
FT                   KIGVRDKRTSQVLGGISASFGIAEMKTGMNPLALIEAADKQLYEAKNLGRNRVMPMSNG
FT                   "
FT   gene            complement(541570..544911)
FT                   /locus_tag="Patl_0466"
FT   CDS_pept        complement(541570..544911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0466"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase WD40-like beta Propeller; KEGG:
FT                   pha:PSHAa1171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38996"
FT                   /db_xref="GOA:Q15YP2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YP2"
FT                   /protein_id="ABG38996.1"
FT                   /translation="MYKNLINVALFSTMLSLSADAFSRVELQKAKQNALTEESSEAEWD
FT                   VLNPPFNLNEVTINTDETTWSSLDVSPNGEKFVFDMLGDLYVSSIGGGEATSLTQDFAW
FT                   NIQPTFSPDGKKIAFISDRGGMSNVWVMNSDGSNLVQVTKEKNNLIHSPKWSPDGQYIV
FT                   ANKGIMSSRSIPAGEIWLYHHSGGDGMVLKKRVHGNPDQKNIADPAFSPDGKYLYYTQD
FT                   VSPGSTFDYNRDPLKSIFAITRYDMNTGEEERYISGTGGAVVPTPSPDGKQIAFIRRVK
FT                   EKTGLFVKDIATGVESLLYLKLERDMQEGFGSEGYFPYFDWMPNSKRIVFWTGGKFHSI
FT                   DVKTQAVKDIPVSVKATVKYADAVRFDVDVAPEKFAVKMARWAQKSPNGQNIVFQALGK
FT                   LYIKEIKSGKVKRLTRQNDHDEYYPRYSHDGKKIVFTTWNDKDLGSVRTVSASGRSEKV
FT                   ISKEPGHFIEPSFSTDDKLITYNKKTGGYLLAPEYSVEPGIYTATVKGEKHRRVAKNGS
FT                   APHFAGDNSRVYFTESVSGSDYPEQQLVSVDLNGEDKREHLYGGDKIAEYRLSPDKKWI
FT                   AFVYQYKAYVAPFTEIGQKQDIGPKSTTIPIKQLSDRAGEYLTWRSDSQAISWYHAATY
FT                   YERELKEAFAFVPGAAEDLPDPVTEGMSLSFEQKTDKPSGYKALVGGTVVTMRDANNQQ
FT                   EIIEDAVVVIKDNKIVEVGKRADITIPNNALKIDTTGKTILPGLIDAHAHGSQGSNEII
FT                   PEQNWNMYSALAFGVTTIHDPSNDTSEIFAASELQKAGKRVAPRTYSTGTIIYGAEALG
FT                   YKAIINSYEDALTHLRRLKDAGAISVKSYNQPRRDQRQQILAAARELNLMVVPEGGGKY
FT                   QQNISMLVDGHTGLEHSLPIARGYQDLTALWVETEFGYTPTFVVSYGGLMGEEYWYDRT
FT                   EVWKNERLLRYTPSFLLDRRAIRRPTAPDNQYNHVFVAQYAKTLRDKGVSVHIGAHGQR
FT                   EGLAAHWELWLMTQGGFTPWEALRGGTIDGATHLGMGKQLGSIEAGKLADMMIIDGDVL
FT                   TDIRRSEYVTYTVINGRIYDAATMNEVGSKTKRPAFFFENNNTLFMPEATQQSIQQKSE
FT                   KHHWVH"
FT   sig_peptide     complement(544846..544911)
FT                   /locus_tag="Patl_0466"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.617 at
FT                   residue 22"
FT   gene            complement(545066..547276)
FT                   /locus_tag="Patl_0467"
FT   CDS_pept        complement(545066..547276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0467"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: type II secretion system protein E GAF; SMART:
FT                   ATPase; KEGG: neu:NE2290 bacterial type II secretion system
FT                   protein E:GAF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38997"
FT                   /db_xref="GOA:Q15YP1"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YP1"
FT                   /protein_id="ABG38997.1"
FT                   /translation="MEHQSALQELKQLLANAPSLISAYDKLEPLLLSLFNVQRMSIFQR
FT                   RMQHQDLVARFKTGNEIQEIKVPISPQSIAGYVALSQKPLIVNDPYSSEELSAIHPRLK
FT                   FADKFDKSSTFKTQNLICIPILNAGVLMGIMQIINRNDGVFQSADLALADKVAQALGNK
FT                   FRYELGGTSQPFDYLVHRNVIDEDTLAKYVHTNPDHAQLVQRLMTEKRIPEDEMGIALS
FT                   VHYQVPYIGYKPDRFHLYQSDSKLNLSYLKRNFVAVITDATEKPTVLMAQPSNANLLME
FT                   IESALGIDSYGISVALPNTVLQYLGEASGGGAGPGAMNEILDEIETSGQEADEQADDMS
FT                   DDAPAVVRLVSRILHDAKRLDASDIHIDAEKNAPTRVRMRIDGVCRDITQVPASHHNAV
FT                   IARIKIMSNLNIAEKRLPQDGKLAFKLSGQIIEVRVATIPTVAGEGVVMRILATGGALP
FT                   MEKMNLSPANNQSILRMIEKPHGILLVVGPTGSGKTTTLHAVLGHINTPDKKIWTAEDP
FT                   VEITQAGLQQVQVSPRIGFTFASALRAFLRADPDIILIGEMRDKETAHAGVEASLTGHL
FT                   VFSTLHTNSAPETITRLLDLGIDPVNFSDACIGILAQRLVRTLCKNCKEATPASDTDVE
FT                   FITRQYGADYVSELSLQPTLMLHKPKGCDRCGNTGYKGRTGVHELLSMTPALRSMVYKE
FT                   APVSQLKAQAMEDGMRTLIQDGILKVLKGDTDIAQIQMLASV"
FT   gene            547635..547946
FT                   /locus_tag="Patl_0468"
FT   CDS_pept        547635..547946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0468"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="PFAM: ribosomal protein S10; KEGG: ppr:PBPRA0319
FT                   putative ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38998"
FT                   /db_xref="GOA:Q15YP0"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YP0"
FT                   /protein_id="ABG38998.1"
FT                   /translation="MPNQRIRIRLKAFDHKLIDQSTAEIVETAKRTGAQVSGPIPLPTR
FT                   KERYTILTSPHVNKDARDQYEIRTHKRLVDIIEPTDKTVDALMRLDLAAGVDVQISLG"
FT   gene            547965..548603
FT                   /locus_tag="Patl_0469"
FT   CDS_pept        547965..548603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0469"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="PFAM: ribosomal protein L3; KEGG: pha:PSHAa0144 50S
FT                   ribosomal subunit protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABG38999"
FT                   /db_xref="GOA:Q15YN9"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YN9"
FT                   /protein_id="ABG38999.1"
FT                   /translation="MAIGLIGRKVGMTRIFTEDGVSIPVTVIEATPNRVTQLRTDETDG
FT                   YTALQVTAGDKKANRVNKAAAGHFAKAGVEAGRGLWEFRLDGNEGEGIEVGSEITVEIF
FT                   AETKMVDVAGTSKGKGFQGAIKRWNFSHQRNSHGNSLSHRAPGSIGQNQSPGKVFKGKK
FT                   MAGQMGNKRVTVQSLDVVRVDAENNLLLVRGNVPGAPGGDVIIKAAVKA"
FT   gene            548622..549227
FT                   /locus_tag="Patl_0470"
FT   CDS_pept        548622..549227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0470"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: ilo:IL1923
FT                   ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39000"
FT                   /db_xref="GOA:Q15YN8"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YN8"
FT                   /protein_id="ABG39000.1"
FT                   /translation="MELVLKDAQSALEVSEATFGREFNEALVHQVVVAFGAGARQGSKA
FT                   QKTRSEVRGGGAKPWRQKGTGRARAGTIRSPIWRSGGVTFAAKPQDHSQKVNKKMYRGA
FT                   IQSILSELVRQERLIVVEKFSVEAPKTKELLSKLNGLELSDVLIVTSEVDENLFLAARN
FT                   LYKVDVRDVQGIDPVSLIAFEKVLITADAVKALEEALA"
FT   gene            549224..549526
FT                   /locus_tag="Patl_0471"
FT   CDS_pept        549224..549526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0471"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: pha:PSHAa0146
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39001"
FT                   /db_xref="GOA:Q15YN7"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YN7"
FT                   /protein_id="ABG39001.1"
FT                   /translation="MINEERLLKVVLAPHVSEKATLAAEVNNTVVFKVLKDANKEEIKA
FT                   AVEKLFEVEVNSVRTVNVKGKTKRHGASFGKRKDWKKAYVVLKEGQDIDFAGSEG"
FT   gene            549541..550365
FT                   /locus_tag="Patl_0472"
FT   CDS_pept        549541..550365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0472"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="PFAM: ribosomal protein L2; KEGG: pha:PSHAa0147 50S
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39002"
FT                   /db_xref="GOA:Q15YN6"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YN6"
FT                   /protein_id="ABG39002.1"
FT                   /translation="MPLLKAKPTSAGRRHVVQVVNPDLHKGAPYAPLLEKNSKSGGRNN
FT                   NGRITVRHVGGGHKQHYRVIDFKRNKDGIPAKIERLEYDPNRSANICLVLYADGERRYI
FT                   LAPKGAKAGDQIQSGSDAAIKAGNSLPMRNIPVGTTVHAIEMKPGKGAQIARSAGQYAQ
FT                   ILARAEGYVTLRLRSGEVRRVLADCRATIGEIGNAEHMLRSLGKAGANRWRGIRPTVRG
FT                   VAMNPVDHPHGGGEGRTSGGRHPVSPWGVPTKGKKTRSNKRTDKLIVRRRNK"
FT   gene            550381..550656
FT                   /locus_tag="Patl_0473"
FT   CDS_pept        550381..550656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0473"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: vpa:VP0261 ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39003"
FT                   /db_xref="GOA:Q15YN5"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YN5"
FT                   /protein_id="ABG39003.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEAAVEKNDKKPIKTWSRRSMIIPDMI
FT                   GLTIAVHNGRQHVPVFVSDEMVGHKLGEFAPTRTYRGHVADKKAKR"
FT   gene            550667..550999
FT                   /locus_tag="Patl_0474"
FT   CDS_pept        550667..550999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0474"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: ilo:IL1919 ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39004"
FT                   /db_xref="GOA:Q15YN4"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YN4"
FT                   /protein_id="ABG39004.1"
FT                   /translation="MEALATHRHARTSAQKARLVADQIRGLHVEKALELLAYSPKKSAD
FT                   LIKKVLESAIANAEHNEGADIDELTVSKVFVDEGPTMKRIKPRAKGRADRIFKRSSHIT
FT                   VVVADN"
FT   gene            551009..551707
FT                   /locus_tag="Patl_0475"
FT   CDS_pept        551009..551707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0475"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="KEGG: pha:PSHAa0150 30S ribosomal subunit protein
FT                   S3; TIGRFAM: ribosomal protein S3; PFAM: ribosomal protein
FT                   S3-like KH, type 2; SMART: KH"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39005"
FT                   /db_xref="GOA:Q15YN3"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YN3"
FT                   /protein_id="ABG39005.1"
FT                   /translation="MGQKVHPTGIRLGISKPWTSTWYANTADYADNLFNDHQVRQYLTK
FT                   ALKTASLSKIVIERPAKSIRVTIHTARPGVVIGKKGEDVEKLRKHVSKLAGVPAQINIA
FT                   EVRKPELDGQLVADSIASQLERRVMFRRAMKRAVQNAMRIGAKGIKVQVSGRLGGAEIA
FT                   RAEWYREGRVPLHTFRADIDYATSEANTTYGIIGVKVWIFKGEVLGGLPLTQEQPAQPK
FT                   KKGRSPKREG"
FT   gene            551710..552120
FT                   /locus_tag="Patl_0476"
FT   CDS_pept        551710..552120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0476"
FT                   /product="LSU ribosomal protein L16P"
FT                   /note="PFAM: ribosomal protein L16; KEGG: plu:plu4719 50S
FT                   ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39006"
FT                   /db_xref="GOA:Q15YN2"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YN2"
FT                   /protein_id="ABG39006.1"
FT                   /translation="MLQPKRMKFRKMHKGRNRGYAAGDSVSFGTFGLKSVGRGRMTARQ
FT                   IEAARRAMTRAVKRQGKIWIRVFPDKPITEKPLEVRQGKGKGNVEYWVCQIQPGRVLYE
FT                   MEGVPESVAREAFELAASKLPFKTTFVTRTVM"
FT   gene            552120..552311
FT                   /locus_tag="Patl_0477"
FT   CDS_pept        552120..552311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0477"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="PFAM: ribosomal protein L29; KEGG: pha:PSHAa0152 50S
FT                   ribosomal subunit protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39007"
FT                   /db_xref="GOA:Q15YN1"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YN1"
FT                   /protein_id="ABG39007.1"
FT                   /translation="MKATELKDKSVEELNTELLNLLREQFNLRMQASTGQLEKTDQIRK
FT                   VRRSIARVKTILTQKAAA"
FT   gene            552311..552562
FT                   /locus_tag="Patl_0478"
FT   CDS_pept        552311..552562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0478"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="PFAM: ribosomal protein S17; KEGG: son:SO0240 30S
FT                   ribosomal subunit protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39008"
FT                   /db_xref="GOA:Q15YN0"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YN0"
FT                   /protein_id="ABG39008.1"
FT                   /translation="MTEQSSRTVQGRVVSNKMDKTITVAVERKVKSPIYGKFIKRTTKL
FT                   HAHDETNQCNTGDVVTVRECRPMSKSKNWMLVDIVTKA"
FT   gene            complement(552665..554080)
FT                   /locus_tag="Patl_0479"
FT   CDS_pept        complement(552665..554080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0479"
FT                   /product="peptidase S41"
FT                   /note="PFAM: peptidase S41; KEGG: pha:PSHAa0289
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39009"
FT                   /db_xref="GOA:Q15YM9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YM9"
FT                   /protein_id="ABG39009.1"
FT                   /translation="MTGEAFTDAAGDALDEKLWLRSWTNNTYLWYDEVDDNNPADFSTS
FT                   IYFEQLKTDFRSDAGSFKDNFHFSQSTDEYLTRTQRGQSFGYGISWEFIQASAPRRIIV
FT                   RYTQPGSPAENAGIERGDELIAIDTIDFINTENNDDVDTINEALFPSSAGQVFQFTLQK
FT                   KSGVQRDYSLTPSNVELSPVRNSTVLSTEIGSVGYVQFDSHIQSAQGPLISAFNLFSQN
FT                   NVQALILDLRYNGGGLLSMASQLAFMVTGEQQTDGLIFDELKFNDKHPTFDPVTGRRLQ
FT                   PTPFYNREIDYERNEFTSNALPSLGLNTIYILTSGATCSASEAVINGLRGIDVEVVIIG
FT                   DTTCGKPYGFYPTDNCGTTYFTIQFQGSNQKGFGEYSDGFIPTPNPIFEADVQGCLVED
FT                   DFSHALGSNDERMLSAAVNHLQTGQCPVQAKAKIAVAQFPVSQGPSIQTSVSILDAIML
FT                   ENALNQPIGEPQK"
FT   gene            554597..555778
FT                   /locus_tag="Patl_0480"
FT   CDS_pept        554597..555778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0480"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: conserved
FT                   hypothetical protein; KEGG: rru:Rru_A3374 putative
FT                   diguanylate cyclase (GGDEF domain) with PAS/PAC sensor
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39010"
FT                   /db_xref="GOA:Q15YM8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YM8"
FT                   /protein_id="ABG39010.1"
FT                   /translation="MTTNRSSHYPPGYPRGAAISSTVYLLLGVLLAVFVFLTLDRVIQA
FT                   QAKITHEVNISGQQRMLLQRASLFASAYLYSEDIAAKQTSLQALGEMQVNHQHLTEPHF
FT                   SALEKGQASPLSAELQALYFTADNNVTEQLTIFGDQLYFALNLEKIQNGAKLDAKALME
FT                   MAYTPLLQKLEDVTRQYEIQDNKRIDALRSVQRVVFWMTIAILLLGLCLMMFNFNKHAH
FT                   IELAAKSLGGDSGQETPVFNLNALELSARKLIATARRHNESMSVLAFDIDRFPQILTNY
FT                   GRDTADEVLNQVAKSISTVCRDSDYLGQIEDEKFVLLLPKTSAKQAMCLANKISSYFEQ
FT                   LKSNAQLREVIPSVSIGISELDVDDSVLQPIITRAFHALTLHSSLKHGRVCVG"
FT   gene            555911..557407
FT                   /locus_tag="Patl_0481"
FT   CDS_pept        555911..557407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0481"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: Catalase-like; KEGG: rru:Rru_A2489 catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39011"
FT                   /db_xref="GOA:Q15YM7"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YM7"
FT                   /protein_id="ABG39011.1"
FT                   /translation="MSDKPRLTTSAGAPVPSNSTSRSAGERGPLLLTDYQLIEKLAHQN
FT                   RERIPERAVHAKGWGLKGKFTVTHDISQYSCAKLFSNVGKTTEVLSRWSTVAGESGAAD
FT                   TERDVRGFSLKFYTEEGNWDMVGNNTPVFFIRDGFKFPDFIRTQKRHPKANLRSPEAMF
FT                   DFWAAQPECVHQVTILMSDRGIPVNPMYMNGYGSHTFSMWNKDAERHWVKFHFKTQQGH
FT                   KHYTNAEAEALTGKTREAYQEDLYNAIEEGNFPKWTMYIQVMPELEAENQPFNPFDITK
FT                   IWPHADFPLIEVGELEMNENPENYFQMVENAAYSPSNVVPGIGYSPDKMLQARVFSYAD
FT                   AHRYRLGTHYEALPANVAKASNIQHYHKDGSMRFFTNDFGNPDAYYEPNQHNGPVADAS
FT                   VEEPPLRIDGDAARYEQQESDADYVQPRALYEMFDDAQKQRLYDNYAAAMGPCSSSVKE
FT                   RWYAVLEKVHPEYARGVRLANDNLDSDTNAVPITDDTPVR"
FT   gene            complement(557538..558083)
FT                   /locus_tag="Patl_0482"
FT   CDS_pept        complement(557538..558083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0482"
FT                   /product="Paraquat-inducible protein A"
FT                   /note="PFAM: Paraquat-inducible protein A; KEGG: son:SO4710
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39012"
FT                   /db_xref="GOA:Q15YM6"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YM6"
FT                   /protein_id="ABG39012.1"
FT                   /translation="MAIALFIPGITLPMFALSMEMTALLNTAGMTSNLIDKELSILSMV
FT                   HELWDSERFLVAALIFLFSVCIPILKTTLMSIIYFTRNHNLARQVTQFVATIGKWSMAD
FT                   VFVVAVFLAILSTNHADTLSQETLNLFGFTIGIDISTQTLSAAGDGFFYFVGYCLISLL
FT                   ASHIATSPYTLQRVEIDV"
FT   gene            complement(558138..558566)
FT                   /locus_tag="Patl_0483"
FT   CDS_pept        complement(558138..558566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC3767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39013"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YM5"
FT                   /protein_id="ABG39013.1"
FT                   /translation="MGPLITRFFSIVALIVVSHSSLALVVVVGKGNTLDSLSKTQVIDI
FT                   YMGRYNTFPNGVVAKPLDRTTGSNEKQQFYQLLVNKSEEKINAYWARLLFSGRASPPSN
FT                   FPSNDEMLDELRRSDKAIGYVLESEVDDSLKVVYRFEE"
FT   sig_peptide     complement(558495..558566)
FT                   /locus_tag="Patl_0483"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.951 at
FT                   residue 24"
FT   gene            complement(558568..559836)
FT                   /locus_tag="Patl_0484"
FT   CDS_pept        complement(558568..559836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0484"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vch:VC2456 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39014"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YM4"
FT                   /protein_id="ABG39014.1"
FT                   /translation="MPNYTTLARSTFTYLLLSIVSIDMALAESDMIKFNGFATLGAIYN
FT                   DSDDLGFHTNFKTPARSGFSFAPDSLIGAQANISFTPQWDAIVQAVYRDKQDSSVLNYI
FT                   DVAFLRYKLDSRWEFRAGRMNTDIYFLSEYKSVGYAYLWARPPAEFYSKVTSVSQFEGA
FT                   DIAYKHSLGNGFLQLKAGFGESDARIATTGRAYDIDFTDVLTTSVSYQQDNWQLRASYL
FT                   SAEVDNFSADLSAFDAAIALFPPSVWPGGPELLDRVSFESKDQQFFGLGYQYDNDLWLV
FT                   QTELGFIKSDWELERDSVSGYLSIGYQPEGITYFVTVSAIEPTKDNVDDGVGEISPFAP
FT                   AEVVATIQSFGPSITNLFNQNRTKQHTFSLGTKWQLSASLIAKFQMDYSVIADDGFGIW
FT                   KVNVQPDSGESVTVTSLNLNWVF"
FT   gene            560064..560690
FT                   /locus_tag="Patl_0485"
FT   CDS_pept        560064..560690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39015"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YM3"
FT                   /protein_id="ABG39015.1"
FT                   /translation="MPRFASYSYILSIFDRVTPLRIIICFIAIVYASQGAATELNWQQT
FT                   LQWLKQTLPQSAELDFDKKSIKFDGCHQRDYQLTFHQELGEGISIDTQIGYVKGELSWG
FT                   AHNQKTTTRQWAILPRYRLNHRVSLGLGYVRQMDTNLETSQGADIQLPASNQWLLSSRF
FT                   MLDSEKQYVEVAVSRALWQANDASQAWAGQGRADKQINLVYVANF"
FT   gene            complement(560733..561587)
FT                   /locus_tag="Patl_0486"
FT   CDS_pept        complement(560733..561587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0486"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase-like amino acid-binding ACT; KEGG:
FT                   pfl:PFL_4786 formyltetrahydrofolate deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39016"
FT                   /db_xref="GOA:Q15YM2"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YM2"
FT                   /protein_id="ABG39016.1"
FT                   /translation="MEQTLRLVIDCPDQVGLVASVSQFLAQHNATIVEASHHTDLQTGR
FT                   FFMRHEISTDSLTMDIEQIRLGFAPIAEKYSMNWKLVDSSKKPRMALLASHESHCLMDL
FT                   LHRWHSKELNCEIPCIIANHPQMKQFADWHSIPFHWIDFKSLGKEAAFAQISQLIKQYD
FT                   IDLTVLARFMQILPDALCKELAGRAINIHHSFLPSFAGAKPYQQAYDRGVKLIGATCHY
FT                   VTSDLDEGPIIEQEVMRISHSDSAQDMVRKGKNCEKTALANGVRYHLEDRVIIHHSKTV
FT                   VFA"
FT   gene            complement(561691..562221)
FT                   /locus_tag="Patl_0487"
FT   CDS_pept        complement(561691..562221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0487"
FT                   /product="2'-5' RNA ligase"
FT                   /note="TIGRFAM: 2'-5' RNA ligase; PFAM: 2',5' RNA ligase;
FT                   KEGG: eca:ECA3315 2'-5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39017"
FT                   /db_xref="GOA:Q15YM1"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YM1"
FT                   /protein_id="ABG39017.1"
FT                   /translation="MRAFFALTPPGTTKLAIETWRDKAFPQFYSPVKASNFHITLAFLG
FT                   NINESQLDSLSQYIDAHLNTQCFLLTLDYVGYWSKPKALWLGNTQVSKEQLDLVALLQK
FT                   ASPACGITMQKRDYISHLTLARKCSENPPAALIEPNFAFQATELTLYESASSAHGVTYR
FT                   PILTWPFSPRFSF"
FT   gene            562332..564803
FT                   /locus_tag="Patl_0488"
FT   CDS_pept        562332..564803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0488"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /note="TIGRFAM: ATP-dependent helicase HrpB; PFAM:
FT                   helicase-like DEAD/DEAH box helicase-like Helicase
FT                   ATP-dependent-like; KEGG: hch:HCH_05855 ATP-dependent
FT                   helicase HrpB"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39018"
FT                   /db_xref="GOA:Q15YM0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YM0"
FT                   /protein_id="ABG39018.1"
FT                   /translation="MNTQLPVEDTLPALHDGLNNNDVILVAPPGAGKSTRVPLALLQHS
FT                   TFATRKIIMLQPRRIAARNIAHYLAKQLGEEVGQTVGYRIRGDSRVSKATRLEIVTEGI
FT                   LTRMLQNDPELSSVSLVIFDEFHERSMHADFSLALCLEVKDALRDDLRLLVMSATLDVS
FT                   SLEKLLPNADSIACEGRGYPIETYYRPDATAGSIVDKTARLTLFAAAEHQGDILVFLPG
FT                   QAEIRRCEKILAQSLSKGCQIHCLFSQQTLAAQEAALLPDPQGRRKIILATNIAETSLT
FT                   IEGVSVVVDSGMQKGAIYQLNKGLTQLRSQMISKASAIQRAGRAGRLGPGVCYRLWSKE
FT                   QHQRLAEHGQAEILTSDISPFLLEACVWGAQISEFALIDMPSDAQIAQAHSVLMGLQII
FT                   DANFQVTPHGKEVHSLGSQAHIATMLLKSSELSAGHRSLACALAALLEDKDPLGAQAGS
FT                   LCYDRLTLLQQHKSHPLWRAIRQWHKKLACDVTHWPLEDTGVLLGFAFPHWIAKASDSG
FT                   RYGLVDGTGAQLSEHDSLMGQSWLAVGQMMLTNSAQSNAKIMLAEPLSRQQIDKYFNHL
FT                   IDSETRCEWDSSRSAIVTQSVQRLGRIVLKKMPSAKPSVEQITALWHKQIKERGVMSLP
FT                   FNDAALQLIYRLRMAKEYLTDGQWPDVSEFGLLSNLHHWLMPYLHDVLSWQQLSKLDFY
FT                   SLLFNQLDYASQQALNQLFPTKITVPSTSRISVQYDDVGGASLSVRMQEVYGLADTPSV
FT                   ARGKVKIQMILLSPAGRPLQQTQDLAGFWKGSYKEVQKEMKGRYQKHFWPDDPANAQAT
FT                   SKTKKKMSNTQ"
FT   gene            564933..567278
FT                   /locus_tag="Patl_0489"
FT   CDS_pept        564933..567278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0489"
FT                   /product="penicillin-binding protein 1B"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: cps:CPS_4301 penicillin-binding protein;
FT                   TIGRFAM: penicillin-binding protein 1B; PFAM: glycosyl
FT                   transferase, family 51 penicillin-binding protein,
FT                   transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39019"
FT                   /db_xref="GOA:Q15YL9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011813"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR028166"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YL9"
FT                   /protein_id="ABG39019.1"
FT                   /translation="MKKTAKNKSKSSQSGASSKLRHLHPWAWLKRNWWRLLIILTAVVA
FT                   AYGVYLDAQIVKQFSGNKWQVPAQIFARPMHFELKQEITTQEIVEELELLGYRKVRHAD
FT                   DTGEYQLKASGVRIQRRAFHFPHGKESEVALDITLANGRVASLRNLDNNQALNDVYLEP
FT                   WLVTRLMSSGREDRMLVNLDGVPQSLIKALVLVEDKDFYKHYGIAPLSILRALIANVSA
FT                   GRAVQGGSTLTQQLVKNLFLTNEKSLVRKAKEALMALIIDARYSKDEIIEAYLNEVFLG
FT                   QNGNTGVHGFGLASLFYFDRPIAELNVAEIATLVGIIKGPSYYNPRRHPERVIERRNLV
FT                   LRILFENNELQRNEYEYAINQPLNLATGASLTSGKHPAFMSMVRRELKTVLSDPNMRES
FT                   GLKVFTTLDSVAQRKAEQALKVGVKAQQKRMKLTALQAAMVVTDIKSGEVRSIVGDVNP
FT                   QFQGFNRALDAKRAIGSLIKPAIYLTALERAAQYNLATPLKDEPISLKSTYGKMWEPKN
FT                   ADKKFRGQVSLVEALTQSLNVPTVNLGMEVGLDDIAATVERLGVNEPMDIYPAMTLGAV
FT                   NLSPIQVNQMYQTIANNGRFIPLHAVTAVLSPKNKPLWRFSARGEQRADHKATYLLNYA
FT                   LHKVTREGTARQIKQTFGDINMAGKTGTTDDYRDSWFSGFDNNILVTSWMGKDNNEPIN
FT                   LSGASGAMQLFIGYQKLQQPKSFVRRYPKGLGIAHFEEQSGALSRPGCANTISVPAILD
FT                   ALPPVPKTCNGEVRGPLKKSLWERLFGN"
FT   sig_peptide     564933..565094
FT                   /locus_tag="Patl_0489"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.820 at
FT                   residue 54"
FT   gene            complement(567295..568161)
FT                   /locus_tag="Patl_0490"
FT   CDS_pept        complement(567295..568161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0490"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV4404 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39020"
FT                   /db_xref="GOA:Q15YL8"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YL8"
FT                   /protein_id="ABG39020.1"
FT                   /translation="MKADFSPSLPPRPKAKMGTLWIILVSLLLHIIIFALIARTPNEIP
FT                   NFETSQDSTPQIKPITARLIFPTISVPPEPAPEPAPVDKPALESETVPEPKAGAQLEEP
FT                   AVVEQAPPAVVTPEPTPTPLAEIAPKPTPEPEPTPEVAPPETKNEASFMQQDPMALPES
FT                   NKRPKLAEGQEQTVADKVKDQLHSSTQQSIADLAAEEAARYRREQTSPSLFDKPELSQL
FT                   TEDEKLEKENEVLADCSSYTNKGVAVLSGLMGGNIKCTTTNGAESFIQDRLNKTAHLPA
FT                   MKDKKNN"
FT   gene            568597..568935
FT                   /locus_tag="Patl_0491"
FT   CDS_pept        568597..568935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0491"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   vvy:VV2748 nitrogen regulatory protein PII"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39021"
FT                   /db_xref="GOA:Q15YL7"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YL7"
FT                   /protein_id="ABG39021.1"
FT                   /translation="MKLVTAIIKPFKLDDVREAISEIGIDGLTVTEVKGFGRQKGHTEL
FT                   YRGAEYQVDFLPKVKLEVAVQDDQVERLVEAIVGAAKTGKIGDGKVFVYDLEHAVRIRT
FT                   GETDGEAI"
FT   gene            568956..570224
FT                   /locus_tag="Patl_0492"
FT   CDS_pept        568956..570224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0492"
FT                   /product="ammonium transporter"
FT                   /note="PFAM: Rh-like protein/ammonium transporter; KEGG:
FT                   cps:CPS_0642 putative ammonium transporter; TC 1.A.11"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39022"
FT                   /db_xref="GOA:Q15YL6"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR019879"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YL6"
FT                   /protein_id="ABG39022.1"
FT                   /translation="MEQAFHLQYAMDTFYFLVCGALVMWMAAGFSMLEAGLVRSKNTTE
FT                   ILTKNIALFAISCLMYLVCGYAIMYGGDYFLTGIESVDVTETLGEFAGREDGFEGGSIY
FT                   SGASDFFFQVVFVATAMSIVSGAVAERMKLWAFLAFAVVMTAFIYPMEGGWTWGGNSVF
FT                   GLYSLGDDFGFSDFAGSGIVHMAGAAAALAGVLLLGARKGKYTADGKVNAIPGANLPMA
FT                   TLGTFILWMGWFGFNGGSVLKLGDIANANSVAMVFLNTNAAAAGGAVAALVLAKILFKK
FT                   ADLTMVLNGALAGLVAITAEPSTPSALGATIIGAIGGVIVVFSIISLDKLKIDDPVGAI
FT                   SVHGVVGFFGVMVVPATNDGATYLGQFVGAMTIFVWVFFASLIVWAILKAVMGIRVTEE
FT                   EEFEGVDISECGLEAYPDFTSGR"
FT   gene            570525..571445
FT                   /locus_tag="Patl_0493"
FT   CDS_pept        570525..571445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0493"
FT                   /product="Dyp-type peroxidase family"
FT                   /note="TIGRFAM: Dyp-type peroxidase family; PFAM: Dyp-type
FT                   peroxidase; KEGG: cps:CPS_4479 putative melanin
FT                   biosynthesis protein TyrA"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39023"
FT                   /db_xref="GOA:Q15YL5"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YL5"
FT                   /protein_id="ABG39023.1"
FT                   /translation="MPQPQKGICAEASLHALYLLLNVNDDDDSVMRIKIAQIVDLFAHY
FT                   DEEHYEAMVTGVVAIGSSYWHDVYPGLIPVELAPFPDMHCDDRSAPVAPCDLFIQIRAD
FT                   RADICHALAMEIMRLLGSHVDLIEDIRGFRYLDGRDLTGFIYADDNPKGMHKLDIALVG
FT                   ELDPDFAGGSYIHVQRYRHNIAKWEQLSAYHQEYIMGRKKSDNSPLSDAFKSPRSHYDC
FT                   TQITDNESRPMRILRQSMPYGDMHVQGLFFVSCARSPKPFEHMLRNMIMNDENGEYDRF
FT                   LDYTSAETGAAFFAPSLTFIKQRAN"
FT   gene            complement(571808..572902)
FT                   /locus_tag="Patl_0494"
FT   CDS_pept        complement(571808..572902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0494"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase
FT                   Tetratricopeptide TPR_2; KEGG: lic:LIC20094
FT                   adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39024"
FT                   /db_xref="GOA:Q15YL4"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YL4"
FT                   /protein_id="ABG39024.1"
FT                   /translation="MLEFISESLLVVLLAFCVVCLVVIAFLLKKLKALSHEKMSDVTPK
FT                   PRAVNQKSFEELPTERFEQRADEALRLRHTFQKFVPKQFVDHFAKHGSSVLELGHAVED
FT                   DVAILFCDIRGFTGLSENMSPQELMRFLNSYFLRMNDPIHLNGGFIDKFIGDAIMALFD
FT                   HPDGCDEDKARDALCAALDLRQALSIYNQHRQNSGYPSIEIGIGIHFGPVVLGTVGSDD
FT                   RMDTTVIGDSVNIAYRLEALAPIYHCDIVVSAQALQQAAQPERFNARLLDWVKVKGRSN
FT                   AIEIHEVIAHLPKELQQLKLSNMALIKQGLTYRFEQNWAQAINCFEQAATLSPDDYLPK
FT                   LHISQCQQLAEQKLLADWDGTVQL"
FT   sig_peptide     complement(572825..572902)
FT                   /locus_tag="Patl_0494"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.725) with cleavage site probability 0.706 at
FT                   residue 26"
FT   gene            complement(572947..574242)
FT                   /locus_tag="Patl_0495"
FT   CDS_pept        complement(572947..574242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0495"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase class-III; KEGG: cps:CPS_4629
FT                   glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39025"
FT                   /db_xref="GOA:Q15YL3"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YL3"
FT                   /protein_id="ABG39025.1"
FT                   /translation="MQKSEQLFARAQKHIPGGVNSPVRAFRAVGGTPPFIEKADGPYLY
FT                   DADGKQYIDYVQSWGPMVLGHNNPIIRQAVIDAAQNGLSFGAPTEAEVTIADLVSELVP
FT                   SMEMLRMVNSGTEATMSAIRLARGYTKRDKILKFEGCYHGHADALLVKAGSGALTFGVP
FT                   SSPGIPADFAKHTLTMEYNNIDSVVQAFEQYPDDIACIIVEPVAGNMNCIPPVHGFLQG
FT                   LRDVCDKYGAVLIFDEVMTGFRVALGGAQAKYNIVPDLTCLGKVIGGGMPVGAFGGKRD
FT                   IMQHIAPSGPVYQAGTLSGNPVAMAAGLAALNQVKRPGLYEELSEATKTLAEGIKAIAN
FT                   GLGIPMSVNYAGSMFGLFFTDVECVTNYQQAINCNTEQFNHFYHGMLENGVYLAPASYE
FT                   AGFVSAQHSPEIIQQTLQIAEKVLADVAKKFG"
FT   gene            complement(574297..575301)
FT                   /locus_tag="Patl_0496"
FT   CDS_pept        complement(574297..575301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0496"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="KEGG: ilo:IL2244 aspartate carbamoyltransferase,
FT                   catalytic chain; TIGRFAM: aspartate carbamoyltransferase;
FT                   PFAM: aspartate/ornithine carbamoyltransferase,
FT                   Asp/Orn-binding region aspartate/ornithine
FT                   carbamoyltransferase, carbamoyl-P binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39026"
FT                   /db_xref="GOA:Q15YL2"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YL2"
FT                   /protein_id="ABG39026.1"
FT                   /translation="MKFEGSHILSVNQFDRESIERVFDVANQMEPYAKRQKRTTVLDGA
FT                   ILGNLFFEPSTRTRVSFGTAFNLLGGEVRETTGMSNSALAKGESLYDTARVLSGYSDII
FT                   TMRHPDSGSVAEFAQGSRVPVINGGDGANEHPTQALLDLYTIQKELLYHGGNIDGLHIA
FT                   MIGDLKYGRTVHSLSKLLCLFKNIRFTLISPKELAMPDAILSAIENAGHSYTISETLEG
FT                   NFDADICYQTRVQEERFGSQEEANLYRGKFRLNQQIYTKHFQSKTVIMHPLPRDSRTEA
FT                   NELDNDLNMNPNLAIFRQTDNGVLVRMALFALTLGVENIVSKFDKEVHWYSGH"
FT   gene            575449..575961
FT                   /pseudo
FT                   /locus_tag="Patl_0497"
FT   gene            complement(576022..576738)
FT                   /locus_tag="Patl_0498"
FT   CDS_pept        complement(576022..576738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0498"
FT                   /product="lipolytic enzyme, G-D-S-L"
FT                   /note="PFAM: lipolytic enzyme, G-D-S-L; KEGG:
FT                   bur:Bcep18194_A3328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39027"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YL1"
FT                   /protein_id="ABG39027.1"
FT                   /translation="MLYHLASVFLALLFIVQGKYVRRVTPKLPEPEGCREGTFGSGPPL
FT                   SLLIIGDSAAAGVGVELQRYALAGNMLNTLGQHYQVAWKLMAKTGNTSAELLKKIQHIE
FT                   STQAYETVVISIGVNDVTGLTSSRKWLSNLAFISQALQDKFGAKRVLFSSLPPMHLFPA
FT                   LPQPLRWWLGVRAKHLNDLAEKFCQTNPQCHFVSAPFPIDQRFIADDGFHPGALAYQLW
FT                   GEYLARVLQEKLIRHA"
FT   gene            complement(576959..578020)
FT                   /locus_tag="Patl_0499"
FT   CDS_pept        complement(576959..578020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0499"
FT                   /product="peptidase M12A, astacin"
FT                   /note="PFAM: peptidase M12A, astacin peptidase M10A and
FT                   M12B, matrixin and adamalysin; SMART: Peptidase,
FT                   metallopeptidases; KEGG: sco:SCO6992 regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39028"
FT                   /db_xref="GOA:Q15YL0"
FT                   /db_xref="InterPro:IPR001506"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YL0"
FT                   /protein_id="ABG39028.1"
FT                   /translation="MKTCEHSAPSICNLPLVEPRKLDPNIDRNRESLVRYIEKKWVNHT
FT                   VLHYYFMQNQAQLAGQANQLQAVREAFDEWKNLGIGLDFIEVGDSAQAEFRIGFAPGSS
FT                   WSYVGRDCIDLVPNHEDQTMNFGWDLTTPYGRDTALHEIGHAMGFPHEHQNHKAGIVWD
FT                   ENAVYANFAGSPNYWDDATTYHNIIRKLSPQDATGSPWDRDSIMHYQFDAGLILSPAEY
FT                   QQQPLIPAPGLSEMDIQEALKFYPDNSVAQWPELAPFLSQKLDITPGQQLDFTIEPNIS
FT                   RTYNIQTFGTMDTVIVLFEDDDGEPIYLAGDDDSGTNYNSKITLRLINGRRYYLRLRLY
FT                   SAGASGEGGVMLW"
FT   gene            complement(578325..578777)
FT                   /locus_tag="Patl_0500"
FT   CDS_pept        complement(578325..578777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0500"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory proteins, AsnC/Lrp; KEGG:
FT                   sil:SPO3612 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39029"
FT                   /db_xref="GOA:Q15YK9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YK9"
FT                   /protein_id="ABG39029.1"
FT                   /translation="MNLKDKYNERILHELSQQGRIANTELADKIGLSASACLRRVQELE
FT                   NSGVIKGYRAILDSELLGNGFIAYVTVGLGKHTKGSQDAFEQAIASADEVKECHNVTGS
FT                   FEYILRVETTNLKTYKSFHTDILGTLPQVSTITTHVVMDSPKDQRT"
FT   gene            578895..579488
FT                   /locus_tag="Patl_0501"
FT   CDS_pept        578895..579488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0501"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   sil:SPO3613 transporter, LysE family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39030"
FT                   /db_xref="GOA:Q15YK8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YK8"
FT                   /protein_id="ABG39030.1"
FT                   /translation="MTFDILTALMLFALVSSITPGPNNLMLMASGANYGVKRSLPHMFG
FT                   VSLGFTLMVALVGLGIMQIFDMFPVTYQILKVLSVTYLLYLAYKIATASNAKQSNTTDA
FT                   KPMTFFQAVMFQWVNPKAWTMALTAISVYAPSKSVLAVVMVSGVFGAVNFPCISGWTIL
FT                   GQKIQVFLTDNKRLRAFNFTMAGLLVLSLYPVFL"
FT   sig_peptide     578895..578984
FT                   /locus_tag="Patl_0501"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.748) with cleavage site probability 0.483 at
FT                   residue 30"
FT   gene            complement(579605..580024)
FT                   /locus_tag="Patl_0502"
FT   CDS_pept        complement(579605..580024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0502"
FT                   /product="peptidylprolyl isomerase, FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase, FKBP-type; KEGG:
FT                   cvi:CV0705 probable FkbP-type peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39031"
FT                   /db_xref="GOA:Q15YK7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YK7"
FT                   /protein_id="ABG39031.1"
FT                   /translation="MTKLAIDYFTDAGLLKSHLFHIERVINVQQDVKIEDLVEGSGKAA
FT                   ERGALITAHYRGFLEDDTEFDSSHKNNAPFQVVLSNKRVIQGWVLGLKGMKEGGKRKLW
FT                   VPAALAYGERQIGNMIPPNSDLTFEIELLEVLTRD"
FT   gene            complement(580126..580581)
FT                   /locus_tag="Patl_0503"
FT   CDS_pept        complement(580126..580581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0503"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nar:Saro_0460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39032"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YK6"
FT                   /protein_id="ABG39032.1"
FT                   /translation="MNNIKMAVFTRMLISSMLAFGISTTAIAQESSYSYGTVWEAHGIR
FT                   ILPGQFENYMDHLAGSWKDVYEFAKKEGHVVDYHVLANNHAREGEPDLILVVEYKDYIK
FT                   TAEYEAFQKKVDEMMSTNERKADKEFGERETMRKTLSSSQYQELDLK"
FT   sig_peptide     complement(580495..580581)
FT                   /locus_tag="Patl_0503"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 29"
FT   gene            complement(580890..581420)
FT                   /locus_tag="Patl_0504"
FT   CDS_pept        complement(580890..581420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39033"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YK5"
FT                   /protein_id="ABG39033.1"
FT                   /translation="MRLLIKRLSVLGPIMLIGLTNLTACACFGSADTPESSQAGHAPSQ
FT                   VPPAANIEGKNASGVSTAQPQSPSSLSNAKMNVHPLSWVTDADPLNDAKQAIRNGDLRL
FT                   LAFAGRAISIPGVDLALHPLAQIQQHCGYRTLKGTGDTLRVGEQTSLRSKAHDYAVIYN
FT                   QKVIAACVLPQNT"
FT   sig_peptide     complement(581340..581420)
FT                   /locus_tag="Patl_0504"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.525 at
FT                   residue 27"
FT   gene            complement(581408..584083)
FT                   /locus_tag="Patl_0505"
FT   CDS_pept        complement(581408..584083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0505"
FT                   /product="PPE-repeat protein"
FT                   /note="KEGG: hch:HCH_04317 PPE-repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39034"
FT                   /db_xref="GOA:Q15YK4"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YK4"
FT                   /protein_id="ABG39034.1"
FT                   /translation="MQVVNKYNFSKFAQRMLLIAASGIGALSAGTASAESLWVASAQAK
FT                   FSAEDTAPKVAVVKGNYQSLASDSLQQRFSDKTAAITLALPLPDGSYADFTLTPSRVMS
FT                   DDLAARYPQFMSYDAVQVNAPQNVGRFSLTHKGLTGIFRQNGQWALLSPVYEKNDEQYV
FT                   SYYYLDSDGKSLLPQGMDDSIGTLSAQEETNTDLITAQKTTGDTLTTYRLALSATGEYT
FT                   QAVGGTKADAVAEMITLVNRVNQILLVDTAIQFELIDNEDIIYTDAATDPFTNSDANED
FT                   LDTNQQVIDDAVGSSNYDIGHLLATNPGGLAFVGVVCLSTHKARGYTGNTSPQGERFYI
FT                   DLVIHELGHQLDAEHSFNAQDFDSCDEEQRSSSSAFEPGSGSTIMSYAGICGTQNLQNT
FT                   SSPYFHAGSVEQIRDYVETGRGRLCGTTSSLNNAAPQVSLTSTNYTIPANTPFLLDAQA
FT                   TDDETLTYTWEQIDAGGDTGGTTTASDMRSDNGANPLFRSYSAVSESYRYFPALEDVLE
FT                   NTVSFGEAYPTTDRELNFRVTVKDNRGGVDTADIMLSVTNTGTAFAVTQPTATSVWQGN
FT                   AAQTIAWNTASTQNAPISCPSVDITADLDGDNTFDSILISDTPNDGEQVVFSPNTNTTN
FT                   ARIKVSCADNVFYAVNPANFAITQGASNVAPVIDGQSVLSLNEDDTLTLTLTDLQVTDP
FT                   DSSYPDNFTLALQAGSNYSIEDGVTLVPDANFSGELSVSITVNDGIEDSSAFPLVVNVA
FT                   PVNDAPQASDDSQTVEQDSAAALISVLNNDTDIDGDNLSISDINYTGSGTVSISGNQVR
FT                   YQPASGFSGNESLTYIVSDGIATDSATLTITVTATPTTTAPTTGSSSGGGGSFSYLWLG
FT                   LVSVMMFIGRRSRKSAKCAC"
FT   sig_peptide     complement(583979..584083)
FT                   /locus_tag="Patl_0505"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 35"
FT   gene            584541..585221
FT                   /locus_tag="Patl_0506"
FT   CDS_pept        584541..585221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0506"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO1658 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39035"
FT                   /db_xref="GOA:Q15YK3"
FT                   /db_xref="InterPro:IPR021367"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YK3"
FT                   /protein_id="ABG39035.1"
FT                   /translation="MQDVIQIRASAKRNVLTTSLFGVTGIFVAAGIFAWLPEAFFLAGV
FT                   FVTSASIVALLIAWFKFREPIFSLELSHDSICYQHRKGQWHVSWHNIQRIDVPRAHRDL
FT                   ALEDLSLVGIKLKDYRPFLTTTPIKLMIHLLMEQRSLLLLGDKADSASGLSFSANLVED
FT                   DKHKLPDGTVLTGTQAMLANRMTKLRERLGYDLYINVSELDRSEQEFVTLLRECQEFVQ
FT                   NQQK"
FT   gene            complement(585269..588406)
FT                   /locus_tag="Patl_0507"
FT   CDS_pept        complement(585269..588406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0507"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver ATP-binding
FT                   region, ATPase-like histidine kinase A-like Hpt Diverse 7TM
FT                   receptor, transmembrane region; KEGG: son:SO3457 sensor
FT                   histidine kinase/response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39036"
FT                   /db_xref="GOA:Q15YK2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YK2"
FT                   /protein_id="ABG39036.1"
FT                   /translation="MQLWLALLVCLMALGGVSTGNAQQVESLVQLISKDQEVSLSSSIS
FT                   VMQEDGIELSVTQARDMLSQFVWHSGGNPNYGFSEHGVWLYTTLSNVTTTDKWVVSVAF
FT                   SQLDNVDMYLMQDGQILASSFQGKLGMKTHYRLPMMKVELPYAQTVELFVRLQSQHSSL
FT                   VAPISIQSSTSHEMQSFYDSLLWGLFYGGLIILAIYNLVVYFALRESSLLAYVGYICTV
FT                   IVWQFVWGGHANMMLPQALSHWFDTHTDIIFVLIGIGSGLFTIVFLEAKVTAPKTLPFI
FT                   KVSIGLLALMGLCSMVNLFPPVWQNAAVYVVSMLAISCYTYAGFESYSNQFYAARYFIF
FT                   AWSILATCALIGMFSLVDMLPSNFFTTYCFQFGVFFESALFSLALMDKSRHQLEIEVQQ
FT                   ATNDLRNNIELVEEQNVRLDIARKEAVAASNVKSQFLANMSHEIRTPLNAILGFSKELQ
FT                   QGDFSADKRDQINIINAAADNLMTIVNDVLDVSKIEAGKLQINSHPFSINELLEEMIGV
FT                   MAKSAHLKGLEFVYDIEPLPLKLIGDSYRIRQILNNLLGNALKFTDTGHIGLAASGKVL
FT                   EHGIFELNIKIEDTGIGISREDKRKLFTAFSQVDDALNRSYQGTGLGLVICKELVKLMH
FT                   GQLSLQSSPGQGSTFNVTVRMNILNTKPSISPKSDWQDQTVLLYEPYPNARFTASKLLK
FT                   SLGAIVTSVDSIAFLQTCTKAFDCMIFCIHPHNQAANEQAFSSASNIVVKHKVLLCSGE
FT                   DSCCRFSQFTGQFTPQLRLPLTPGKLKEIMHKPTHAPVNELQKRLQDLPAVTVLAVDDM
FT                   EMNLRLLSTWLKPSRLELKLAFSGQDAVNLCKESEFDLILMDVQMPNMDGLQATKLIRE
FT                   TKLNFGTPIIAVTAHAFKEEQQRLLNSGMDDYLPKPLDLSDLVDLINRWCHQGVEDDEH
FT                   IEVFNWPLALKRANQNVDAARDLFNQFIKQLPSFESKFERLQAHPEHNELQQVVHALHG
FT                   VCCYTGAVALHSSCSELESQLKREQFDKVPSTLARLINDVKALLRQEKDIKHNIRD"
FT   sig_peptide     complement(588338..588406)
FT                   /locus_tag="Patl_0507"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.776 at
FT                   residue 23"
FT   gene            588566..589681
FT                   /locus_tag="Patl_0508"
FT   CDS_pept        588566..589681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0508"
FT                   /product="L-sorbosone dehydrogenase (SNDH)"
FT                   /note="KEGG: pha:PSHAa2586 L-sorbosone dehydrogenase
FT                   (SNDH)"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39037"
FT                   /db_xref="GOA:Q15YK1"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YK1"
FT                   /protein_id="ABG39037.1"
FT                   /translation="MILRRLILLSFVSFAGIAKSLPLEKLSLPTGYSIEVYASDVKNAR
FT                   QMALSDNGILFVGSRDSGLLTAVVDKDQDGNVDEVLQIAKDLTMPSGLTIKDGDLYVAE
FT                   VSRILKYANIEQNFRELPEPEVVIDGLPDKKHHGWKNIDFGPDDWLYVPVGAPCNICET
FT                   NGGEKFDNPEFASILKYNLKTKERVWVAKGVRNSVGFDWHPQTNQMWFSDNGRDMMGDD
FT                   IPPCEINRVDEIGAHYGYPYYHGGTIADPEFGTDKNAADYVAPALNLGAHVAPLGIHFY
FT                   HGDMFPADAQNNLFVAEHGSWNRSKKSGYKVMRAILKDNEIVEYQPFIEGWLQADETSW
FT                   GRPVAMLTMPDGSLLVSDDFANVIYRVTYQK"
FT   sig_peptide     588566..588628
FT                   /locus_tag="Patl_0508"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.502 at
FT                   residue 21"
FT   gene            589764..592076
FT                   /locus_tag="Patl_0509"
FT   CDS_pept        589764..592076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0509"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA topoisomerase IV, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A DNA gyrase C-terminal
FT                   repeat, beta-propeller; KEGG: pha:PSHAa2585 DNA
FT                   topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39038"
FT                   /db_xref="GOA:Q15YK0"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YK0"
FT                   /protein_id="ABG39038.1"
FT                   /translation="MSQEIIINKDGIEQLPMRQFTEESYLNYSMYVIMDRALPHIGDGL
FT                   KPVQRRIVYAMSELGLSNNAKYKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRY
FT                   PLVDGQGNWGAPDDPKSFAAMRYTESRLSKFSEVLLTELGQGTVDWQPNFDGTLDEPKI
FT                   LPARLPHILLNGITGIAVGMATDIPPHNVREVANACAHLLDNSKAELHELLEFVQGPDY
FT                   PTDAEIITPQSDIRKMYETGRGSIKMRAVYYEEAGDIIITALPHQASGGKVLEQIAAQM
FT                   QAKKLPMVSDLRDESDHENPTRLLITPRSNRVDVEQLMQHLFATTDLEKNYRVNINMIG
FT                   LDGRPQVKDLRMILSEWLIFRKDTVVRRLQYRLDKVLARLHILEGLMIAFLNIDEVIRI
FT                   IRYEDKPKLVLMDTFSLSDIQAEAILELKLRHLAKLEEMKIKGEQDELAKERDELQLIL
FT                   GSDRRLKTLIKKEILAAAEMYGDDRRSPIIERSESKALSEKELIPSEAVTVVLSEKGWA
FT                   RCAKGHDVDVVGLSYKAGDKYLASSKGRSNQQAVFMDTSGRAFSCDAHLLPSARSQGEP
FT                   ITGRFSIVSGESVEHVVMGQDEQQYLIASDAGYGFVGKFADMISKNRAGKAYISLPKAA
FT                   KIIAPQAVHDLSSDWCLAISNEGRMLMFPLRDLPSLGKGKGNKIISIPSAKSQAREEFV
FT                   KVLAVVPQGANIKVLAGKRGMTLTADDLTHYQGERGRRGNKLPRGLQRVDGIEVEAGTG
FT                   VSDQADDAGELPNEPSL"
FT   gene            592139..593803
FT                   /locus_tag="Patl_0510"
FT   CDS_pept        592139..593803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0510"
FT                   /product="Carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /note="PFAM: Carboxylesterase, type B; KEGG: sma:SAV433
FT                   putative carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39039"
FT                   /db_xref="GOA:Q15YJ9"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YJ9"
FT                   /protein_id="ABG39039.1"
FT                   /translation="MQFALVAFALFISSFAAIAEQITTQYGLLSGQKNNKSQIFSFKGI
FT                   PFAAPPVGELRWQPPQPVSAWQGVRDATKFAPRPMQNPIYSDMQFRSQEVSEDSLYLNV
FT                   WTPNTSDSAKLPVLLYFHGGGFIAGSGDEKRYDGASMAQKGIVVVTANYRLGVFGFFAH
FT                   EGLSKQTDYHGSGNYGLMDQQAALKWVAENIQQFGGDPKRITIAGESAGSISVSALMVA
FT                   PSAKPYIAGAIGESGSIVGPPLDPLALKDAEQYGQKVATTALKDTPEQNVGLAEARIAA
FT                   LRKIPAQTLLDKVTKGGFIYFKPNIDGAFFPESPDALFAKGTQAKVPLLLGDNSQEGGY
FT                   QQIMVDGSPTVEHYVDKIKRLYPDDFKEVLSLYPGENSAQVIASAQALASDRFMGIATF
FT                   NWAYQNVKTNTAPSFYYFYDHIRPAMIGAKNVLPVNKPRGAVHSAEIEYALGNLDANPL
FT                   YEWQDADYQVSEIMQQYFAHFIKTGVPNGTDDANHALPHWPQFSQHKRMVLKAQPKVED
FT                   IRYLQERHAFHRRYFFEKAQLEKDSLKGIIEKSSTPQ"
FT   sig_peptide     592139..592198
FT                   /locus_tag="Patl_0510"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 20"
FT   gene            593812..594930
FT                   /locus_tag="Patl_0511"
FT   CDS_pept        593812..594930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0511"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: pha:PSHAa0177
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39040"
FT                   /db_xref="GOA:Q15YJ8"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YJ8"
FT                   /protein_id="ABG39040.1"
FT                   /translation="MSNQFKKEYIVVAQNASGRNMNVPLYRFIGQKPGPKVYIQSSIHG
FT                   AEVQGNVVIYHLIQLLKKMPICGEVILVPNCNPVGTNIKAGEYTLGRFDPVNGTNWNRG
FT                   YFYDASLIEDFAQTVQNDESISQIKQRFRQQIKHILASKLEEPWGIGLAQRLNLKLQQL
FT                   AFDADFVLDLHNGPVSTRHIYVPEYAQKSASLFNIPHVILIPNKFAGALDEATFCPWWT
FT                   LQDLVSHKRQQDVDFGVEAFTLEMGSQEVINFSEGEYDANSILSYLNGKGCLLQSDIHP
FT                   EAMRRVATYLKNYKVLYTQQGGMVEYLAKPGDVVKKGQPLAKLLNVDELDTENATELVV
FT                   AQCDLIPILHFPSASILSGTQLYKCFTHYFEL"
FT   gene            complement(594948..595445)
FT                   /locus_tag="Patl_0512"
FT   CDS_pept        complement(594948..595445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0512"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory proteins, AsnC/Lrp; KEGG:
FT                   cps:CPS_3819 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39041"
FT                   /db_xref="GOA:Q15YJ7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YJ7"
FT                   /protein_id="ABG39041.1"
FT                   /translation="MMPKKNSRPLDSIDLDILASLYEDARTTNKEIAKRVGLAPSSCLE
FT                   RIKRLQADEIIQGASLQIDLNALGGHIQAMISIRLSDHNRLAVDDFVTDLLPQPEVLSV
FT                   FHMGGNIDFLLHVTVTDSSHLRDFIFNQLTARPEVNHVESALVYEHRCSQQLPTFYPQS
FT                   TT"
FT   gene            complement(595672..596991)
FT                   /locus_tag="Patl_0513"
FT   CDS_pept        complement(595672..596991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0513"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B Opacity-associated protein A
FT                   Opacity-associated protein A-like; KEGG: ilo:IL2237
FT                   peptidase, M23/M37 family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39042"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013731"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YJ6"
FT                   /protein_id="ABG39042.1"
FT                   /translation="MYELNFPVVKKAFSQLPKAHKWAVASLASIVLILALFPSDRASAS
FT                   RNTEAALLEIGKRYELPISTDHLSVSSEEHVSDDVEWNTYQVKRGDTLAKIFKRAGLSA
FT                   RDTYNVSSAGELAKMLLKIRPGQLVSLQVDENGSFAGLSYAFSNTETLLIHPDEKNQLT
FT                   ARVDKKKVDTRLNYAQGEINSSFWNAGVKAHLSESQIMSLAAIFGWDIDFALEIRQGDN
FT                   FNVVFEEKYIDGEFVEYGDIVSAEFTNGGNTFTAIRYSDGNYYTPEGRSMRKSFLRAPV
FT                   SFKYISSSFTKRRFHPVQKRWKAHRGVDYAANRGTPVMAAGDGKVIRSSYDKYNGNHVF
FT                   IQHGEKYVTKYLHFTKRKVKVGQTVKQGDVIGTVGSTGLASGPHLHYEFLVDGVHRNPR
FT                   TVSLPKALPIAKKERSAFELVAKEQLELLTNSKRIMLAMN"
FT   gene            597181..598380
FT                   /locus_tag="Patl_0514"
FT   CDS_pept        597181..598380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0514"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="TIGRFAM: tyrosyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase, class Ib; KEGG: cps:CPS_4727
FT                   tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39043"
FT                   /db_xref="GOA:Q15YJ5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YJ5"
FT                   /protein_id="ABG39043.1"
FT                   /translation="MADWQSAFAELQRGAEEILLEEELIAKLKEGKPLKIKAGFDPTAP
FT                   DLHLGHTVLINKLRSFQQLGHEVIFLIGDFTGMIGDPTGKNVTRKPLTREDVLANAETY
FT                   KEQVFKILDPAKTTIRFNSEWMEGLGASGMIKLASSQTVARMLERDDFKKRYANGQPIA
FT                   IHEFLYPLVQGWDSVALESDVELGGTDQRFNLLMGRELQKGQGQRPQTVLMMPLLEGLD
FT                   GVQKMSKSLGNYIGITDSPSDMFGKIMSISDDLMWRYYDLLSFKAIEEIALYKEQVAGG
FT                   TNPRDIKIALAKEIIARFHDDAAAEAAHHEFIQRFQKNAIPDEMPEFTFEAGAEGMAVA
FT                   NLLKEAALVASTSEAMRMIKQGAVKMDGEKVADQKAIFTSLQEAVFQVGKRKFARVTLS
FT                   "
FT   gene            complement(598424..598840)
FT                   /locus_tag="Patl_0515"
FT   CDS_pept        complement(598424..598840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO1320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39044"
FT                   /db_xref="GOA:Q15YJ4"
FT                   /db_xref="InterPro:IPR021279"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YJ4"
FT                   /protein_id="ABG39044.1"
FT                   /translation="MTITLTTPAMLFPAISLLLLAYTNRFLTLASTIRNLDPTQDQENT
FT                   HAQINNLRTRIQLIKRMQEFGAFSFFLCVLSMLAIYAEYQTIGSTIFAGSLVLLLYSLG
FT                   LSVREINISVEALDLHLSHFNLDRKKRKPSREKP"
FT   sig_peptide     complement(598775..598840)
FT                   /locus_tag="Patl_0515"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.883 at
FT                   residue 22"
FT   gene            complement(598922..599371)
FT                   /locus_tag="Patl_0516"
FT   CDS_pept        complement(598922..599371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39045"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YJ3"
FT                   /protein_id="ABG39045.1"
FT                   /translation="MYMTPKFSYSTASGSYSFEVSSNVVMCTFNGACCDQIAQRYLATL
FT                   CKIVSDFNGEPWAYLGNAQLHLAATPQAEQYLLECFVMSVKNNCIGDAYCLTSAVGISQ
FT                   LKSIRQKAGLTATLEERMFGSQQSAFSQLTKELKQYSAVENSQEK"
FT   gene            complement(599546..600442)
FT                   /locus_tag="Patl_0517"
FT   CDS_pept        complement(599546..600442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0517"
FT                   /product="adenosylcobinamide-phosphate synthase"
FT                   /EC_number="6.3.1.10"
FT                   /note="PFAM: cobalamin biosynthesis protein CbiB; KEGG:
FT                   cps:CPS_4742 CobD/CbiB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39046"
FT                   /db_xref="GOA:Q15YJ2"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YJ2"
FT                   /protein_id="ABG39046.1"
FT                   /translation="MLVEMLLHWPERYHPLFFAKLVATRMADKVNPCADRAPLQLRISG
FT                   TLAPLVLISPVAVILAIFINMAEFPLFFDAMLLLVALQYQHVMTRGKKVYSALLSGKKT
FT                   LARQTLKPMVLRETELLSQVGLVKATIESMTLRFHQQYLCTAMLFLLFGPVTALCYRLV
FT                   YEFSHCWNTKLTQFTYFGQPSAKTLLVVQWVPLRLTSFLFTLMGSVTSAISAWRALPRS
FT                   SSAHQVLLALHGGALGIELSGPAIYENTKKRSIKCGGKRQANTIDIKRLSNHIVLCKFA
FT                   FWVLCLCIAVGLYRLHL"
FT   gene            complement(600524..601231)
FT                   /locus_tag="Patl_0518"
FT   CDS_pept        complement(600524..601231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0518"
FT                   /product="methylthioadenosine nucleosidase"
FT                   /EC_number="3.2.2.16"
FT                   /note="PFAM: purine and other phosphorylases, family 1;
FT                   KEGG: vpa:VP0479 MTA/SAH nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39047"
FT                   /db_xref="GOA:Q15YJ1"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YJ1"
FT                   /protein_id="ABG39047.1"
FT                   /translation="MKIAILGAMDEEITLLKESISGLVEHQHAHLTLYTGQLQGADVVL
FT                   VKCGIGKVAAAVATTIVVDKFAPDFVVNTGSAGGFDQALSIGDIVIANEVVHHDADLTH
FT                   FGYALGQCAGMPETYLCDTALIEAAEKAAITLGEAKTKRGLICTGDAFIGSDEAAAKLR
FT                   TDFPAIAAAEMEGVAIGQTCHLLNVPFLVIRSLSDIAGKASTVSFQTYLEQAAKHSAML
FT                   VMEMLTVLQNQTK"
FT   gene            complement(601477..602643)
FT                   /locus_tag="Patl_0519"
FT   CDS_pept        complement(601477..602643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pha:PSHAa0696 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39048"
FT                   /db_xref="GOA:Q15YJ0"
FT                   /db_xref="InterPro:IPR003684"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YJ0"
FT                   /protein_id="ABG39048.1"
FT                   /translation="MNIKRISLTSLALACSTVSFTSLANPLDKTTFGFSGYVKADAMVS
FT                   QYSDGTLPSGTIGRDFYIPSLTPTGGEKESAQFDAHIKQSRFRFTTNTLLSNNEKITGV
FT                   LEFDFHTTPDGNERISNSYEPRIRHAFIKYNNWLIGQTWSTFQDVKTLPESLDFIGVTD
FT                   GTIFARQTMVRYTSGAFEVALENPETTVTPFGGSGRIVADDNSVPDLAARYTLNQSWGH
FT                   VSFAGLVRQLSYVEKQNGSDIDTDDVGYGLSITSKINFGQDDVRVMANIGSGLGRYIAL
FT                   NAVNSAVLDANNELDTIDVRGFTVAYRHFWDPQWRSTFSYAMFSADNDTDLTGLGVIKE
FT                   TYSARANILYSPSPELTFGAEYAYAKKTLESDADGDMSRLQFSAKYAF"
FT   sig_peptide     complement(602569..602643)
FT                   /locus_tag="Patl_0519"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            complement(602825..604510)
FT                   /locus_tag="Patl_0520"
FT   CDS_pept        complement(602825..604510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0520"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region chemotaxis
FT                   sensory transducer Cache, type 2; KEGG: vpa:VPA0024
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39049"
FT                   /db_xref="GOA:Q15YI9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YI9"
FT                   /protein_id="ABG39049.1"
FT                   /translation="MFSYISIKNRLLIISIVPLVSLVSILLLIIISQVTALTGTVEKSA
FT                   QTLLIESKKGELKNTVELAYSAVKPMYQEGGDKREAIEILKRLTFGKDGYIFGYDDKAV
FT                   RLFNGENEAGIGQNYYDFKDVNGIYLIRDLIAAGRNNKFAQGNEFVTYHFPRLGENTPA
FT                   AKLSYAIYLPEWKMMLGTGLYIDSIDDQVSVFSQHIDESRATLITSVTLVSGILLLLLL
FT                   MLGLLLVRSILSPLNTVTQSIKELSSAEGDLTRRLNLNDNHELGELASHLNTLLSKLQT
FT                   IIGNVRDISLRVKQNSDELGTQTLSIKDLSIKQHNEIDQVASATSQMSETAHQVSVNAD
FT                   AAASAALEADNNGHQAMRSVEQSCHEMSLLLNELSATEEVVTQVGDDVENIGAVLLVIE
FT                   SIAGQTNLLALNAAIEAARAGEQGRGFAVVADEVRNLASKTQGSTEEIQNMIAKLQSGS
FT                   RAAVVVMSDSKQRSNETEKSISATAVSLGEISKSVATMNNLNVQIATAAREQSIVGKEI
FT                   SQRIIDISNQTTELSGIAVKNGKTAESLRQKTAELEGLVGQFKV"
FT   sig_peptide     complement(604400..604510)
FT                   /locus_tag="Patl_0520"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.971 at
FT                   residue 37"
FT   gene            604827..606767
FT                   /locus_tag="Patl_0521"
FT   CDS_pept        604827..606767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0521"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /note="TIGRFAM: acetate--CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: pha:PSHAa0698 acetyl-coenzyme
FT                   A synthetase (acetate--CoA ligase) (acyl-activating
FT                   enzyme)"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39050"
FT                   /db_xref="GOA:Q15YI8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YI8"
FT                   /protein_id="ABG39050.1"
FT                   /translation="MSQQIYPVPAHAKEHSHLTPADYARMYAESVEQPEVFWAEQAKSL
FT                   DWVKTPTKIKNTSFDAHHVSIKWFEDGELNVAYNCIDRHLAKRGHVTAFIWEGDDPHSH
FT                   DIITYHRLHDEVAKIANGLRKLGVGKGDRVAIYMPMIPQAVYAMLACARIGAVHTVIFG
FT                   GFSPNAIADRVNNCQAKVLITADEGLRAGKHIPLKDNVDTALAEHDCPSMEQVIVFKHT
FT                   GSHVSWGKDDVWWHDLTDGCSTDCPPEVMNAEDPLFILYTSGSTGQPKGVVHTTGGYLL
FT                   WASITHKYVFDYKPGDIYWCAADVGWVTGHSYIVYGPLANGATSVMFEGVPTYPDVRRI
FT                   GQIVDKHKVNILYTAPTAIRALMAHGDFPTEGISGESLRLLGSVGEPINPEAWHWYYTT
FT                   VGQSRCPIVDTWWQTETGAAMLTPLPSVTAMKPGAASHPFFGVQPALVDGQGNELSGAT
FT                   EGNLIITDSWPGQARTVYGDHERFVQTYFTTYPGTYCTGDGARRDEDDYFWITGRVDDV
FT                   LNVSGHRLGTAEIESALVSHNAVAEAAVVGYPHDLKGQGIYVYLMPNEGVEITDELTKE
FT                   VSNWVRKELSPIATPDLIQWSSGLPKTRSGKIMRRILRKIAANEYEQLGDTSTLADPSV
FT                   VDTLIEQRLNR"
FT   gene            606787..607446
FT                   /locus_tag="Patl_0522"
FT   CDS_pept        606787..607446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0522"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR response regulator
FT                   receiver; KEGG: pha:PSHAa0699 regulator in two-component
FT                   regulatory system ; LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39051"
FT                   /db_xref="GOA:Q15YI7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YI7"
FT                   /protein_id="ABG39051.1"
FT                   /translation="MITLLVADDHPLYRDALRGALTLSFSDLTLLEAADLMQTVALLEE
FT                   HKDIDLLLLDLHMPGSGDLFGLIHIRKLFPELPVAVVSGLEDPMIITKVINLGALGFVP
FT                   KTTGAAQIADAVTSMLEGDIWLPESYASDEVELDNEFAELADNVASLTPAQYKVLCYMR
FT                   DGLLNKQIAYNLDIATATVKAHVTAIFKKLHINNRTQAVLIASQLQLEPPAAAPST"
FT   gene            complement(607394..610831)
FT                   /locus_tag="Patl_0523"
FT   CDS_pept        complement(607394..610831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0523"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: Na+/solute
FT                   symporter response regulator receiver ATP-binding region,
FT                   ATPase-like histidine kinase A-like; KEGG: pha:PSHAa0585
FT                   sensory box histidine kinase/response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39052"
FT                   /db_xref="GOA:Q15YI6"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YI6"
FT                   /protein_id="ABG39052.1"
FT                   /translation="MALGWMVLAIVYLMGLFWVAKWGDGKSPLAKRISSHPAIYSLALA
FT                   IYCTAWTFFGSVGEASRDTWDYLPIFLGPMLLYLFGYRFLRKLIAVSKRQHITTIADFI
FT                   SSRYGKRQTIALLVTLIALLAIIPYIALQLKAVGSAFLMVSGQTHAELVVLGATTFIAL
FT                   FSIYFGTQHTDVTEYRRGLMVAISFESVIKLCALIAVASFGYLTYSQHSDTPLLQEFTT
FT                   LNALGNIWSFSFFAQTLMAAGAVVCLPRQFHVAIVDNLKLSHLKTARWLFPLYLLCIAI
FT                   LIPIISAAGDDMFRLTSQEPDTYVLGMAMNSGNMLLQVLVFVGGLSAATAMIIVATLTL
FT                   STMLTNDVILPNLLAEHRGAGVPPNFTKRILLIRRLVIAAILSLAYLYYQQMTDSRTLA
FT                   SIGLIAFSLVIQLLPAIVGGLYWKRGHAQGVYAGLMAGIGSWILWLMLPLLNDAGQNLI
FT                   LNDTINAVAIYSLLANTFAYVLFSYVADVRLIDRIQAEAFVTTTDDKSKHHNAPRTHTT
FT                   VEDLHTLLSTFLGEKRCKQLLSDYQQRNGHILNPAESATEEFVLFSERALGGVIGASSA
FT                   KALVDSAISGKKLNFEEVVNFFDDTTQAIQFNMSALVASLESLEQGISVIDRDLNLVAW
FT                   NKSYLALFSYPANMIRVGRPVEDLVRYNAQRGECGAGEVEILVQKRLEHMRKGTSHRFL
FT                   RQRSDGRTLEMIGTPLPGGGFVTSFNDVTEHIETQHALKEANIDLENRIQKRSQEVQTI
FT                   NAELRLEIQRRADAETQLVSARKVAEQANASKTRFLALASHDILQPLNAAKLYLGALEE
FT                   AKLNDDARQTVGKLSNSIQASEALIATLLDIARIDQGELKPEYKAINVRDVLQPLIAEF
FT                   ELIAEHKGLQLRSRVADVWVKTDRTYLYRIMQNFVSNALKYTQTGGVLVSVRTKGENVA
FT                   FDVFDTGSGIAPDQLDKIFGDFYRISGHQQQGVGLGLGVVQRLASILDANLTVASRINH
FT                   GSRFSIQLPSSRPIETNSPVQINKVGFHDLKVLCVDDQSQNLDALQSLLAKWKVVSHSE
FT                   QTPSAALASLGHFVPDVILMDFQLSSDIDGLQLIEQLRERICDIHANNVPAILITANIE
FT                   LELVQRCKEQGCGYLSKPVKPAKLRALLQAAQAEVVRQ"
FT   gene            611001..611279
FT                   /locus_tag="Patl_0524"
FT   CDS_pept        611001..611279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0524"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pha:PSHAa0586 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39053"
FT                   /db_xref="GOA:Q15YI5"
FT                   /db_xref="InterPro:IPR019886"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YI5"
FT                   /protein_id="ABG39053.1"
FT                   /translation="MKNKMAFKNEEDKKAYWRENLALMTKLLVVWFVVSFGFGILLVDL
FT                   LDQIQVFGFKLGFWFAQQGAIYVFVALIFIYMYKMNQLDKRYGVDEE"
FT   gene            611290..613011
FT                   /locus_tag="Patl_0525"
FT   CDS_pept        611290..613011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0525"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: ilo:IL1178
FT                   Na+/solute symporter, Ssf family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39054"
FT                   /db_xref="GOA:Q15YI4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR019899"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YI4"
FT                   /protein_id="ABG39054.1"
FT                   /translation="MDVQVLTFLIVGASFALYIAIAIWARAGSTQEFYVAGGGVHPIAN
FT                   GMATAADWMSAASFISMAGLISFMGYDGAVYLLGWTGGYVLLALCLAPYLRKFGKFTVP
FT                   DFIGDRYYSQTARTVAVVCAIFVCFTYVAGQMRGVGVVFSRFLEVDIVTGVVIGMAIVF
FT                   FYTVLGGMKGITYTQVAQYCVLIFAYLVPAVFISIMVTGHVLPQTGFGASLADGSGVYL
FT                   LEKLDGLSTQLGFNEYTSGTKGTFDVFCITAALMVGTAGLPHVIVRFFTVPKVRDARKS
FT                   AGWALLFIAILYTTAPSIAAFARVNMIETINGPTVSEQAPTGTPYSEAPSWITNWEKTG
FT                   LISWDDKNQDGKMFYSGDERNEMQVDRDIMVMANPEIANLPAWVIALVAAGGIAAALST
FT                   SAGLLLVISTSVSHDLLKRNLMPNITDKKELFYARLAAGVAIVIAGYFGVNPPGFVAQV
FT                   VAFAFGLAASSFFPAIIMGIFMKRMNDKGAISGMLAGIGFTAAYIIYFKFVNPAANVSE
FT                   NWWFGVSPEGIGAIGMLVNFAVALLVFKMTEEAPQEIQQLVEDIRYPKGAGDATAH"
FT   gene            613208..614350
FT                   /locus_tag="Patl_0526"
FT   CDS_pept        613208..614350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0526"
FT                   /product="Domain of unknown function DUF1745"
FT                   /note="PFAM: Domain of unknown function DUF1745; KEGG:
FT                   cps:CPS_0128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39055"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YI3"
FT                   /protein_id="ABG39055.1"
FT                   /translation="MAVFSDVQFTSNVTVKALADSVAELMLSKPKGIMILCSEEAASWG
FT                   DDFKQYVGTLDVPIFGGIFPGLILDSRFEPRGILVVGLRNNIRVCVIESVSTCAPVSSN
FT                   MAYMSQSVNSVMILTDALSRQIDGYLQHVLAFLPEDCSVFGGGAGTLEFKAQPCLFSAA
FT                   GMHQDAMILVEMSTHWDLSVGHGWEILAGPFLANSTDDNCVLELNFEPAAQLYERVVQE
FT                   HSKLSFDKHEFFDIAKTFPFGLARLDDEVLIRDPLKLEGSGLVCAGDIPENTMLYIMCG
FT                   DAEKLIAAASGAVNQALSTLNDTHEVTDCFLFDCVSRQLFLQDKFATELDLIHREIAPP
FT                   YRTVGALVLGEIELGAGGILSLHNKTAVAALARASKQDVV"
FT   gene            614383..616209
FT                   /locus_tag="Patl_0527"
FT   CDS_pept        614383..616209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0527"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: conserved
FT                   hypothetical protein EAL; KEGG: tbd:Tbd_1042 putative
FT                   diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains)
FT                   with PAS/PAC and GAF sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39056"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YI2"
FT                   /protein_id="ABG39056.1"
FT                   /translation="MSEMSRTLQIISIQHELAMSIGLDLNLDKMLQLFLDRAKKRLSLR
FT                   SAVVFKEAPRSRNDSDILCYPYNHRPDDTNDWLTEQVYEFSQLNVQSVCRQRGDTYYYL
FT                   FKIPKFGAISFERKRTPIDDIVLNALMPLFGRLAVSCQACLEHQNLVDEISNRKAVEEQ
FT                   LRLQTYQDVLTGLPNRKMLNINLQSLLTNAQQHGQYGAVFFIDLDRFKLINDTLGHSVG
FT                   DELLINITSKLKACIRRDDTLARVGGDEFILLLGDIGPTEQSAVGKATKVADKMLSLTR
FT                   DSIELSRCAVFTSFSIGIALFPSPELNANKSIAEQAKQLIKHADIAMYKIKHTSRNDYL
FT                   FYRHELQIMATFRSEVEQRLHVALREEAFELYFQPMVNVAGEIVAAEGLLRWHDEKLGW
FT                   VGPQEFIPVAEECGLIVEIGQWVLRQTCVLISQHLDWFSEGNLRYISINISPRQFSQPH
FT                   FVAQVLEIIEEFTFPHSYLRLEITEGVAMENITSAIYIMNALIVHELFFMLDDFGSGYS
FT                   SLSYLHQLPLKSVKIDRSFVSKIDQNTDNQVIVEAIIYISQHFSLECVVEGLETSQEHA
FT                   YFHEKDVAAIQGFHFYKPLPREAFVNLLESTN"
FT   gene            616438..618273
FT                   /locus_tag="Patl_0528"
FT   CDS_pept        616438..618273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0528"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein protein of
FT                   unknown function DUF294, nucleotidyltransferase putative;
FT                   KEGG: pha:PSHAa0588 inosine-5'-monophosphate dehydrogenase
FT                   (IMP dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39057"
FT                   /db_xref="GOA:Q15YI1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YI1"
FT                   /protein_id="ABG39057.1"
FT                   /translation="MNHIPQHILEFLRDSAPFEVLDEHEMNRLAQSITVAYFSQEDVTN
FT                   ILKQQQGGLFLICSGQYSVKDSAESERHVSDGDYFGCDNLWQKQPNKIAVTVDSPGLVY
FT                   CIPKKSFAQCVASHPSIEVFFRNYTSEQIYSDHVDDSKSMWLYKPISEVISDGVVSEDI
FT                   NSSILQGVQVMSKSGVSSLVITDNQLLVGILTDRDIRNRVVAQQTDVNLAVSEIMTRDP
FT                   VKISDQRTLFDALCVMTEHNVHHLPVVDKNSGVPLGMLTASDMIRHQRGNVLFVINELT
FT                   KAPSLYELTRLSWQLPHYFSKHAKRLGDFDIAGKVLSQATDIMTRKLIGFYQQQHGEAP
FT                   MEFCWLVYGSQAREDQTMGSDQDNGLLFATEPSPEQSAYFADMAEYVCRGLDKCGIKLC
FT                   TGNIMASNPALRLSIKQAVQQAQSWVREPSPEAILNCNIFLDVRAVAGNRFLLSQLHVE
FT                   RKELLKQSRFIAALTRHASDGHVPLSMFQKFVYKKGLPKKDCIDMKNSGVAIINNLVRI
FT                   YSLANGLTMPSIPHRLEGLLSHAGLSSKDVKNLRDIWLFLNRLRWRHQIQNKVTDNYVS
FT                   ISDLSSIEKYQLKEAMRVIRRTQQAAVFKFAGGLG"
FT   gene            618306..618980
FT                   /locus_tag="Patl_0529"
FT   CDS_pept        618306..618980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0529"
FT                   /product="Exonuclease, RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease, RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: cps:CPS_4955 DNA polymerase III
FT                   epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39058"
FT                   /db_xref="GOA:Q15YI0"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YI0"
FT                   /protein_id="ABG39058.1"
FT                   /translation="MFKKLKKWFAPKPPIPEAWLGMPLADIPFLCIDLELTSLDLNDTK
FT                   ILSIGWVEGKGKQISLQSCYYQVISTTASLNQSPVIHGLTADHIAQGQPLRIALEALKQ
FT                   FASSHVWVFHCTHLDMTVLNGVFKKLNIPLPTVVTLDTLRFGLYQLTKNLRPPPPNAVV
FT                   LPVCRARYNLPAVPAHNALDDAMATLELLFAQIQKFAPKNTDTLKTLMVTDALEVFPAP
FT                   TD"
FT   gene            619131..620309
FT                   /locus_tag="Patl_0530"
FT   CDS_pept        619131..620309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0530"
FT                   /product="Tetratricopeptide TPR_2"
FT                   /note="PFAM: TPR repeat Tetratricopeptide TPR_2; SMART:
FT                   Tetratricopeptide region; KEGG: cps:CPS_2703 TPR domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39059"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YH9"
FT                   /protein_id="ABG39059.1"
FT                   /translation="MNYLTKQHSFWLTLLVLFSLTACQSAPTVQHVSGSILDDDAFPLA
FT                   KDVHIESEKDIFRLDKDARNYVKRTVGHIDDPIERTETLARSIFKRLSFDLLYRGDANT
FT                   TANETFHNRAANCLSLSIMTYALANEADLSVRFQDVQIPEYWTRRDGISLLNGHINLQI
FT                   IPRSRSANSFYFYKRGYQIDFDPQALRQHFPKTQLTKQQVIAMFYNNKGADALLSNDRD
FT                   RAYAYFSAALKVEPNFDSALVNLGFLYRVSERYALSERAYLKALSSSPDNLTAWENLAY
FT                   LYNYSNKMTQAQEILARVESKRLRNPFYHLDLGRREFDQGDLQGALAHFNRALAIDKDR
FT                   HEIFFALARTYHAMGQMTLSERYLKKAKRTTKNLQEKELYQGKLDLLSRSSI"
FT   sig_peptide     619131..619208
FT                   /locus_tag="Patl_0530"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.592 at
FT                   residue 26"
FT   gene            complement(620372..621211)
FT                   /locus_tag="Patl_0531"
FT   CDS_pept        complement(620372..621211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0531"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; KEGG: ppr:PBPRB0800
FT                   putative oxidoreductase iron/ascorbatefamily"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39060"
FT                   /db_xref="GOA:Q15YH8"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YH8"
FT                   /protein_id="ABG39060.1"
FT                   /translation="MQLLAVDYTAPDADKKFVESLRQTGFGVLKNHPIEQSTVTSIYEN
FT                   WQAFFNSDDKLHYAFDNQSHDGFFSTKVSETAKGFKKKDIKEYFHYYPWGKCPPDLKQE
FT                   LQDYYQAANNLASELLGWVEKYSPADVAAHYSEPLSGMAVDSDQTLLRVLHYPPITGSE
FT                   EPDAIRAAAHEDINLLTILPSANEPGLQVKGTGDEWIDVPCDFGTLIVNIGDMLQEASG
FT                   GYFPSTSHRVINPQGADQTKSRISLPLFLHPRPEVVLSERHTAKTYLAERLRELGVA"
FT   gene            complement(621278..622486)
FT                   /locus_tag="Patl_0532"
FT   CDS_pept        complement(621278..622486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0532"
FT                   /product="nucleoside transporter"
FT                   /note="TIGRFAM: nucleoside transporter; PFAM: Na+ dependent
FT                   nucleoside transporter nucleoside recognition Na+ dependent
FT                   nucleoside transporter-like; KEGG: son:SO1214 NupC family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39061"
FT                   /db_xref="GOA:Q15YH7"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="InterPro:IPR018270"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YH7"
FT                   /protein_id="ABG39061.1"
FT                   /translation="MVSLIGIAVLFILAILLSAHRKSINWRTVGGAFAIQAIIGALVLY
FT                   FPPGKEFLLGLTVYVKNIIEYSQQGIDFIFGQLGNKSLGFIFAFNVLPVIVFFSSLITV
FT                   LYHLGVMSWIIRLIGGFLQIALKTSRPESMSAAANIFVGQTEAPLVVKPFIPHMTRSEL
FT                   FAIMVGGLASIAGSVMAGYAGMGVEIKYLLAASFMAAPGGLLMAKIIMPETQEFKNELT
FT                   EVNNEEDKYANIFDAAASGAASGMHLALNVGAMLLAFIALIALLNGLIGWAGGLVGVEN
FT                   LSFEVILGYVFQPLAWALGVPWDEANLAGSFIGQKMVVNEFVAYVDFLKYQADLSPGTQ
FT                   AIVIFSLCGFANFSSIAILMGGIGALAPGRRKEIAQMGLKAVLAATLANLMSAALAGLY
FT                   LSL"
FT   gene            complement(622532..623155)
FT                   /locus_tag="Patl_0533"
FT   CDS_pept        complement(622532..623155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0533"
FT                   /product="uridine kinase"
FT                   /EC_number="2.7.1.48"
FT                   /note="TIGRFAM: uridine kinase; PFAM:
FT                   phosphoribulokinase/uridine kinase; KEGG: cps:CPS_1974
FT                   uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39062"
FT                   /db_xref="GOA:Q15YH6"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YH6"
FT                   /protein_id="ABG39062.1"
FT                   /translation="MSAPLVIAISGASGSGKSLFTENLLKEFSEDGKHVQILREDHYYR
FT                   AQDHLPMEEREKNNYDHPKAFEHELLVEHLQALKNWQSVDYPHYCYKTHTRLAQTEKLM
FT                   SAPVIIIEGIMLLANQELQPLFDIKIFVDTPLDICLLRRMKRDIAERGRTLDSVAKQYE
FT                   STVKPMYHQFIAPSRFTADVIVTQGGKNRIALDVIKSHIQQTLL"
FT   gene            complement(623490..624425)
FT                   /locus_tag="Patl_0534"
FT   CDS_pept        complement(623490..624425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pha:PSHAb0344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39063"
FT                   /db_xref="GOA:Q15YH5"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YH5"
FT                   /protein_id="ABG39063.1"
FT                   /translation="MKTKLIYVGLFTLIWLIFQFAFVIGVHFQATSNQAQFLANIEKRI
FT                   AIDLPKLRLANPKFKTVADTRSVSHYISDLNRVLDEQRSPIDVISIQGIVEADIQRAGA
FT                   SRETYLETHDQKITIQYAVNAPSIVDYIGLTPLILATLLSYLCIQRLRLTHRNTANLHK
FT                   ELETPVNHQLIIDLKTKSISYVDGTTPIILPNKPFCFYAALVDYCIQDNSANLSNSSDV
FT                   PEELIQIANKYFYRLIDLGHTKRKRPDFAANLDKTLSEIRSALDEIFVDHQEEKELFYP
FT                   PKAQGEGSRSKLHNYALPNISTEKVLFIGK"
FT   sig_peptide     complement(624354..624425)
FT                   /locus_tag="Patl_0534"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.646) with cleavage site probability 0.268 at
FT                   residue 24"
FT   gene            complement(624415..625254)
FT                   /locus_tag="Patl_0535"
FT   CDS_pept        complement(624415..625254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pha:PSHAb0343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39064"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YH4"
FT                   /protein_id="ABG39064.1"
FT                   /translation="MLASWYAGVLSSVIKSENLSNLISQSLTCQTQSVNNSDEFVVFIT
FT                   DQGMASKLLSSLCSNQTINRQYGIVTVQWSHNEQEIIQYVGKGIADLALVKENVMLAFA
FT                   AETTYRYQTVAQYKDYSTYLISLKEKPELTKQYLWGKRLGLLDYPSSRSGHIVPKGLLN
FT                   ELGISEANMDIVYVNSHEALRDLLATGSVDIISSFWKEEDAERFSANYITPINTKVSGS
FT                   KWYLKMETQNTDLICEIQNTLSTLSTNTQSDYYRQLELVPYHCPLTKNSNEVLDHEN"
FT   gene            625702..628728
FT                   /locus_tag="Patl_0536"
FT   CDS_pept        625702..628728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0536"
FT                   /product="Oar-like outer membrane protein protein, OmpA
FT                   family"
FT                   /note="KEGG: ilo:IL0583 Oar-like outer membrane protein
FT                   protein, OmpA family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39065"
FT                   /db_xref="GOA:Q15YH3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YH3"
FT                   /protein_id="ABG39065.1"
FT                   /translation="MLRKTKLTSIALAVAMSLGMSSAALAQTTSSGMTGQIVGPNGNPA
FT                   AGTVVKVTHVPTGAVKTATVNSAGTFNLNGLRVGGPYTIELDSNTFADQTIEDVYLSLG
FT                   ETAPINRVLASEENIERIAVSASQISSLSFGKIGPGANFDLSTLENAPAINRDLTDIVR
FT                   IDPRIYVDEGGSGGIQCVGKSPRFNSLTVDGVRMNDLFGLNSNGYPTERMPFSYDAIEG
FT                   VAVEIAPFDVIYGGFSACNISAVSKTGTNEVHGSAFYDYGSNDLRGDSLEGDDINLGDY
FT                   TEKRYGFSVGAPLIKDTLFIFAAYEKLEGANIFDRGVAGSGAINEVALSQTQLDDIIRI
FT                   SNDLYQFDPGTVPSSLANEDEKLLVKLDWNINEQHRASFTYNWNDGNNFAESDGDSDEF
FT                   ELSSHFYERGAELTSYSGVLYSDWNDKFSTEVRLSYTELDNRQNSLTGDGTVGGNDFGE
FT                   VKIFLEDMTVFLGSDDSRQVNDLNWDALSMMFRGNYYMDNGHTLTFGYESDDLEIYNIF
FT                   VQHAETSLSFDSIADFENGIASDVEYGHAYSGDINDRAAEWGYTSHSTYLQDEFYLTDD
FT                   LKVIAGLRYDWITTSDKPVENADFLAGNGYSNTANLDGISLLQPRIGLNYTLSDSTEIR
FT                   GGVGLFSGGNPNVWMTNNYQNTNVTGGEVDGGDFGYDDGSRSLFDDDVVWVNVEDGAPV
FT                   GPGYGVPSELDDLLDNGNAGNFESNNLDPDFKMPSEWKVSAGITHVTDSDYVLNADLLV
FT                   SFTQDQAMIKYVGIEEVGITDAGYVDYDRNGYGSLELTNSDEVSTSYSLTGTLEKTWDN
FT                   GLRLVTGYSYNHAEDVQPMTSSVAFSNYQYRAFTNPNEDVSSLSDWNIEHRFTADFSYA
FT                   VELFAGLETRFNMYALAQSGRPYSFTLSQDDGNSAFGFTPYLDSNSVLPIGAERNDQES
FT                   DWWTKVDIAVRQEIPAFADGHSATVSLTMDNFTNFLNDDWGILEEVSFNTATIGNSSPQ
FT                   SRQGDASLWEMRIGVNYRF"
FT   sig_peptide     625702..625782
FT                   /locus_tag="Patl_0536"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 27"
FT   gene            628798..629973
FT                   /locus_tag="Patl_0537"
FT   CDS_pept        628798..629973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0537"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   cps:CPS_1964 endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39066"
FT                   /db_xref="GOA:Q15YH2"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YH2"
FT                   /protein_id="ABG39066.1"
FT                   /translation="MHRIFGLLVLLVGVPLVPEAKTVRIATFNVSMEASNYLPKGVTPT
FT                   GQELFENLQSGDNQQIKNIAEIIQRVRPDIILLNEFDYTSDDDKGVKAFISHYLAVSQL
FT                   GTKSIDYPYYYIAPVNTGVPSGVDLNHNGTSTDNGGDTFAFGLYPGQYGMVLLSRFPIE
FT                   REQLRTFQHFLWKDMPNGLLNSVKTEEGADWYSPQAKAIFRLSSKSHWDVPISIDGKLV
FT                   HVLASHPTPPVFDGPENRNGKRNHDEIRFWTDYISGGKGADYIYDDKQQRGGLRSEHFV
FT                   VLGDLNASAEEGDGHKDGIGSLLKNSKVNSHNIPMSAGGAVHSPENALGASHTAFWRMR
FT                   ADYVLPSKKLGEVSTSGVFWPTSDEASYRLIQNRQASSDHRLVWVDVDVTE"
FT   sig_peptide     628798..628860
FT                   /locus_tag="Patl_0537"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.847) with cleavage site probability 0.846 at
FT                   residue 21"
FT   gene            complement(630064..630528)
FT                   /locus_tag="Patl_0538"
FT   CDS_pept        complement(630064..630528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0538"
FT                   /product="transcriptional regulator, ArgR family"
FT                   /note="PFAM: arginine repressor; KEGG: pha:PSHAa2659
FT                   arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39067"
FT                   /db_xref="GOA:Q15YH1"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YH1"
FT                   /protein_id="ABG39067.1"
FT                   /translation="MATHKQEELIKAFKDILKAENFGSQGDIVDALKTQNFDNISQSKV
FT                   SRMLSKFGAVRTRNARGDMVYCLPPELGMPTARSPLRQLVLDIVHNNVMIIIRTSPGAA
FT                   QLIARLLDSLSQKDGVLGTIAGDDTIFIAPSDINQIEEIRMRVEALFENV"
FT   gene            630694..631629
FT                   /locus_tag="Patl_0539"
FT   CDS_pept        630694..631629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0539"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /note="TIGRFAM: malate dehydrogenase, NAD-dependent; PFAM:
FT                   Lactate/malate dehydrogenase; KEGG: ilo:IL0472 malate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39068"
FT                   /db_xref="GOA:Q15YH0"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR023958"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YH0"
FT                   /protein_id="ABG39068.1"
FT                   /translation="MKVAVLGAAGGIGQALSLLLKTQLPAGTELALYDVAPVVPGVAVD
FT                   LSHIPTDVKVEGFGKDDLAKALTGSDIVLIPAGVPRKPGMDRSDLFNINAGIVRNLVDS
FT                   VADNCPEACLCIITNPVNTTVAIAAEALKAKGVYNKNKLFGVTTLDVIRAETFVGNLRD
FT                   LNPANVHVPVIGGHSGTTILPLLSQVEGVEFTDEEVASLTTRIQNAGTEVVEAKAGGGS
FT                   ATLSMGQAAARFCLSLVSAMRGENVVEYTYVETNSDDAQFFSHPVRLGKNGVEEILPYG
FT                   ELSDFEQKAKESMLEGLRGDIKLGVEFVNN"
FT   gene            complement(631721..632326)
FT                   /locus_tag="Patl_0540"
FT   CDS_pept        complement(631721..632326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0540"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cps:CPS_4785 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39069"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YG9"
FT                   /protein_id="ABG39069.1"
FT                   /translation="MELAIILMMILIVVAIGAVKLNEPSLTFPFKKKTNLFTPVERSFL
FT                   ALIDEAVGNQFRVMCRVKLSDVVATRESTSKKAGKSALSRTSGRHLDFVLCSKADMSPV
FT                   VAIDLVHATQNGKDGYKRQRDWFVSGALDAARIPHVRIKVRSGYTAHDIRQCIDAKLAS
FT                   VRIASKSTPLVAGTAGQVKDPNIATRPTKPLGQDPMAA"
FT   gene            complement(632464..632910)
FT                   /locus_tag="Patl_0541"
FT   CDS_pept        complement(632464..632910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39070"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YG8"
FT                   /protein_id="ABG39070.1"
FT                   /translation="MSVIHHKSIMLVLYTEYQMGNTIAVVKRSTLCLLISGVYSGVLSA
FT                   QNHALNADSGAPTTCPAAFHGIDIPTDASACLLFADALPASLTYHSKQTPNDLLAFFRQ
FT                   HIDGPISQKLSQNRILIRLQNDHKIIVISPDGAGSQVDILINSK"
FT   gene            632976..633497
FT                   /locus_tag="Patl_0542"
FT   CDS_pept        632976..633497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pst:PSPTO3908 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39071"
FT                   /db_xref="GOA:Q15YG7"
FT                   /db_xref="InterPro:IPR016917"
FT                   /db_xref="InterPro:IPR022584"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YG7"
FT                   /protein_id="ABG39071.1"
FT                   /translation="MNIVREYLRLAVFAIGLLSGVQIPVFIDQYQKRVDAHLLEAKQNL
FT                   AGFEQTAKRYFKGDMQKLIRHYQQSEDAIFRQDAKNVQLIFSRASLLQVQWDNLNKGVV
FT                   QRAYYLATQYNPQILQETITQYSYTVPLNPVALGWGICIALLFAALFDMTIGISAKTCS
FT                   VCFHAVRKRN"
FT   gene            complement(633647..634747)
FT                   /locus_tag="Patl_0543"
FT   CDS_pept        complement(633647..634747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0543"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hsa:1834 dentin sialophosphoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39072"
FT                   /db_xref="GOA:Q15YG6"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YG6"
FT                   /protein_id="ABG39072.1"
FT                   /translation="MKKLTLASIITSVLATSAFAAQQDTTTQESAGQESAGQESTPQAT
FT                   DSNFATLDTNEDGAISQGEASKDNVWNYFVKVDEDENGQLSPREFNTYASIYSKADIGL
FT                   ADTVVTGKNANTTDSSDQLSTSGTNAAIGDTSESMAKADKDMVGTESAAKEANDNPEDM
FT                   ADTQLSQAKQNAISANAQNSNAKLDTQLTEHDSHDDVNASAGAGINNKMKDAESNVQNA
FT                   LDNAKELSAKGQSPLDHSADAMNKELESTGVEGHANEVPAKSETEQQNLAASSDVSINA
FT                   DLESNNPALKAPDQPAPVEQEFSEVDTDADGFISKEEAKNAEISEHFDNADINSDDKIS
FT                   QEEYDTFVKGQQLTMRYSVRYPYESE"
FT   sig_peptide     complement(634685..634747)
FT                   /locus_tag="Patl_0543"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 21"
FT   gene            complement(635057..635401)
FT                   /locus_tag="Patl_0544"
FT   CDS_pept        complement(635057..635401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0544"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="TIGRFAM: iron-sulfur cluster assembly accessory
FT                   protein; PFAM: HesB/YadR/YfhF; KEGG: pmu:PM0458
FT                   hypothetical HI1723"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39073"
FT                   /db_xref="GOA:Q15YG5"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YG5"
FT                   /protein_id="ABG39073.1"
FT                   /translation="MSVQTAVPIEFSDAAARKVKALVEEEENPNLKLRVYVTGGGCSGF
FT                   QYGFTFDEKVNDGDTTIDKDQVTLVVDPMSLQYLLGGEVDYTEGLEGSRFLVNNPNATT
FT                   TCGCGASFTV"
FT   gene            complement(635516..636214)
FT                   /locus_tag="Patl_0545"
FT   CDS_pept        complement(635516..636214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0545"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ilo:IL2241 uncharacterized conserved membrane
FT                   or secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39074"
FT                   /db_xref="GOA:Q15YG4"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YG4"
FT                   /protein_id="ABG39074.1"
FT                   /translation="MNYTELKQRFGPYQFYALCLVILLSTGYLAFSFGYRLSDEQQTLL
FT                   KQLKNSSESLRLENAELSRQVNVMSVELDIATTTQKKLAEETELALAREVSLRKELGFY
FT                   QQVMAPELSATGLGIDGFAVEKTLSENYYRFKLVLLQQDKIKATLNGTVQLVIHGSENG
FT                   HPKSYPLTSLSDQGPLTFRFKYFQMLEQEFTLPMDFLAEKVVITADVYKYKRKLGELNK
FT                   TFDWVLSTSE"
FT   gene            636328..638007
FT                   /locus_tag="Patl_0546"
FT   CDS_pept        636328..638007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0546"
FT                   /product="Cl-channel, voltage gated"
FT                   /note="PFAM: Cl- channel, voltage gated; KEGG:
FT                   pha:PSHAa2252 voltage-gated ClC-type chloride channel ClcA"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39075"
FT                   /db_xref="GOA:Q15YG3"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YG3"
FT                   /protein_id="ABG39075.1"
FT                   /translation="MSLNAFRQELATPRTSIQLCVLGIIGGVCAASVIILFRLSVEWLQ
FT                   LIYLDEVNNFTTLSTLERAIMPVIGVVLILCVAYLTGFKHYRMGIPFVIHRVKKRFGHI
FT                   PFRTTVNQFFGGAFALASGFSVGREGPSVHLGAAGSSFFGQWLKLPDNSIRILSGCGIA
FT                   AGISASFNTPFAAVIFVMEVVLREYKIHIFIPIMLAAACGTVMTRAVFGQAQELDFIEF
FT                   FEFSRWIYLYLILFGILLGALATLFNNALMKVMHIFQRFNMIKRLLIAALITGAVGYIL
FT                   PQALGAHFFSVHDMVLQQQDVVLLVAVLCAKFFITIIAIGLGVPGGIMGPVFVLGMLSG
FT                   ALLAAPLGLAVDNMEQLSGSFALLGMAGLMTSVVHAPLAALSAVMELSYSPELILPAIL
FT                   VIVPAYVTSTQFLGNSSIFIRQLDYQKLPYSTSSVLEALQRTGVLAVMDKEFKLFNNAQ
FT                   QHHILQFLETSPTHPVVQRNSVEIDVQYSLVQYDISLSREESSLAFYAMQGVSFQSTLG
FT                   EVYELLQSSREGAVYVYENEPSNITGVITWNMLRSYLHKAQY"
FT   gene            638047..638475
FT                   /locus_tag="Patl_0547"
FT   CDS_pept        638047..638475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0547"
FT                   /product="conserved hypothetical protein 701"
FT                   /note="PFAM: conserved hypothetical protein 701; KEGG:
FT                   ilo:IL2243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39076"
FT                   /db_xref="GOA:Q15YG2"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YG2"
FT                   /protein_id="ABG39076.1"
FT                   /translation="MSILWLKALHIFFMIAWMAGIFYLPRIFVYHAQTDNQAVRDQFKT
FT                   MERKLWFFITPFALLTLIFGLSLIYQYGASWLAHSGWLHAKLLLVALLYGYHFYLYHLV
FT                   KVFARDENKHSSRFYRFLNEAPVLILLAIVCLAVVKFI"
FT   gene            639081..639635
FT                   /locus_tag="Patl_0548"
FT   CDS_pept        639081..639635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0548"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="PFAM: GTP cyclohydrolase I; KEGG: psp:PSPPH_1071 GTP
FT                   cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39077"
FT                   /db_xref="GOA:Q15YG1"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YG1"
FT                   /protein_id="ABG39077.1"
FT                   /translation="MSDDLTQHYSQILSILGEDTQRGGLVDTPKRAAKAMQFLTDGYEK
FT                   NLNDVVNGAIFEADTDEMVVIQNIEYYSLCEHHILPFIGQCHIAYLPQGKVLGLSKFAR
FT                   IVDMYARRLQIQEGLTKQIADAIQEVTGAAGVGVIMEGKHMCMMMRGVQKQNSSMVTSV
FT                   MLGAMRKSDATRNEFLRLIGK"
FT   gene            639866..640855
FT                   /locus_tag="Patl_0549"
FT   CDS_pept        639866..640855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0549"
FT                   /product="methylthioadenosine nucleosidase"
FT                   /EC_number="3.2.2.16"
FT                   /note="PFAM: purine and other phosphorylases, family 1;
FT                   KEGG: ccr:CC2266 5'-methylthioadenosine nucleosidase /
FT                   S-adenosylhomocysteine nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39078"
FT                   /db_xref="GOA:Q15YG0"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YG0"
FT                   /protein_id="ABG39078.1"
FT                   /translation="MCIMLISFTAAAKSTDPSSEYGPRTFDVDNKWTAIVAAYEPEIKA
FT                   IDAAIAKLPDANITKTVTFQGVKYQLGTYKGEPIVIFTTGISVPNAAMTMQMALDYFPI
FT                   DRVIMMGIAGAISSEFTPGDIAVPARWYFHDESVYINPDKEHEGEFVLPDYYEKSLASF
FT                   LERRKQDPHSPAYENFGFIHPEEMAVIKEGWDSPRQMPYFTASSELLDLTKKALKKVSP
FT                   IAMPSGKAIKVKVGGNGVTGSVFLDNADYRNWIRRVFNADVSEMESAAVAQVCFVNDVD
FT                   WVVIRSISDLAGGQQGKNVENVFDGIASGTGAKLLLGVLDEVVALPVQ"
FT   gene            complement(640941..641672)
FT                   /locus_tag="Patl_0550"
FT   CDS_pept        complement(640941..641672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0550"
FT                   /product="protein of unknown function DUF28"
FT                   /note="PFAM: protein of unknown function DUF28; KEGG:
FT                   vch:VCA0006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39079"
FT                   /db_xref="GOA:Q15YF9"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YF9"
FT                   /protein_id="ABG39079.1"
FT                   /translation="MGRKFEVRKVAMAKTAGAKTKVYSKYGKEIYMVAKNGGTDPQANL
FT                   SLRRLIDKAKKDQVPSHVIDKAIDKAAGGAGEDFTPARYEGFGPGGCMVIVDCLTDNNN
FT                   RTITDVRNCFTKTNSKIGVTGTVSHMFDHQAVFSFPGDDEDAVLEVLMEADVDVTEVEC
FT                   EEGVITVFAPHTEYFKTRTALTDNNPELEFDADEITFVPQTETVVTGEDVATFDKFMDM
FT                   LEDCDDVQDVYHNAVVEREGE"
FT   gene            complement(641780..642886)
FT                   /locus_tag="Patl_0551"
FT   CDS_pept        complement(641780..642886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0551"
FT                   /product="AFG1-like ATPase"
FT                   /note="PFAM: AFG1-like ATPase; KEGG: cps:CPS_4344 ATPase,
FT                   AFG1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39080"
FT                   /db_xref="GOA:Q15YF8"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030870"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YF8"
FT                   /protein_id="ABG39080.1"
FT                   /translation="MSASTPWQKYQSDLQRDDFHSDPAQANAVKQLQRLYDDLVAPDKE
FT                   PSLWTKVKFVLGKDDKAQSIKGLYFWGGVGRGKTYLVDTFYDCLPFEKKMRVHFHRFMH
FT                   RVHEELKSLGGQSDPLKIIAAKFASEAKVICFDEFFVSDITDAMILGTLMEEMFARGIV
FT                   LVATSNIIPDELYRNGLQRARFLPAIALINQHTQVVNVDSGIDYRLRTLKQAEIYHFPL
FT                   DQTANDNLSVYFAQLAPEECQHDDAITIKGRKIPTVHHAEGVAMFEFRALCDGPRSQTD
FT                   YMELSRCYHSILLANVEQMGKSVDDIARRFIAMVDEFYERNVKLIMSAEVPLEELYTEG
FT                   ALNFEFHRCLSRLKEMQSHDYLATEHLP"
FT   gene            643130..643570
FT                   /locus_tag="Patl_0552"
FT   CDS_pept        643130..643570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ilo:IL0412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39081"
FT                   /db_xref="GOA:Q15YF7"
FT                   /db_xref="InterPro:IPR009386"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YF7"
FT                   /protein_id="ABG39081.1"
FT                   /translation="MDWLIGVVLVLVGAVIGFFVAKYVYFDKEKTSKDGQKEQTLKDVM
FT                   VQQSLNHVTESRKIAEQLQKQCQTLSQNLDSYESSLSLLNTDAQSSNVSFFGEHASPFL
FT                   QNKEQKVTREKDSADVQPLDFSNQSSGLFSGSENVRPEKQSK"
FT   gene            643664..645034
FT                   /locus_tag="Patl_0553"
FT   CDS_pept        643664..645034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0553"
FT                   /product="peptidase Do, Serine peptidase, MEROPS family
FT                   S01B"
FT                   /EC_number="3.4.21.107"
FT                   /note="TIGRFAM: protease Do; PFAM: peptidase S1 and S6,
FT                   chymotrypsin/Hap PDZ/DHR/GLGF; KEGG: son:SO3942 serine
FT                   protease, HtrA/DegQ/DegS family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39082"
FT                   /db_xref="GOA:Q15YF6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YF6"
FT                   /protein_id="ABG39082.1"
FT                   /translation="MSKVINRTAITSCVFAASLMIAGSASAALPFFSSDNEPVTSLAPM
FT                   LEKTTPGIVTISVEGTQVSRQQVPEMFRRFFGGNGEQVQERPFKGLGSGVIIDADKGYV
FT                   VTNNHVVENADEITVKLNDGREVKAKKLGADEQSDIALLKIETDNLNLTAVPLADSDKV
FT                   RVGDFVVAIGNPFGLSQTVTSGIVSALGRSGLNIGGYENFIQTDAAINRGNSGGALVSL
FT                   NGELVGINTAIFGPNGGNVGIGFAIPANMMKSLVDQIIEFGEVRRGLLGILGQDVDSGL
FT                   AEAMNLDVSRGAFVSEVSEGSAADKGGIQAGDIIIEIEGRPVTSFLELRAKIGSKGAGT
FT                   KVNLTLLRKGKEKDVQVTLGDATQSTVAAKEIHPALEGATLTNGKTKQGVDGVVISELV
FT                   ARSPSSLIGLQDGDVIIGVNRHKIDNVVDLRNALDEAKGVIALNVKRGVSTLYLVIR"
FT   sig_peptide     643664..643747
FT                   /locus_tag="Patl_0553"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 28"
FT   gene            645212..646198
FT                   /locus_tag="Patl_0554"
FT   CDS_pept        645212..646198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0554"
FT                   /product="DegS peptidase, Serine peptidase, MEROPS family
FT                   S01B"
FT                   /note="PFAM: peptidase S1 and S6, chymotrypsin/Hap
FT                   PDZ/DHR/GLGF; KEGG: cps:CPS_4347 serine protease DegS"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39083"
FT                   /db_xref="GOA:Q15YF5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YF5"
FT                   /protein_id="ABG39083.1"
FT                   /translation="MPDLRHGSSLNLSMFNPTRQTSDKLSFNHAVNVSGPAVVNIYSQS
FT                   IESGSIYNRSQAVERTSLGSGVIMSEDGLILTCLHVIANANSILVGLQDGRRAEAQIIG
FT                   YDPYTDLAVLKVAEDNLHVIPQLDDPGTRVGDLVLAIGNPYNLGQTITQGVVSRVGRNG
FT                   LAAYFDFIQMDAVLNEGNSGGALIDSNGYLIGINNANFKTLDSQRRVKEVDGVSFAIPY
FT                   GLAKKVMDEIVANGRVTRGQLGVGAAEVYGRSGILITSVSPGSSADKGGIRTDDVMLAI
FT                   NGQPTDSVTQTLDFIAETKPGTELQVEVSRGGQLITLTVVVAELGAQ"
FT   gene            complement(646307..647566)
FT                   /locus_tag="Patl_0555"
FT   CDS_pept        complement(646307..647566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0555"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   son:SO3948 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39084"
FT                   /db_xref="GOA:Q15YF4"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YF4"
FT                   /protein_id="ABG39084.1"
FT                   /translation="MDKLLIKASKPLQGSVRISGAKNAALPILMSSILADTTCYFDNVP
FT                   ELRDINTSLALLAELGADAKRVSGHAVEIDPSSINNCNASYDLVKTMRASILVLGPLLA
FT                   KYGEANVSLPGGCAIGARPVNLHLQGLEKMGAKIDVEAGYIRAKVDGRLKGANIFMDMV
FT                   SVGATENLMMAACLADGETVLENAAREPEIVDLANCLNAMGAKVTHAGSDKIRIQGVER
FT                   LQGCRYAVLPDRIETGTFLIAAAVTGGKIRCENAAPETLDAVLDKLVMAGAVITTGDDW
FT                   IELDMQGHPLTSVNIKTAPHPGFPTDMQAQFVALNCVAQGTGVVTENIFENRFMHVPEL
FT                   QRMGAKIDLETNSAVCHGVSSLKGAQVMATDLRASASLVIAGLVAEGETVVDRIYHLDR
FT                   GYEHIETKLNGLGANIQRIK"
FT   gene            complement(647636..647893)
FT                   /locus_tag="Patl_0556"
FT   CDS_pept        complement(647636..647893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0556"
FT                   /product="BolA-like protein"
FT                   /note="PFAM: BolA-like protein; KEGG: sgl:SG0210
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39085"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YF3"
FT                   /protein_id="ABG39085.1"
FT                   /translation="MQNSEIEQLLIEKLGLAEAHVTGDGSHFQIIAVSDQFDDMSRVKK
FT                   QQFVYAPLSEIIAQGTMHAISIKTFSEKQWKRERLLNMPQ"
FT   gene            complement(647921..648253)
FT                   /locus_tag="Patl_0557"
FT   CDS_pept        complement(647921..648253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0557"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: vpa:VP2660 putative anti-sigma B
FT                   factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39086"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YF2"
FT                   /protein_id="ABG39086.1"
FT                   /translation="MSNATSPKLTIVNDSSSPESFLLSGNLNRDTIPNFWPDSLQQLTN
FT                   AKRTNKPLVLNLEKITQIDTAGLAWLINLIRDAKKQDIEFSLLNPPDTLLNLAKISDVD
FT                   GFLPLQ"
FT   gene            complement(648254..648895)
FT                   /locus_tag="Patl_0558"
FT   CDS_pept        complement(648254..648895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0558"
FT                   /product="toluene tolerance"
FT                   /note="PFAM: toluene tolerance; KEGG: vpa:VP2661
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39087"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YF1"
FT                   /protein_id="ABG39087.1"
FT                   /translation="MKHLTRIFSAALILIFSSVATAEEANPYKLLEDVASETFARIKDQ
FT                   HAEIQKNPEILRDIIEQDLLPYIDYNFAALKVLGKHFRTVPKDKIPEFIQVFRQYLITT
FT                   YALALTYYNGQEVVFQPLRDAPEDKTATVRAVVKEDGRPDIKISFKLRKNTKTNEWKAY
FT                   DMVAEGISLLSSKQSEYESILRQDGIQKVIDIMKEKIKQPITLEHPEEES"
FT   sig_peptide     complement(648827..648895)
FT                   /locus_tag="Patl_0558"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            complement(648927..649391)
FT                   /locus_tag="Patl_0559"
FT   CDS_pept        complement(648927..649391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0559"
FT                   /product="Mammalian cell entry related protein"
FT                   /note="PFAM: Mammalian cell entry related; KEGG:
FT                   cps:CPS_4534 mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39088"
FT                   /db_xref="GOA:Q15YF0"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YF0"
FT                   /protein_id="ABG39088.1"
FT                   /translation="MSSRKAEIMVGLFVVLTLAAGLLLALKVVNQGMSSGTGTYTLYAK
FT                   FDNIGGLKARSAVKVGGVTVGRVDNISLDPDGYTPVVELKIYQEYNKFPETSSVSILTS
FT                   GLLGEQYVGFQPGFSIDGIADLAEGDYISDTKSALVLEDLIGQFLFSKND"
FT   sig_peptide     complement(649314..649391)
FT                   /locus_tag="Patl_0559"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.946) with cleavage site probability 0.653 at
FT                   residue 26"
FT   gene            complement(649405..650184)
FT                   /locus_tag="Patl_0560"
FT   CDS_pept        complement(649405..650184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0560"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   ilo:IL0404 ABC-type transport system involved in resistance
FT                   to organic solvents, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39089"
FT                   /db_xref="GOA:Q15YE9"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YE9"
FT                   /protein_id="ABG39089.1"
FT                   /translation="MQWLASIGRNTIDTVGSFGRAFLMLMGAIIAKPQFIKNTPLTIKQ
FT                   IYVVGVQSLLIIVVSGLFIGMVMALQGYTILVDYGAEGSLGPMVALSLLRELGPVVTAL
FT                   LFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVVAPRLWAGIISMPMLALIFSAV
FT                   GILGGHLVGVDWLGVDVGSYWSIMQSSVDWNEDVVNGIIKTLVFAFVITWIAIFKGYDA
FT                   VPTSEGISKATTETVVFSSLAVLGLDFILTALMFGIE"
FT   gene            complement(650185..650982)
FT                   /locus_tag="Patl_0561"
FT   CDS_pept        complement(650185..650982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0561"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   pha:PSHAa2544 transport protein (ABC superfamily,
FT                   atp-binding)"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39090"
FT                   /db_xref="GOA:Q15YE8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YE8"
FT                   /protein_id="ABG39090.1"
FT                   /translation="MENLLEIDNLTFSRSGRIIYDDISLRIVKGKTTAIMGPSGIGKTT
FT                   MLRLMGGQLKPDSGDIRFKGESIQSMKRNRLFTVRRQMSMLFQSGALFTDMSVFDNIAF
FT                   PLREHTKLSESVIKTLVLLKLQAVGLRGAADLMPAELSGGMARRAALARAIALDPELIM
FT                   YDEPFAGQDPISMGVLVKLIKALNDSLQLTSVVVTHDVTEVLTIADYIYILAEKKVIGS
FT                   GTPEQIKQSDSPLVQQFLKGQADGPVPFHYPADDIEQTFLGAK"
FT   gene            651314..652276
FT                   /locus_tag="Patl_0562"
FT   CDS_pept        651314..652276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0562"
FT                   /product="Na+/Ca+ antiporter, CaCA family"
FT                   /note="TIGRFAM: Na+/Ca+ antiporter, CaCA family; PFAM:
FT                   sodium/calcium exchanger membrane region; KEGG:
FT                   pha:PSHAa2545 Na:Ca transport protein (CacA)"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39091"
FT                   /db_xref="GOA:Q15YE7"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YE7"
FT                   /protein_id="ABG39091.1"
FT                   /translation="MIVEALLFLLWLVVLSWGADRFVFGSSALARNMGISPMIIGLTIV
FT                   AMGSSAPEIMVSATASLNGNTDTAIGNAIGSNITNIALVLGLTALLKPLTVASTTLKRE
FT                   MPVMLGVSLLATYFLADLYLSLNEGIVLFILFFFTIGGLAWMSYHMEKGDPLEQETHDE
FT                   VPDGVPTKSAVIWLFVGLVLLPLSAHFMVESAVEIARHFGLSDLVIGLTIIAIGTSLPE
FT                   LAASIAGVLKGEDDLALGNIIGSNIFNILAVMAMPGLISPGAVDPDAASRDIYTMLGLS
FT                   ILLVLFCFNIRGSRRINRYEAVAFLGCFVAYQYFVFNQG"
FT   gene            652283..653254
FT                   /locus_tag="Patl_0563"
FT   CDS_pept        652283..653254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0563"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="KEGG: pha:PSHAa2546 D-arabinose 5-phosphate
FT                   isomerase; TIGRFAM: KpsF/GutQ family protein; PFAM: CBS
FT                   domain containing protein sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39092"
FT                   /db_xref="GOA:Q15YE6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YE6"
FT                   /protein_id="ABG39092.1"
FT                   /translation="MSQQEYIQSALRVLEIEGQAIKQLSQYIDDNFIAACELMKNCKGK
FT                   VVVCGMGKSGHIGHKISATLASTGTPAFFMHPGEANHGDLGMLTEQDVLLAISNSGETS
FT                   ELLALLPVVKRRGIAIIAMSNNPASSLGKHADVNLCIKVEKEACSLGLAPTASTTATLV
FT                   MGDALAVALLDARGFTPDDFALSHPGGALGRKLLLKLDDIMCQGDLMPLVGTTQTISQA
FT                   LLEISRKGLGMAGIVGDDGRLLGIFTDGDLRRVLDARVDIHTVSIESVMTANCVTASQE
FT                   TLAAEVLNVMQKRKISSLFIVDDNHLPVGAINMQTLLSAGVI"
FT   gene            653254..653808
FT                   /locus_tag="Patl_0564"
FT   CDS_pept        653254..653808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0564"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /EC_number="3.1.3.45"
FT                   /note="TIGRFAM: 3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family; KEGG: cps:CPS_4539 phosphatase,
FT                   YrbI family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39093"
FT                   /db_xref="GOA:Q15YE5"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YE5"
FT                   /protein_id="ABG39093.1"
FT                   /translation="MGDVNTLYGAKSSSLMDKLSRIKLLTCDVDGVFSDGRIYMGNDGE
FT                   ELKAFHTRDGFGVKALLNIGVHVAVITGRESKIVHKRMSALGVEHIIQGCEQKNDALLA
FT                   LQRQLNIGKDATASIGDDMPDVGMFTLSNVAVATHDAHPFVQKQALYITQINGGFGAVR
FT                   EVCDLILHAKGKLNKVSGSSV"
FT   gene            653805..654368
FT                   /locus_tag="Patl_0565"
FT   CDS_pept        653805..654368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0565"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   pha:PSHAa2548 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39094"
FT                   /db_xref="GOA:Q15YE4"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YE4"
FT                   /protein_id="ABG39094.1"
FT                   /translation="MNRVTLSIGLLFLLVIAINLPDWLADEDLIPRTETESAWQPNYQA
FT                   SEMLSTLFDKDGRLSHQVFATKMEHFDLLGFTLFKEPQYTIFVASQTAPWQVSAKDGTL
FT                   YEDNRIQLENNVEIRNQDEQGFARSIRTDFIEINLIDKTMVSDQPVKIFGQHYVINSNG
FT                   FKANLTTQQYELLDHVQTIYQPQP"
FT   sig_peptide     653805..653879
FT                   /locus_tag="Patl_0565"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.797) with cleavage site probability 0.706 at
FT                   residue 25"
FT   gene            654409..654930
FT                   /locus_tag="Patl_0566"
FT   CDS_pept        654409..654930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0566"
FT                   /product="OstA-like protein"
FT                   /note="PFAM: OstA-like protein; KEGG: ilo:IL0398
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39095"
FT                   /db_xref="GOA:Q15YE3"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YE3"
FT                   /protein_id="ABG39095.1"
FT                   /translation="MAGKEDFTQAIKVDSKFQFGDGKTKKSIFREDVHINQGSLNVYAD
FT                   EVEVDASKGEGNEVFIATGSPAKYSQQQEQGGSIEASANRIEYRRDLRTLTLEGDAQLK
FT                   QNNSSVKGESIVFNMELEQIVAQGESESENSGRVTTIFQPAKKSASSKKQTDAKKSSDA
FT                   EVKPKQDETP"
FT   gene            654930..655655
FT                   /locus_tag="Patl_0567"
FT   CDS_pept        654930..655655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0567"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   ilo:IL0397 unclassified ABC-type transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39096"
FT                   /db_xref="GOA:Q15YE2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YE2"
FT                   /protein_id="ABG39096.1"
FT                   /translation="MATLKASHLAKSYKSRQVVRDVSLEVSTGQIVGLLGPNGAGKTTT
FT                   FYMIVGLVPLDKGEISIDQQDLTLQPMHMRARLGIGYLPQEASIFRKLTVYQNLMAILQ
FT                   TRKELSAEQREQQADSLLDEFNINHIRNSAGMSLSGGERRRVEIARALAADPEFILLDE
FT                   PFAGVDPISVNDIKKIIQHLRDRGIGVLITDHNVRETLDVCEKAYIVSHGELIASGTAE
FT                   EVLSDQRVRDVYLGEQFRL"
FT   gene            655778..657271
FT                   /locus_tag="Patl_0568"
FT   CDS_pept        655778..657271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0568"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN/SigL"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor sigma-54 factor, core-binding region
FT                   sigma-54, DNA-binding; KEGG: cps:CPS_4543 RNA polymerase
FT                   sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39097"
FT                   /db_xref="GOA:Q15YE1"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YE1"
FT                   /protein_id="ABG39097.1"
FT                   /translation="MKPSLQLKFSQSLTMTPQLQQAIRLLQLSTLDLQQEIQEALDSNP
FT                   LLEVEEPTDQESGDSALNDNSLDPSSKDTNEIVDTSSDNLDSSEAFEKNEIPEDLPTDT
FT                   TWDEYISASSAPASSISSGAGGDDEQIFQGETTDNIQDHLLWQMRLTHFSDTDVAIATA
FT                   IIDSIDESGYLTMSAEDVLASMDDEEIELDEVECVLKRIQMFDPIGSGSRTPQECLLVQ
FT                   LRQFAPDTPWLEEAKTLIGDYADLLASKDYRTLMRKSRLKEDDLREVMRLLKTLNPRPG
FT                   SALIKGEAEYVIPDVSVSKKNGRWTVELNPDSLPKLNVNQQYAAMSRSAKNTSDSQFIR
FT                   SHMQEAKWFIKSVESRNDTLLKVSNCIVQQQMGFFEHGPEMMKPMVLNDVAEMVDMHES
FT                   TISRVTTQKYMHTPRGIFELKYFFSSHVATETGGECSSTAIRALIKKLVAAEKPSKPLS
FT                   DSKIAQLLADQGIMVARRTIAKYRESLMIPPSNQRKSLL"
FT   gene            657297..657584
FT                   /locus_tag="Patl_0569"
FT   CDS_pept        657297..657584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0569"
FT                   /product="SSU ribosomal protein S30P"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   ilo:IL0395 S30EA ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39098"
FT                   /db_xref="GOA:Q15YE0"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YE0"
FT                   /protein_id="ABG39098.1"
FT                   /translation="MQINITGHHVDVTDSLKDYVDTKFTKLERHFDQINNVHVILNVEK
FT                   LNQKAEATIHLNGADVFATMEHNDMYAAIDGLIDKLDRQVIKHKEKAKRH"
FT   gene            657600..658043
FT                   /locus_tag="Patl_0570"
FT   CDS_pept        657600..658043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0570"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /note="TIGRFAM: PTS IIA-like nitrogen-regulatory protein
FT                   PtsN; PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2; KEGG: vfi:VF0385
FT                   nitrogen regulatory IIA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39099"
FT                   /db_xref="GOA:Q15YD9"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YD9"
FT                   /protein_id="ABG39099.1"
FT                   /translation="MEISNILHPDCVVCAVQGSSKKRILELISQLASEHLVEVDQATIL
FT                   SSLAGREKMGCTGIGGGIALPHGRIKGLESALGVLVTCQPPVQYDAIDNMPVDIFFAIL
FT                   VPEEKAQEHLQTLSAIAKKFVDKDILNRLRSATTDQELFQVLS"
FT   gene            658046..658891
FT                   /locus_tag="Patl_0571"
FT   CDS_pept        658046..658891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0571"
FT                   /product="Uncharacterized P-loop ATPase protein UPF0042"
FT                   /note="PFAM: Uncharacterised P-loop ATPase protein UPF0042;
FT                   KEGG: cps:CPS_4546 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39100"
FT                   /db_xref="GOA:Q15YD8"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YD8"
FT                   /protein_id="ABG39100.1"
FT                   /translation="MKLIIISGRSGSGKSIVLRSLEDLGYYCVDNIPVNLLPTLTHTVA
FT                   DEYDQVAVSIDVRNLPKDPNELVEILDYLPSTWEMTILYLDASDDVLIKRFSETRRLHP
FT                   LSKQNKSLSGAIQAESQLLAPIAERADLYIDTDQLSIHQLAELVRERILGKKSSRLVLV
FT                   FESFGFKHGIPKDADYVFDARFLPNPHWEPDLKPLTGLDSPVEIFLGSQPIVTKFIWQI
FT                   QNLISTWLPHLERNNRSYVTIAIGCTGGQHRSVYVVEMLAKTFSTSHPDVQIRHRELNR
FT                   "
FT   gene            658888..659166
FT                   /locus_tag="Patl_0572"
FT   CDS_pept        658888..659166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0572"
FT                   /product="HPr-like nitrogen-regulatory protein NPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; KEGG: pha:PSHAa2555
FT                   phosphocarrier protein NPr (HPr-like), nitrogen-related"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39101"
FT                   /db_xref="GOA:Q15YD7"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YD7"
FT                   /protein_id="ABG39101.1"
FT                   /translation="MSERLEKTLLIVNKLGLHARAATQLVKLANQFEAEVTIVQDDKSA
FT                   SASSVLGLMMLESCQGKEIQVISEGKDARQAMDAVEELIVGKFNESE"
FT   gene            complement(659267..660037)
FT                   /locus_tag="Patl_0573"
FT   CDS_pept        complement(659267..660037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0573"
FT                   /product="endonuclease"
FT                   /EC_number="3.1.30.2"
FT                   /note="PFAM: DNA/RNA non-specific endonuclease; KEGG:
FT                   stm:STM1330 putative DNA/RNA non-specific endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39102"
FT                   /db_xref="GOA:Q15YD6"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR018524"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="InterPro:IPR040255"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YD6"
FT                   /protein_id="ABG39102.1"
FT                   /translation="MKSYFVLILAFVCNAGYANVCSSLGCPTGAPDSNDLLERAIYTIS
FT                   NNQQTKFADWAAYKVTMQTIDGPSRSRSWRSDPNLKREHTLEAADYKDAHALIRTDRGH
FT                   QVPLASVSNTADWRSTNYLSNITPQSSNLNQGPWVRLESAVRVLARSGESVYVVTGPLY
FT                   ESFFATLPGADESHTIPSGYFKIVATINQAGYVRASAYVMEQNSARADDYCSKEVTIDN
FT                   VESRSGLNIFPEMKGSKEYAVEARLGGLSSQLGC"
FT   sig_peptide     complement(659975..660037)
FT                   /locus_tag="Patl_0573"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.922) with cleavage site probability 0.824 at
FT                   residue 21"
FT   gene            complement(660173..661012)
FT                   /locus_tag="Patl_0574"
FT   CDS_pept        complement(660173..661012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0574"
FT                   /product="ApbE-like lipoprotein"
FT                   /note="PFAM: ApbE-like lipoprotein; KEGG: cps:CPS_2787 ApbE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39103"
FT                   /db_xref="GOA:Q15YD5"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YD5"
FT                   /protein_id="ABG39103.1"
FT                   /translation="MASPCELLIETPNQLLANRLLQEVVLQTKRIEQKYSRYIVGNLVH
FT                   QINNSHGKWVDIDQETHRLLAFGQTCFELSDGMFDLTSGVLRKIWDFTGKGQFPRSEHV
FT                   SEVLQYIGWQNVQFTQQQIRLPRGFELDFGGIGKEYAVDSAAKLCMQLAPDTSVLVNFG
FT                   GDIQVTQPRHHEAYWQVGIERPHVKGDSAKSALVKIASGGLATSGDTRRFIVHNGVRYS
FT                   HILSPKTGYPVSGAPRSVTVATDFCIQSGMLATMALLQGTEAEHFLQAQQQKHWCYW"
FT   gene            complement(661158..662456)
FT                   /locus_tag="Patl_0575"
FT   CDS_pept        complement(661158..662456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0575"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_2788 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39104"
FT                   /db_xref="InterPro:IPR021953"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YD4"
FT                   /protein_id="ABG39104.1"
FT                   /translation="MQLTKNNNISVSLAAAACALLNSGVQAQENTQASEWQFDTAILYY
FT                   GETDRVQLGEGVFNANKDFGDEHIFNGKIAIDTLTGASASGAVAQQGVQTFTRPSGNGQ
FT                   YVVNAGETPLDDTFKDTRVQLSAQWTQPLWENITGSTGVHLSKEYDYLSLGVNGSLARD
FT                   FNQKNTTLSAGVSYQYDSIDPVGEAPIGFSTMVVNNGQFSDESAFETAFNATRTADSKD
FT                   KNTVDLLLSVTQVINRRMLMQFNYSYSVADGYLTDPYKLLSVINTEGVTQDILHENRPD
FT                   KRTKQSVYWQTKYASDYGIADVSYRYATDDWDIDSHTLDSRFRVKLTDNSYIQPHFRYY
FT                   QQSAADFYQPFLLAGSLLPSVASADYRLGEMTAYTIGLKYGQALDNGREWAVRLEYYQQ
FT                   SPKNAGFDGPGALQGLDLYPSIDAIIAQVSYSF"
FT   sig_peptide     complement(662373..662456)
FT                   /locus_tag="Patl_0575"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            complement(662447..662686)
FT                   /locus_tag="Patl_0576"
FT   CDS_pept        complement(662447..662686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0576"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: cps:CPS_2789 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39105"
FT                   /db_xref="InterPro:IPR025362"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YD3"
FT                   /protein_id="ABG39105.1"
FT                   /translation="MLIQLTKKRLILAATLVASFTLNGCADLGVKPWQRDLLAKDEMAL
FT                   DAEGIDIGLDDHIYFSKEATSGGRSFAGGGCGCN"
FT   sig_peptide     complement(662606..662686)
FT                   /locus_tag="Patl_0576"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.569 at
FT                   residue 27"
FT   gene            complement(662691..663209)
FT                   /locus_tag="Patl_0577"
FT   CDS_pept        complement(662691..663209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0577"
FT                   /product="Redoxin"
FT                   /note="PFAM: Redoxin; KEGG: son:SO2100 thioredoxin family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39106"
FT                   /db_xref="GOA:Q15YD2"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YD2"
FT                   /protein_id="ABG39106.1"
FT                   /translation="MVNALSLFYRLNMRNFISIFVLYLTCYSSSGYATVAPDFSYMTRS
FT                   GAVHLSDLKGKVVYVDFWASWCKPCRQSFPWMNDMQHKYAEQGLVVVAVNLDTEPQLVT
FT                   AFLQKIPANFPIVLDPEAEIAQRYDLIGMPSSYLVARDGSIRFSHKGFFNAKASAYEQQ
FT                   LVTLLQETE"
FT   sig_peptide     complement(663108..663209)
FT                   /locus_tag="Patl_0577"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.799 at
FT                   residue 34"
FT   gene            663416..664537
FT                   /locus_tag="Patl_0578"
FT   CDS_pept        663416..664537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0578"
FT                   /product="peptidase M28"
FT                   /note="PFAM: peptidase M28 Nicastrin; KEGG: hch:HCH_01980
FT                   predicted aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39107"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YD1"
FT                   /protein_id="ABG39107.1"
FT                   /translation="MKPLLYFALCALFASSSSLLVHAAPLSTEDSAPNTLIGTGALTHI
FT                   IALADDKKGIGARPAGSKQEHQAAQYIFQQLQRVGLKAEQQTFAIEVNEKQATSINISA
FT                   VIPGKSKKRIVIGAHFDSTGVEQGSLGATDNASGVAVLLAVSEQLVQMKALPYSVQVVF
FT                   FGSEEIGKLGSNYFVRAMPKAELNNIIAMLNLDTVIGGDVLYVHSSSPTDFSCKKIENA
FT                   KLNTSGVFRDALLAYGASQPSLPARFELHEDSEVFAAGQTGDWSDHQAFACNNIPIAYI
FT                   EATNMDINGRGGKDGYSQSIEAQFWTCYSGKKIGSCDPDNEKKWGEIWHTQFDRLDRLS
FT                   PVFNTRMMEQLKANITLIVGALNDPNTMAKLGK"
FT   sig_peptide     663416..663487
FT                   /locus_tag="Patl_0578"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            complement(664628..665203)
FT                   /locus_tag="Patl_0579"
FT   CDS_pept        complement(664628..665203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0579"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: Helix-turn-helix, type 11; KEGG: pha:PSHAb0510
FT                   putative transcriptional regulator ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39108"
FT                   /db_xref="GOA:Q15YD0"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026282"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YD0"
FT                   /protein_id="ABG39108.1"
FT                   /translation="MQMTPMIESFVMHFGEMGSRWGFNRTVGQMYALLVISETPLSANQ
FT                   IAEALSVSRGNVSMGLKELQSWQLIKQHHIPGDRKEYYQGAGTIWEMANRVFEERRKRE
FT                   MDPTLTLLRGIMLETPENKEEIYAQQRLQEIHDLLETISKWTSELQQMNPDTLGTLMKL
FT                   GSGVGKVIDMKNKLMKTNKTPEKKPNKE"
FT   gene            665706..666269
FT                   /locus_tag="Patl_0580"
FT   CDS_pept        665706..666269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0580"
FT                   /product="Lipocalin-like protein"
FT                   /note="PFAM: Lipocalin-like; KEGG: cps:CPS_2173 lipoprotein
FT                   Blc"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39109"
FT                   /db_xref="GOA:Q15YC9"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YC9"
FT                   /protein_id="ABG39109.1"
FT                   /translation="MQLKSSLLTFFRGLPKSGYRLAILLFVVLLNACTSLPEGIKPVKD
FT                   FELQRYLGKWYEIARHDHSFERGLEQVTAQYSMRDDGGVKVINRGFNPEEQEWDEAIGK
FT                   AYFVGEQNTGHLKVSFFGPFYASYVIFSLDIDDYGYAMITGPNRDYFWILARQPELEDD
FT                   VLQRLLTKARDAGFDTEKLIFVNQ"
FT   gene            666360..666881
FT                   /locus_tag="Patl_0581"
FT   CDS_pept        666360..666881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_0796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39110"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YC8"
FT                   /protein_id="ABG39110.1"
FT                   /translation="MFSDNQALNSHLETVEQAKTFLKHISDHAYQDVMAPHVVSSAGAH
FT                   MRHVIDHYLALKQGIEKGVVDYNLRHRESDVAHSTASALQAWNRIEHWLFDVYQSDMHA
FT                   KLTVLSETSVKQTYVNEVNSTLGRELAFVSSHAIHHFSLLAIIASLQGQTTHALFGVAP
FT                   STATYQRAQA"
FT   gene            667007..667345
FT                   /locus_tag="Patl_0582"
FT   CDS_pept        667007..667345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0582"
FT                   /product="alkylphosphonate utilization operon protein PhnA"
FT                   /note="TIGRFAM: alkylphosphonate utilization operon protein
FT                   PhnA; PFAM: PhnA protein; KEGG: bcz:pE33L466_0444
FT                   alkylphosphonate uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39111"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YC7"
FT                   /protein_id="ABG39111.1"
FT                   /translation="MSGLPNCTACNSEYTYEDGNMYVCPECGHEWAQGEDASEDDTPVI
FT                   RDSNGNTLVDGDTVTVIKDLKVKGSSLVVKVGTKVKNIRLVDGDHDIDCKIDGVGAMKL
FT                   KSEFVKKV"
FT   gene            complement(667442..669196)
FT                   /locus_tag="Patl_0583"
FT   CDS_pept        complement(667442..669196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0583"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   cps:CPS_0797 putative hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39112"
FT                   /db_xref="GOA:Q15YC6"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YC6"
FT                   /protein_id="ABG39112.1"
FT                   /translation="MTTAITLLNLVPQEKQTAILTGVMGLLDKLLAIHRLDHLYREHHL
FT                   TGLNKEAFAKALLEALNVTVEGTDVLQKKVPQNGPLVIASNHPFGGIEGVILAYVIGQI
FT                   RPDLKVLANQGLALFTELKDYFIFTNPLSERDPKNAPSLRESLRHVKQGGALLIFPAGR
FT                   VSYYQADKKRISEHQWNRIVANLVTRTGAQYLALFVSGENSPLFYHLGRVYYRLRMLML
FT                   PRELLNKRDTSIKISAATCVPANAFAANTDDIELSALQRIQSYTQDPTWRHTWPASNVV
FT                   AMQPLISQVPGSVINTELAQLDESQTLLSYRNLDVYYAYYEQIPQTVKEIARLRELVFR
FT                   EHDEGSGNSLDTDDFDKTYTHLFIVERDLGRIIGAYRMGQSDRLLANASLNIDPFYLSA
FT                   MFNFSADFINRQAPCLEMGRSFLIPEYQNSFQGLLLLWRGIGRFVCQFPQYRTLYGTVS
FT                   LSKLYDPRSVSLIEHALVTPTRNATARTQLGFSVPPEIADFAKQYPLKKHLTSLLAGIE
FT                   SDGKDVPILLKHYQKLGAKFHCLGIDSNFNHTPGLLLSVELAKAPEKLGRLYLGDGWKA
FT                   YKCHQENQ"
FT   gene            669385..670419
FT                   /locus_tag="Patl_0584"
FT   CDS_pept        669385..670419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0584"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="KEGG: pst:PSPTO4157 dihydroorotase, homodimeric
FT                   type; TIGRFAM: dihydroorotase, homodimeric type; PFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39113"
FT                   /db_xref="GOA:Q15YC5"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15YC5"
FT                   /protein_id="ABG39113.1"
FT                   /translation="MQQITLTQPDDWHLHFRDNDMLLETVPATARTFKRAIVMPNLVPP
FT                   VVNAELASAYRDRILAARPQGSEFEPLMTLFLTNTTSIDDIRAAKKAGVVAAKLYPAGA
FT                   TTNSDAAVKGIEALFPVFAEMAEQGMLLLIHGEVTESHVDIFDREKLFIEQFLVKIVNQ
FT                   FPQLKVVLEHITTSDAVDFVSASSHNVAATITPQHLLLNRNDLLVGGVRPHNFCLPVLK
FT                   RSTHQQALRKAVATGSSKFFLGTDSAPHEKSAKESACGCAGCYSAWSALELYAQVFEEL
FT                   DALDKLEGFASHHGADFYGLPRNTKQVTLVKEEWTIPEVITLPNGEPIVPFFAGQTVNW
FT                   ALKA"
FT   gene            670419..671243
FT                   /locus_tag="Patl_0585"
FT   CDS_pept        670419..671243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0585"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="KEGG: bba:Bd2855 putative ABC amino acid transporter
FT                   solute binding protein; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39114"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YC4"
FT                   /protein_id="ABG39114.1"
FT                   /translation="MHIRRALITAWLGFMLIPALCGKALAQESTSEPAFWVLTSLEPPF
FT                   SLRNDKGQLEGYLIEVVSGILAEANIEQEILAAPWGRLIQEAQSKPNVLMFPLARTPDR
FT                   ENDYHWILPLTSNIYGVLGATEDKKFVKRKEDLNKVSPIGVLKNDFRHKVLLDQNIEGV
FT                   MPFDDYDAAVSELLSGKLSSLFFSDAGLRYFCFKQGADCSHFTLLYEYQTLTSYIALSK
FT                   GTDAQHIGKLKTAAAHFLRGAKFKEIQQRWLMKLRSQGPFKLHIDHGVLNLW"
FT   sig_peptide     670419..670499
FT                   /locus_tag="Patl_0585"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            671295..672158
FT                   /locus_tag="Patl_0586"
FT   CDS_pept        671295..672158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0586"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="KEGG: hch:HCH_05423 ABC-type amino acid
FT                   transport/signal transduction systems, periplasmic
FT                   component/domain; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39115"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YC3"
FT                   /protein_id="ABG39115.1"
FT                   /translation="MIAPTPTYYYTNNIMIFQPTNRGFLLCTGAYAVFRNLTLILSLCC
FT                   LFHQKVSAQSNHEELALAVIYAEGPPFYVFDENTQRSSGLFIDILQHLAQSLDRDLRYL
FT                   PTARNKIEQDVLEQKADVAFLAPKWLDSPEKLLFSDPVFSYQHAFYGLNAPQEDDKLAD
FT                   TVHGKSVCLRENYRYPELDPWLKNGMLSPVYVSSHSRLFDMLQLARCDLIYTNTYRARW
FT                   TLNANHYDKAVFQLGTMGLTDEIMLAFSPRWTDKIPQVNAIIEQMRQSGEIQDVIDKNL
FT                   NQQRAE"
FT   gene            672223..672912
FT                   /locus_tag="Patl_0587"
FT   CDS_pept        672223..672912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0587"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   pae:PA1748 probable enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABG39116"
FT                   /db_xref="GOA:Q15YC2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q15YC2"
FT                   /protein_id="ABG39116.1"
FT                   /translation="MTELVQYQCENNVATITLNNGKVNAFSHAMIDQLNGALDKASADE
FT                   AVVVIKGQPGMFSAGYDLSVMQESMEAAMKLVEKGSTLTRRMLSFEYPIIAACTGHAVA
FT                   KGAFVLLASDYRIGIQGKFKIGLNEVAIGMTMHQAGLELARGRLAPVFFNRSVILAEMV
FT                   SVDDAVTAGFLDVAVAPDAFEQTVAATAQAMTKLNMKAHKQTKLKARAGLLDALDRAIE
FT                   VDRGSSL"
FT   gene            672941..674320
FT                   /locus_tag="Patl_0588"
FT   CDS_pept        672941..674320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Patl_0588"
FT                   /product="ATP-dependent RNA helicase DbpA"
FT                   /EC_number="5.99.1.-"
FT                   /note="PFAM: helicase-like DbpA, RNA-binding DEAD/DEAH box
FT                   helicase-like; KEGG: ypm:YP1617 ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Patl_0588"
FT                   /db_xref="EnsemblGen