(data stored in ACNUC7421 zone)

EMBL: CP000393

ID   CP000393; SV 1; circular; genomic DNA; STD; PRO; 7750108 BP.
AC   CP000393; AABK04000000-AABK04000054;
PR   Project:PRJNA318;
DT   07-JUL-2006 (Rel. 88, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
DE   Trichodesmium erythraeum IMS101, complete genome.
KW   .
OS   Trichodesmium erythraeum IMS101
OC   Bacteria; Cyanobacteria; Oscillatoriophycideae; Oscillatoriales;
OC   Microcoleaceae; Trichodesmium.
RN   [1]
RP   1-7750108
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Kiss H., Munk A.C., Brettin T., Bruce D., Han C., Tapia R., Gilna P.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Kim E.,
RA   Richardson P.;
RT   "Complete sequence of Trichodesmium erythraeum IMS101";
RL   Unpublished.
RN   [2]
RP   1-7750108
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Kiss H., Munk A.C., Brettin T., Bruce D., Han C., Tapia R., Gilna P.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Kim E.,
RA   Richardson P.;
RT   ;
RL   Submitted (21-JUN-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
DR   MD5; e6218dd6983beaaff80cd9cf86a15098.
DR   BioSample; SAMN02598485.
DR   EnsemblGenomes-Gn; EBG00001047855.
DR   EnsemblGenomes-Gn; EBG00001047856.
DR   EnsemblGenomes-Gn; EBG00001047857.
DR   EnsemblGenomes-Gn; EBG00001047858.
DR   EnsemblGenomes-Gn; EBG00001047859.
DR   EnsemblGenomes-Gn; EBG00001047860.
DR   EnsemblGenomes-Gn; EBG00001047861.
DR   EnsemblGenomes-Gn; EBG00001047862.
DR   EnsemblGenomes-Gn; EBG00001047863.
DR   EnsemblGenomes-Gn; EBG00001047864.
DR   EnsemblGenomes-Gn; EBG00001047865.
DR   EnsemblGenomes-Gn; EBG00001047866.
DR   EnsemblGenomes-Gn; EBG00001047867.
DR   EnsemblGenomes-Gn; EBG00001047868.
DR   EnsemblGenomes-Gn; EBG00001047869.
DR   EnsemblGenomes-Gn; EBG00001047870.
DR   EnsemblGenomes-Gn; EBG00001047871.
DR   EnsemblGenomes-Gn; EBG00001047872.
DR   EnsemblGenomes-Gn; EBG00001047873.
DR   EnsemblGenomes-Gn; EBG00001047874.
DR   EnsemblGenomes-Gn; EBG00001047875.
DR   EnsemblGenomes-Gn; EBG00001047876.
DR   EnsemblGenomes-Gn; EBG00001047877.
DR   EnsemblGenomes-Gn; EBG00001047878.
DR   EnsemblGenomes-Gn; EBG00001047879.
DR   EnsemblGenomes-Gn; EBG00001047880.
DR   EnsemblGenomes-Gn; EBG00001047881.
DR   EnsemblGenomes-Gn; EBG00001047882.
DR   EnsemblGenomes-Gn; EBG00001047883.
DR   EnsemblGenomes-Gn; EBG00001047884.
DR   EnsemblGenomes-Gn; EBG00001047885.
DR   EnsemblGenomes-Gn; EBG00001047886.
DR   EnsemblGenomes-Gn; EBG00001047887.
DR   EnsemblGenomes-Gn; EBG00001047888.
DR   EnsemblGenomes-Gn; EBG00001047889.
DR   EnsemblGenomes-Gn; EBG00001047890.
DR   EnsemblGenomes-Gn; EBG00001047891.
DR   EnsemblGenomes-Gn; EBG00001047892.
DR   EnsemblGenomes-Gn; EBG00001047893.
DR   EnsemblGenomes-Gn; EBG00001047894.
DR   EnsemblGenomes-Gn; EBG00001047895.
DR   EnsemblGenomes-Gn; EBG00001047896.
DR   EnsemblGenomes-Gn; EBG00001047897.
DR   EnsemblGenomes-Gn; EBG00001047898.
DR   EnsemblGenomes-Gn; EBG00001047899.
DR   EnsemblGenomes-Gn; EBG00001047900.
DR   EnsemblGenomes-Gn; EBG00001047901.
DR   EnsemblGenomes-Gn; EBG00001047902.
DR   EnsemblGenomes-Gn; EBG00001047903.
DR   EnsemblGenomes-Gn; EBG00001047904.
DR   EnsemblGenomes-Gn; EBG00001047905.
DR   EnsemblGenomes-Gn; EBG00001047906.
DR   EnsemblGenomes-Gn; EBG00001047907.
DR   EnsemblGenomes-Gn; EBG00001047908.
DR   EnsemblGenomes-Gn; EBG00001047909.
DR   EnsemblGenomes-Gn; EBG00001047910.
DR   EnsemblGenomes-Gn; EBG00001047911.
DR   EnsemblGenomes-Gn; EBG00001047912.
DR   EnsemblGenomes-Gn; EBG00001047913.
DR   EnsemblGenomes-Gn; EBG00001047914.
DR   EnsemblGenomes-Gn; EBG00001047915.
DR   EnsemblGenomes-Gn; Tery_R0001.
DR   EnsemblGenomes-Gn; Tery_R0002.
DR   EnsemblGenomes-Gn; Tery_R0003.
DR   EnsemblGenomes-Gn; Tery_R0004.
DR   EnsemblGenomes-Gn; Tery_R0005.
DR   EnsemblGenomes-Gn; Tery_R0006.
DR   EnsemblGenomes-Gn; Tery_R0007.
DR   EnsemblGenomes-Gn; Tery_R0008.
DR   EnsemblGenomes-Gn; Tery_R0009.
DR   EnsemblGenomes-Gn; Tery_R0011.
DR   EnsemblGenomes-Gn; Tery_R0012.
DR   EnsemblGenomes-Gn; Tery_R0013.
DR   EnsemblGenomes-Gn; Tery_R0014.
DR   EnsemblGenomes-Gn; Tery_R0015.
DR   EnsemblGenomes-Gn; Tery_R0016.
DR   EnsemblGenomes-Gn; Tery_R0017.
DR   EnsemblGenomes-Gn; Tery_R0018.
DR   EnsemblGenomes-Gn; Tery_R0019.
DR   EnsemblGenomes-Gn; Tery_R0020.
DR   EnsemblGenomes-Gn; Tery_R0022.
DR   EnsemblGenomes-Gn; Tery_R0024.
DR   EnsemblGenomes-Gn; Tery_R0025.
DR   EnsemblGenomes-Gn; Tery_R0026.
DR   EnsemblGenomes-Gn; Tery_R0027.
DR   EnsemblGenomes-Gn; Tery_R0028.
DR   EnsemblGenomes-Gn; Tery_R0029.
DR   EnsemblGenomes-Gn; Tery_R0030.
DR   EnsemblGenomes-Gn; Tery_R0031.
DR   EnsemblGenomes-Gn; Tery_R0032.
DR   EnsemblGenomes-Gn; Tery_R0033.
DR   EnsemblGenomes-Gn; Tery_R0035.
DR   EnsemblGenomes-Gn; Tery_R0036.
DR   EnsemblGenomes-Gn; Tery_R0037.
DR   EnsemblGenomes-Gn; Tery_R0038.
DR   EnsemblGenomes-Gn; Tery_R0039.
DR   EnsemblGenomes-Gn; Tery_R0040.
DR   EnsemblGenomes-Gn; Tery_R0041.
DR   EnsemblGenomes-Gn; Tery_R0042.
DR   EnsemblGenomes-Gn; Tery_R0043.
DR   EnsemblGenomes-Gn; Tery_R0044.
DR   EnsemblGenomes-Gn; Tery_R0045.
DR   EnsemblGenomes-Gn; Tery_R0046.
DR   EnsemblGenomes-Gn; Tery_R0047.
DR   EnsemblGenomes-Gn; Tery_R0048.
DR   EnsemblGenomes-Tr; EBT00001650389.
DR   EnsemblGenomes-Tr; EBT00001650391.
DR   EnsemblGenomes-Tr; EBT00001650393.
DR   EnsemblGenomes-Tr; EBT00001650395.
DR   EnsemblGenomes-Tr; EBT00001650397.
DR   EnsemblGenomes-Tr; EBT00001650399.
DR   EnsemblGenomes-Tr; EBT00001650400.
DR   EnsemblGenomes-Tr; EBT00001650403.
DR   EnsemblGenomes-Tr; EBT00001650405.
DR   EnsemblGenomes-Tr; EBT00001650407.
DR   EnsemblGenomes-Tr; EBT00001650409.
DR   EnsemblGenomes-Tr; EBT00001650411.
DR   EnsemblGenomes-Tr; EBT00001650413.
DR   EnsemblGenomes-Tr; EBT00001650417.
DR   EnsemblGenomes-Tr; EBT00001650421.
DR   EnsemblGenomes-Tr; EBT00001650424.
DR   EnsemblGenomes-Tr; EBT00001650425.
DR   EnsemblGenomes-Tr; EBT00001650427.
DR   EnsemblGenomes-Tr; EBT00001650429.
DR   EnsemblGenomes-Tr; EBT00001650433.
DR   EnsemblGenomes-Tr; EBT00001650437.
DR   EnsemblGenomes-Tr; EBT00001650440.
DR   EnsemblGenomes-Tr; EBT00001650443.
DR   EnsemblGenomes-Tr; EBT00001650445.
DR   EnsemblGenomes-Tr; EBT00001650453.
DR   EnsemblGenomes-Tr; EBT00001650455.
DR   EnsemblGenomes-Tr; EBT00001650457.
DR   EnsemblGenomes-Tr; EBT00001650459.
DR   EnsemblGenomes-Tr; EBT00001650461.
DR   EnsemblGenomes-Tr; EBT00001650463.
DR   EnsemblGenomes-Tr; EBT00001650465.
DR   EnsemblGenomes-Tr; EBT00001650468.
DR   EnsemblGenomes-Tr; EBT00001650470.
DR   EnsemblGenomes-Tr; EBT00001650472.
DR   EnsemblGenomes-Tr; EBT00001650474.
DR   EnsemblGenomes-Tr; EBT00001650476.
DR   EnsemblGenomes-Tr; EBT00001650478.
DR   EnsemblGenomes-Tr; EBT00001650481.
DR   EnsemblGenomes-Tr; EBT00001650483.
DR   EnsemblGenomes-Tr; EBT00001650486.
DR   EnsemblGenomes-Tr; EBT00001650488.
DR   EnsemblGenomes-Tr; EBT00001650489.
DR   EnsemblGenomes-Tr; EBT00001650491.
DR   EnsemblGenomes-Tr; EBT00001650492.
DR   EnsemblGenomes-Tr; EBT00001650493.
DR   EnsemblGenomes-Tr; EBT00001650495.
DR   EnsemblGenomes-Tr; EBT00001650496.
DR   EnsemblGenomes-Tr; EBT00001650499.
DR   EnsemblGenomes-Tr; EBT00001650501.
DR   EnsemblGenomes-Tr; EBT00001650503.
DR   EnsemblGenomes-Tr; EBT00001650506.
DR   EnsemblGenomes-Tr; EBT00001650508.
DR   EnsemblGenomes-Tr; EBT00001650512.
DR   EnsemblGenomes-Tr; EBT00001650514.
DR   EnsemblGenomes-Tr; EBT00001650515.
DR   EnsemblGenomes-Tr; EBT00001650518.
DR   EnsemblGenomes-Tr; EBT00001650520.
DR   EnsemblGenomes-Tr; EBT00001650523.
DR   EnsemblGenomes-Tr; EBT00001650526.
DR   EnsemblGenomes-Tr; EBT00001650527.
DR   EnsemblGenomes-Tr; EBT00001650531.
DR   EnsemblGenomes-Tr; Tery_R0001-1.
DR   EnsemblGenomes-Tr; Tery_R0002-1.
DR   EnsemblGenomes-Tr; Tery_R0003-1.
DR   EnsemblGenomes-Tr; Tery_R0004-1.
DR   EnsemblGenomes-Tr; Tery_R0005-1.
DR   EnsemblGenomes-Tr; Tery_R0006-1.
DR   EnsemblGenomes-Tr; Tery_R0007-1.
DR   EnsemblGenomes-Tr; Tery_R0008-1.
DR   EnsemblGenomes-Tr; Tery_R0009-1.
DR   EnsemblGenomes-Tr; Tery_R0011-1.
DR   EnsemblGenomes-Tr; Tery_R0012-1.
DR   EnsemblGenomes-Tr; Tery_R0013-1.
DR   EnsemblGenomes-Tr; Tery_R0014-1.
DR   EnsemblGenomes-Tr; Tery_R0015-1.
DR   EnsemblGenomes-Tr; Tery_R0016-1.
DR   EnsemblGenomes-Tr; Tery_R0017-1.
DR   EnsemblGenomes-Tr; Tery_R0018-1.
DR   EnsemblGenomes-Tr; Tery_R0019-1.
DR   EnsemblGenomes-Tr; Tery_R0020-1.
DR   EnsemblGenomes-Tr; Tery_R0022-1.
DR   EnsemblGenomes-Tr; Tery_R0024-1.
DR   EnsemblGenomes-Tr; Tery_R0025-1.
DR   EnsemblGenomes-Tr; Tery_R0026-1.
DR   EnsemblGenomes-Tr; Tery_R0027-1.
DR   EnsemblGenomes-Tr; Tery_R0028-1.
DR   EnsemblGenomes-Tr; Tery_R0029-1.
DR   EnsemblGenomes-Tr; Tery_R0030-1.
DR   EnsemblGenomes-Tr; Tery_R0031-1.
DR   EnsemblGenomes-Tr; Tery_R0032-1.
DR   EnsemblGenomes-Tr; Tery_R0033-1.
DR   EnsemblGenomes-Tr; Tery_R0035-1.
DR   EnsemblGenomes-Tr; Tery_R0036-1.
DR   EnsemblGenomes-Tr; Tery_R0037-1.
DR   EnsemblGenomes-Tr; Tery_R0038-1.
DR   EnsemblGenomes-Tr; Tery_R0039-1.
DR   EnsemblGenomes-Tr; Tery_R0040-1.
DR   EnsemblGenomes-Tr; Tery_R0041-1.
DR   EnsemblGenomes-Tr; Tery_R0042-1.
DR   EnsemblGenomes-Tr; Tery_R0043-1.
DR   EnsemblGenomes-Tr; Tery_R0044-1.
DR   EnsemblGenomes-Tr; Tery_R0045-1.
DR   EnsemblGenomes-Tr; Tery_R0046-1.
DR   EnsemblGenomes-Tr; Tery_R0047-1.
DR   EnsemblGenomes-Tr; Tery_R0048-1.
DR   EuropePMC; PMC2242806; 18045455.
DR   EuropePMC; PMC2442094; 18534010.
DR   EuropePMC; PMC2567498; 18812508.
DR   EuropePMC; PMC2632131; 19047393.
DR   EuropePMC; PMC2813007; 20008171.
DR   EuropePMC; PMC3957732; 24600043.
DR   EuropePMC; PMC4649490; 26577185.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01116; Yfr1.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01419; IsrR.
DR   RFAM; RF01701; Cyano-1.
DR   RFAM; RF01739; glnA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000393.
DR   SILVA-SSU; CP000393.
DR   StrainInfo; 527924; 0.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2662189
CC   Source DNA and bacteria available from John B. Waterbury
CC   (jwaterbury@whoi.edu)
CC   Contacts: John B. Waterbury (jwaterbury@whoi.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376)
CC   Additional Notes: The following regions have an unresolved number
CC   of repeat copies: 2426365-2431895, 3531561-3532440,
CC   4808319-4799188, 5967783-5973981, 7275245-7279260.
FH   Key             Location/Qualifiers
FT   source          1..7750108
FT                   /organism="Trichodesmium erythraeum IMS101"
FT                   /strain="IMS101"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:203124"
FT   gene            27..1397
FT                   /locus_tag="Tery_0001"
FT   CDS_pept        27..1397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: ana:alr2009 chromosomal replication initiator
FT                   protein; TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator, DnaA-like
FT                   Chromosomal replication initiator, DnaA; SMART: ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49531"
FT                   /db_xref="GOA:Q11AE3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q11AE3"
FT                   /protein_id="ABG49531.1"
FT   gene            complement(1489..1689)
FT                   /locus_tag="Tery_0002"
FT   CDS_pept        complement(1489..1689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0002"
FT                   /product="putative transposase gene of IS630 family
FT                   insertion sequence ISY100h"
FT                   /note="KEGG: syn:sll0431 putative transposase gene of IS630
FT                   family insertion sequence ISY100h"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49532"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AE2"
FT                   /protein_id="ABG49532.1"
FT   gene            complement(1729..2070)
FT                   /pseudo
FT                   /locus_tag="Tery_0003"
FT   gene            complement(1995..2393)
FT                   /pseudo
FT                   /locus_tag="Tery_0004"
FT   gene            9021..9395
FT                   /pseudo
FT                   /locus_tag="Tery_0005"
FT   gene            complement(9478..9756)
FT                   /locus_tag="Tery_0006"
FT   CDS_pept        complement(9478..9756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49533"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AE1"
FT                   /protein_id="ABG49533.1"
FT   gene            9983..10273
FT                   /pseudo
FT                   /locus_tag="Tery_0007"
FT   gene            10371..10973
FT                   /locus_tag="Tery_0008"
FT   CDS_pept        10371..10973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0008"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number=""
FT                   /note="PFAM: DNA polymerase III, beta chain; KEGG:
FT                   ava:Ava_0002 DNA polymerase III subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49534"
FT                   /db_xref="GOA:Q11AE0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AE0"
FT                   /protein_id="ABG49534.1"
FT   gene            complement(11269..11829)
FT                   /pseudo
FT                   /locus_tag="Tery_0009"
FT   gene            complement(11838..12341)
FT                   /locus_tag="Tery_0010"
FT   CDS_pept        complement(11838..12341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0010"
FT                   /product="putative transposase"
FT                   /note="KEGG: ava:Ava_C0088 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49535"
FT                   /db_xref="GOA:Q10V81"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q10V81"
FT                   /protein_id="ABG49535.1"
FT                   SHLN"
FT   gene            12895..15912
FT                   /locus_tag="Tery_0011"
FT   CDS_pept        12895..15912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_C0237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49536"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AD8"
FT                   /protein_id="ABG49536.1"
FT                   ALAFLIEVNKVVDVYF"
FT   gene            17126..20872
FT                   /locus_tag="Tery_0012"
FT   CDS_pept        17126..20872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0012"
FT                   /product="helicase-like"
FT                   /note="KEGG: ava:Ava_C0236 helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49537"
FT                   /db_xref="GOA:Q11AD7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AD7"
FT                   /protein_id="ABG49537.1"
FT   gene            complement(21246..22433)
FT                   /locus_tag="Tery_0013"
FT   CDS_pept        complement(21246..22433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0013"
FT                   /product="arsenite-activated ATPase ArsA"
FT                   /EC_number=""
FT                   /note="KEGG: syn:sll0086 arsenical pump-driving ATPase;
FT                   TIGRFAM: arsenite-activated ATPase ArsA; PFAM:
FT                   Anion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49538"
FT                   /db_xref="GOA:Q11AD6"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AD6"
FT                   /protein_id="ABG49538.1"
FT   gene            complement(22680..23072)
FT                   /locus_tag="Tery_0014"
FT   CDS_pept        complement(22680..23072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0014"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49539"
FT                   /db_xref="InterPro:IPR018790"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AD5"
FT                   /protein_id="ABG49539.1"
FT   gene            complement(23799..24329)
FT                   /locus_tag="Tery_0015"
FT   CDS_pept        complement(23799..24329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0015"
FT                   /product="pentapeptide repeat"
FT                   /note="PFAM: pentapeptide repeat; KEGG: ana:all0664 WD-40
FT                   repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49540"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AD4"
FT                   /protein_id="ABG49540.1"
FT                   ANFSKAYMPNVNC"
FT   gene            24612..24890
FT                   /pseudo
FT                   /locus_tag="Tery_0016"
FT   gene            complement(24984..25247)
FT                   /locus_tag="Tery_0017"
FT   CDS_pept        complement(24984..25247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49541"
FT                   /db_xref="GOA:Q11AD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AD3"
FT                   /protein_id="ABG49541.1"
FT   gene            complement(25441..27636)
FT                   /locus_tag="Tery_0018"
FT   CDS_pept        complement(25441..27636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0018"
FT                   /product="Rho termination factor-like"
FT                   /note="PFAM: Rho termination factor-like; KEGG:
FT                   ava:Ava_4273 Rho termination factor-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49542"
FT                   /db_xref="GOA:Q11AD2"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR026737"
FT                   /db_xref="InterPro:IPR032585"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AD2"
FT                   /protein_id="ABG49542.1"
FT   gene            28954..30639
FT                   /locus_tag="Tery_0019"
FT   CDS_pept        28954..30639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0019"
FT                   /product="dihydroxyacid dehydratase"
FT                   /EC_number=""
FT                   /note="KEGG: ava:Ava_0023 dihydroxy-acid dehydratase;
FT                   TIGRFAM: dihydroxy-acid dehydratase; PFAM: dihydroxy-acid
FT                   and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49543"
FT                   /db_xref="GOA:Q11AD1"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q11AD1"
FT                   /protein_id="ABG49543.1"
FT   gene            complement(31434..32471)
FT                   /locus_tag="Tery_0020"
FT   CDS_pept        complement(31434..32471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0020"
FT                   /product="transposase"
FT                   /note="KEGG: ana:alr4628 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49544"
FT                   /db_xref="GOA:Q11AD0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AD0"
FT                   /protein_id="ABG49544.1"
FT                   LPQPT"
FT   gene            33065..35353
FT                   /locus_tag="Tery_0021"
FT   CDS_pept        33065..35353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0021"
FT                   /product="FHA modulated glycosyl
FT                   transferase/transpeptidase"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: Forkhead-associated glycosyl transferase, family 51
FT                   penicillin-binding protein, transpeptidase; KEGG:
FT                   ana:alr4579 penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49545"
FT                   /db_xref="GOA:Q11AC9"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AC9"
FT                   /protein_id="ABG49545.1"
FT                   NYMKKVVNK"
FT   gene            36830..38158
FT                   /locus_tag="Tery_0022"
FT   CDS_pept        36830..38158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0022"
FT                   /product="Tetratricopeptide TPR_2"
FT                   /note="PFAM: TPR repeat Tetratricopeptide TPR_2; SMART:
FT                   Tetratricopeptide region; KEGG: lpp:lpp2549 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49546"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040632"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AC8"
FT                   /protein_id="ABG49546.1"
FT   gene            39907..40488
FT                   /locus_tag="Tery_0023"
FT   CDS_pept        39907..40488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0023"
FT                   /product="Tetratricopeptide TPR_2"
FT                   /note="PFAM: TPR repeat Tetratricopeptide TPR_2; SMART:
FT                   Tetratricopeptide region; KEGG: pmt:PMT1811 TPR repeat:HAT
FT                   (Half-A-TPR) repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49547"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AC7"
FT                   /protein_id="ABG49547.1"
FT   gene            40836..41411
FT                   /locus_tag="Tery_0024"
FT   CDS_pept        40836..41411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49548"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AC6"
FT                   /protein_id="ABG49548.1"
FT   gene            41475..41900
FT                   /locus_tag="Tery_0025"
FT   CDS_pept        41475..41900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49549"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AC5"
FT                   /protein_id="ABG49549.1"
FT   gene            43293..43841
FT                   /pseudo
FT                   /locus_tag="Tery_0026"
FT   gene            complement(45501..48125)
FT                   /locus_tag="Tery_0027"
FT   CDS_pept        complement(45501..48125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0027"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number=""
FT                   /note="KEGG: ava:Ava_0030 DNA topoisomerase I; TIGRFAM: DNA
FT                   topoisomerase I; PFAM: TOPRIM domain containing protein DNA
FT                   topoisomerase, type IA, central; SMART: DNA topoisomerase,
FT                   type IA, domain 2 DNA topoisomerase, type IA, DNA-binding
FT                   Toprim subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49550"
FT                   /db_xref="GOA:Q11AC4"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AC4"
FT                   /protein_id="ABG49550.1"
FT                   ENN"
FT   gene            48918..49433
FT                   /locus_tag="Tery_0028"
FT   CDS_pept        48918..49433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49551"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AC3"
FT                   /protein_id="ABG49551.1"
FT                   RARSKEKK"
FT   gene            complement(51305..51757)
FT                   /pseudo
FT                   /locus_tag="Tery_0029"
FT   gene            53747..54048
FT                   /pseudo
FT                   /locus_tag="Tery_0030"
FT   gene            54556..55059
FT                   /locus_tag="Tery_0031"
FT   CDS_pept        54556..55059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0031"
FT                   /product="putative transposase"
FT                   /note="KEGG: ava:Ava_C0088 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49552"
FT                   /db_xref="GOA:Q10V81"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q10V81"
FT                   /protein_id="ABG49552.1"
FT                   SHLN"
FT   gene            55038..55628
FT                   /pseudo
FT                   /locus_tag="Tery_0032"
FT   gene            55816..56544
FT                   /locus_tag="Tery_0033"
FT   CDS_pept        55816..56544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0033"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   ava:Ava_0806 protein of unknown function DUF477"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49553"
FT                   /db_xref="GOA:Q11AC1"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AC1"
FT                   /protein_id="ABG49553.1"
FT   sig_peptide     55816..55926
FT                   /locus_tag="Tery_0033"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.491 at
FT                   residue 37"
FT   gene            complement(56599..56982)
FT                   /locus_tag="Tery_0034"
FT   CDS_pept        complement(56599..56982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0034"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all4101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49554"
FT                   /db_xref="InterPro:IPR017260"
FT                   /db_xref="InterPro:IPR025595"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AC0"
FT                   /protein_id="ABG49554.1"
FT   gene            complement(57894..58106)
FT                   /locus_tag="Tery_0035"
FT   CDS_pept        complement(57894..58106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49555"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AB9"
FT                   /protein_id="ABG49555.1"
FT   gene            58663..58878
FT                   /pseudo
FT                   /locus_tag="Tery_0036"
FT   gene            59088..59294
FT                   /locus_tag="Tery_0037"
FT   CDS_pept        59088..59294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0037"
FT                   /product="putative transposase gene of IS630 family
FT                   insertion sequence ISY100h"
FT                   /note="KEGG: syn:sll0431 putative transposase gene of IS630
FT                   family insertion sequence ISY100h"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49556"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AB8"
FT                   /protein_id="ABG49556.1"
FT   gene            complement(59260..59850)
FT                   /pseudo
FT                   /locus_tag="Tery_0038"
FT   gene            complement(59829..60332)
FT                   /locus_tag="Tery_0039"
FT   CDS_pept        complement(59829..60332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0039"
FT                   /product="putative transposase"
FT                   /note="KEGG: ava:Ava_C0088 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49557"
FT                   /db_xref="GOA:Q10V81"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q10V81"
FT                   /protein_id="ABG49557.1"
FT                   SHLN"
FT   gene            complement(63117..63416)
FT                   /locus_tag="Tery_0040"
FT   CDS_pept        complement(63117..63416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all0403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49558"
FT                   /db_xref="InterPro:IPR018664"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AB6"
FT                   /protein_id="ABG49558.1"
FT   gene            64428..64763
FT                   /locus_tag="Tery_0041"
FT   CDS_pept        64428..64763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr3811 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49559"
FT                   /db_xref="InterPro:IPR008479"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AB5"
FT                   /protein_id="ABG49559.1"
FT                   FTNDKNE"
FT   gene            complement(65393..65835)
FT                   /pseudo
FT                   /locus_tag="Tery_0042"
FT   gene            complement(66565..67806)
FT                   /locus_tag="Tery_0043"
FT   CDS_pept        complement(66565..67806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0043"
FT                   /product="glutamate N-acetyltransferase / N-acetylglutamate
FT                   synthase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="KEGG: ana:alr2073 glutamate N-acetyltransferase;
FT                   TIGRFAM: arginine biosynthesis bifunctional protein ArgJ;
FT                   PFAM: arginine biosynthesis protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49560"
FT                   /db_xref="GOA:Q11AB4"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AB4"
FT                   /protein_id="ABG49560.1"
FT                   LSYDYVKINAEYTT"
FT   gene            complement(68207..68550)
FT                   /pseudo
FT                   /locus_tag="Tery_0044"
FT   gene            complement(68747..70330)
FT                   /locus_tag="Tery_0045"
FT   CDS_pept        complement(68747..70330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0045"
FT                   /product="glycoside hydrolase, family 57"
FT                   /note="PFAM: glycoside hydrolase, family 57; KEGG:
FT                   ava:Ava_0382 glycoside hydrolase, family 57"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49561"
FT                   /db_xref="GOA:Q11AB3"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR015293"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037090"
FT                   /db_xref="InterPro:IPR040042"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AB3"
FT                   /protein_id="ABG49561.1"
FT                   FPQVNYRVYR"
FT   gene            71135..71347
FT                   /locus_tag="Tery_0046"
FT   CDS_pept        71135..71347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49562"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AB2"
FT                   /protein_id="ABG49562.1"
FT   gene            71367..72836
FT                   /locus_tag="Tery_0047"
FT   CDS_pept        71367..72836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0047"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rru:Rru_A3262 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49563"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AB1"
FT                   /protein_id="ABG49563.1"
FT   gene            complement(72933..73421)
FT                   /pseudo
FT                   /locus_tag="Tery_0048"
FT   gene            complement(73445..73846)
FT                   /locus_tag="Tery_0049"
FT   CDS_pept        complement(73445..73846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_C0173 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49564"
FT                   /db_xref="InterPro:IPR027805"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AB0"
FT                   /protein_id="ABG49564.1"
FT   gene            73849..74169
FT                   /locus_tag="Tery_0050"
FT   CDS_pept        73849..74169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49565"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AA9"
FT                   /protein_id="ABG49565.1"
FT                   PI"
FT   gene            74354..74533
FT                   /locus_tag="Tery_0051"
FT   CDS_pept        74354..74533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49566"
FT                   /db_xref="UniProtKB/TrEMBL:Q10VF2"
FT                   /protein_id="ABG49566.1"
FT                   YISNETKELIDKLK"
FT   gene            complement(74658..75248)
FT                   /pseudo
FT                   /locus_tag="Tery_0052"
FT   gene            complement(75227..75730)
FT                   /locus_tag="Tery_0053"
FT   CDS_pept        complement(75227..75730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0053"
FT                   /product="putative transposase"
FT                   /note="KEGG: ava:Ava_C0088 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49567"
FT                   /db_xref="GOA:Q10V81"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q10V81"
FT                   /protein_id="ABG49567.1"
FT                   SHLN"
FT   gene            76285..76875
FT                   /locus_tag="Tery_0054"
FT   CDS_pept        76285..76875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0054"
FT                   /product="putative signal transduction protein with Nacht
FT                   domain"
FT                   /note="KEGG: ana:alr9015 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49568"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AA6"
FT                   /protein_id="ABG49568.1"
FT   gene            76940..77529
FT                   /pseudo
FT                   /locus_tag="Tery_0055"
FT   gene            77526..78212
FT                   /locus_tag="Tery_0056"
FT   CDS_pept        77526..78212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A2511 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49569"
FT                   /db_xref="GOA:Q10VB9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:Q10VB9"
FT                   /protein_id="ABG49569.1"
FT                   LGFVWA"
FT   gene            78349..81126
FT                   /locus_tag="Tery_0057"
FT   CDS_pept        78349..81126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0057"
FT                   /product="HEAT domain containing protein"
FT                   /note="PFAM: HEAT domain containing protein; KEGG:
FT                   pfa:PF11_0486 MAEBL, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49570"
FT                   /db_xref="GOA:Q11AA4"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AA4"
FT                   /protein_id="ABG49570.1"
FT   gene            complement(81365..81982)
FT                   /locus_tag="Tery_0058"
FT   CDS_pept        complement(81365..81982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0058"
FT                   /product="pentapeptide repeat"
FT                   /note="PFAM: pentapeptide repeat; KEGG: mba:Mbar_A0710
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49571"
FT                   /db_xref="GOA:Q11AA3"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AA3"
FT                   /protein_id="ABG49571.1"
FT   sig_peptide     complement(81797..81982)
FT                   /locus_tag="Tery_0058"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.808) with cleavage site probability 0.555 at
FT                   residue 62"
FT   gene            complement(82492..84570)
FT                   /locus_tag="Tery_0059"
FT   CDS_pept        complement(82492..84570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0059"
FT                   /product="serine/threonine protein kinase with WD40
FT                   repeats"
FT                   /note="PFAM: protein kinase WD-40 repeat; SMART:
FT                   Serine/threonine protein kinase; KEGG: ava:Ava_2851
FT                   serine/threonine protein kinase with WD40 repeats"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49572"
FT                   /db_xref="GOA:Q11AA2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AA2"
FT                   /protein_id="ABG49572.1"
FT   gene            84932..85924
FT                   /locus_tag="Tery_0060"
FT   CDS_pept        84932..85924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0060"
FT                   /product="oxidoreductase, molybdopterin binding"
FT                   /note="PFAM: oxidoreductase, molybdopterin binding; KEGG:
FT                   cyb:CYB_1827 oxidoreductase molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49573"
FT                   /db_xref="GOA:Q11AA1"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AA1"
FT                   /protein_id="ABG49573.1"
FT   gene            87142..87384
FT                   /pseudo
FT                   /locus_tag="Tery_0061"
FT   gene            complement(87868..88340)
FT                   /pseudo
FT                   /locus_tag="Tery_0062"
FT   gene            complement(88341..88580)
FT                   /pseudo
FT                   /locus_tag="Tery_0063"
FT   gene            complement(90562..90864)
FT                   /locus_tag="Tery_0064"
FT   CDS_pept        complement(90562..90864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0064"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gvi:gll2563 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49574"
FT                   /db_xref="GOA:Q11AA0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q11AA0"
FT                   /protein_id="ABG49574.1"
FT   gene            complement(92566..92754)
FT                   /locus_tag="Tery_0065"
FT   CDS_pept        complement(92566..92754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0065"
FT                   /product="transposase"
FT                   /note="KEGG: ava:Ava_2371 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49575"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A99"
FT                   /protein_id="ABG49575.1"
FT                   YVGEPAIKTPKKKAPIQ"
FT   gene            complement(92879..93088)
FT                   /locus_tag="Tery_0066"
FT   CDS_pept        complement(92879..93088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49576"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A98"
FT                   /protein_id="ABG49576.1"
FT   gene            93274..93909
FT                   /pseudo
FT                   /locus_tag="Tery_0067"
FT   gene            94221..94430
FT                   /locus_tag="Tery_0068"
FT   CDS_pept        94221..94430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0068"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: syf:Synpcc7942_1822 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49577"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A97"
FT                   /protein_id="ABG49577.1"
FT   gene            94683..96173
FT                   /locus_tag="Tery_0069"
FT   CDS_pept        94683..96173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0069"
FT                   /product="leucyl aminopeptidase. Metallo peptidase. MEROPS
FT                   family M17"
FT                   /EC_number=""
FT                   /note="PFAM: peptidase M17, leucyl aminopeptidase-like;
FT                   KEGG: ava:Ava_2727 leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49578"
FT                   /db_xref="GOA:Q11A96"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q11A96"
FT                   /protein_id="ABG49578.1"
FT   gene            complement(96964..97182)
FT                   /locus_tag="Tery_0070"
FT   CDS_pept        complement(96964..97182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0070"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:alr5158 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49579"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A95"
FT                   /protein_id="ABG49579.1"
FT   gene            98280..99698
FT                   /locus_tag="Tery_0071"
FT   CDS_pept        98280..99698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0071"
FT                   /product="isocitrate dehydrogenase (NADP)"
FT                   /EC_number=""
FT                   /note="TIGRFAM: isocitrate dehydrogenase, NADP-dependent;
FT                   PFAM: isocitrate/isopropylmalate dehydrogenase; KEGG:
FT                   ana:alr1827 isocitrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49580"
FT                   /db_xref="GOA:Q11A94"
FT                   /db_xref="InterPro:IPR004439"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A94"
FT                   /protein_id="ABG49580.1"
FT                   LKCSEFADAIIKHF"
FT   gene            100518..101846
FT                   /locus_tag="Tery_0072"
FT   CDS_pept        100518..101846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0072"
FT                   /product="PBS lyase HEAT-like repeat"
FT                   /note="PFAM: HEAT domain containing protein PBS lyase
FT                   HEAT-like repeat; KEGG: ana:all0605 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49581"
FT                   /db_xref="GOA:Q11A93"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A93"
FT                   /protein_id="ABG49581.1"
FT   gene            complement(102724..103299)
FT                   /locus_tag="Tery_0073"
FT   CDS_pept        complement(102724..103299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49582"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A92"
FT                   /protein_id="ABG49582.1"
FT   gene            complement(104064..104282)
FT                   /pseudo
FT                   /locus_tag="Tery_0074"
FT   gene            complement(105037..105312)
FT                   /locus_tag="Tery_0075"
FT   CDS_pept        complement(105037..105312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:gll3036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49583"
FT                   /db_xref="GOA:Q11A91"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A91"
FT                   /protein_id="ABG49583.1"
FT   gene            complement(105879..106097)
FT                   /locus_tag="Tery_0076"
FT   CDS_pept        complement(105879..106097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:gll3036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49584"
FT                   /db_xref="GOA:Q11A90"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A90"
FT                   /protein_id="ABG49584.1"
FT   gene            complement(106852..107070)
FT                   /locus_tag="Tery_0077"
FT   CDS_pept        complement(106852..107070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:gll3036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49585"
FT                   /db_xref="GOA:Q11A87"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A87"
FT                   /protein_id="ABG49585.1"
FT   gene            complement(107825..108043)
FT                   /locus_tag="Tery_0078"
FT   CDS_pept        complement(107825..108043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0078"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:gll3036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49586"
FT                   /db_xref="GOA:Q11A87"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A87"
FT                   /protein_id="ABG49586.1"
FT   gene            complement(108798..109016)
FT                   /locus_tag="Tery_0079"
FT   CDS_pept        complement(108798..109016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:gll3036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49587"
FT                   /db_xref="GOA:Q11A87"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A87"
FT                   /protein_id="ABG49587.1"
FT   gene            complement(109771..110394)
FT                   /locus_tag="Tery_0080"
FT   CDS_pept        complement(109771..110394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:gll3036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49588"
FT                   /db_xref="GOA:Q11A86"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A86"
FT                   /protein_id="ABG49588.1"
FT   gene            complement(110607..111539)
FT                   /locus_tag="Tery_0081"
FT   CDS_pept        complement(110607..111539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; PFAM:
FT                   diacylglycerol kinase, catalytic region; KEGG: ana:alr2881
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49589"
FT                   /db_xref="GOA:Q11A85"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A85"
FT                   /protein_id="ABG49589.1"
FT   gene            complement(113289..115082)
FT                   /locus_tag="Tery_0082"
FT   CDS_pept        complement(113289..115082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0082"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: syn:sll1064
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49590"
FT                   /db_xref="GOA:Q11A84"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR039331"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A84"
FT                   /protein_id="ABG49590.1"
FT   gene            complement(115132..115716)
FT                   /pseudo
FT                   /locus_tag="Tery_0083"
FT   gene            complement(115731..115994)
FT                   /locus_tag="Tery_0084"
FT   CDS_pept        complement(115731..115994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49591"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A83"
FT                   /protein_id="ABG49591.1"
FT   gene            116114..116977
FT                   /locus_tag="Tery_0085"
FT   CDS_pept        116114..116977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0085"
FT                   /product="sulfotransferase"
FT                   /note="PFAM: sulfotransferase; KEGG: cel:Y113G7A.11
FT                   Hypothetical protein Y113G7A.11"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49592"
FT                   /db_xref="GOA:Q11A82"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A82"
FT                   /protein_id="ABG49592.1"
FT                   LWQIPE"
FT   gene            complement(118355..119075)
FT                   /pseudo
FT                   /locus_tag="Tery_0086"
FT   gene            119376..121190
FT                   /locus_tag="Tery_0087"
FT   CDS_pept        119376..121190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0087"
FT                   /product="aspartate kinase"
FT                   /EC_number=""
FT                   /note="KEGG: ava:Ava_3642 aspartate kinase; TIGRFAM:
FT                   aspartate kinase aspartate kinase, monofunctional class;
FT                   PFAM: aspartate/glutamate/uridylate kinase amino
FT                   acid-binding ACT"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49593"
FT                   /db_xref="GOA:Q11A81"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A81"
FT                   /protein_id="ABG49593.1"
FT   gene            complement(122033..123379)
FT                   /locus_tag="Tery_0088"
FT   CDS_pept        complement(122033..123379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0088"
FT                   /product="serine/threonine protein kinase with FHA domain"
FT                   /note="PFAM: Forkhead-associated protein kinase; SMART:
FT                   Tyrosine protein kinase Serine/threonine protein kinase;
FT                   KEGG: ana:alr4954 serine/threonine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49594"
FT                   /db_xref="GOA:Q11A80"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A80"
FT                   /protein_id="ABG49594.1"
FT   gene            124516..125490
FT                   /locus_tag="Tery_0089"
FT   CDS_pept        124516..125490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr2712 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49595"
FT                   /db_xref="GOA:Q11A79"
FT                   /db_xref="InterPro:IPR017804"
FT                   /db_xref="InterPro:IPR019257"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035094"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A79"
FT                   /protein_id="ABG49595.1"
FT   gene            125895..127244
FT                   /locus_tag="Tery_0090"
FT   CDS_pept        125895..127244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0090"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   son:SO4465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49596"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR027577"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A78"
FT                   /protein_id="ABG49596.1"
FT   gene            127898..128116
FT                   /locus_tag="Tery_0091"
FT   CDS_pept        127898..128116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49597"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A77"
FT                   /protein_id="ABG49597.1"
FT   gene            128117..128599
FT                   /pseudo
FT                   /locus_tag="Tery_0092"
FT   gene            129597..129836
FT                   /locus_tag="Tery_0093"
FT   CDS_pept        129597..129836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49598"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A76"
FT                   /protein_id="ABG49598.1"
FT   gene            130201..130701
FT                   /locus_tag="Tery_0094"
FT   CDS_pept        130201..130701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0094"
FT                   /product="protein of unknown function DUF427"
FT                   /note="PFAM: protein of unknown function DUF427; KEGG:
FT                   ava:Ava_1190 protein of unknown function DUF427"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49599"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A75"
FT                   /protein_id="ABG49599.1"
FT                   RWW"
FT   gene            130765..131052
FT                   /pseudo
FT                   /locus_tag="Tery_0095"
FT   gene            131093..131992
FT                   /locus_tag="Tery_0096"
FT   CDS_pept        131093..131992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0096"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG: bta:613413
FT                   histamine N-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49600"
FT                   /db_xref="GOA:Q11A74"
FT                   /db_xref="InterPro:IPR016673"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A74"
FT                   /protein_id="ABG49600.1"
FT                   VSLYYFQKKKEEEVKKGT"
FT   gene            complement(132007..133308)
FT                   /locus_tag="Tery_0097"
FT   CDS_pept        complement(132007..133308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0097"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: Spore germination protein amino acid
FT                   permease-associated region; KEGG: rba:RB950 amino acid
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49601"
FT                   /db_xref="GOA:Q11A73"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A73"
FT                   /protein_id="ABG49601.1"
FT   gene            133769..134475
FT                   /pseudo
FT                   /locus_tag="Tery_0098"
FT   gene            134634..134954
FT                   /pseudo
FT                   /locus_tag="Tery_0099"
FT   gene            135778..138564
FT                   /locus_tag="Tery_0100"
FT   CDS_pept        135778..138564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0100"
FT                   /product="Na-Ca exchanger/integrin-beta4"
FT                   /note="PFAM: Na-Ca exchanger/integrin-beta4; SMART:
FT                   Peptidase, metallopeptidases; KEGG: ava:Ava_4725
FT                   polymorphic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49602"
FT                   /db_xref="GOA:Q11A72"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR013858"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR034033"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A72"
FT                   /protein_id="ABG49602.1"
FT   gene            complement(138907..139326)
FT                   /pseudo
FT                   /locus_tag="Tery_0101"
FT   gene            complement(139424..139738)
FT                   /locus_tag="Tery_0102"
FT   CDS_pept        complement(139424..139738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0102"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cvi:CV3035 probable transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49603"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q10VD7"
FT                   /protein_id="ABG49603.1"
FT                   "
FT   gene            complement(140161..140898)
FT                   /locus_tag="Tery_0103"
FT   CDS_pept        complement(140161..140898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0103"
FT                   /product="Pirin-like"
FT                   /note="PFAM: Pirin-like; KEGG: gvi:glr1823 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49604"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A70"
FT                   /protein_id="ABG49604.1"
FT   gene            complement(141415..142320)
FT                   /locus_tag="Tery_0104"
FT   CDS_pept        complement(141415..142320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0104"
FT                   /product="Vitamin K epoxide reductase"
FT                   /note="PFAM: Vitamin K epoxide reductase; KEGG: tel:tlr0588
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49605"
FT                   /db_xref="GOA:Q11A69"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A69"
FT                   /protein_id="ABG49605.1"
FT   sig_peptide     complement(142228..142320)
FT                   /locus_tag="Tery_0104"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.699) with cleavage site probability 0.410 at
FT                   residue 31"
FT   gene            143542..144689
FT                   /pseudo
FT                   /locus_tag="Tery_0105"
FT   gene            complement(145446..145688)
FT                   /pseudo
FT                   /locus_tag="Tery_0106"
FT   gene            146668..146931
FT                   /locus_tag="Tery_0107"
FT   CDS_pept        146668..146931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49606"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A68"
FT                   /protein_id="ABG49606.1"
FT   sig_peptide     146668..146736
FT                   /locus_tag="Tery_0107"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.626 at
FT                   residue 23"
FT   gene            147658..148572
FT                   /locus_tag="Tery_0108"
FT   CDS_pept        147658..148572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0108"
FT                   /product="Ap4A phosphorylase II"
FT                   /note="KEGG: ava:Ava_3329 Ap4A phosphorylase II"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49607"
FT                   /db_xref="GOA:Q11A67"
FT                   /db_xref="InterPro:IPR009163"
FT                   /db_xref="InterPro:IPR019200"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A67"
FT                   /protein_id="ABG49607.1"
FT   gene            complement(149231..150202)
FT                   /locus_tag="Tery_0109"
FT   CDS_pept        complement(149231..150202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0109"
FT                   /product="NADPH-protochlorophyllide oxidoreductase /
FT                   chlorophyll synthase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="TIGRFAM: light-dependent protochlorophyllide
FT                   reductase; KEGG: tel:tlr0575 light-dependent
FT                   NADPH-protochlorophyllide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49608"
FT                   /db_xref="GOA:Q11A66"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR005979"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A66"
FT                   /protein_id="ABG49608.1"
FT   sig_peptide     complement(150119..150202)
FT                   /locus_tag="Tery_0109"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.888 at
FT                   residue 28"
FT   gene            150775..151294
FT                   /pseudo
FT                   /locus_tag="Tery_0110"
FT   gene            complement(151332..151466)
FT                   /locus_tag="Tery_0111"
FT   CDS_pept        complement(151332..151466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pcu:pc1275 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49609"
FT                   /db_xref="GOA:Q10VF0"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:Q10VF0"
FT                   /protein_id="ABG49609.1"
FT   gene            complement(151879..152058)
FT                   /locus_tag="Tery_0112"
FT   CDS_pept        complement(151879..152058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49610"
FT                   /db_xref="UniProtKB/TrEMBL:Q10VF2"
FT                   /protein_id="ABG49610.1"
FT                   YISNETKELIDKLK"
FT   gene            153324..154171
FT                   /pseudo
FT                   /locus_tag="Tery_0113"
FT   gene            complement(154460..154756)
FT                   /locus_tag="Tery_0114"
FT   CDS_pept        complement(154460..154756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0114"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bld:BLi00262 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49611"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A63"
FT                   /protein_id="ABG49611.1"
FT   gene            complement(155085..157763)
FT                   /locus_tag="Tery_0115"
FT   CDS_pept        complement(155085..157763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0115"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2 glycosyl
FT                   transferase, group 1 TPR repeat Tetratricopeptide TPR_3
FT                   Tetratricopeptide TPR_2; SMART: Tetratricopeptide region;
FT                   KEGG: gox:GOX0593 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49612"
FT                   /db_xref="GOA:Q11A62"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A62"
FT                   /protein_id="ABG49612.1"
FT   gene            complement(158094..158963)
FT                   /locus_tag="Tery_0116"
FT   CDS_pept        complement(158094..158963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0116"
FT                   /product="TPR repeat"
FT                   /note="PFAM: TPR repeat Tetratricopeptide TPR_2; SMART:
FT                   Tetratricopeptide region; KEGG: pmn:PMN2A_1093 TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49613"
FT                   /db_xref="GOA:Q11A61"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A61"
FT                   /protein_id="ABG49613.1"
FT                   YYQKATSI"
FT   gene            complement(159122..163132)
FT                   /locus_tag="Tery_0117"
FT   CDS_pept        complement(159122..163132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0117"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin Cna B-type; KEGG: pha:PSHAb0200 putative secreted
FT                   serine protease, subtilisin family, possibly excreted"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49614"
FT                   /db_xref="GOA:Q11A60"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR011121"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="InterPro:IPR034204"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A60"
FT                   /protein_id="ABG49614.1"
FT   gene            163385..163648
FT                   /locus_tag="Tery_0118"
FT   CDS_pept        163385..163648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0683 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49615"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A59"
FT                   /protein_id="ABG49615.1"
FT   gene            complement(164262..164930)
FT                   /locus_tag="Tery_0119"
FT   CDS_pept        complement(164262..164930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bld:BLi00262 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49616"
FT                   /db_xref="GOA:Q11A58"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="InterPro:IPR018011"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A58"
FT                   /protein_id="ABG49616.1"
FT                   "
FT   gene            complement(165274..166119)
FT                   /locus_tag="Tery_0120"
FT   CDS_pept        complement(165274..166119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0120"
FT                   /product="sulfotransferase"
FT                   /note="PFAM: sulfotransferase; KEGG: tbd:Tbd_1782
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49617"
FT                   /db_xref="GOA:Q11A57"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037359"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A57"
FT                   /protein_id="ABG49617.1"
FT                   "
FT   gene            complement(166446..167438)
FT                   /locus_tag="Tery_0121"
FT   CDS_pept        complement(166446..167438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0121"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11 Methyltransferase
FT                   type 12; KEGG: tfu:Tfu_2464 similar to methylase involved
FT                   in ubiquinone/menaquinone biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49618"
FT                   /db_xref="GOA:Q11A56"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A56"
FT                   /protein_id="ABG49618.1"
FT   gene            complement(167483..177388)
FT                   /locus_tag="Tery_0122"
FT   CDS_pept        complement(167483..177388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0122"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1 TPR repeat
FT                   Sel1-like repeat Tetratricopeptide TPR_3 Tetratricopeptide
FT                   TPR_2; SMART: Tetratricopeptide region; KEGG: pmt:PMT0296
FT                   TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49619"
FT                   /db_xref="GOA:Q11A55"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR007657"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A55"
FT                   /protein_id="ABG49619.1"
FT                   SIFKKIFHNFS"
FT   gene            178317..178508
FT                   /pseudo
FT                   /locus_tag="Tery_0123"
FT   gene            complement(178603..180135)
FT                   /locus_tag="Tery_0124"
FT   CDS_pept        complement(178603..180135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0124"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:alr4863 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49620"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A54"
FT                   /protein_id="ABG49620.1"
FT   gene            complement(180459..181211)
FT                   /locus_tag="Tery_0125"
FT   CDS_pept        complement(180459..181211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0125"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   ana:all1947 ATP-binding protein of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49621"
FT                   /db_xref="GOA:Q11A53"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017780"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A53"
FT                   /protein_id="ABG49621.1"
FT   gene            181229..181651
FT                   /pseudo
FT                   /locus_tag="Tery_0126"
FT   gene            complement(181654..182427)
FT                   /locus_tag="Tery_0127"
FT   CDS_pept        complement(181654..182427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0127"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   syn:sll0764 ABC-type urea transport system ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49622"
FT                   /db_xref="GOA:Q11A52"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017781"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A52"
FT                   /protein_id="ABG49622.1"
FT   gene            complement(182421..183602)
FT                   /locus_tag="Tery_0128"
FT   CDS_pept        complement(182421..183602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0128"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: syn:slr1201
FT                   ABC-type urea transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49623"
FT                   /db_xref="GOA:Q11A51"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR017778"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A51"
FT                   /protein_id="ABG49623.1"
FT   sig_peptide     complement(183495..183602)
FT                   /locus_tag="Tery_0128"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.813) with cleavage site probability 0.562 at
FT                   residue 36"
FT   gene            complement(184247..185407)
FT                   /locus_tag="Tery_0129"
FT   CDS_pept        complement(184247..185407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0129"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: ana:all1950
FT                   putative branched-chain amino acid transport system
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49624"
FT                   /db_xref="GOA:Q11A50"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A50"
FT                   /protein_id="ABG49624.1"
FT   gene            complement(186490..187761)
FT                   /locus_tag="Tery_0130"
FT   CDS_pept        complement(186490..187761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0130"
FT                   /product="extracellular ligand-binding receptor"
FT                   /note="KEGG: ava:Ava_4361 extracellular ligand-binding
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49625"
FT                   /db_xref="GOA:Q11A49"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR017777"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A49"
FT                   /protein_id="ABG49625.1"
FT   sig_peptide     complement(187675..187761)
FT                   /locus_tag="Tery_0130"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.566 at
FT                   residue 29"
FT   gene            complement(188512..188796)
FT                   /locus_tag="Tery_0131"
FT   CDS_pept        complement(188512..188796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cyb:CYB_2017 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49626"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A48"
FT                   /protein_id="ABG49626.1"
FT   gene            complement(189570..193661)
FT                   /locus_tag="Tery_0132"
FT   CDS_pept        complement(189570..193661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0132"
FT                   /product="hydrogenobyrinic acid a,c-diamide
FT                   cobaltochelatase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: cobaltochelatase, CobN subunit; PFAM:
FT                   CobN/magnesium chelatase; KEGG: ava:Ava_1167
FT                   cobaltochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49627"
FT                   /db_xref="GOA:Q11A47"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011953"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A47"
FT                   /protein_id="ABG49627.1"
FT   gene            complement(194505..195692)
FT                   /locus_tag="Tery_0133"
FT   CDS_pept        complement(194505..195692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0133"
FT                   /product="protein of unknown function DUF187"
FT                   /note="PFAM: protein of unknown function DUF187; KEGG:
FT                   ana:all2116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49628"
FT                   /db_xref="GOA:Q11A46"
FT                   /db_xref="InterPro:IPR003790"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A46"
FT                   /protein_id="ABG49628.1"
FT   sig_peptide     complement(195609..195692)
FT                   /locus_tag="Tery_0133"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 28"
FT   gene            196262..197389
FT                   /locus_tag="Tery_0134"
FT   CDS_pept        196262..197389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bfr:BF1770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49629"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A45"
FT                   /protein_id="ABG49629.1"
FT   gene            197382..197672
FT                   /locus_tag="Tery_0135"
FT   CDS_pept        197382..197672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bfr:BF1769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49630"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A44"
FT                   /protein_id="ABG49630.1"
FT   gene            197814..198488
FT                   /locus_tag="Tery_0136"
FT   CDS_pept        197814..198488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0136"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bfr:BF1769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49631"
FT                   /db_xref="InterPro:IPR022532"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A43"
FT                   /protein_id="ABG49631.1"
FT                   RE"
FT   gene            198506..199444
FT                   /locus_tag="Tery_0137"
FT   CDS_pept        198506..199444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49632"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A42"
FT                   /protein_id="ABG49632.1"
FT   gene            complement(199938..201053)
FT                   /locus_tag="Tery_0138"
FT   CDS_pept        complement(199938..201053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0138"
FT                   /product="putative ribonuclease BN"
FT                   /note="TIGRFAM: putative ribonuclease BN; PFAM:
FT                   ribonuclease BN; KEGG: ana:all2070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49633"
FT                   /db_xref="GOA:Q11A41"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A41"
FT                   /protein_id="ABG49633.1"
FT   gene            202233..202853
FT                   /locus_tag="Tery_0139"
FT   CDS_pept        202233..202853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_3116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49634"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A40"
FT                   /protein_id="ABG49634.1"
FT   gene            complement(204811..205926)
FT                   /locus_tag="Tery_0140"
FT   CDS_pept        complement(204811..205926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0140"
FT                   /product="L-threonine synthase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: threonine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit;
FT                   KEGG: ava:Ava_3117 threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49635"
FT                   /db_xref="GOA:Q11A39"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR026260"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A39"
FT                   /protein_id="ABG49635.1"
FT   gene            207239..207502
FT                   /locus_tag="Tery_0141"
FT   CDS_pept        207239..207502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49636"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A38"
FT                   /protein_id="ABG49636.1"
FT   gene            207806..208861
FT                   /locus_tag="Tery_0142"
FT   CDS_pept        207806..208861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0142"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: ava:Ava_4211
FT                   fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49637"
FT                   /db_xref="GOA:Q11A37"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A37"
FT                   /protein_id="ABG49637.1"
FT                   FKEYDAQKVSQ"
FT   gene            209440..210882
FT                   /locus_tag="Tery_0143"
FT   CDS_pept        209440..210882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0143"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase protein of
FT                   unknown function DUF450; KEGG: ana:alr1113 ParA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49638"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029464"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A36"
FT                   /protein_id="ABG49638.1"
FT   gene            210882..211856
FT                   /locus_tag="Tery_0144"
FT   CDS_pept        210882..211856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0144"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_4703 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49639"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A35"
FT                   /protein_id="ABG49639.1"
FT   gene            complement(212926..214536)
FT                   /locus_tag="Tery_0145"
FT   CDS_pept        complement(212926..214536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49640"
FT                   /db_xref="GOA:Q11A34"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A34"
FT                   /protein_id="ABG49640.1"
FT   gene            complement(214536..215744)
FT                   /locus_tag="Tery_0146"
FT   CDS_pept        complement(214536..215744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0146"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   ava:Ava_4699 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49641"
FT                   /db_xref="GOA:Q11A33"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A33"
FT                   /protein_id="ABG49641.1"
FT                   LLG"
FT   gene            215800..216867
FT                   /locus_tag="Tery_0147"
FT   CDS_pept        215800..216867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE2164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49642"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A32"
FT                   /protein_id="ABG49642.1"
FT                   EFSTARYCLEKIFFS"
FT   gene            217777..218829
FT                   /locus_tag="Tery_0148"
FT   CDS_pept        217777..218829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0148"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   ava:Ava_1120 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49643"
FT                   /db_xref="GOA:Q11A31"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A31"
FT                   /protein_id="ABG49643.1"
FT                   AFKFIRRLRS"
FT   gene            complement(219182..219649)
FT                   /locus_tag="Tery_0149"
FT   CDS_pept        complement(219182..219649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0149"
FT                   /product="Rho termination factor-like"
FT                   /note="PFAM: Rho termination factor-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49644"
FT                   /db_xref="GOA:Q11A30"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A30"
FT                   /protein_id="ABG49644.1"
FT   gene            complement(220187..220516)
FT                   /locus_tag="Tery_0150"
FT   CDS_pept        complement(220187..220516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49645"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A29"
FT                   /protein_id="ABG49645.1"
FT                   RLSLF"
FT   gene            221200..222018
FT                   /locus_tag="Tery_0151"
FT   CDS_pept        221200..222018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49646"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A28"
FT                   /protein_id="ABG49646.1"
FT   gene            222270..224264
FT                   /locus_tag="Tery_0152"
FT   CDS_pept        222270..224264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49647"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A27"
FT                   /protein_id="ABG49647.1"
FT   gene            224551..225456
FT                   /locus_tag="Tery_0153"
FT   CDS_pept        224551..225456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49648"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A26"
FT                   /protein_id="ABG49648.1"
FT   gene            complement(226829..227508)
FT                   /pseudo
FT                   /locus_tag="Tery_0154"
FT   gene            complement(228600..228776)
FT                   /locus_tag="Tery_0155"
FT   CDS_pept        complement(228600..228776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0155"
FT                   /product="transposase"
FT                   /note="KEGG: rfe:RF_0383 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49649"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A25"
FT                   /protein_id="ABG49649.1"
FT                   VDGAFKNCPNVFP"
FT   gene            complement(230297..232696)
FT                   /locus_tag="Tery_0156"
FT   CDS_pept        complement(230297..232696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0156"
FT                   /product="transglutaminase-like"
FT                   /note="PFAM: transglutaminase-like; KEGG: ana:alr0103
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49650"
FT                   /db_xref="GOA:Q11A24"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A24"
FT                   /protein_id="ABG49650.1"
FT   gene            238306..239277
FT                   /locus_tag="Tery_0157"
FT   CDS_pept        238306..239277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0157"
FT                   /product="Trans-hexaprenyltranstransferase"
FT                   /EC_number=""
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: ava:Ava_1469
FT                   polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49651"
FT                   /db_xref="GOA:Q11A23"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A23"
FT                   /protein_id="ABG49651.1"
FT   gene            complement(239488..239967)
FT                   /locus_tag="Tery_0158"
FT   CDS_pept        complement(239488..239967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0158"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49652"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A22"
FT                   /protein_id="ABG49652.1"
FT   gene            240062..241228
FT                   /locus_tag="Tery_0159"
FT   CDS_pept        240062..241228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49653"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A21"
FT                   /protein_id="ABG49653.1"
FT   gene            241221..242240
FT                   /locus_tag="Tery_0160"
FT   CDS_pept        241221..242240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0160"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_1472 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49654"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A20"
FT                   /protein_id="ABG49654.1"
FT   gene            complement(242603..243415)
FT                   /locus_tag="Tery_0161"
FT   CDS_pept        complement(242603..243415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0161"
FT                   /product="glutamate racemase"
FT                   /EC_number=""
FT                   /note="KEGG: syn:slr1746 glutamate racemase; TIGRFAM:
FT                   glutamate racemase; PFAM: Asp/Glu racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49655"
FT                   /db_xref="GOA:Q11A19"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q11A19"
FT                   /protein_id="ABG49655.1"
FT   gene            complement(244314..244883)
FT                   /locus_tag="Tery_0162"
FT   CDS_pept        complement(244314..244883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0162"
FT                   /product="Redoxin"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen Redoxin; KEGG: syn:sll1621
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49656"
FT                   /db_xref="GOA:Q11A18"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A18"
FT                   /protein_id="ABG49656.1"
FT   gene            complement(246541..247155)
FT                   /locus_tag="Tery_0163"
FT   CDS_pept        complement(246541..247155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0163"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf-like protein; KEGG:
FT                   ana:all3075 putative septum formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49657"
FT                   /db_xref="GOA:Q11A17"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q11A17"
FT                   /protein_id="ABG49657.1"
FT   gene            complement(247846..248388)
FT                   /locus_tag="Tery_0164"
FT   CDS_pept        complement(247846..248388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0164"
FT                   /product="photosystem II oxygen evolving complex protein
FT                   PsbP"
FT                   /note="PFAM: photosystem II oxygen evolving complex protein
FT                   PsbP; KEGG: ava:Ava_0834 photosystem II oxygen evolving
FT                   complex protein PsbP"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49658"
FT                   /db_xref="GOA:Q11A16"
FT                   /db_xref="InterPro:IPR002683"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A16"
FT                   /protein_id="ABG49658.1"
FT                   EKVNDKFQQVINSFSVY"
FT   sig_peptide     complement(248293..248388)
FT                   /locus_tag="Tery_0164"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.332 at
FT                   residue 32"
FT   gene            248855..249184
FT                   /locus_tag="Tery_0165"
FT   CDS_pept        248855..249184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0165"
FT                   /product="DNA recombination protein, RuvA"
FT                   /note="PFAM: DNA recombination protein, RuvA; KEGG:
FT                   ava:Ava_2820 Holliday junction DNA helicase motor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49659"
FT                   /db_xref="GOA:Q11A15"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A15"
FT                   /protein_id="ABG49659.1"
FT                   PLIRI"
FT   gene            249743..250456
FT                   /pseudo
FT                   /locus_tag="Tery_0166"
FT   gene            250697..251212
FT                   /pseudo
FT                   /locus_tag="Tery_0167"
FT   gene            251225..251584
FT                   /locus_tag="Tery_0168"
FT   CDS_pept        251225..251584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0168"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="KEGG: syf:Synpcc7942_2298 Holliday junction DNA
FT                   helicase RuvA"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49660"
FT                   /db_xref="GOA:Q11A14"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A14"
FT                   /protein_id="ABG49660.1"
FT                   WIREAISWLSRSTQL"
FT   gene            251672..251941
FT                   /locus_tag="Tery_0169"
FT   CDS_pept        251672..251941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0169"
FT                   /product="SSU ribosomal protein S15P"
FT                   /note="PFAM: ribosomal protein S15; KEGG: ava:Ava_4651 30S
FT                   ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49661"
FT                   /db_xref="GOA:Q11A13"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q11A13"
FT                   /protein_id="ABG49661.1"
FT   gene            251952..252425
FT                   /locus_tag="Tery_0170"
FT   CDS_pept        251952..252425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0170"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49662"
FT                   /db_xref="GOA:Q11A12"
FT                   /db_xref="InterPro:IPR021855"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A12"
FT                   /protein_id="ABG49662.1"
FT   gene            254069..255130
FT                   /locus_tag="Tery_0171"
FT   CDS_pept        254069..255130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0171"
FT                   /product="3-deoxy-D-arabinoheptulosonate-7-phosphate
FT                   synthase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; PFAM: DAHP synthetase I/KDSA; KEGG: ava:Ava_4649
FT                   3-deoxy-7-phosphoheptulonate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49663"
FT                   /db_xref="GOA:Q11A11"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041071"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A11"
FT                   /protein_id="ABG49663.1"
FT                   SVKRWPQPEPAIV"
FT   gene            complement(256583..257716)
FT                   /locus_tag="Tery_0172"
FT   CDS_pept        complement(256583..257716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all4254 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49664"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A10"
FT                   /protein_id="ABG49664.1"
FT   gene            258358..259317
FT                   /locus_tag="Tery_0173"
FT   CDS_pept        258358..259317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0173"
FT                   /product="FO synthase subunit 1"
FT                   /EC_number="2.5.1.-"
FT                   /note="PFAM: Radical SAM; SMART: Elongator protein
FT                   3/MiaB/NifB; KEGG: ava:Ava_1598 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49665"
FT                   /db_xref="GOA:Q11A09"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR019939"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q11A09"
FT                   /protein_id="ABG49665.1"
FT   gene            259770..261428
FT                   /locus_tag="Tery_0174"
FT   CDS_pept        259770..261428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0174"
FT                   /product="GUN4-like"
FT                   /note="PFAM: GUN4-like; KEGG: ana:alr4949 serine/threonine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49666"
FT                   /db_xref="GOA:Q11A08"
FT                   /db_xref="InterPro:IPR008629"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR037215"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A08"
FT                   /protein_id="ABG49666.1"
FT   sig_peptide     259770..259835
FT                   /locus_tag="Tery_0174"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.923 at
FT                   residue 22"
FT   gene            262109..262288
FT                   /locus_tag="Tery_0175"
FT   CDS_pept        262109..262288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49667"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A07"
FT                   /protein_id="ABG49667.1"
FT                   SFVLQKGGLLTQNG"
FT   gene            complement(262379..262978)
FT                   /locus_tag="Tery_0176"
FT   CDS_pept        complement(262379..262978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0176"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_0131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49668"
FT                   /db_xref="GOA:Q11A06"
FT                   /db_xref="InterPro:IPR025478"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A06"
FT                   /protein_id="ABG49668.1"
FT   gene            263727..264146
FT                   /locus_tag="Tery_0177"
FT   CDS_pept        263727..264146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49669"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A05"
FT                   /protein_id="ABG49669.1"
FT   sig_peptide     263727..263801
FT                   /locus_tag="Tery_0177"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.972 at
FT                   residue 25"
FT   gene            264281..265960
FT                   /locus_tag="Tery_0178"
FT   CDS_pept        264281..265960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0178"
FT                   /product="GUN4-like"
FT                   /note="PFAM: peptidase S1 and S6, chymotrypsin/Hap
FT                   GUN4-like; KEGG: ana:alr4949 serine/threonine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49670"
FT                   /db_xref="InterPro:IPR008629"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR037215"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A04"
FT                   /protein_id="ABG49670.1"
FT   gene            complement(266150..266914)
FT                   /locus_tag="Tery_0179"
FT   CDS_pept        complement(266150..266914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0179"
FT                   /product="protein of unknown function DUF1568"
FT                   /note="PFAM: protein of unknown function DUF1568; KEGG:
FT                   ana:all4950 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49671"
FT                   /db_xref="GOA:Q11A03"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A03"
FT                   /protein_id="ABG49671.1"
FT   gene            complement(267717..267947)
FT                   /pseudo
FT                   /locus_tag="Tery_0180"
FT   gene            268161..269534
FT                   /locus_tag="Tery_0181"
FT   CDS_pept        268161..269534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0181"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: ava:Ava_2103 cytochrome
FT                   P450"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49672"
FT                   /db_xref="GOA:Q11A02"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q11A02"
FT                   /protein_id="ABG49672.1"
FT   gene            269811..270872
FT                   /locus_tag="Tery_0182"
FT   CDS_pept        269811..270872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0182"
FT                   /product="photosystem q(b) protein"
FT                   /note="TIGRFAM: photosystem q(b) protein; PFAM:
FT                   photosynthetic reaction centre protein; KEGG:
FT                   syf:Synpcc7942_1389 photosystem q(b) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49673"
FT                   /db_xref="GOA:Q11A00"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005867"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q11A00"
FT                   /protein_id="ABG49673.1"
FT                   LDLAAVEAPSIKG"
FT   gene            271328..272389
FT                   /locus_tag="Tery_0183"
FT   CDS_pept        271328..272389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0183"
FT                   /product="photosystem q(b) protein"
FT                   /note="TIGRFAM: photosystem q(b) protein; PFAM:
FT                   photosynthetic reaction centre protein; KEGG:
FT                   syf:Synpcc7942_1389 photosystem q(b) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49674"
FT                   /db_xref="GOA:Q11A00"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005867"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q11A00"
FT                   /protein_id="ABG49674.1"
FT                   LDLAAVEAPSIKG"
FT   gene            complement(272619..272692)
FT                   /locus_tag="Tery_R0001"
FT                   /note="tRNA-Val2"
FT   tRNA            complement(272619..272692)
FT                   /locus_tag="Tery_R0001"
FT                   /product="tRNA-Val"
FT   gene            complement(272764..274590)
FT                   /locus_tag="Tery_0184"
FT   CDS_pept        complement(272764..274590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0184"
FT                   /product="serine/threonine protein kinase with WD40
FT                   repeats"
FT                   /note="PFAM: protein kinase WD-40 repeat; SMART: Tyrosine
FT                   protein kinase Serine/threonine protein kinase; KEGG:
FT                   ana:alr3119 WD repeat protein with Ser/Thr protein kinase
FT                   motif"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49675"
FT                   /db_xref="GOA:Q119Z9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Z9"
FT                   /protein_id="ABG49675.1"
FT   gene            complement(275667..276845)
FT                   /locus_tag="Tery_0185"
FT   CDS_pept        complement(275667..276845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0185"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V; KEGG: ana:alr3210
FT                   L-cysteine/cystine lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49676"
FT                   /db_xref="GOA:Q119Z8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Z8"
FT                   /protein_id="ABG49676.1"
FT   gene            277765..279303
FT                   /locus_tag="Tery_0186"
FT   CDS_pept        277765..279303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0186"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4865 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49677"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Z7"
FT                   /protein_id="ABG49677.1"
FT   gene            279451..280641
FT                   /locus_tag="Tery_0187"
FT   CDS_pept        279451..280641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49678"
FT                   /db_xref="GOA:Q119Z6"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Z6"
FT                   /protein_id="ABG49678.1"
FT   gene            280981..281054
FT                   /locus_tag="Tery_R0002"
FT                   /note="tRNA-Asp1"
FT   tRNA            280981..281054
FT                   /locus_tag="Tery_R0002"
FT                   /product="tRNA-Asp"
FT   gene            281404..284049
FT                   /locus_tag="Tery_0188"
FT   CDS_pept        281404..284049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0188"
FT                   /product="glutamate--tRNA(Gln) ligase / glutamyl-tRNA
FT                   synthetase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="TIGRFAM: glutamyl-tRNA synthetase; PFAM:
FT                   glutamyl-tRNA synthetase, class Ic; KEGG: ava:Ava_4861
FT                   glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49679"
FT                   /db_xref="GOA:Q119Z5"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR020752"
FT                   /db_xref="InterPro:IPR025564"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q119Z5"
FT                   /protein_id="ABG49679.1"
FT                   IKREIFGKPS"
FT   gene            284158..284673
FT                   /locus_tag="Tery_0189"
FT   CDS_pept        284158..284673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0189"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all3643 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49680"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Z4"
FT                   /protein_id="ABG49680.1"
FT                   YVIKITKE"
FT   sig_peptide     284158..284250
FT                   /locus_tag="Tery_0189"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.735 at
FT                   residue 31"
FT   gene            complement(285862..287871)
FT                   /locus_tag="Tery_0190"
FT   CDS_pept        complement(285862..287871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all0405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49681"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Z3"
FT                   /protein_id="ABG49681.1"
FT   sig_peptide     complement(287788..287871)
FT                   /locus_tag="Tery_0190"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.935 at
FT                   residue 28"
FT   gene            complement(288073..288348)
FT                   /pseudo
FT                   /locus_tag="Tery_0191"
FT   gene            289075..289680
FT                   /locus_tag="Tery_0192"
FT   CDS_pept        289075..289680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0192"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cch:Cag_0159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49682"
FT                   /db_xref="GOA:Q119Z2"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Z2"
FT                   /protein_id="ABG49682.1"
FT   gene            complement(289976..291565)
FT                   /locus_tag="Tery_0193"
FT   CDS_pept        complement(289976..291565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all2349 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49683"
FT                   /db_xref="InterPro:IPR038752"
FT                   /db_xref="InterPro:IPR041356"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Z1"
FT                   /protein_id="ABG49683.1"
FT                   PTTNTISWNSSI"
FT   gene            complement(292667..292939)
FT                   /locus_tag="Tery_0194"
FT   CDS_pept        complement(292667..292939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:asr4498 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49684"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Z0"
FT                   /protein_id="ABG49684.1"
FT   gene            293673..294263
FT                   /pseudo
FT                   /locus_tag="Tery_0195"
FT   gene            complement(294279..294905)
FT                   /locus_tag="Tery_0196"
FT   CDS_pept        complement(294279..294905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49685"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Y9"
FT                   /protein_id="ABG49685.1"
FT   gene            294991..295656
FT                   /locus_tag="Tery_0197"
FT   CDS_pept        294991..295656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3793 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49686"
FT                   /db_xref="GOA:Q119Y8"
FT                   /db_xref="InterPro:IPR019275"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Y8"
FT                   /protein_id="ABG49686.1"
FT   gene            complement(297094..297624)
FT                   /locus_tag="Tery_0198"
FT   CDS_pept        complement(297094..297624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0198"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: syn:slr1218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49687"
FT                   /db_xref="GOA:Q119Y7"
FT                   /db_xref="InterPro:IPR025433"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Y7"
FT                   /protein_id="ABG49687.1"
FT                   QAELIRIQQQTGN"
FT   gene            298526..300574
FT                   /locus_tag="Tery_0199"
FT   CDS_pept        298526..300574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0199"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related Oligopeptide/dipeptide
FT                   ABC transporter-like; SMART: ATPase; KEGG: ana:all4778
FT                   peptide transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49688"
FT                   /db_xref="GOA:Q119Y6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Y6"
FT                   /protein_id="ABG49688.1"
FT   gene            302330..303367
FT                   /locus_tag="Tery_0200"
FT   CDS_pept        302330..303367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0200"
FT                   /product="transposase"
FT                   /note="KEGG: ana:alr4628 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49689"
FT                   /db_xref="GOA:Q10VJ2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q10VJ2"
FT                   /protein_id="ABG49689.1"
FT                   LPQPT"
FT   gene            304605..306062
FT                   /locus_tag="Tery_0201"
FT   CDS_pept        304605..306062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0201"
FT                   /product="aminotransferase, class V"
FT                   /EC_number=""
FT                   /note="PFAM: aminotransferase, class V; KEGG: dsy:DSY0801
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49690"
FT                   /db_xref="GOA:Q119Y4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Y4"
FT                   /protein_id="ABG49690.1"
FT   gene            306604..307140
FT                   /locus_tag="Tery_0202"
FT   CDS_pept        306604..307140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0202"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: rsp:RSP_4193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49691"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Y3"
FT                   /protein_id="ABG49691.1"
FT                   TEDAEEAEGREYFKS"
FT   gene            307162..308481
FT                   /locus_tag="Tery_0203"
FT   CDS_pept        307162..308481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0203"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="PFAM: ATP-binding region, ATPase-like histidine
FT                   kinase A-like; SMART: PAS; KEGG: ana:all0707 two-component
FT                   sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49692"
FT                   /db_xref="GOA:Q119Y2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Y2"
FT                   /protein_id="ABG49692.1"
FT   gene            309201..310238
FT                   /locus_tag="Tery_0204"
FT   CDS_pept        309201..310238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0204"
FT                   /product="transposase"
FT                   /note="KEGG: ana:alr4628 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49693"
FT                   /db_xref="GOA:Q10VJ2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q10VJ2"
FT                   /protein_id="ABG49693.1"
FT                   LPQPT"
FT   gene            complement(310956..311729)
FT                   /locus_tag="Tery_0205"
FT   CDS_pept        complement(310956..311729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0205"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ana:all0475 probable short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49694"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Y0"
FT                   /protein_id="ABG49694.1"
FT   gene            complement(311780..312592)
FT                   /locus_tag="Tery_0206"
FT   CDS_pept        complement(311780..312592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0206"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_2889 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49695"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q119X9"
FT                   /protein_id="ABG49695.1"
FT   sig_peptide     complement(312509..312592)
FT                   /locus_tag="Tery_0206"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 28"
FT   gene            312998..314122
FT                   /locus_tag="Tery_0207"
FT   CDS_pept        312998..314122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0207"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number=""
FT                   /note="KEGG: ava:Ava_2890 N-acetylglucosaminyltransferase,
FT                   MurG; TIGRFAM:
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; PFAM: glycosyl transferase, family 28
FT                   glycosyltransferase 28-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49696"
FT                   /db_xref="GOA:Q119X8"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q119X8"
FT                   /protein_id="ABG49696.1"
FT   gene            complement(314229..314588)
FT                   /locus_tag="Tery_0208"
FT   CDS_pept        complement(314229..314588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49697"
FT                   /db_xref="GOA:Q119X7"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q119X7"
FT                   /protein_id="ABG49697.1"
FT                   VKLNYEKTNTGWLDR"
FT   gene            315196..317253
FT                   /locus_tag="Tery_0209"
FT   CDS_pept        315196..317253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0209"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: pleckstrin/ G-protein, interacting region MscS
FT                   Mechanosensitive ion channel; KEGG: cya:CYA_2563
FT                   transporter, small conductance mechanosensitive ion channel
FT                   (MscS) family"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49698"
FT                   /db_xref="GOA:Q119X6"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q119X6"
FT                   /protein_id="ABG49698.1"
FT   gene            complement(317874..319187)
FT                   /locus_tag="Tery_0210"
FT   CDS_pept        complement(317874..319187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0210"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating)"
FT                   /EC_number=""
FT                   /note="KEGG: syn:sll0099 precorrin-6y C5,
FT                   15-methyltransferase (decarboxylating); TIGRFAM:
FT                   precorrin-6y C5,15-methyltransferase (decarboxylating),
FT                   CbiE subunit precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49699"
FT                   /db_xref="GOA:Q119X5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q119X5"
FT                   /protein_id="ABG49699.1"
FT   gene            complement(319663..320403)
FT                   /locus_tag="Tery_0211"
FT   CDS_pept        complement(319663..320403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1391 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49700"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:Q119X4"
FT                   /protein_id="ABG49700.1"
FT   gene            320516..321466
FT                   /locus_tag="Tery_0212"
FT   CDS_pept        320516..321466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0212"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number=""
FT                   /note="TIGRFAM: DNA polymerase III, delta subunit; PFAM:
FT                   DNA polymerase III, delta; KEGG: ava:Ava_3469 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49701"
FT                   /db_xref="GOA:Q119X3"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q119X3"
FT                   /protein_id="ABG49701.1"
FT   gene            324132..325088
FT                   /locus_tag="Tery_0213"
FT   CDS_pept        324132..325088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0213"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:alr4086 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49702"
FT                   /db_xref="GOA:Q119X2"
FT                   /db_xref="UniProtKB/TrEMBL:Q119X2"
FT                   /protein_id="ABG49702.1"
FT   gene            325107..326174
FT                   /locus_tag="Tery_0214"
FT   CDS_pept        325107..326174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0214"
FT                   /product="GHMP kinase"
FT                   /note="PFAM: GHMP kinase; KEGG: tko:TK1831 galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49703"
FT                   /db_xref="GOA:Q119X1"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:Q119X1"
FT                   /protein_id="ABG49703.1"
FT                   QCFKLVVRAEYSNSK"
FT   gene            complement(327191..327484)
FT                   /locus_tag="Tery_0215"
FT   CDS_pept        complement(327191..327484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0215"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gvi:gll3521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49704"
FT                   /db_xref="UniProtKB/TrEMBL:Q119X0"
FT                   /protein_id="ABG49704.1"
FT   gene            complement(328879..329292)
FT                   /locus_tag="Tery_0216"
FT   CDS_pept        complement(328879..329292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0216"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   KEGG: syn:sll0359 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49705"
FT                   /db_xref="GOA:Q119W9"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q119W9"
FT                   /protein_id="ABG49705.1"
FT   gene            330834..331637
FT                   /locus_tag="Tery_0217"
FT   CDS_pept        330834..331637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0217"
FT                   /product="Creatininase"
FT                   /note="PFAM: Creatininase; KEGG: cyb:CYB_1420 creatininase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49706"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:Q119W8"
FT                   /protein_id="ABG49706.1"
FT   gene            complement(332920..335472)
FT                   /locus_tag="Tery_0218"
FT   CDS_pept        complement(332920..335472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0218"
FT                   /product="glycogen/starch/alpha-glucan phosphorylases"
FT                   /EC_number=""
FT                   /note="KEGG: gvi:glr0998 glycogen phosphorylase; TIGRFAM:
FT                   glycogen/starch/alpha-glucan phosphorylases; PFAM: glycosyl
FT                   transferase, family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49707"
FT                   /db_xref="GOA:Q119W7"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:Q119W7"
FT                   /protein_id="ABG49707.1"
FT   gene            complement(336517..336958)
FT                   /pseudo
FT                   /locus_tag="Tery_0219"
FT   gene            complement(337202..338224)
FT                   /locus_tag="Tery_0220"
FT   CDS_pept        complement(337202..338224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0220"
FT                   /product="Radical SAM"
FT                   /note="PFAM: Radical SAM; KEGG: ava:Ava_1219 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49708"
FT                   /db_xref="GOA:Q119W6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017833"
FT                   /db_xref="InterPro:IPR022563"
FT                   /db_xref="UniProtKB/TrEMBL:Q119W6"
FT                   /protein_id="ABG49708.1"
FT                   "
FT   gene            339480..340676
FT                   /locus_tag="Tery_0221"
FT   CDS_pept        339480..340676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4378 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49709"
FT                   /db_xref="GOA:Q119W5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q119W5"
FT                   /protein_id="ABG49709.1"
FT   gene            340839..341948
FT                   /locus_tag="Tery_0222"
FT   CDS_pept        340839..341948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr2464 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49710"
FT                   /db_xref="InterPro:IPR040871"
FT                   /db_xref="UniProtKB/TrEMBL:Q119W4"
FT                   /protein_id="ABG49710.1"
FT   gene            complement(344301..345062)
FT                   /locus_tag="Tery_0223"
FT   CDS_pept        complement(344301..345062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49711"
FT                   /db_xref="GOA:Q119W3"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q119W3"
FT                   /protein_id="ABG49711.1"
FT   gene            complement(345347..347230)
FT                   /locus_tag="Tery_0224"
FT   CDS_pept        complement(345347..347230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0224"
FT                   /product="secretion protein HlyD"
FT                   /note="PFAM: secretion protein HlyD; KEGG: ava:Ava_4382
FT                   secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49712"
FT                   /db_xref="GOA:Q119W2"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q119W2"
FT                   /protein_id="ABG49712.1"
FT   gene            complement(347561..350287)
FT                   /locus_tag="Tery_0225"
FT   CDS_pept        complement(347561..350287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0225"
FT                   /product="bacteriocin-processing peptidase. Cysteine
FT                   peptidase. MEROPS family C39"
FT                   /note="PFAM: cyclic nucleotide-binding ABC transporter,
FT                   transmembrane region ABC transporter related peptidase C39,
FT                   bacteriocin processing; SMART: ATPase; KEGG: ana:alr1927
FT                   putative multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49713"
FT                   /db_xref="GOA:Q119W1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q119W1"
FT                   /protein_id="ABG49713.1"
FT   gene            complement(350401..351009)
FT                   /locus_tag="Tery_0226"
FT   CDS_pept        complement(350401..351009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr1926 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49714"
FT                   /db_xref="GOA:Q119W0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:Q119W0"
FT                   /protein_id="ABG49714.1"
FT   gene            352378..353694
FT                   /locus_tag="Tery_0227"
FT   CDS_pept        352378..353694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0227"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tel:tlr1460 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49715"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q119V9"
FT                   /protein_id="ABG49715.1"
FT   gene            354244..356607
FT                   /locus_tag="Tery_0228"
FT   CDS_pept        354244..356607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0228"
FT                   /product="putative Chase2 sensor protein"
FT                   /note="PFAM: CHASE2; KEGG: ava:Ava_1624 WD-40 repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49716"
FT                   /db_xref="GOA:Q119V8"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q119V8"
FT                   /protein_id="ABG49716.1"
FT   gene            356894..357769
FT                   /locus_tag="Tery_0229"
FT   CDS_pept        356894..357769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0229"
FT                   /product="protein of unknown function DUF928"
FT                   /note="PFAM: protein of unknown function DUF928; KEGG:
FT                   ava:Ava_3877 protein of unknown function DUF928"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49717"
FT                   /db_xref="InterPro:IPR010328"
FT                   /db_xref="UniProtKB/TrEMBL:Q119V7"
FT                   /protein_id="ABG49717.1"
FT                   IQNCCNVSDQ"
FT   sig_peptide     356894..356965
FT                   /locus_tag="Tery_0229"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.953 at
FT                   residue 24"
FT   gene            358803..359048
FT                   /locus_tag="Tery_0230"
FT   CDS_pept        358803..359048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0230"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: syn:sll0810 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49718"
FT                   /db_xref="UniProtKB/TrEMBL:Q119V6"
FT                   /protein_id="ABG49718.1"
FT   gene            complement(359583..361217)
FT                   /locus_tag="Tery_0231"
FT   CDS_pept        complement(359583..361217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0231"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase metal-dependent
FT                   phosphohydrolase, HD subdomain; KEGG: ava:Ava_3530 Ppx/GppA
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49719"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:Q119V5"
FT                   /protein_id="ABG49719.1"
FT   gene            361712..362587
FT                   /locus_tag="Tery_0232"
FT   CDS_pept        361712..362587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0232"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: ava:Ava_3531
FT                   4-hydroxybenzoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49720"
FT                   /db_xref="GOA:Q119V4"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:Q119V4"
FT                   /protein_id="ABG49720.1"
FT                   LAGMITGLIF"
FT   gene            362733..362966
FT                   /locus_tag="Tery_0233"
FT   CDS_pept        362733..362966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0233"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gvi:gll3349 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49721"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:Q119V3"
FT                   /protein_id="ABG49721.1"
FT   gene            complement(363849..364400)
FT                   /locus_tag="Tery_0234"
FT   CDS_pept        complement(363849..364400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0234"
FT                   /product="Redoxin"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen Redoxin; KEGG: ana:alr4642
FT                   putative thiol-specific antioxidant protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49722"
FT                   /db_xref="GOA:Q119V2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q119V2"
FT                   /protein_id="ABG49722.1"
FT   gene            complement(364533..365132)
FT                   /locus_tag="Tery_0235"
FT   CDS_pept        complement(364533..365132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0235"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen Redoxin; KEGG: ava:Ava_2024 alkyl
FT                   hydroperoxide reductase/thiol specific antioxidant/Mal
FT                   allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49723"
FT                   /db_xref="GOA:Q119V1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q119V1"
FT                   /protein_id="ABG49723.1"
FT   gene            366620..367054
FT                   /pseudo
FT                   /locus_tag="Tery_0236"
FT   gene            complement(367817..367889)
FT                   /locus_tag="Tery_R0003"
FT                   /note="tRNA-Met3"
FT   tRNA            complement(367817..367889)
FT                   /locus_tag="Tery_R0003"
FT                   /product="tRNA-Met"
FT   gene            complement(368911..371385)
FT                   /locus_tag="Tery_0237"
FT   CDS_pept        complement(368911..371385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0237"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: Peptidoglycan-binding LysM peptidase M23B;
FT                   KEGG: syf:Synpcc7942_0598 peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49724"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q119V0"
FT                   /protein_id="ABG49724.1"
FT                   PMAYLPSRIASN"
FT   gene            complement(372181..372642)
FT                   /locus_tag="Tery_0238"
FT   CDS_pept        complement(372181..372642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0238"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   ava:Ava_3194 RNA methyltransferase TrmH, group 2"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49725"
FT                   /db_xref="GOA:Q119U9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q119U9"
FT                   /protein_id="ABG49725.1"
FT   gene            373560..375467
FT                   /locus_tag="Tery_0239"
FT   CDS_pept        373560..375467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0239"
FT                   /product="RNA-directed DNA polymerase"
FT                   /EC_number=""
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase) HNH endonuclease Group II intron,
FT                   maturase-specific; SMART: HNH nuclease; KEGG: ana:alr8560
FT                   reverse transcriptase homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49726"
FT                   /db_xref="GOA:Q119U8"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:Q119U8"
FT                   /protein_id="ABG49726.1"
FT                   "
FT   gene            complement(375832..377736)
FT                   /locus_tag="Tery_0240"
FT   CDS_pept        complement(375832..377736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0240"
FT                   /product="RNA-directed DNA polymerase"
FT                   /EC_number=""
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase) HNH endonuclease Group II intron,
FT                   maturase-specific; SMART: HNH nuclease; KEGG: ana:alr8560
FT                   reverse transcriptase homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49727"
FT                   /db_xref="GOA:Q119U7"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:Q119U7"
FT                   /protein_id="ABG49727.1"
FT   gene            377965..378238
FT                   /pseudo
FT                   /locus_tag="Tery_0241"
FT   gene            complement(379093..380244)
FT                   /locus_tag="Tery_0242"
FT   CDS_pept        complement(379093..380244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0242"
FT                   /product="glutamate--cysteine ligase, putative"
FT                   /note="TIGRFAM: glutamate--cysteine ligase, putative; PFAM:
FT                   glutamate--cysteine ligase, GCS2; KEGG: ana:alr3351
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49728"
FT                   /db_xref="GOA:Q119U6"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011792"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:Q119U6"
FT                   /protein_id="ABG49728.1"
FT   gene            complement(380511..381323)
FT                   /locus_tag="Tery_0243"
FT   CDS_pept        complement(380511..381323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49729"
FT                   /db_xref="GOA:Q119U5"
FT                   /db_xref="UniProtKB/TrEMBL:Q119U5"
FT                   /protein_id="ABG49729.1"
FT   gene            382366..383226
FT                   /locus_tag="Tery_0244"
FT   CDS_pept        382366..383226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49730"
FT                   /db_xref="UniProtKB/TrEMBL:Q119U4"
FT                   /protein_id="ABG49730.1"
FT                   IAFIR"
FT   gene            383619..384155
FT                   /locus_tag="Tery_0245"
FT   CDS_pept        383619..384155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49731"
FT                   /db_xref="GOA:Q119U3"
FT                   /db_xref="UniProtKB/TrEMBL:Q119U3"
FT                   /protein_id="ABG49731.1"
FT                   VILVLLLGKKVSSNK"
FT   gene            384785..385255
FT                   /locus_tag="Tery_0246"
FT   CDS_pept        384785..385255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0246"
FT                   /product="protein of unknown function DUF924"
FT                   /note="PFAM: protein of unknown function DUF924; KEGG:
FT                   bmb:BruAb1_1191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49732"
FT                   /db_xref="GOA:Q119U2"
FT                   /db_xref="InterPro:IPR010323"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q119U2"
FT                   /protein_id="ABG49732.1"
FT   gene            complement(385456..387327)
FT                   /locus_tag="Tery_0247"
FT   CDS_pept        complement(385456..387327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0247"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase protein of unknown function
FT                   DUF323; SMART: Tyrosine protein kinase Serine/threonine
FT                   protein kinase; KEGG: ana:alr1336 serine/threonine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49733"
FT                   /db_xref="GOA:Q119U1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:Q119U1"
FT                   /protein_id="ABG49733.1"
FT   gene            complement(389480..390406)
FT                   /locus_tag="Tery_0248"
FT   CDS_pept        complement(389480..390406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0248"
FT                   /product="Spermine synthase"
FT                   /note="PFAM: Spermine synthase; KEGG: cps:CPS_4320
FT                   spermine/spermidine synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q119U0"
FT                   /protein_id="ABG49734.1"
FT   gene            complement(390886..392010)
FT                   /locus_tag="Tery_0249"
FT   CDS_pept        complement(390886..392010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0249"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase THUMP; KEGG:
FT                   gvi:glr4041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49735"
FT                   /db_xref="GOA:Q119T9"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q119T9"
FT                   /protein_id="ABG49735.1"
FT   gene            392348..392641
FT                   /locus_tag="Tery_0250"
FT   CDS_pept        392348..392641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49736"
FT                   /db_xref="GOA:Q119T8"
FT                   /db_xref="InterPro:IPR007072"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q119T8"
FT                   /protein_id="ABG49736.1"
FT   gene            complement(392631..393239)
FT                   /locus_tag="Tery_0251"
FT   CDS_pept        complement(392631..393239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49737"
FT                   /db_xref="UniProtKB/TrEMBL:Q119T7"
FT                   /protein_id="ABG49737.1"
FT   sig_peptide     complement(393159..393239)
FT                   /locus_tag="Tery_0251"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.945) with cleavage site probability 0.918 at
FT                   residue 27"
FT   gene            complement(393976..394604)
FT                   /pseudo
FT                   /locus_tag="Tery_0252"
FT   gene            complement(394605..395062)
FT                   /pseudo
FT                   /locus_tag="Tery_0253"
FT   gene            complement(395770..395910)
FT                   /locus_tag="Tery_0254"
FT   CDS_pept        complement(395770..395910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49738"
FT                   /db_xref="UniProtKB/TrEMBL:Q119T6"
FT                   /protein_id="ABG49738.1"
FT                   I"
FT   gene            397560..398477
FT                   /locus_tag="Tery_0255"
FT   CDS_pept        397560..398477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0255"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: Peptidoglycan-binding LysM peptidase M23B;
FT                   KEGG: ava:Ava_2410 peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49739"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q119T5"
FT                   /protein_id="ABG49739.1"
FT   sig_peptide     397560..397643
FT                   /locus_tag="Tery_0255"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.706) with cleavage site probability 0.672 at
FT                   residue 28"
FT   gene            complement(399270..400796)
FT                   /locus_tag="Tery_0256"
FT   CDS_pept        complement(399270..400796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0256"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_2225 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49740"
FT                   /db_xref="GOA:Q119T4"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q119T4"
FT                   /protein_id="ABG49740.1"
FT   gene            401387..401554
FT                   /locus_tag="Tery_0257"
FT   CDS_pept        401387..401554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49741"
FT                   /db_xref="InterPro:IPR017136"
FT                   /db_xref="UniProtKB/TrEMBL:Q119T3"
FT                   /protein_id="ABG49741.1"
FT                   KSSPLLAPPN"
FT   gene            401698..402621
FT                   /locus_tag="Tery_0258"
FT   CDS_pept        401698..402621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0258"
FT                   /product="asparaginase"
FT                   /EC_number=""
FT                   /note="PFAM: peptidase T2, asparaginase 2; KEGG:
FT                   ava:Ava_1775 peptidase T2, asparaginase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49742"
FT                   /db_xref="GOA:Q119T2"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q119T2"
FT                   /protein_id="ABG49742.1"
FT   gene            complement(402783..403595)
FT                   /locus_tag="Tery_0259"
FT   CDS_pept        complement(402783..403595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0259"
FT                   /product="endodeoxyribonuclease RusA"
FT                   /note="PFAM: endodeoxyribonuclease RusA"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49743"
FT                   /db_xref="GOA:Q119T1"
FT                   /db_xref="InterPro:IPR008822"
FT                   /db_xref="InterPro:IPR036614"
FT                   /db_xref="UniProtKB/TrEMBL:Q119T1"
FT                   /protein_id="ABG49743.1"
FT   gene            complement(404593..405453)
FT                   /locus_tag="Tery_0260"
FT   CDS_pept        complement(404593..405453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49744"
FT                   /db_xref="UniProtKB/TrEMBL:Q119T0"
FT                   /protein_id="ABG49744.1"
FT                   SRRRR"
FT   sig_peptide     complement(405385..405453)
FT                   /locus_tag="Tery_0260"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.296 at
FT                   residue 23"
FT   gene            405667..406119
FT                   /pseudo
FT                   /locus_tag="Tery_0261"
FT   gene            complement(407544..407945)
FT                   /locus_tag="Tery_0262"
FT   CDS_pept        complement(407544..407945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0262"
FT                   /product="LSU ribosomal protein L12P"
FT                   /note="PFAM: ribosomal protein L7/L12; KEGG: ana:alr5303
FT                   50S ribosomal protein L12"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49745"
FT                   /db_xref="GOA:Q119S9"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q119S9"
FT                   /protein_id="ABG49745.1"
FT   gene            complement(408165..408737)
FT                   /locus_tag="Tery_0263"
FT   CDS_pept        complement(408165..408737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0263"
FT                   /product="LSU ribosomal protein L10P"
FT                   /note="PFAM: ribosomal protein L10; KEGG: ava:Ava_2554 50S
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49746"
FT                   /db_xref="GOA:Q119S8"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q119S8"
FT                   /protein_id="ABG49746.1"
FT   gene            complement(409830..410546)
FT                   /locus_tag="Tery_0264"
FT   CDS_pept        complement(409830..410546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0264"
FT                   /product="LSU ribosomal protein L1P"
FT                   /note="PFAM: ribosomal protein L1; KEGG:
FT                   syf:Synpcc7942_0633 ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49747"
FT                   /db_xref="GOA:Q119S7"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q119S7"
FT                   /protein_id="ABG49747.1"
FT                   EIDVSSLQDLKLTEAA"
FT   gene            complement(410674..411099)
FT                   /locus_tag="Tery_0265"
FT   CDS_pept        complement(410674..411099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0265"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="PFAM: ribosomal protein L11; KEGG: ava:Ava_2552 50S
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49748"
FT                   /db_xref="GOA:Q119S6"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q119S6"
FT                   /protein_id="ABG49748.1"
FT   gene            complement(411099..411773)
FT                   /locus_tag="Tery_0266"
FT   CDS_pept        complement(411099..411773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0266"
FT                   /product="transcription antitermination protein nusG"
FT                   /note="KEGG: ava:Ava_2551 transcription antitermination
FT                   protein NusG; TIGRFAM: transcription
FT                   termination/antitermination factor NusG; PFAM:
FT                   transcription antitermination protein NusG KOW; SMART: NGN
FT                   KOW (Kyrpides, Ouzounis, Woese) motif"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49749"
FT                   /db_xref="GOA:Q119S5"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q119S5"
FT                   /protein_id="ABG49749.1"
FT                   HK"
FT   gene            complement(411770..411994)
FT                   /locus_tag="Tery_0267"
FT   CDS_pept        complement(411770..411994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0267"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: syf:Synpcc7942_0636
FT                   SecE subunit of protein translocation complex"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49750"
FT                   /db_xref="GOA:Q119S4"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q119S4"
FT                   /protein_id="ABG49750.1"
FT   gene            complement(412296..412368)
FT                   /locus_tag="Tery_R0004"
FT                   /note="tRNA-Trp1"
FT   tRNA            complement(412296..412368)
FT                   /locus_tag="Tery_R0004"
FT                   /product="tRNA-Trp"
FT   gene            complement(412469..412852)
FT                   /locus_tag="Tery_0268"
FT   CDS_pept        complement(412469..412852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0268"
FT                   /product="LSU ribosomal protein L19P"
FT                   /note="PFAM: ribosomal protein L19; KEGG: ava:Ava_2549 50S
FT                   ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49751"
FT                   /db_xref="GOA:Q119S3"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q119S3"
FT                   /protein_id="ABG49751.1"
FT   gene            413407..415158
FT                   /locus_tag="Tery_0269"
FT   CDS_pept        413407..415158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0269"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: ana:alr2338 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49752"
FT                   /db_xref="GOA:Q119S2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q119S2"
FT                   /protein_id="ABG49752.1"
FT                   GVKRKPS"
FT   gene            415937..417622
FT                   /locus_tag="Tery_0270"
FT   CDS_pept        415937..417622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0270"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: ava:Ava_3766 chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49753"
FT                   /db_xref="GOA:Q119S1"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q119S1"
FT                   /protein_id="ABG49753.1"
FT   gene            417849..420950
FT                   /locus_tag="Tery_0271"
FT   CDS_pept        417849..420950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0271"
FT                   /product="pentapeptide repeat"
FT                   /note="PFAM: pentapeptide repeat; KEGG: ava:Ava_4849
FT                   pentapeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49754"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q119S0"
FT                   /protein_id="ABG49754.1"
FT   gene            421111..421561
FT                   /pseudo
FT                   /locus_tag="Tery_0272"
FT   gene            422371..423588
FT                   /locus_tag="Tery_0273"
FT   CDS_pept        422371..423588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0273"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dvu:DVU1895 major facilitator superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49755"
FT                   /db_xref="GOA:Q119R9"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q119R9"
FT                   /protein_id="ABG49755.1"
FT                   TQSIKS"
FT   gene            423919..424896
FT                   /locus_tag="Tery_0274"
FT   CDS_pept        423919..424896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0274"
FT                   /product="sulfotransferase"
FT                   /note="PFAM: sulfotransferase; KEGG: mmu:215895 similar to
FT                   sulfotransferase family 3A, member 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49756"
FT                   /db_xref="GOA:Q119R8"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q119R8"
FT                   /protein_id="ABG49756.1"
FT   gene            complement(425178..426698)
FT                   /locus_tag="Tery_0275"
FT   CDS_pept        complement(425178..426698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0275"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase GMC
FT                   oxidoreductase; KEGG: ava:Ava_B0176
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49757"
FT                   /db_xref="GOA:Q119R7"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q119R7"
FT                   /protein_id="ABG49757.1"
FT   gene            complement(427229..427843)
FT                   /locus_tag="Tery_0276"
FT   CDS_pept        complement(427229..427843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0276"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /note="PFAM: cytochrome c oxidase, subunit III; KEGG:
FT                   ava:Ava_4300 cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49758"
FT                   /db_xref="GOA:Q119R6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q119R6"
FT                   /protein_id="ABG49758.1"
FT   gene            complement(428293..429981)
FT                   /locus_tag="Tery_0277"
FT   CDS_pept        complement(428293..429981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0277"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number=""
FT                   /note="PFAM: cytochrome c oxidase, subunit I; KEGG:
FT                   ana:alr2732 cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49759"
FT                   /db_xref="GOA:Q119R5"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q119R5"
FT                   /protein_id="ABG49759.1"
FT   gene            complement(430086..430994)
FT                   /locus_tag="Tery_0278"
FT   CDS_pept        complement(430086..430994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0278"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="PFAM: cytochrome c oxidase, subunit II cytochrome C
FT                   oxidase subunit II, transmembrane region; KEGG: ana:alr2731
FT                   cytochrome c oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49760"
FT                   /db_xref="GOA:Q119R4"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:Q119R4"
FT                   /protein_id="ABG49760.1"
FT   sig_peptide     complement(430881..430994)
FT                   /locus_tag="Tery_0278"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.372 at
FT                   residue 38"
FT   gene            complement(431013..431618)
FT                   /locus_tag="Tery_0279"
FT   CDS_pept        complement(431013..431618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_B0180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49761"
FT                   /db_xref="GOA:Q119R3"
FT                   /db_xref="InterPro:IPR019251"
FT                   /db_xref="UniProtKB/TrEMBL:Q119R3"
FT                   /protein_id="ABG49761.1"
FT   gene            complement(431615..432115)
FT                   /locus_tag="Tery_0280"
FT   CDS_pept        complement(431615..432115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_B0181 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49762"
FT                   /db_xref="GOA:Q119R2"
FT                   /db_xref="InterPro:IPR019251"
FT                   /db_xref="UniProtKB/TrEMBL:Q119R2"
FT                   /protein_id="ABG49762.1"
FT                   ILQ"
FT   gene            complement(433208..434281)
FT                   /locus_tag="Tery_0281"
FT   CDS_pept        complement(433208..434281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0281"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: ava:Ava_1499
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49763"
FT                   /db_xref="GOA:Q119R1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q119R1"
FT                   /protein_id="ABG49763.1"
FT                   EWIKQNETVTSRTEVAV"
FT   gene            complement(434458..435672)
FT                   /pseudo
FT                   /locus_tag="Tery_0282"
FT   gene            436168..437337
FT                   /locus_tag="Tery_0283"
FT   CDS_pept        436168..437337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0283"
FT                   /product="transaldolase"
FT                   /EC_number=""
FT                   /note="KEGG: gvi:gll1597 transaldolase; TIGRFAM:
FT                   transaldolase; PFAM: Transaldolase Calcium-binding EF-hand"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49764"
FT                   /db_xref="GOA:Q119R0"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q119R0"
FT                   /protein_id="ABG49764.1"
FT   gene            complement(438503..439606)
FT                   /locus_tag="Tery_0284"
FT   CDS_pept        complement(438503..439606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0284"
FT                   /product="glycine oxidase ThiO"
FT                   /note="TIGRFAM: glycine oxidase ThiO; PFAM: FAD dependent
FT                   oxidoreductase; KEGG: ana:all3519 thiamin biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49765"
FT                   /db_xref="GOA:Q119Q9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Q9"
FT                   /protein_id="ABG49765.1"
FT   gene            complement(440288..440577)
FT                   /pseudo
FT                   /locus_tag="Tery_0285"
FT   gene            440975..442579
FT                   /locus_tag="Tery_0286"
FT   CDS_pept        440975..442579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0286"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: 2-isopropylmalate synthase/homocitrate
FT                   synthase family protein; PFAM: pyruvate carboxyltransferase
FT                   LeuA allosteric (dimerisation) domain; KEGG: ana:alr3522
FT                   2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49766"
FT                   /db_xref="GOA:Q119Q8"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Q8"
FT                   /protein_id="ABG49766.1"
FT                   MLESQSQENAVSVVIVN"
FT   gene            complement(442807..443091)
FT                   /locus_tag="Tery_0287"
FT   CDS_pept        complement(442807..443091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49767"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Q7"
FT                   /protein_id="ABG49767.1"
FT   gene            443535..444284
FT                   /locus_tag="Tery_0288"
FT   CDS_pept        443535..444284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0288"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11 Methyltransferase
FT                   type 12; KEGG: syf:Synpcc7942_1408 membrane-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49768"
FT                   /db_xref="GOA:Q119Q6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Q6"
FT                   /protein_id="ABG49768.1"
FT   gene            444560..444925
FT                   /locus_tag="Tery_0289"
FT   CDS_pept        444560..444925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0289"
FT                   /product="transposase"
FT                   /note="KEGG: ana:all4868 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49769"
FT                   /db_xref="GOA:Q119Q5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Q5"
FT                   /protein_id="ABG49769.1"
FT                   QYDVVFESNQSYYNLFK"
FT   gene            445064..445597
FT                   /locus_tag="Tery_0290"
FT   CDS_pept        445064..445597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0290"
FT                   /product="transposase"
FT                   /note="KEGG: ana:alr4628 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49770"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Q4"
FT                   /protein_id="ABG49770.1"
FT                   FPKLFQYEILPQPT"
FT   gene            446241..447479
FT                   /locus_tag="Tery_0291"
FT   CDS_pept        446241..447479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0291"
FT                   /product="TPR repeat"
FT                   /note="PFAM: peptidase S1 and S6, chymotrypsin/Hap TPR
FT                   repeat Tetratricopeptide TPR_2; SMART: Tetratricopeptide
FT                   region; KEGG: tel:tlr1637 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49771"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Q3"
FT                   /protein_id="ABG49771.1"
FT                   LYLIKKLRNLLLV"
FT   sig_peptide     446241..446339
FT                   /locus_tag="Tery_0291"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.982 at
FT                   residue 33"
FT   gene            complement(447471..448331)
FT                   /locus_tag="Tery_0292"
FT   CDS_pept        complement(447471..448331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfa:PF11_0218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49772"
FT                   /db_xref="GOA:Q119Q2"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Q2"
FT                   /protein_id="ABG49772.1"
FT                   LSKLD"
FT   sig_peptide     complement(448266..448331)
FT                   /locus_tag="Tery_0292"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.942) with cleavage site probability 0.938 at
FT                   residue 22"
FT   gene            complement(449414..450586)
FT                   /locus_tag="Tery_0293"
FT   CDS_pept        complement(449414..450586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0293"
FT                   /product="L-aspartate aminotransferase"
FT                   /EC_number=""
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   ava:Ava_2127 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49773"
FT                   /db_xref="GOA:Q119Q1"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Q1"
FT                   /protein_id="ABG49773.1"
FT   sig_peptide     complement(450512..450586)
FT                   /locus_tag="Tery_0293"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.888) with cleavage site probability 0.875 at
FT                   residue 25"
FT   gene            complement(451430..452728)
FT                   /locus_tag="Tery_0294"
FT   CDS_pept        complement(451430..452728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0294"
FT                   /product="protein of unknown function DUF89"
FT                   /note="PFAM: protein of unknown function DUF89; KEGG:
FT                   sru:SRU_1339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49774"
FT                   /db_xref="GOA:Q119Q0"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="InterPro:IPR036075"
FT                   /db_xref="InterPro:IPR039763"
FT                   /db_xref="UniProtKB/TrEMBL:Q119Q0"
FT                   /protein_id="ABG49774.1"
FT   gene            452825..455425
FT                   /locus_tag="Tery_0295"
FT   CDS_pept        452825..455425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0295"
FT                   /product="peptidase M1, membrane alanine aminopeptidase"
FT                   /note="PFAM: peptidase M1, membrane alanine aminopeptidase
FT                   PBS lyase HEAT-like repeat; KEGG: ava:Ava_0316 peptidase
FT                   M1, membrane alanine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49775"
FT                   /db_xref="GOA:Q119P9"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:Q119P9"
FT                   /protein_id="ABG49775.1"
FT   gene            complement(455679..455810)
FT                   /locus_tag="Tery_0296"
FT   CDS_pept        complement(455679..455810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0296"
FT                   /product="CG8440 gene product from transcript CG8440-RA
FT                   CG8440 gene product from transcript CG8440-RB"
FT                   /note="KEGG: dme:CG8440-PA CG8440 gene product from
FT                   transcript CG8440-RA CG8440 gene product from transcript
FT                   CG8440-RB"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49776"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q119P8"
FT                   /protein_id="ABG49776.1"
FT   gene            complement(456020..456517)
FT                   /pseudo
FT                   /locus_tag="Tery_0297"
FT   gene            456754..457272
FT                   /locus_tag="Tery_0298"
FT   CDS_pept        456754..457272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0298"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; KEGG: ana:all4063
FT                   phosphatidylglycerophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49777"
FT                   /db_xref="GOA:Q119P7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:Q119P7"
FT                   /protein_id="ABG49777.1"
FT                   LPTQETSNT"
FT   gene            457720..459648
FT                   /locus_tag="Tery_0299"
FT   CDS_pept        457720..459648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0299"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   ava:Ava_3020 ABC transporter-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49778"
FT                   /db_xref="GOA:Q119P6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:Q119P6"
FT                   /protein_id="ABG49778.1"
FT                   ELAEIDS"
FT   gene            459720..460340
FT                   /locus_tag="Tery_0300"
FT   CDS_pept        459720..460340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0300"
FT                   /product="transcriptional activator, TenA family"
FT                   /note="PFAM: TENA/THI-4 protein; KEGG: ath:At3g16990
FT                   TENA/THI-4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49779"
FT                   /db_xref="GOA:Q119P5"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR026285"
FT                   /db_xref="UniProtKB/TrEMBL:Q119P5"
FT                   /protein_id="ABG49779.1"
FT   gene            460361..460780
FT                   /locus_tag="Tery_0301"
FT   CDS_pept        460361..460780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0301"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number=""
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin type; KEGG: syf:Synpcc7942_1431 peptidylprolyl
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49780"
FT                   /db_xref="GOA:Q119P4"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q119P4"
FT                   /protein_id="ABG49780.1"
FT   gene            461870..463597
FT                   /locus_tag="Tery_0302"
FT   CDS_pept        461870..463597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0302"
FT                   /product="flavin reductase-like, FMN-binding"
FT                   /note="PFAM: beta-lactamase-like flavin reductase-like,
FT                   FMN-binding flavodoxin/nitric oxide synthase; KEGG:
FT                   ana:all3895 probable flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49781"
FT                   /db_xref="GOA:Q119P3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q119P3"
FT                   /protein_id="ABG49781.1"
FT   gene            complement(464021..469630)
FT                   /locus_tag="Tery_0303"
FT   CDS_pept        complement(464021..469630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0303"
FT                   /product="alpha-2-macroglobulin-like"
FT                   /note="PFAM: alpha-2-macroglobulin-like
FT                   alpha-2-macroglobulin-like 2; KEGG: ava:Ava_2357
FT                   alpha-2-macroglobulin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49782"
FT                   /db_xref="GOA:Q119P2"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="UniProtKB/TrEMBL:Q119P2"
FT                   /protein_id="ABG49782.1"
FT   gene            470525..470749
FT                   /pseudo
FT                   /locus_tag="Tery_0304"
FT   gene            complement(470844..471815)
FT                   /locus_tag="Tery_0305"
FT   CDS_pept        complement(470844..471815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49783"
FT                   /db_xref="GOA:Q119P1"
FT                   /db_xref="UniProtKB/TrEMBL:Q119P1"
FT                   /protein_id="ABG49783.1"
FT   gene            complement(471882..474209)
FT                   /locus_tag="Tery_0306"
FT   CDS_pept        complement(471882..474209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49784"
FT                   /db_xref="GOA:Q119P0"
FT                   /db_xref="UniProtKB/TrEMBL:Q119P0"
FT                   /protein_id="ABG49784.1"
FT   gene            complement(474219..474887)
FT                   /pseudo
FT                   /locus_tag="Tery_0307"
FT   gene            complement(475370..476356)
FT                   /locus_tag="Tery_0308"
FT   CDS_pept        complement(475370..476356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0308"
FT                   /product="GTP cyclohydrolase subunit MoaA"
FT                   /note="KEGG: ava:Ava_1830 molybdenum cofactor
FT                   synthesis-like; TIGRFAM: molybdenum cofactor biosynthesis
FT                   protein A; PFAM: Radical SAM molybdenum cofactor
FT                   synthesis-like; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49785"
FT                   /db_xref="GOA:Q119N9"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q119N9"
FT                   /protein_id="ABG49785.1"
FT   gene            478266..479129
FT                   /locus_tag="Tery_0309"
FT   CDS_pept        478266..479129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0309"
FT                   /product="conserved Hypothetical protein F26A1.8"
FT                   /note="KEGG: cel:F26A1.8 Hypothetical protein F26A1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49786"
FT                   /db_xref="GOA:Q119N8"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q119N8"
FT                   /protein_id="ABG49786.1"
FT                   QKEYYG"
FT   sig_peptide     478266..478325
FT                   /locus_tag="Tery_0309"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.854) with cleavage site probability 0.587 at
FT                   residue 20"
FT   gene            479268..480356
FT                   /locus_tag="Tery_0310"
FT   CDS_pept        479268..480356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_2472 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49787"
FT                   /db_xref="InterPro:IPR025569"
FT                   /db_xref="UniProtKB/TrEMBL:Q119N7"
FT                   /protein_id="ABG49787.1"
FT   gene            480768..481508
FT                   /locus_tag="Tery_0311"
FT   CDS_pept        480768..481508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0311"
FT                   /product="OmpA/MotB"
FT                   /note="PFAM: OmpA/MotB; KEGG: cyb:CYB_2329 OmpA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49788"
FT                   /db_xref="GOA:Q119N6"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q119N6"
FT                   /protein_id="ABG49788.1"
FT   gene            482431..483828
FT                   /pseudo
FT                   /locus_tag="Tery_0312"
FT   gene            complement(484911..486182)
FT                   /locus_tag="Tery_0313"
FT   CDS_pept        complement(484911..486182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0313"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: ava:Ava_1398 band 7
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49789"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q119N5"
FT                   /protein_id="ABG49789.1"
FT   gene            complement(486705..488087)
FT                   /locus_tag="Tery_0314"
FT   CDS_pept        complement(486705..488087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0314"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: ana:alr4526 similar to
FT                   flotillin"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49790"
FT                   /db_xref="GOA:Q119N4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q119N4"
FT                   /protein_id="ABG49790.1"
FT                   QK"
FT   gene            complement(488217..488453)
FT                   /pseudo
FT                   /locus_tag="Tery_0315"
FT   gene            complement(488541..489149)
FT                   /locus_tag="Tery_0316"
FT   CDS_pept        complement(488541..489149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: syf:Synpcc7942_2500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49791"
FT                   /db_xref="GOA:Q119N3"
FT                   /db_xref="UniProtKB/TrEMBL:Q119N3"
FT                   /protein_id="ABG49791.1"
FT   sig_peptide     complement(489081..489149)
FT                   /locus_tag="Tery_0316"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.985 at
FT                   residue 23"
FT   gene            complement(489261..490346)
FT                   /locus_tag="Tery_0317"
FT   CDS_pept        complement(489261..490346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0317"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_2091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49792"
FT                   /db_xref="InterPro:IPR017481"
FT                   /db_xref="UniProtKB/TrEMBL:Q119N2"
FT                   /protein_id="ABG49792.1"
FT   gene            492550..493929
FT                   /locus_tag="Tery_0318"
FT   CDS_pept        492550..493929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0318"
FT                   /product="putative nicotinate phosphoribosyltransferase"
FT                   /note="TIGRFAM: putative nicotinate
FT                   phosphoribosyltransferase; PFAM: Nicotinate
FT                   phosphoribosyltransferase and related; KEGG: ana:alr2482
FT                   putative nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49793"
FT                   /db_xref="GOA:Q119N1"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:Q119N1"
FT                   /protein_id="ABG49793.1"
FT                   S"
FT   gene            494912..495502
FT                   /locus_tag="Tery_0319"
FT   CDS_pept        494912..495502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0319"
FT                   /product="cytidyltransferase-related domain"
FT                   /note="TIGRFAM: cytidyltransferase-related domain; PFAM:
FT                   cytidylyltransferase; KEGG: ava:Ava_0415 nicotinic acid
FT                   mononucleotide adenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49794"
FT                   /db_xref="GOA:Q119N0"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q119N0"
FT                   /protein_id="ABG49794.1"
FT   gene            495589..496197
FT                   /locus_tag="Tery_0320"
FT   CDS_pept        495589..496197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0320"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: ava:Ava_0416 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49795"
FT                   /db_xref="GOA:Q119M9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q119M9"
FT                   /protein_id="ABG49795.1"
FT   gene            497092..497943
FT                   /locus_tag="Tery_0321"
FT   CDS_pept        497092..497943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49796"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:Q119M8"
FT                   /protein_id="ABG49796.1"
FT                   KV"
FT   sig_peptide     497092..497178
FT                   /locus_tag="Tery_0321"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.724 at
FT                   residue 29"
FT   gene            complement(498095..498529)
FT                   /locus_tag="Tery_0322"
FT   CDS_pept        complement(498095..498529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49797"
FT                   /db_xref="GOA:Q119M7"
FT                   /db_xref="UniProtKB/TrEMBL:Q119M7"
FT                   /protein_id="ABG49797.1"
FT   sig_peptide     complement(498458..498529)
FT                   /locus_tag="Tery_0322"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.464 at
FT                   residue 24"
FT   gene            complement(498617..499183)
FT                   /locus_tag="Tery_0323"
FT   CDS_pept        complement(498617..499183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0323"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:all2736 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49798"
FT                   /db_xref="UniProtKB/TrEMBL:Q119M6"
FT                   /protein_id="ABG49798.1"
FT   gene            499291..499899
FT                   /locus_tag="Tery_0324"
FT   CDS_pept        499291..499899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0324"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="PFAM: ribosomal protein S4 RNA-binding S4; KEGG:
FT                   ava:Ava_4303 30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49799"
FT                   /db_xref="GOA:Q119M5"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q119M5"
FT                   /protein_id="ABG49799.1"
FT   gene            500956..501675
FT                   /locus_tag="Tery_0325"
FT   CDS_pept        500956..501675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0325"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small Methyltransferase type
FT                   12; KEGG: bfs:BF2394 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49800"
FT                   /db_xref="GOA:Q119M4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR022882"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q119M4"
FT                   /protein_id="ABG49800.1"
FT                   TYTPEFITLIKDFYLKY"
FT   gene            502028..502257
FT                   /pseudo
FT                   /locus_tag="Tery_0326"
FT   gene            502599..503360
FT                   /locus_tag="Tery_0327"
FT   CDS_pept        502599..503360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0327"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM: MCP
FT                   methyltransferase, CheR-type Methyltransferase type 11
FT                   Methyltransferase type 12; KEGG: pca:Pcar_0081 conserved
FT                   hypothetical HI0319/3"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49801"
FT                   /db_xref="GOA:Q119M3"
FT                   /db_xref="InterPro:IPR005271"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q119M3"
FT                   /protein_id="ABG49801.1"
FT   gene            503552..503686
FT                   /locus_tag="Tery_0328"
FT   CDS_pept        503552..503686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0328"
FT                   /product="glutathione S-transferase-like"
FT                   /note="KEGG: ava:Ava_2483 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49802"
FT                   /db_xref="GOA:Q119M2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q119M2"
FT                   /protein_id="ABG49802.1"
FT   gene            503708..503887
FT                   /locus_tag="Tery_0329"
FT   CDS_pept        503708..503887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49803"
FT                   /db_xref="UniProtKB/TrEMBL:Q119M1"
FT                   /protein_id="ABG49803.1"
FT                   EKAEEKIATVLTFF"
FT   gene            503895..504053
FT                   /locus_tag="Tery_0330"
FT   CDS_pept        503895..504053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49804"
FT                   /db_xref="GOA:Q119M0"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q119M0"
FT                   /protein_id="ABG49804.1"
FT                   SLIARPA"
FT   gene            complement(504317..505921)
FT                   /locus_tag="Tery_0331"
FT   CDS_pept        complement(504317..505921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0331"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   dar:Daro_0045 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49805"
FT                   /db_xref="GOA:Q119L9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q119L9"
FT                   /protein_id="ABG49805.1"
FT                   TANESWQLKPIITLDKR"
FT   gene            complement(506652..507881)
FT                   /locus_tag="Tery_0332"
FT   CDS_pept        complement(506652..507881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0332"
FT                   /product="Na+ dependent nucleoside transporter-like"
FT                   /note="PFAM: Na+ dependent nucleoside transporter
FT                   nucleoside recognition Na+ dependent nucleoside
FT                   transporter-like; KEGG: ana:all0378 sodium-dependent
FT                   nucleoside transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49806"
FT                   /db_xref="GOA:Q119L8"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="InterPro:IPR018270"
FT                   /db_xref="UniProtKB/TrEMBL:Q119L8"
FT                   /protein_id="ABG49806.1"
FT                   MTACIAGILL"
FT   sig_peptide     complement(507813..507881)
FT                   /locus_tag="Tery_0332"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.729) with cleavage site probability 0.362 at
FT                   residue 23"
FT   gene            509153..510514
FT                   /locus_tag="Tery_0333"
FT   CDS_pept        509153..510514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0333"
FT                   /product="small GTP-binding protein"
FT                   /note="KEGG: ava:Ava_2896 GTP-binding protein EngA;
FT                   TIGRFAM: small GTP-binding protein GTP-binding; PFAM:
FT                   GTP-binding protein, HSR1-related; SMART: ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49807"
FT                   /db_xref="GOA:Q119L7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q119L7"
FT                   /protein_id="ABG49807.1"
FT   gene            510841..512151
FT                   /locus_tag="Tery_0334"
FT   CDS_pept        510841..512151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0334"
FT                   /product="conserved hypothetical protein 698"
FT                   /note="PFAM: conserved hypothetical protein 698; KEGG:
FT                   rba:RB9488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49808"
FT                   /db_xref="GOA:Q119L6"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:Q119L6"
FT                   /protein_id="ABG49808.1"
FT   gene            complement(513120..513839)
FT                   /locus_tag="Tery_0335"
FT   CDS_pept        complement(513120..513839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0335"
FT                   /product="Heme oxygenase (decyclizing)"
FT                   /EC_number=""
FT                   /note="PFAM: Haem oxygenase; KEGG: ava:Ava_3767 heme
FT                   oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49809"
FT                   /db_xref="GOA:Q119L5"
FT                   /db_xref="InterPro:IPR002051"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR018207"
FT                   /db_xref="UniProtKB/TrEMBL:Q119L5"
FT                   /protein_id="ABG49809.1"
FT                   LTRKRTAGSTELATAAE"
FT   gene            515297..516334
FT                   /locus_tag="Tery_0336"
FT   CDS_pept        515297..516334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0336"
FT                   /product="protein of unknown function DUF187"
FT                   /note="PFAM: protein of unknown function DUF187; KEGG:
FT                   gvi:glr1802 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49810"
FT                   /db_xref="GOA:Q119L4"
FT                   /db_xref="InterPro:IPR003790"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q119L4"
FT                   /protein_id="ABG49810.1"
FT                   KYVYN"
FT   gene            complement(516434..517675)
FT                   /locus_tag="Tery_0337"
FT   CDS_pept        complement(516434..517675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0337"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_A0007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49811"
FT                   /db_xref="GOA:Q119L3"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q119L3"
FT                   /protein_id="ABG49811.1"
FT                   SRHVYDRMMAMDSK"
FT   gene            518226..518862
FT                   /pseudo
FT                   /locus_tag="Tery_0338"
FT   gene            520009..522129
FT                   /locus_tag="Tery_0339"
FT   CDS_pept        520009..522129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0339"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number=""
FT                   /note="PFAM: cell wall hydrolase/autolysin; KEGG:
FT                   ava:Ava_1465 cell wall hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49812"
FT                   /db_xref="GOA:Q119L2"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:Q119L2"
FT                   /protein_id="ABG49812.1"
FT                   RGILKYVQVYYR"
FT   sig_peptide     520009..520140
FT                   /locus_tag="Tery_0339"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.987 at
FT                   residue 44"
FT   gene            complement(522487..523410)
FT                   /locus_tag="Tery_0340"
FT   CDS_pept        complement(522487..523410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0340"
FT                   /product="glucokinase regulatory-like protein"
FT                   /note="TIGRFAM: glucokinase regulatory-like protein; KEGG:
FT                   ava:Ava_0242 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49813"
FT                   /db_xref="GOA:Q119L1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q119L1"
FT                   /protein_id="ABG49813.1"
FT   gene            complement(523930..524292)
FT                   /locus_tag="Tery_0341"
FT   CDS_pept        complement(523930..524292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0341"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0241 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49814"
FT                   /db_xref="InterPro:IPR021503"
FT                   /db_xref="UniProtKB/TrEMBL:Q119L0"
FT                   /protein_id="ABG49814.1"
FT                   TEADLDKIRRQLEGLL"
FT   gene            525128..532096
FT                   /locus_tag="Tery_0342"
FT   CDS_pept        525128..532096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0342"
FT                   /product="protein of unknown function DUF490"
FT                   /note="PFAM: protein of unknown function DUF490; KEGG:
FT                   ana:all2430 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49815"
FT                   /db_xref="GOA:Q119K9"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:Q119K9"
FT                   /protein_id="ABG49815.1"
FT   sig_peptide     525128..525241
FT                   /locus_tag="Tery_0342"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.652) with cleavage site probability 0.431 at
FT                   residue 38"
FT   gene            complement(532606..532974)
FT                   /pseudo
FT                   /locus_tag="Tery_0343"
FT   gene            complement(533221..533520)
FT                   /pseudo
FT                   /locus_tag="Tery_0344"
FT   gene            534200..535810
FT                   /locus_tag="Tery_0345"
FT   CDS_pept        534200..535810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49816"
FT                   /db_xref="InterPro:IPR021787"
FT                   /db_xref="UniProtKB/TrEMBL:Q119K8"
FT                   /protein_id="ABG49816.1"
FT   sig_peptide     534200..534262
FT                   /locus_tag="Tery_0345"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.934 at
FT                   residue 21"
FT   gene            complement(536247..536486)
FT                   /locus_tag="Tery_0346"
FT   CDS_pept        complement(536247..536486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0346"
FT                   /product="phenolpthiocerol synthesis polyketide synthase
FT                   PpsA"
FT                   /note="KEGG: mag:amb1949 phenolpthiocerol synthesis
FT                   polyketide synthase PpsA"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49817"
FT                   /db_xref="GOA:Q119K7"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="UniProtKB/TrEMBL:Q119K7"
FT                   /protein_id="ABG49817.1"
FT   gene            complement(536956..538086)
FT                   /locus_tag="Tery_0347"
FT   CDS_pept        complement(536956..538086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0347"
FT                   /product="CO2 hydration protein"
FT                   /note="TIGRFAM: CO2 hydration protein; KEGG: ana:alr0871
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49818"
FT                   /db_xref="InterPro:IPR010220"
FT                   /db_xref="UniProtKB/TrEMBL:Q119K6"
FT                   /protein_id="ABG49818.1"
FT   gene            complement(538091..539179)
FT                   /locus_tag="Tery_0348"
FT   CDS_pept        complement(538091..539179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0348"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase, IS891/IS1136/IS1341 transposase,
FT                   IS605 OrfB; KEGG: ava:Ava_1829 transposase,
FT                   IS891/IS1136/IS1341"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49819"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q119K5"
FT                   /protein_id="ABG49819.1"
FT   gene            complement(540346..541866)
FT                   /locus_tag="Tery_0349"
FT   CDS_pept        complement(540346..541866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0349"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /EC_number=""
FT                   /note="KEGG: ava:Ava_4474 NADH dehydrogenase subunit M;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain M; PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49820"
FT                   /db_xref="GOA:Q119K4"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:Q119K4"
FT                   /protein_id="ABG49820.1"
FT   gene            542293..542511
FT                   /pseudo
FT                   /locus_tag="Tery_0350"
FT   gene            543311..544138
FT                   /locus_tag="Tery_0351"
FT   CDS_pept        543311..544138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0351"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: ava:Ava_1799
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49821"
FT                   /db_xref="GOA:Q119K3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q119K3"
FT                   /protein_id="ABG49821.1"
FT   gene            complement(544282..545463)
FT                   /locus_tag="Tery_0352"
FT   CDS_pept        complement(544282..545463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0352"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number=""
FT                   /note="KEGG: ava:Ava_2819 8-amino-7-oxononanoate synthase;
FT                   TIGRFAM: 8-amino-7-oxononanoate synthase; PFAM:
FT                   aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49822"
FT                   /db_xref="GOA:Q119K2"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q119K2"
FT                   /protein_id="ABG49822.1"
FT   gene            546691..547593
FT                   /locus_tag="Tery_0353"
FT   CDS_pept        546691..547593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0353"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11 Methyltransferase
FT                   type 12; KEGG: syf:Synpcc7942_2054 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49823"
FT                   /db_xref="GOA:Q119K1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q119K1"
FT                   /protein_id="ABG49823.1"
FT   gene            547614..547883
FT                   /pseudo
FT                   /locus_tag="Tery_0354"
FT   gene            548063..548857
FT                   /locus_tag="Tery_0355"
FT   CDS_pept        548063..548857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr7346 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49824"
FT                   /db_xref="GOA:Q119K0"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022017"
FT                   /db_xref="UniProtKB/TrEMBL:Q119K0"
FT                   /protein_id="ABG49824.1"
FT   gene            549606..550889
FT                   /locus_tag="Tery_0356"
FT   CDS_pept        549606..550889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0356"
FT                   /product="glutaredoxin"
FT                   /note="PFAM: Phycobilisome protein glutaredoxin glutathione
FT                   S-transferase-like; KEGG: ava:Ava_5006 glutathione
FT                   S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49825"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q119J9"
FT                   /protein_id="ABG49825.1"
FT   gene            complement(551119..551400)
FT                   /locus_tag="Tery_0357"
FT   CDS_pept        complement(551119..551400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0357"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:asl1502 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49826"
FT                   /db_xref="GOA:Q119J8"
FT                   /db_xref="UniProtKB/TrEMBL:Q119J8"
FT                   /protein_id="ABG49826.1"
FT   sig_peptide     complement(551296..551400)
FT                   /locus_tag="Tery_0357"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.605) with cleavage site probability 0.394 at
FT                   residue 35"
FT   gene            complement(551450..551788)
FT                   /locus_tag="Tery_0358"
FT   CDS_pept        complement(551450..551788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49827"
FT                   /db_xref="GOA:Q119J7"
FT                   /db_xref="UniProtKB/TrEMBL:Q119J7"
FT                   /protein_id="ABG49827.1"
FT                   SMKSYLLR"
FT   gene            551971..553365
FT                   /locus_tag="Tery_0359"
FT   CDS_pept        551971..553365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0359"
FT                   /product="multicopper oxidase, type 3"
FT                   /note="PFAM: multicopper oxidase, type 1 multicopper
FT                   oxidase, type 2 multicopper oxidase, type 3; KEGG:
FT                   tth:TTC1370 laccase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49828"
FT                   /db_xref="GOA:Q119J6"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:Q119J6"
FT                   /protein_id="ABG49828.1"
FT                   KARLSI"
FT   gene            553419..553976
FT                   /locus_tag="Tery_0360"
FT   CDS_pept        553419..553976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0360"
FT                   /product="protein of unknown function DUF411"
FT                   /note="PFAM: protein of unknown function DUF411; KEGG:
FT                   noc:Noc_0535 protein of unknown function DUF411"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49829"
FT                   /db_xref="GOA:Q119J5"
FT                   /db_xref="InterPro:IPR007332"
FT                   /db_xref="UniProtKB/TrEMBL:Q119J5"
FT                   /protein_id="ABG49829.1"
FT   sig_peptide     553419..553490
FT                   /locus_tag="Tery_0360"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.907 at
FT                   residue 24"
FT   gene            complement(554156..554713)
FT                   /locus_tag="Tery_0361"
FT   CDS_pept        complement(554156..554713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49830"
FT                   /db_xref="UniProtKB/TrEMBL:Q119J4"
FT                   /protein_id="ABG49830.1"
FT   gene            complement(555242..555889)
FT                   /locus_tag="Tery_0362"
FT   CDS_pept        complement(555242..555889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0362"
FT                   /product="Dephospho-CoA kinase"
FT                   /EC_number=""
FT                   /note="KEGG: ava:Ava_0282 dephospho-CoA kinase; TIGRFAM:
FT                   dephospho-CoA kinase; PFAM: Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49831"
FT                   /db_xref="GOA:Q119J3"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q119J3"
FT                   /protein_id="ABG49831.1"
FT   gene            556288..561606
FT                   /locus_tag="Tery_0363"
FT   CDS_pept        556288..561606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0363"
FT                   /product="filamentous haemagglutinin family outer membrane
FT                   protein"
FT                   /note="TIGRFAM: filamentous haemagglutinin family outer
FT                   membrane protein; PFAM: filamentous haemagglutinin-like;
FT                   KEGG: syn:slr1753 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49832"
FT                   /db_xref="GOA:Q119J2"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:Q119J2"
FT                   /protein_id="ABG49832.1"
FT                   SHPYYWASFTMIGSPW"
FT   gene            complement(562495..563130)
FT                   /locus_tag="Tery_0364"
FT   CDS_pept        complement(562495..563130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0364"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase Methyltransferase
FT                   type 11 Methyltransferase type 12; KEGG: sru:SRU_1592
FT                   menaquinone biosynthesis methyltransferase UbiE"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49833"
FT                   /db_xref="GOA:Q119J1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q119J1"
FT                   /protein_id="ABG49833.1"
FT   gene            563584..564342
FT                   /locus_tag="Tery_0365"
FT   CDS_pept        563584..564342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0365"
FT                   /product="phosphonate ABC transporter, ATPase subunit"
FT                   /note="KEGG: ana:all8090 phosphonate transport system
FT                   ATP-binding protein; TIGRFAM: phosphonate ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; SMART:
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49834"
FT                   /db_xref="GOA:Q119J0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q119J0"
FT                   /protein_id="ABG49834.1"
FT   gene            564791..565687
FT                   /locus_tag="Tery_0366"
FT   CDS_pept        564791..565687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0366"
FT                   /product="phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /note="TIGRFAM: phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein; KEGG: ana:all8089 putative
FT                   phosphonate transport system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49835"
FT                   /db_xref="GOA:Q119I9"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="PDB:5JVB"
FT                   /db_xref="PDB:5LQ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q119I9"
FT                   /protein_id="ABG49835.1"
FT                   VRNLGEVLELNFEQLNK"
FT   sig_peptide     564791..564874
FT                   /locus_tag="Tery_0366"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.538 at
FT                   residue 28"
FT   gene            565744..566562
FT                   /locus_tag="Tery_0367"
FT   CDS_pept        565744..566562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0367"
FT                   /product="phosphonate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: phosphonate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ana:all8088 phosphonate
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49836"
FT                   /db_xref="GOA:Q119I8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q119I8"
FT                   /protein_id="ABG49836.1"
FT   gene            566682..567677
FT                   /locus_tag="Tery_0368"
FT   CDS_pept        566682..567677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0368"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic region D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD-binding; KEGG: ana:all8087 glycerate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49837"
FT                   /db_xref="GOA:Q119I7"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q119I7"
FT                   /protein_id="ABG49837.1"
FT   gene            complement(568161..568865)
FT                   /locus_tag="Tery_0369"
FT   CDS_pept        complement(568161..568865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0369"
FT                   /product="TENA/THI-4 protein"
FT                   /note="PFAM: TENA/THI-4 protein; KEGG: cca:CCA00996
FT                   coenzyme pqq synthesis protein c, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49838"
FT                   /db_xref="GOA:Q119I6"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027572"
FT                   /db_xref="InterPro:IPR039068"
FT                   /db_xref="UniProtKB/TrEMBL:Q119I6"
FT                   /protein_id="ABG49838.1"
FT                   DGVYEEYCQAVN"
FT   gene            complement(569567..570250)
FT                   /locus_tag="Tery_0370"
FT   CDS_pept        complement(569567..570250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49839"
FT                   /db_xref="UniProtKB/TrEMBL:Q119I5"
FT                   /protein_id="ABG49839.1"
FT                   KSLSC"
FT   gene            complement(570659..571606)
FT                   /locus_tag="Tery_0371"
FT   CDS_pept        complement(570659..571606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0371"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane Protein of unknown function DUF250; KEGG:
FT                   ava:Ava_4331 protein of unknown function DUF6,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49840"
FT                   /db_xref="GOA:Q119I4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q119I4"
FT                   /protein_id="ABG49840.1"
FT   gene            complement(572149..572221)
FT                   /locus_tag="Tery_R0005"
FT                   /note="tRNA-Glu1"
FT   tRNA            complement(572149..572221)
FT                   /locus_tag="Tery_R0005"
FT                   /product="tRNA-Glu"
FT   gene            complement(572415..573554)
FT                   /locus_tag="Tery_0372"
FT   CDS_pept        complement(572415..573554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0372"
FT                   /product="S-layer region-like"
FT                   /note="KEGG: ava:Ava_3184 S-layer region-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49841"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:Q119I3"
FT                   /protein_id="ABG49841.1"
FT   sig_peptide     complement(573474..573554)
FT                   /locus_tag="Tery_0372"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 27"
FT   gene            complement(573749..574606)
FT                   /locus_tag="Tery_0373"
FT   CDS_pept        complement(573749..574606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_2973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49842"
FT                   /db_xref="GOA:Q119I2"
FT                   /db_xref="InterPro:IPR025325"
FT                   /db_xref="UniProtKB/TrEMBL:Q119I2"
FT                   /protein_id="ABG49842.1"
FT                   MLIK"
FT   gene            complement(575477..576270)
FT                   /pseudo
FT                   /locus_tag="Tery_0374"
FT   gene            complement(577302..578246)
FT                   /locus_tag="Tery_0375"
FT   CDS_pept        complement(577302..578246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0375"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CAC2816 hypothetical protein, CF-17
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49843"
FT                   /db_xref="UniProtKB/TrEMBL:Q119I1"
FT                   /protein_id="ABG49843.1"
FT   gene            complement(578538..580040)
FT                   /locus_tag="Tery_0376"
FT   CDS_pept        complement(578538..580040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0376"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number=""
FT                   /note="KEGG: ana:alr2945 probable orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49844"
FT                   /db_xref="GOA:Q119I0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q119I0"
FT                   /protein_id="ABG49844.1"
FT   gene            581688..583043
FT                   /locus_tag="Tery_0377"
FT   CDS_pept        581688..583043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0377"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /note="KEGG: ava:Ava_3037 tRNA-i(6)A37 modification enzyme
FT                   MiaB; TIGRFAM: RNA modification enzyme, MiaB family
FT                   tRNA-i(6)A37 thiotransferase enzyme MiaB; PFAM:
FT                   deoxyribonuclease/rho motif-related TRAM protein of unknown
FT                   function UPF0004 Radical SAM; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49845"
FT                   /db_xref="GOA:Q119H9"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q119H9"
FT                   /protein_id="ABG49845.1"
FT   gene            583692..585479
FT                   /locus_tag="Tery_0378"
FT   CDS_pept        583692..585479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0378"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15)
FT                   Polypeptide-transport-associated, ShlB-type; KEGG:
FT                   ava:Ava_4426 surface antigen variable number"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49846"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:Q119H8"
FT                   /protein_id="ABG49846.1"
FT   sig_peptide     583692..583778
FT                   /locus_tag="Tery_0378"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.868) with cleavage site probability 0.867 at
FT                   residue 29"
FT   gene            585492..588713
FT                   /locus_tag="Tery_0379"
FT   CDS_pept        585492..588713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0379"
FT                   /product="filamentous haemagglutinin family outer membrane
FT                   protein"
FT                   /note="TIGRFAM: filamentous haemagglutinin family outer
FT                   membrane protein; PFAM: filamentous haemagglutinin-like;
FT                   KEGG: ana:alr1397 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49847"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:Q119H7"
FT                   /protein_id="ABG49847.1"
FT   sig_peptide     585492..585575
FT                   /locus_tag="Tery_0379"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.971 at
FT                   residue 28"
FT   gene            588749..591631
FT                   /locus_tag="Tery_0380"
FT   CDS_pept        588749..591631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0380"
FT                   /product="Tetratricopeptide region"
FT                   /note="SMART: Tetratricopeptide region; KEGG: ana:all2170
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49848"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:Q119H6"
FT                   /protein_id="ABG49848.1"
FT   sig_peptide     588749..588880
FT                   /locus_tag="Tery_0380"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 44"
FT   gene            complement(591650..592441)
FT                   /locus_tag="Tery_0381"
FT   CDS_pept        complement(591650..592441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0381"
FT                   /product="protein of unknown function DUF928"
FT                   /note="PFAM: protein of unknown function DUF928; KEGG:
FT                   ana:all3179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49849"
FT                   /db_xref="InterPro:IPR010328"
FT                   /db_xref="UniProtKB/TrEMBL:Q119H5"
FT                   /protein_id="ABG49849.1"
FT   sig_peptide     complement(592376..592441)
FT                   /locus_tag="Tery_0381"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.606 at
FT                   residue 22"
FT   gene            complement(592556..594907)
FT                   /locus_tag="Tery_0382"
FT   CDS_pept        complement(592556..594907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0382"
FT                   /product="putative Chase2 sensor protein"
FT                   /note="PFAM: CHASE2 peptidase C14, caspase catalytic
FT                   subunit p20; KEGG: ava:Ava_3878 possible sensor with CHASE2
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49850"
FT                   /db_xref="GOA:Q119H4"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:Q119H4"
FT                   /protein_id="ABG49850.1"
FT   gene            complement(595024..595416)
FT                   /locus_tag="Tery_0383"
FT   CDS_pept        complement(595024..595416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49851"
FT                   /db_xref="UniProtKB/TrEMBL:Q119H3"
FT                   /protein_id="ABG49851.1"
FT   gene            complement(595539..596810)
FT                   /locus_tag="Tery_0384"
FT   CDS_pept        complement(595539..596810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0384"
FT                   /product="WD-40 repeat"
FT                   /note="PFAM: WD-40 repeat; KEGG: ani:AN8468.2 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49852"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q119H2"
FT                   /protein_id="ABG49852.1"
FT   gene            597558..598646
FT                   /locus_tag="Tery_0385"
FT   CDS_pept        597558..598646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0385"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: sigma-70 region 2 sigma-70 region 4 Sigma-70,
FT                   region 4 type 2; KEGG: mta:Moth_2362 sigma-24 (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49853"
FT                   /db_xref="GOA:Q119H1"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q119H1"
FT                   /protein_id="ABG49853.1"
FT   gene            599368..599778
FT                   /locus_tag="Tery_0386"
FT   CDS_pept        599368..599778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49854"
FT                   /db_xref="UniProtKB/TrEMBL:Q119H0"
FT                   /protein_id="ABG49854.1"
FT   sig_peptide     599368..599457
FT                   /locus_tag="Tery_0386"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 30"
FT   gene            600305..603121
FT                   /locus_tag="Tery_0387"
FT   CDS_pept        600305..603121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0387"
FT                   /product="Cadherin"
FT                   /note="PFAM: Hemolysin-type calcium-binding region
FT                   Cadherin; SMART: Dystroglycan-type cadherin-like; KEGG:
FT                   ava:Ava_0582 integrins alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49855"
FT                   /db_xref="GOA:Q119G9"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR003995"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR010620"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="UniProtKB/TrEMBL:Q119G9"
FT                   /protein_id="ABG49855.1"
FT                   INDGSVFI"
FT   gene            603425..603682
FT                   /locus_tag="Tery_0388"
FT   CDS_pept        603425..603682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49856"
FT                   /db_xref="GOA:Q119G8"
FT                   /db_xref="UniProtKB/TrEMBL:Q119G8"
FT                   /protein_id="ABG49856.1"
FT   sig_peptide     603425..603523
FT                   /locus_tag="Tery_0388"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.929) with cleavage site probability 0.908 at
FT                   residue 33"
FT   gene            603834..605684
FT                   /locus_tag="Tery_0389"
FT   CDS_pept        603834..605684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0389"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_4063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49857"
FT                   /db_xref="UniProtKB/TrEMBL:Q119G7"
FT                   /protein_id="ABG49857.1"
FT   gene            complement(605999..606187)
FT                   /locus_tag="Tery_0390"
FT   CDS_pept        complement(605999..606187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr2709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49858"
FT                   /db_xref="GOA:Q119G6"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="UniProtKB/TrEMBL:Q119G6"
FT                   /protein_id="ABG49858.1"
FT                   KYNFKEKKTVNTFFLRV"
FT   gene            complement(606398..606628)
FT                   /locus_tag="Tery_0391"
FT   CDS_pept        complement(606398..606628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49859"
FT                   /db_xref="UniProtKB/TrEMBL:Q119G5"
FT                   /protein_id="ABG49859.1"
FT   gene            606874..607626
FT                   /locus_tag="Tery_0392"
FT   CDS_pept        606874..607626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0392"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number=""
FT                   /note="PFAM: dienelactone hydrolase; KEGG: ava:Ava_0533
FT                   dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49860"
FT                   /db_xref="GOA:Q119G4"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q119G4"
FT                   /protein_id="ABG49860.1"
FT   gene            608237..608632
FT                   /locus_tag="Tery_0393"
FT   CDS_pept        608237..608632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0393"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; KEGG:
FT                   ava:Ava_B0071 transposase, IS891/IS1136/IS1341"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49861"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q119G3"
FT                   /protein_id="ABG49861.1"
FT   gene            complement(609071..609604)
FT                   /locus_tag="Tery_0394"
FT   CDS_pept        complement(609071..609604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0394"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number=""
FT                   /note="KEGG: lic:LIC10545 peptide methionine sulfoxide
FT                   reductase; TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49862"
FT                   /db_xref="GOA:Q119G2"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q119G2"
FT                   /protein_id="ABG49862.1"
FT                   LQKLKKYFPDQVSA"
FT   gene            609824..610243
FT                   /pseudo
FT                   /locus_tag="Tery_0395"
FT   gene            complement(611164..611595)
FT                   /pseudo
FT                   /locus_tag="Tery_0396"
FT   gene            complement(612482..618103)
FT                   /locus_tag="Tery_0397"
FT   CDS_pept        complement(612482..618103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0397"
FT                   /product="phage Tail Collar"
FT                   /note="PFAM: Collagen triple helix repeat phage Tail
FT                   Collar; KEGG: mlo:mlr0587 hypothetical glycine-rich
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49863"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:Q119G1"
FT                   /protein_id="ABG49863.1"
FT   gene            620588..621844
FT                   /locus_tag="Tery_0398"
FT   CDS_pept        620588..621844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0398"
FT                   /product="UDP-sulfoquinovose synthase"
FT                   /EC_number=""
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   ana:alr1744 sulfolipid biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49864"
FT                   /db_xref="GOA:Q119G0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q119G0"
FT                   /protein_id="ABG49864.1"
FT   gene            622277..623410
FT                   /locus_tag="Tery_0399"
FT   CDS_pept        622277..623410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0399"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   ava:Ava_0090 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49865"
FT                   /db_xref="GOA:Q119F9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q119F9"
FT                   /protein_id="ABG49865.1"
FT   gene            623997..626591
FT                   /locus_tag="Tery_0400"
FT   CDS_pept        623997..626591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0400"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase
FT                   GAF Tetratricopeptide TPR_3; SMART: PAS; KEGG: ava:Ava_0091
FT                   adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49866"
FT                   /db_xref="GOA:Q119F8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q119F8"
FT                   /protein_id="ABG49866.1"
FT   gene            627137..627862
FT                   /locus_tag="Tery_0401"
FT   CDS_pept        627137..627862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0401"
FT                   /product="pentapeptide repeat"
FT                   /note="PFAM: pentapeptide repeat; KEGG: tel:tll0709
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49867"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q119F7"
FT                   /protein_id="ABG49867.1"
FT   sig_peptide     627137..627208
FT                   /locus_tag="Tery_0401"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.728) with cleavage site probability 0.699 at
FT                   residue 24"
FT   gene            628071..628838
FT                   /locus_tag="Tery_0402"
FT   CDS_pept        628071..628838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0402"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number=""
FT                   /note="TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24; KEGG: ava:Ava_0754 methionine
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49868"
FT                   /db_xref="GOA:Q119F6"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q119F6"
FT                   /protein_id="ABG49868.1"
FT   gene            629701..630027
FT                   /pseudo
FT                   /locus_tag="Tery_0403"
FT   gene            631426..633651
FT                   /locus_tag="Tery_0404"
FT   CDS_pept        631426..633651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0404"
FT                   /product="oxidoreductase alpha (molybdopterin) subunit"
FT                   /note="TIGRFAM: oxidoreductase alpha (molybdopterin)
FT                   subunit; PFAM: molybdopterin oxidoreductase molydopterin
FT                   dinucleotide-binding region; KEGG: ttj:TTHB197 probable
FT                   formate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49869"
FT                   /db_xref="GOA:Q119F5"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:Q119F5"
FT                   /protein_id="ABG49869.1"
FT   gene            complement(634051..636180)
FT                   /locus_tag="Tery_0405"
FT   CDS_pept        complement(634051..636180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0405"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; KEGG:
FT                   bja:bll7673 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49870"
FT                   /db_xref="GOA:Q119F4"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:Q119F4"
FT                   /protein_id="ABG49870.1"
FT                   KIENIIFEGNNIFVG"
FT   gene            637017..637871
FT                   /locus_tag="Tery_0406"
FT   CDS_pept        637017..637871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0406"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase, subunit FdhD;
FT                   KEGG: sma:SAV1837 putative protein associated with
FT                   oxidoreductase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49871"
FT                   /db_xref="GOA:Q119F3"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q119F3"
FT                   /protein_id="ABG49871.1"
FT                   RIK"
FT   gene            638761..639687
FT                   /locus_tag="Tery_0407"
FT   CDS_pept        638761..639687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0407"
FT                   /product="nuclease (SNase-like)"
FT                   /note="PFAM: nuclease (SNase-like); KEGG: sha:SH1688
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49872"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q119F2"
FT                   /protein_id="ABG49872.1"
FT   gene            640658..641164
FT                   /pseudo
FT                   /locus_tag="Tery_0408"
FT   gene            complement(641535..642221)
FT                   /locus_tag="Tery_0409"
FT   CDS_pept        complement(641535..642221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0409"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase-like hydrolase;
FT                   KEGG: ava:Ava_4630 HAD-superfamily hydrolase subfamily IA,
FT                   variant 3"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49873"
FT                   /db_xref="GOA:Q119F1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q119F1"
FT                   /protein_id="ABG49873.1"
FT                   YLKYSA"
FT   gene            complement(644189..644608)
FT                   /locus_tag="Tery_0410"
FT   CDS_pept        complement(644189..644608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0410"
FT                   /product="WD-40 repeat"
FT                   /note="PFAM: WD-40 repeat; KEGG: mac:MA2580 WD-domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49874"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q119F0"
FT                   /protein_id="ABG49874.1"
FT   gene            complement(645123..645503)
FT                   /pseudo
FT                   /locus_tag="Tery_0411"
FT   gene            complement(645965..646633)
FT                   /locus_tag="Tery_0412"
FT   CDS_pept        complement(645965..646633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0412"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG:
FT                   reu:Reut_A1154 phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49875"
FT                   /db_xref="GOA:Q119E9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q119E9"
FT                   /protein_id="ABG49875.1"
FT                   "
FT   gene            647650..648378
FT                   /locus_tag="Tery_0413"
FT   CDS_pept        647650..648378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0413"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   ava:Ava_0893 phage SPO1 DNA polymerase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49876"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q119E8"
FT                   /protein_id="ABG49876.1"
FT   gene            complement(648930..650492)
FT                   /locus_tag="Tery_0414"
FT   CDS_pept        complement(648930..650492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cya:CYA_1695 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49877"
FT                   /db_xref="GOA:Q119E7"
FT                   /db_xref="InterPro:IPR018650"
FT                   /db_xref="UniProtKB/TrEMBL:Q119E7"
FT                   /protein_id="ABG49877.1"
FT                   QII"
FT   gene            complement(650769..652265)
FT                   /locus_tag="Tery_0415"
FT   CDS_pept        complement(650769..652265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: syn:sll1352 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49878"
FT                   /db_xref="GOA:Q119E6"
FT                   /db_xref="InterPro:IPR018650"
FT                   /db_xref="UniProtKB/TrEMBL:Q119E6"
FT                   /protein_id="ABG49878.1"
FT   gene            652887..654566
FT                   /locus_tag="Tery_0416"
FT   CDS_pept        652887..654566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0416"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number=""
FT                   /note="KEGG: ava:Ava_1300 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; TIGRFAM: 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; PFAM: TPR repeat Tetratricopeptide TPR_2
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase-like;
FT                   SMART: Tetratricopeptide region"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49879"
FT                   /db_xref="GOA:Q119E5"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q119E5"
FT                   /protein_id="ABG49879.1"
FT   gene            654900..656402
FT                   /locus_tag="Tery_0417"
FT   CDS_pept        654900..656402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0417"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: ava:Ava_1070 peptidase
FT                   M50"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49880"
FT                   /db_xref="GOA:Q119E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q119E4"
FT                   /protein_id="ABG49880.1"
FT   gene            657755..658105
FT                   /pseudo
FT                   /locus_tag="Tery_0418"
FT   gene            659042..662110
FT                   /locus_tag="Tery_0419"
FT   CDS_pept        659042..662110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0419"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; SMART:
FT                   CHRD; KEGG: ana:alr0791 outer membrane secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49881"
FT                   /db_xref="GOA:Q119E3"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR010895"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="UniProtKB/TrEMBL:Q119E3"
FT                   /protein_id="ABG49881.1"
FT   gene            663633..663986
FT                   /locus_tag="Tery_0420"
FT   CDS_pept        663633..663986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0420"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: gvi:glr3633 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49882"
FT                   /db_xref="GOA:Q119E2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q119E2"
FT                   /protein_id="ABG49882.1"
FT                   YLVSLLQPTKVSK"
FT   gene            664213..664440
FT                   /locus_tag="Tery_0421"
FT   CDS_pept        664213..664440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0421"
FT                   /product="transposase, IS5 family"
FT                   /note="KEGG: syn:sll1791 putative transposase gene of IS5
FT                   family insertion sequence ISY802a"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49883"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q10UX5"
FT                   /protein_id="ABG49883.1"
FT   gene            664452..664913
FT                   /pseudo
FT                   /locus_tag="Tery_0422"
FT   gene            complement(664960..665406)
FT                   /pseudo
FT                   /locus_tag="Tery_0423"
FT   gene            complement(666287..669340)
FT                   /locus_tag="Tery_0424"
FT   CDS_pept        complement(666287..669340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0424"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; SMART:
FT                   CHRD; KEGG: ana:alr0791 outer membrane secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49884"
FT                   /db_xref="GOA:Q119E0"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR010895"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="UniProtKB/TrEMBL:Q119E0"
FT                   /protein_id="ABG49884.1"
FT   gene            complement(669642..675599)
FT                   /locus_tag="Tery_0425"
FT   CDS_pept        complement(669642..675599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0425"
FT                   /product="Protein splicing site"
FT                   /note="TIGRFAM: Protein splicing (intein) site; SMART:
FT                   Hedgehog/intein hint domain-like Hedgehog/intein hint-like;
FT                   KEGG: ana:all4035 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49885"
FT                   /db_xref="GOA:Q119D9"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR007869"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:Q119D9"
FT                   /protein_id="ABG49885.1"
FT   gene            complement(675849..677618)
FT                   /locus_tag="Tery_0426"
FT   CDS_pept        complement(675849..677618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0426"
FT                   /product="RNA-directed DNA polymerase"
FT                   /EC_number=""
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase) HNH endonuclease Group II intron,
FT                   maturase-specific; SMART: HNH nuclease; KEGG: ana:alr8560
FT                   reverse transcriptase homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49886"
FT                   /db_xref="GOA:Q119D8"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="UniProtKB/TrEMBL:Q119D8"
FT                   /protein_id="ABG49886.1"
FT                   KTALERETSQSED"
FT   gene            677883..678125
FT                   /locus_tag="Tery_0427"
FT   CDS_pept        677883..678125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49887"
FT                   /db_xref="GOA:Q119D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q119D7"
FT                   /protein_id="ABG49887.1"
FT   gene            complement(678196..678477)
FT                   /locus_tag="Tery_0428"
FT   CDS_pept        complement(678196..678477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0428"
FT                   /product="RP ribonucleotide reductase-like"
FT                   /note="KEGG: ava:Ava_1670 RP ribonucleotide reductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49888"
FT                   /db_xref="UniProtKB/TrEMBL:Q119D6"
FT                   /protein_id="ABG49888.1"
FT   gene            complement(678691..678861)
FT                   /pseudo
FT                   /locus_tag="Tery_0429"
FT   gene            complement(679466..679681)
FT                   /locus_tag="Tery_0430"
FT   CDS_pept        complement(679466..679681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49889"
FT                   /db_xref="UniProtKB/TrEMBL:Q119D5"
FT                   /protein_id="ABG49889.1"
FT   gene            679909..680187
FT                   /locus_tag="Tery_0431"
FT   CDS_pept        679909..680187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49890"
FT                   /db_xref="UniProtKB/TrEMBL:Q119D4"
FT                   /protein_id="ABG49890.1"
FT   gene            complement(680792..682300)
FT                   /locus_tag="Tery_0432"
FT   CDS_pept        complement(680792..682300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0432"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase) Group II intron, maturase-specific; KEGG:
FT                   ana:alr8560 reverse transcriptase homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49891"
FT                   /db_xref="GOA:Q119D3"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="UniProtKB/TrEMBL:Q119D3"
FT                   /protein_id="ABG49891.1"
FT   gene            complement(682941..683198)
FT                   /locus_tag="Tery_0433"
FT   CDS_pept        complement(682941..683198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0433"
FT                   /product="protein splicing site"
FT                   /note="KEGG: syf:Synpcc7942_1609 protein splicing (intein)
FT                   site"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49892"
FT                   /db_xref="InterPro:IPR040763"
FT                   /db_xref="UniProtKB/TrEMBL:Q119D2"
FT                   /protein_id="ABG49892.1"
FT   gene            complement(683916..684992)
FT                   /locus_tag="Tery_0434"
FT   CDS_pept        complement(683916..684992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0434"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ana:alr4583 peptide
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49893"
FT                   /db_xref="GOA:Q119D1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q119D1"
FT                   /protein_id="ABG49893.1"
FT                   ADLLLKVVDPRIKLESIK"
FT   gene            complement(685183..685695)
FT                   /locus_tag="Tery_0435"
FT   CDS_pept        complement(685183..685695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0435"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number=""
FT                   /note="KEGG: syn:sll1430 adenine phosphoribosyltransferase;
FT                   TIGRFAM: adenine phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49894"
FT                   /db_xref="GOA:Q119D0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q119D0"
FT                   /protein_id="ABG49894.1"
FT                   IISLIEY"
FT   gene            687517..688122
FT                   /locus_tag="Tery_0436"
FT   CDS_pept        687517..688122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all4581 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49895"
FT                   /db_xref="InterPro:IPR021399"
FT                   /db_xref="UniProtKB/TrEMBL:Q119C9"
FT                   /protein_id="ABG49895.1"
FT   gene            complement(688950..690572)
FT                   /locus_tag="Tery_0437"
FT   CDS_pept        complement(688950..690572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0437"
FT                   /product="peptidase S15"
FT                   /note="PFAM: peptidase S15 X-Pro dipeptidyl-peptidase-like;
FT                   KEGG: ava:Ava_4266 peptidase S15"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49896"
FT                   /db_xref="GOA:Q119C8"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q119C8"
FT                   /protein_id="ABG49896.1"
FT   gene            690731..691150
FT                   /locus_tag="Tery_0438"
FT   CDS_pept        690731..691150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0438"
FT                   /product="transposase"
FT                   /note="KEGG: ana:all4868 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49897"
FT                   /db_xref="GOA:Q10Z08"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:Q10Z08"
FT                   /protein_id="ABG49897.1"
FT   gene            691235..691768
FT                   /locus_tag="Tery_0439"
FT   CDS_pept        691235..691768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0439"
FT                   /product="transposase"
FT                   /note="KEGG: ana:alr4628 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49898"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q114G7"
FT                   /protein_id="ABG49898.1"
FT                   FPKLFQYEILPQPT"
FT   gene            complement(692630..693079)
FT                   /locus_tag="Tery_0440"
FT   CDS_pept        complement(692630..693079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0440"
FT                   /product="Cupin 2, conserved barrel"
FT                   /note="PFAM: Cupin 2, conserved barrel; KEGG: ava:Ava_1579
FT                   TonB box-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49899"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q119C5"
FT                   /protein_id="ABG49899.1"
FT   gene            694774..695922
FT                   /locus_tag="Tery_0441"
FT   CDS_pept        694774..695922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0441"
FT                   /product="cobalamin synthesis protein, P47K"
FT                   /note="PFAM: cobalamin synthesis protein, P47K cobalamin
FT                   synthesis CobW-like; KEGG: ava:Ava_3717 cobalamin synthesis
FT                   protein/P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49900"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:Q119C4"
FT                   /protein_id="ABG49900.1"
FT   gene            696402..696863
FT                   /locus_tag="Tery_0442"
FT   CDS_pept        696402..696863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0442"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="PFAM: D-tyrosyl-tRNA(Tyr) deacylase; KEGG:
FT                   cpe:CPE1937 D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49901"
FT                   /db_xref="GOA:Q119C3"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q119C3"
FT                   /protein_id="ABG49901.1"
FT   gene            697751..698074
FT                   /locus_tag="Tery_0443"
FT   CDS_pept        697751..698074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr2980 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49902"
FT                   /db_xref="InterPro:IPR014954"
FT                   /db_xref="UniProtKB/TrEMBL:Q119C2"
FT                   /protein_id="ABG49902.1"
FT                   HQS"
FT   gene            complement(698789..700753)
FT                   /locus_tag="Tery_0444"
FT   CDS_pept        complement(698789..700753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0444"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number=""
FT                   /note="KEGG: ava:Ava_0926 penicillin-binding protein 1A;
FT                   TIGRFAM: penicillin-binding protein, 1A family; PFAM:
FT                   glycosyl transferase, family 51 penicillin-binding protein,
FT                   transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49903"
FT                   /db_xref="GOA:Q119C1"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q119C1"
FT                   /protein_id="ABG49903.1"
FT   gene            700843..702060
FT                   /locus_tag="Tery_0445"
FT   CDS_pept        700843..702060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0445"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: tyrosyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase, class Ib RNA-binding S4; KEGG:
FT                   syf:Synpcc7942_2570 tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49904"
FT                   /db_xref="GOA:Q119C0"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q119C0"
FT                   /protein_id="ABG49904.1"
FT                   VRLVKN"
FT   gene            702713..703441
FT                   /locus_tag="Tery_0446"
FT   CDS_pept        702713..703441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0446"
FT                   /product="orotidine-5'-phosphate decarboxylase"
FT                   /EC_number=""
FT                   /note="KEGG: ana:alr2983 orotidine 5' monophosphate
FT                   decarboxylase; TIGRFAM: orotidine 5'-phosphate
FT                   decarboxylase; PFAM: Orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49905"
FT                   /db_xref="GOA:Q119B9"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q119B9"
FT                   /protein_id="ABG49905.1"
FT   gene            complement(705273..706340)
FT                   /locus_tag="Tery_0447"
FT   CDS_pept        complement(705273..706340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0447"
FT                   /product="conserved hypothetical protein 730"
FT                   /note="PFAM: conserved hypothetical protein 730; KEGG:
FT                   ana:alr0053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49906"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q119B8"
FT                   /protein_id="ABG49906.1"
FT                   KVGGNIQKFSHLGSK"
FT   gene            complement(707465..709603)
FT                   /locus_tag="Tery_0448"
FT   CDS_pept        complement(707465..709603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0448"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_03413 subtilisin-like serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49907"
FT                   /db_xref="GOA:Q119B7"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR034074"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q119B7"
FT                   /protein_id="ABG49907.1"
FT                   PVKNEVEIEIPDKIPDKI"
FT   gene            complement(709826..710833)
FT                   /locus_tag="Tery_0449"
FT   CDS_pept        complement(709826..710833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0449"
FT                   /product="AAA ATPase, central region"
FT                   /note="PFAM: AAA ATPase, central region; SMART: ATPase;
FT                   KEGG: bbr:BB0910 putative ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49908"
FT                   /db_xref="GOA:Q119B6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q119B6"
FT                   /protein_id="ABG49908.1"
FT   gene            complement(711457..713475)
FT                   /locus_tag="Tery_0450"
FT   CDS_pept        complement(711457..713475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0450"
FT                   /product="transketolase"
FT                   /EC_number=""
FT                   /note="KEGG: syn:sll1070 transketolase; TIGRFAM:
FT                   transketolase; PFAM: Transketolase-like Transketolase,
FT                   central region"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49909"
FT                   /db_xref="GOA:Q119B5"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q119B5"
FT                   /protein_id="ABG49909.1"
FT   gene            complement(716384..717634)
FT                   /locus_tag="Tery_0451"
FT   CDS_pept        complement(716384..717634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0451"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /EC_number=""
FT                   /note="PFAM: beta-ketoacyl synthase; KEGG: ava:Ava_3646
FT                   3-oxoacyl-(acyl carrier protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49910"
FT                   /db_xref="GOA:Q119B4"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q119B4"
FT                   /protein_id="ABG49910.1"
FT                   SFGFGGHNVTLAFKKYR"
FT   gene            complement(718330..718596)
FT                   /locus_tag="Tery_0452"
FT   CDS_pept        complement(718330..718596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0452"
FT                   /product="acyl carrier protein"
FT                   /note="TIGRFAM: acyl carrier protein; PFAM:
FT                   phosphopantetheine-binding; KEGG: ilo:IL1339 acyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49911"
FT                   /db_xref="GOA:Q119B3"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q119B3"
FT                   /protein_id="ABG49911.1"
FT   gene            719131..720036
FT                   /locus_tag="Tery_0453"
FT   CDS_pept        719131..720036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0453"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /EC_number=""
FT                   /note="PFAM: protein of unknown function DUF224,
FT                   cysteine-rich region; KEGG: ava:Ava_3648 protein of unknown
FT                   function DUF224, cysteine-rich region"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49912"
FT                   /db_xref="GOA:Q119B2"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:Q119B2"
FT                   /protein_id="ABG49912.1"
FT   gene            720211..720456
FT                   /locus_tag="Tery_0454"
FT   CDS_pept        720211..720456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0454"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding; KEGG:
FT                   syf:Synpcc7942_0535 photosystem I iron-sulfurcenter"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49913"
FT                   /db_xref="GOA:Q119B1"
FT                   /db_xref="InterPro:IPR017491"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q119B1"
FT                   /protein_id="ABG49913.1"
FT   gene            721508..723409
FT                   /locus_tag="Tery_0455"
FT   CDS_pept        721508..723409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0455"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase, class-II sugar isomerase (SIS); KEGG:
FT                   ava:Ava_3485 D-fructose-6-phosphate amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49914"
FT                   /db_xref="GOA:Q119B0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q119B0"
FT                   /protein_id="ABG49914.1"
FT   gene            complement(723456..724006)
FT                   /pseudo
FT                   /locus_tag="Tery_0456"
FT   gene            724335..725195
FT                   /locus_tag="Tery_0457"
FT   CDS_pept        724335..725195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0457"
FT                   /product="zinc finger, SWIM-type"
FT                   /note="PFAM: zinc finger, SWIM-type; KEGG: ana:all4155
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49915"
FT                   /db_xref="GOA:Q119A9"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:Q119A9"
FT                   /protein_id="ABG49915.1"
FT                   KKRGF"
FT   gene            complement(725804..726748)
FT                   /locus_tag="Tery_0458"
FT   CDS_pept        complement(725804..726748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0458"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: ava:Ava_0644
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49916"
FT                   /db_xref="GOA:Q119A8"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q119A8"
FT                   /protein_id="ABG49916.1"
FT   gene            727178..728614
FT                   /locus_tag="Tery_0459"
FT   CDS_pept        727178..728614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0459"
FT                   /product="PUCC protein"
FT                   /note="PFAM: PUCC protein major facilitator superfamily
FT                   MFS_1; KEGG: syn:sll1906 hypothetical protein that may be
FT                   an assembly factor for photosynthetic complex"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49917"
FT                   /db_xref="GOA:Q119A7"
FT                   /db_xref="InterPro:IPR004896"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR026036"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q119A7"
FT                   /protein_id="ABG49917.1"
FT   gene            complement(729656..731518)
FT                   /locus_tag="Tery_0460"
FT   CDS_pept        complement(729656..731518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0460"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase protein of unknown function
FT                   DUF323; SMART: Tyrosine protein kinase Serine/threonine
FT                   protein kinase; KEGG: ava:Ava_5054 serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49918"
FT                   /db_xref="GOA:Q119A6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:Q119A6"
FT                   /protein_id="ABG49918.1"
FT   gene            complement(731760..733625)
FT                   /locus_tag="Tery_0461"
FT   CDS_pept        complement(731760..733625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0461"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase protein of unknown function
FT                   DUF323; SMART: Tyrosine protein kinase Serine/threonine
FT                   protein kinase; KEGG: ava:Ava_5054 serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49919"
FT                   /db_xref="GOA:Q119A5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:Q119A5"
FT                   /protein_id="ABG49919.1"
FT   gene            complement(733867..735744)
FT                   /locus_tag="Tery_0462"
FT   CDS_pept        complement(733867..735744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0462"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase protein of unknown function
FT                   DUF323; SMART: Tyrosine protein kinase Serine/threonine
FT                   protein kinase; KEGG: ava:Ava_5054 serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49920"
FT                   /db_xref="GOA:Q119A4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:Q119A4"
FT                   /protein_id="ABG49920.1"
FT   gene            complement(735970..737883)
FT                   /locus_tag="Tery_0463"
FT   CDS_pept        complement(735970..737883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0463"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase protein of unknown function
FT                   DUF323; SMART: Serine/threonine protein kinase; KEGG:
FT                   ava:Ava_5054 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49921"
FT                   /db_xref="GOA:Q119A3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:Q119A3"
FT                   /protein_id="ABG49921.1"
FT                   RN"
FT   gene            complement(738356..738583)
FT                   /pseudo
FT                   /locus_tag="Tery_0464"
FT   gene            complement(738642..739301)
FT                   /locus_tag="Tery_0465"
FT   CDS_pept        complement(738642..739301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0465"
FT                   /product="Resolvase-like"
FT                   /note="PFAM: regulatory protein, MerR Resolvase-like; KEGG:
FT                   tko:TK0655 predicted site-specific integrase/resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49922"
FT                   /db_xref="GOA:Q119A2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR041718"
FT                   /db_xref="UniProtKB/TrEMBL:Q119A2"
FT                   /protein_id="ABG49922.1"
FT   gene            complement(739494..744134)
FT                   /locus_tag="Tery_0466"
FT   CDS_pept        complement(739494..744134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0466"
FT                   /product="glutamate synthase (ferredoxin)"
FT                   /EC_number=""
FT                   /note="PFAM: glutamine amidotransferase, class-II glutamate
FT                   synthase, alpha subunit-like ferredoxin-dependent glutamate
FT                   synthase glutamate synthase; KEGG: ava:Ava_1294 glutamine
FT                   amidotransferase, class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49923"
FT                   /db_xref="GOA:Q119A1"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q119A1"
FT                   /protein_id="ABG49923.1"
FT   gene            complement(745723..746016)
FT                   /pseudo
FT                   /locus_tag="Tery_0467"
FT   gene            747158..747436
FT                   /locus_tag="Tery_0468"
FT   CDS_pept        747158..747436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49924"
FT                   /db_xref="UniProtKB/TrEMBL:Q119A0"
FT                   /protein_id="ABG49924.1"
FT   gene            complement(747702..748271)
FT                   /locus_tag="Tery_0469"
FT   CDS_pept        complement(747702..748271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0469"
FT                   /product="Group II intron, maturase-specific"
FT                   /note="PFAM: Group II intron, maturase-specific; KEGG:
FT                   gvi:gll0177 reverse transcriptase homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49925"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="UniProtKB/TrEMBL:Q118Z9"
FT                   /protein_id="ABG49925.1"
FT   gene            complement(748560..749348)
FT                   /locus_tag="Tery_0470"
FT   CDS_pept        complement(748560..749348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0470"
FT                   /product="RNA-directed DNA polymerase"
FT                   /note="KEGG: ava:Ava_C0033 RNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49926"
FT                   /db_xref="GOA:Q118Z8"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="UniProtKB/TrEMBL:Q118Z8"
FT                   /protein_id="ABG49926.1"
FT   gene            750262..750672
FT                   /locus_tag="Tery_0471"
FT   CDS_pept        750262..750672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0471"
FT                   /product="Mannose-6-phosphate isomerase"
FT                   /EC_number=""
FT                   /note="PFAM: mannose-6-phosphate isomerase, type II Cupin
FT                   2, conserved barrel; KEGG: syn:slr0493 putative
FT                   mannose-1-phosphate guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49927"
FT                   /db_xref="GOA:Q118Z7"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q118Z7"
FT                   /protein_id="ABG49927.1"
FT   gene            750705..751028
FT                   /locus_tag="Tery_0472"
FT   CDS_pept        750705..751028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0472"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="TIGRFAM: iron-sulfur cluster assembly accessory
FT                   protein; PFAM: HesB/YadR/YfhF; KEGG: ana:all4341
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49928"
FT                   /db_xref="GOA:Q118Z6"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q118Z6"
FT                   /protein_id="ABG49928.1"
FT                   FSV"
FT   gene            751967..752341
FT                   /locus_tag="Tery_0473"
FT   CDS_pept        751967..752341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0473"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: syf:Synpcc7942_0887 ribosomal
FT                   protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49929"
FT                   /db_xref="GOA:Q118Z5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q118Z5"
FT                   /protein_id="ABG49929.1"
FT   gene            752459..752929
FT                   /locus_tag="Tery_0474"
FT   CDS_pept        752459..752929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0474"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="PFAM: ribosomal protein S7; KEGG: ava:Ava_1289 30S
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49930"
FT                   /db_xref="GOA:Q118Z4"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q118Z4"
FT                   /protein_id="ABG49930.1"
FT   gene            753026..755101
FT                   /locus_tag="Tery_0475"
FT   CDS_pept        753026..755101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0475"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: translation elongation factor G small
FT                   GTP-binding protein; PFAM: elongation factor G-like protein
FT                   synthesis factor, GTP-binding elongation factor Tu, domain
FT                   2 elongation factor G, domain IV; KEGG: syn:sll1098
FT                   elongation factor EF-G 2"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49931"
FT                   /db_xref="GOA:Q118Z3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q118Z3"
FT                   /protein_id="ABG49931.1"
FT   gene            755363..756592
FT                   /locus_tag="Tery_0476"
FT   CDS_pept        755363..756592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0476"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="TIGRFAM: translation elongation factor Tu small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding elongation factor Tu-like elongation factor Tu,
FT                   domain 2; KEGG: syf:Synpcc7942_0884 translation elongation
FT                   factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49932"
FT                   /db_xref="GOA:Q118Z2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q118Z2"
FT                   /protein_id="ABG49932.1"
FT                   GAGVVSKIVE"
FT   gene            756838..757155
FT                   /locus_tag="Tery_0477"
FT   CDS_pept        756838..757155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0477"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="PFAM: ribosomal protein S10; KEGG: ava:Ava_1286 30S
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49933"
FT                   /db_xref="GOA:Q118Z1"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q118Z1"
FT                   /protein_id="ABG49933.1"
FT                   L"
FT   gene            757621..758259
FT                   /locus_tag="Tery_0478"
FT   CDS_pept        757621..758259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0478"
FT                   /product="peptidase S16, lon-like"
FT                   /note="PFAM: peptidase S16, lon-like; KEGG: ava:Ava_1285
FT                   peptidase S16, lon"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49934"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q118Z0"
FT                   /protein_id="ABG49934.1"
FT   gene            complement(758513..759103)
FT                   /locus_tag="Tery_0479"
FT   CDS_pept        complement(758513..759103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all4333 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49935"
FT                   /db_xref="InterPro:IPR018971"
FT                   /db_xref="UniProtKB/TrEMBL:Q118Y9"
FT                   /protein_id="ABG49935.1"
FT   gene            759506..760396
FT                   /locus_tag="Tery_0480"
FT   CDS_pept        759506..760396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0480"
FT                   /product="prephenate dehydratase"
FT                   /EC_number=""
FT                   /note="PFAM: prephenate dehydratase amino acid-binding ACT;
FT                   KEGG: ava:Ava_1284 prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49936"
FT                   /db_xref="GOA:Q118Y8"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:Q118Y8"
FT                   /protein_id="ABG49936.1"
FT                   QTLKIFGSYILMSIN"
FT   gene            complement(760873..770310)
FT                   /locus_tag="Tery_0481"
FT   CDS_pept        complement(760873..770310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0481"
FT                   /product="TPR repeat"
FT                   /note="PFAM: glycosyl transferase, group 1 TPR repeat
FT                   Sel1-like repeat Tetratricopeptide TPR_3 Tetratricopeptide
FT                   TPR_2; SMART: RNA-processing protein, HAT helix
FT                   Tetratricopeptide region; KEGG: cch:Cag_0301 TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49937"
FT                   /db_xref="GOA:Q118Y7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q118Y7"
FT                   /protein_id="ABG49937.1"
FT   gene            complement(771178..771813)
FT                   /locus_tag="Tery_0482"
FT   CDS_pept        complement(771178..771813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0482"
FT                   /product="RNase HII"
FT                   /EC_number=""
FT                   /note="PFAM: ribonuclease HII/HIII; KEGG: ana:alr4332
FT                   ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49938"
FT                   /db_xref="GOA:Q118Y6"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q118Y6"
FT                   /protein_id="ABG49938.1"
FT   gene            complement(772170..774218)
FT                   /locus_tag="Tery_0483"
FT   CDS_pept        complement(772170..774218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0483"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA
FT                   binding S1; KEGG: ana:alr4331 ribonuclease E"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49939"
FT                   /db_xref="GOA:Q118Y5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q118Y5"
FT                   /protein_id="ABG49939.1"
FT   gene            complement(774747..775223)
FT                   /locus_tag="Tery_0484"
FT   CDS_pept        complement(774747..775223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0484"
FT                   /product="putative transposase gene of IS605 family
FT                   insertion sequence ISY052a"
FT                   /note="KEGG: syn:slr2062 putative transposase gene of IS605
FT                   family insertion sequence ISY052a"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49940"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="UniProtKB/TrEMBL:Q118Y4"
FT                   /protein_id="ABG49940.1"
FT   gene            complement(775464..778196)
FT                   /locus_tag="Tery_0485"
FT   CDS_pept        complement(775464..778196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0485"
FT                   /product="Radical SAM"
FT                   /note="PFAM: Radical SAM; SMART: Elongator protein
FT                   3/MiaB/NifB; KEGG: ana:alr4330 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49941"
FT                   /db_xref="GOA:Q118Y3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR018768"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023862"
FT                   /db_xref="UniProtKB/TrEMBL:Q118Y3"
FT                   /protein_id="ABG49941.1"
FT   gene            778406..778600
FT                   /locus_tag="Tery_0486"
FT   CDS_pept        778406..778600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1278 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49942"
FT                   /db_xref="UniProtKB/TrEMBL:Q118Y2"
FT                   /protein_id="ABG49942.1"
FT   gene            779543..780718
FT                   /locus_tag="Tery_0487"
FT   CDS_pept        779543..780718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0487"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   ana:all4327 probable aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49943"
FT                   /db_xref="GOA:Q118Y1"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q118Y1"
FT                   /protein_id="ABG49943.1"
FT   gene            781534..783267
FT                   /locus_tag="Tery_0488"
FT   CDS_pept        781534..783267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0488"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin Hemolysin-type calcium-binding region; KEGG:
FT                   ava:Ava_4060 peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49944"
FT                   /db_xref="GOA:Q118Y0"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034204"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q118Y0"
FT                   /protein_id="ABG49944.1"
FT                   V"
FT   gene            783486..784217
FT                   /locus_tag="Tery_0489"
FT   CDS_pept        783486..784217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0489"
FT                   /product="Undecaprenyl-phosphate
FT                   galactosephosphotransferase"
FT                   /EC_number=""
FT                   /note="PFAM: sugar transferase; KEGG: ava:Ava_2099 sugar
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49945"
FT                   /db_xref="GOA:Q118X9"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:Q118X9"
FT                   /protein_id="ABG49945.1"
FT   gene            784902..785930
FT                   /locus_tag="Tery_0490"
FT   CDS_pept        784902..785930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0490"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; KEGG: syn:sll1212
FT                   GDP-D-mannose dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49946"
FT                   /db_xref="GOA:Q118X8"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q118X8"
FT                   /protein_id="ABG49946.1"
FT                   FD"
FT   gene            786994..787938
FT                   /locus_tag="Tery_0491"
FT   CDS_pept        786994..787938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0491"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; KEGG: ava:Ava_2096
FT                   3-beta hydroxysteroid dehydrogenase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49947"
FT                   /db_xref="GOA:Q118X7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q118X7"
FT                   /protein_id="ABG49947.1"
FT   gene            788524..789246
FT                   /locus_tag="Tery_0492"
FT   CDS_pept        788524..789246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bfs:BF1471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49948"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:Q118X6"
FT                   /protein_id="ABG49948.1"
FT                   NYWNQNLHQDKFIKKVKV"
FT   gene            789431..789865
FT                   /locus_tag="Tery_0493"
FT   CDS_pept        789431..789865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: syn:sll0359 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49949"
FT                   /db_xref="GOA:Q118X5"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="UniProtKB/TrEMBL:Q118X5"
FT                   /protein_id="ABG49949.1"
FT   gene            791975..793528
FT                   /locus_tag="Tery_0494"
FT   CDS_pept        791975..793528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0494"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   ana:alr0920 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49950"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q118X4"
FT                   /protein_id="ABG49950.1"
FT                   "
FT   gene            complement(793660..795066)
FT                   /locus_tag="Tery_0495"
FT   CDS_pept        complement(793660..795066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0495"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase-like cytoplasmic
FT                   peptidoglycan synthetases-like Mur ligase, middle region;
FT                   KEGG: ana:all0036 UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl- D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49951"
FT                   /db_xref="GOA:Q118X3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q118X3"
FT                   /protein_id="ABG49951.1"
FT                   LNKVVELLIN"
FT   gene            796283..797596
FT                   /locus_tag="Tery_0496"
FT   CDS_pept        796283..797596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: syn:sll1247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49952"
FT                   /db_xref="UniProtKB/TrEMBL:Q118X2"
FT                   /protein_id="ABG49952.1"
FT   gene            797861..798013
FT                   /locus_tag="Tery_0497"
FT   CDS_pept        797861..798013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0497"
FT                   /product="SSU ribosomal protein S21P"
FT                   /note="PFAM: ribosomal protein S21; KEGG: ava:Ava_4447
FT                   ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49953"
FT                   /db_xref="GOA:Q118X1"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:Q118X1"
FT                   /protein_id="ABG49953.1"
FT                   VRERQ"
FT   gene            complement(798317..798682)
FT                   /pseudo
FT                   /locus_tag="Tery_0498"
FT   gene            798757..800184
FT                   /locus_tag="Tery_0499"
FT   CDS_pept        798757..800184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0499"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein, HSR1-related; KEGG: ana:all4384
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49954"
FT                   /db_xref="GOA:Q118X0"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021147"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q118X0"
FT                   /protein_id="ABG49954.1"
FT                   IKEELIAKLNIKNFSNQ"
FT   gene            complement(800556..802199)
FT                   /locus_tag="Tery_0500"
FT   CDS_pept        complement(800556..802199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0500"
FT                   /product="Conserved TM helix"
FT                   /note="PFAM: Conserved TM helix; KEGG: tel:tlr0733
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49955"
FT                   /db_xref="GOA:Q118W9"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="UniProtKB/TrEMBL:Q118W9"
FT                   /protein_id="ABG49955.1"
FT   gene            802278..802730
FT                   /locus_tag="Tery_0501"
FT   CDS_pept        802278..802730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0501"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all0025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49956"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q118W8"
FT                   /protein_id="ABG49956.1"
FT   gene            complement(803667..804314)
FT                   /locus_tag="Tery_0502"
FT   CDS_pept        complement(803667..804314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0502"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmi:PMT9312_1807 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49957"
FT                   /db_xref="GOA:Q118W7"
FT                   /db_xref="InterPro:IPR010802"
FT                   /db_xref="UniProtKB/TrEMBL:Q118W7"
FT                   /protein_id="ABG49957.1"
FT   sig_peptide     complement(804174..804314)
FT                   /locus_tag="Tery_0502"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.659 at
FT                   residue 47"
FT   gene            complement(804736..805560)
FT                   /locus_tag="Tery_0503"
FT   CDS_pept        complement(804736..805560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_2624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49958"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR032698"
FT                   /db_xref="UniProtKB/TrEMBL:Q118W6"
FT                   /protein_id="ABG49958.1"
FT   gene            complement(806353..808116)
FT                   /locus_tag="Tery_0504"
FT   CDS_pept        complement(806353..808116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0504"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM:
FT                   ATP-binding region, ATPase-like DNA mismatch repair
FT                   protein-like; KEGG: ana:alr3055 DNA mismatch repair
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49959"
FT                   /db_xref="GOA:Q118W5"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:Q118W5"
FT                   /protein_id="ABG49959.1"
FT                   RNWVIGKSHGI"
FT   gene            808271..808972
FT                   /locus_tag="Tery_0505"
FT   CDS_pept        808271..808972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0505"
FT                   /product="protein of unknown function DUF124"
FT                   /note="PFAM: protein of unknown function DUF124; KEGG:
FT                   hch:HCH_01585 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49960"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q118W4"
FT                   /protein_id="ABG49960.1"
FT                   GLVQFLKPKVR"
FT   gene            808988..809668
FT                   /locus_tag="Tery_0506"
FT   CDS_pept        808988..809668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0506"
FT                   /product="protein of unknown function DUF124"
FT                   /note="PFAM: protein of unknown function DUF124; KEGG:
FT                   hch:HCH_01584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49961"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q118W3"
FT                   /protein_id="ABG49961.1"
FT                   PPKK"
FT   gene            810031..810729
FT                   /locus_tag="Tery_0507"
FT   CDS_pept        810031..810729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0507"
FT                   /product="protein of unknown function DUF124"
FT                   /note="PFAM: protein of unknown function DUF124; KEGG:
FT                   hch:HCH_01583 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49962"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q118W2"
FT                   /protein_id="ABG49962.1"
FT                   NPFRPTKGSD"
FT   gene            810760..811599
FT                   /locus_tag="Tery_0508"
FT   CDS_pept        810760..811599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0508"
FT                   /product="peptidase M48, Ste24p"
FT                   /note="PFAM: peptidase M48, Ste24p; KEGG: hch:HCH_01586
FT                   putative Zn-dependent protease, contains TPR repeats"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49963"
FT                   /db_xref="GOA:Q118W1"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q118W1"
FT                   /protein_id="ABG49963.1"
FT   sig_peptide     810760..810879
FT                   /locus_tag="Tery_0508"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.839 at
FT                   residue 40"
FT   gene            812023..812805
FT                   /locus_tag="Tery_0509"
FT   CDS_pept        812023..812805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0509"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   cyb:CYB_0652 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49964"
FT                   /db_xref="GOA:Q118W0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q118W0"
FT                   /protein_id="ABG49964.1"
FT   sig_peptide     812023..812085
FT                   /locus_tag="Tery_0509"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.809) with cleavage site probability 0.675 at
FT                   residue 21"
FT   gene            complement(812932..814077)
FT                   /locus_tag="Tery_0510"
FT   CDS_pept        complement(812932..814077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0510"
FT                   /product="beta-ketoacyl synthase"
FT                   /note="PFAM: beta-ketoacyl synthase; KEGG: ava:Ava_1238
FT                   3-oxoacyl-(acyl carrier protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49965"
FT                   /db_xref="GOA:Q118V9"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q118V9"
FT                   /protein_id="ABG49965.1"
FT   gene            complement(814085..814846)
FT                   /locus_tag="Tery_0511"
FT   CDS_pept        complement(814085..814846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0511"
FT                   /product="peptidyl-prolyl cis-trans isomerase, cyclophilin
FT                   type"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin type; KEGG: ava:Ava_1240 peptidyl-prolyl
FT                   cis-trans isomerase, cyclophilin type"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49966"
FT                   /db_xref="GOA:Q118V8"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q118V8"
FT                   /protein_id="ABG49966.1"
FT   sig_peptide     complement(814751..814846)
FT                   /locus_tag="Tery_0511"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.920 at
FT                   residue 32"
FT   gene            complement(815307..815870)
FT                   /locus_tag="Tery_0512"
FT   CDS_pept        complement(815307..815870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0512"
FT                   /product="photosystem I assembly Ycf4"
FT                   /note="PFAM: photosystem I assembly Ycf4; KEGG:
FT                   ava:Ava_1241 photosystem I assembly protein Ycf4"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49967"
FT                   /db_xref="GOA:Q118V7"
FT                   /db_xref="InterPro:IPR003359"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q118V7"
FT                   /protein_id="ABG49967.1"
FT   gene            816445..817824
FT                   /locus_tag="Tery_0513"
FT   CDS_pept        816445..817824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0513"
FT                   /product="photosystem II 44 kDa subunit reaction center
FT                   protein"
FT                   /note="TIGRFAM: photosystem II 44 kDa subunit reaction
FT                   center protein; PFAM: photosystem antenna protein-like;
FT                   KEGG: syn:sll0851 photosystem II 44 kD reaction centre
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49968"
FT                   /db_xref="GOA:Q118V6"
FT                   /db_xref="InterPro:IPR000932"
FT                   /db_xref="InterPro:IPR005869"
FT                   /db_xref="InterPro:IPR036001"
FT                   /db_xref="UniProtKB/TrEMBL:Q118V6"
FT                   /protein_id="ABG49968.1"
FT                   D"
FT   gene            818020..818307
FT                   /pseudo
FT                   /locus_tag="Tery_0514"
FT   gene            818393..818632
FT                   /pseudo
FT                   /locus_tag="Tery_0515"
FT   gene            818923..820263
FT                   /locus_tag="Tery_0516"
FT   CDS_pept        818923..820263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0516"
FT                   /product="flavin-containing monooxygenase FMO"
FT                   /note="PFAM: flavin-containing monooxygenase FMO; KEGG:
FT                   pub:SAR11_1296 putative flavin-containing monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49969"
FT                   /db_xref="GOA:Q118V5"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q118V5"
FT                   /protein_id="ABG49969.1"
FT   sig_peptide     818923..818994
FT                   /locus_tag="Tery_0516"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.742) with cleavage site probability 0.716 at
FT                   residue 24"
FT   gene            820641..822119
FT                   /locus_tag="Tery_0517"
FT   CDS_pept        820641..822119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0517"
FT                   /product="cobyrinate a,c-diamide synthase /
FT                   hydrogenobyrinic acid a,c-diamide synthase
FT                   (glutamine-hydrolysing)"
FT                   /EC_number="6.3.5.-"
FT                   /EC_number=""
FT                   /note="TIGRFAM: cobyrinic acid a,c-diamide synthase; PFAM:
FT                   Cobyrinic acid a,c-diamide synthase CobB/CobQ-like
FT                   glutamine amidotransferase; KEGG: ana:alr3934 cobyrinic
FT                   acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49970"
FT                   /db_xref="GOA:Q118V4"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q118V4"
FT                   /protein_id="ABG49970.1"
FT   gene            823262..823753
FT                   /locus_tag="Tery_0518"
FT   CDS_pept        823262..823753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0888 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49971"
FT                   /db_xref="GOA:Q118V3"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:Q118V3"
FT                   /protein_id="ABG49971.1"
FT                   "
FT   gene            824434..825072
FT                   /locus_tag="Tery_0519"
FT   CDS_pept        824434..825072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0519"
FT                   /product="transaldolase"
FT                   /EC_number=""
FT                   /note="PFAM: Transaldolase; KEGG: sth:STH66 transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49972"
FT                   /db_xref="GOA:Q118V2"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:Q118V2"
FT                   /protein_id="ABG49972.1"
FT   gene            825705..825887
FT                   /locus_tag="Tery_0520"
FT   CDS_pept        825705..825887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3673 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49973"
FT                   /db_xref="InterPro:IPR025148"
FT                   /db_xref="UniProtKB/TrEMBL:Q118V1"
FT                   /protein_id="ABG49973.1"
FT                   LPPEIEPAPKFDLEE"
FT   gene            826160..826480
FT                   /pseudo
FT                   /locus_tag="Tery_0521"
FT   gene            complement(826613..827146)
FT                   /locus_tag="Tery_0522"
FT   CDS_pept        complement(826613..827146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0522"
FT                   /product="pentapeptide repeat"
FT                   /note="PFAM: pentapeptide repeat; KEGG: mac:MA1892
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49974"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q118V0"
FT                   /protein_id="ABG49974.1"
FT                   SLVRYFWFFIKLSA"
FT   gene            complement(827206..828897)
FT                   /locus_tag="Tery_0523"
FT   CDS_pept        complement(827206..828897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49975"
FT                   /db_xref="GOA:Q118U9"
FT                   /db_xref="UniProtKB/TrEMBL:Q118U9"
FT                   /protein_id="ABG49975.1"
FT   gene            829610..830479
FT                   /locus_tag="Tery_0524"
FT   CDS_pept        829610..830479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49976"
FT                   /db_xref="UniProtKB/TrEMBL:Q118U8"
FT                   /protein_id="ABG49976.1"
FT                   SQELSPEL"
FT   gene            830515..831303
FT                   /locus_tag="Tery_0525"
FT   CDS_pept        830515..831303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0525"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_3879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49977"
FT                   /db_xref="InterPro:IPR014951"
FT                   /db_xref="UniProtKB/TrEMBL:Q118U7"
FT                   /protein_id="ABG49977.1"
FT   gene            831588..832475
FT                   /locus_tag="Tery_0526"
FT   CDS_pept        831588..832475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0526"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   cyb:CYB_1055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49978"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:Q118U6"
FT                   /protein_id="ABG49978.1"
FT                   YISLIDIMGEISDR"
FT   gene            832685..833020
FT                   /locus_tag="Tery_0527"
FT   CDS_pept        832685..833020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0527"
FT                   /product="FdxN element excision controlling factor protein"
FT                   /note="KEGG: ava:Ava_3313 FdxN element excision controlling
FT                   factor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49979"
FT                   /db_xref="InterPro:IPR014968"
FT                   /db_xref="InterPro:IPR035943"
FT                   /db_xref="UniProtKB/TrEMBL:Q118U5"
FT                   /protein_id="ABG49979.1"
FT                   ITDFAVC"
FT   gene            833050..833985
FT                   /locus_tag="Tery_0528"
FT   CDS_pept        833050..833985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; KEGG:
FT                   wol:WD0627 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49980"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:Q118U4"
FT                   /protein_id="ABG49980.1"
FT   gene            834224..838024
FT                   /locus_tag="Tery_0529"
FT   CDS_pept        834224..838024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0529"
FT                   /product="Tetratricopeptide TPR_2"
FT                   /note="PFAM: TPR repeat Tetratricopeptide TPR_3
FT                   Tetratricopeptide TPR_2; SMART: Tetratricopeptide region;
FT                   KEGG: gga:416913 similar to TPR repeat containing protein
FT                   KIAA1043"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49981"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:Q118U3"
FT                   /protein_id="ABG49981.1"
FT   gene            838332..839417
FT                   /locus_tag="Tery_0530"
FT   CDS_pept        838332..839417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0530"
FT                   /product="conserved hypothetical protein, conserved"
FT                   /note="KEGG: lma:LmjF30.2990 hypothetical protein,
FT                   conserved"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49982"
FT                   /db_xref="InterPro:IPR021259"
FT                   /db_xref="UniProtKB/TrEMBL:Q118U2"
FT                   /protein_id="ABG49982.1"
FT   gene            840599..841864
FT                   /locus_tag="Tery_0531"
FT   CDS_pept        840599..841864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0531"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /EC_number=""
FT                   /note="KEGG: ana:alr2276 site-specific
FT                   DNA-methyltransferase; TIGRFAM: DNA-cytosine
FT                   methyltransferase; PFAM: C-5 cytosine-specific DNA
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49983"
FT                   /db_xref="GOA:Q118U1"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:Q118U1"
FT                   /protein_id="ABG49983.1"
FT   gene            complement(842842..843702)
FT                   /locus_tag="Tery_0532"
FT   CDS_pept        complement(842842..843702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0532"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gvi:gll0541 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49984"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="UniProtKB/TrEMBL:Q118U0"
FT                   /protein_id="ABG49984.1"
FT                   SSKDD"
FT   gene            complement(844596..845066)
FT                   /locus_tag="Tery_0533"
FT   CDS_pept        complement(844596..845066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0533"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated; KEGG: tel:tll1487
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49985"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:Q118T9"
FT                   /protein_id="ABG49985.1"
FT   gene            complement(845869..846687)
FT                   /locus_tag="Tery_0534"
FT   CDS_pept        complement(845869..846687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0534"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated; KEGG: ava:Ava_4216 FHA
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49986"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:Q118T8"
FT                   /protein_id="ABG49986.1"
FT   gene            complement(847091..847798)
FT                   /locus_tag="Tery_0535"
FT   CDS_pept        complement(847091..847798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0535"
FT                   /product="6-phosphogluconolactonase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: 6-phosphogluconolactonase; PFAM:
FT                   glucosamine/galactosamine-6-phosphate isomerase; KEGG:
FT                   syn:sll1479 6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49987"
FT                   /db_xref="GOA:Q118T7"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:Q118T7"
FT                   /protein_id="ABG49987.1"
FT                   KGELQWLLTGVNI"
FT   gene            849080..850216
FT                   /locus_tag="Tery_0536"
FT   CDS_pept        849080..850216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0536"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddi:DDB0229968 PAK sub-family kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49988"
FT                   /db_xref="GOA:Q118T6"
FT                   /db_xref="UniProtKB/TrEMBL:Q118T6"
FT                   /protein_id="ABG49988.1"
FT   gene            complement(850299..852104)
FT                   /locus_tag="Tery_0537"
FT   CDS_pept        complement(850299..852104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49989"
FT                   /db_xref="GOA:Q118T5"
FT                   /db_xref="UniProtKB/TrEMBL:Q118T5"
FT                   /protein_id="ABG49989.1"
FT   sig_peptide     complement(851958..852104)
FT                   /locus_tag="Tery_0537"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.829) with cleavage site probability 0.594 at
FT                   residue 49"
FT   gene            complement(852585..853763)
FT                   /locus_tag="Tery_0538"
FT   CDS_pept        complement(852585..853763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0538"
FT                   /product="permease YjgP/YjgQ"
FT                   /note="PFAM: permease YjgP/YjgQ; KEGG: ana:alr4069
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49990"
FT                   /db_xref="GOA:Q118T4"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:Q118T4"
FT                   /protein_id="ABG49990.1"
FT   gene            complement(853946..854257)
FT                   /pseudo
FT                   /locus_tag="Tery_0539"
FT   gene            854436..854939
FT                   /locus_tag="Tery_0540"
FT   CDS_pept        854436..854939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0540"
FT                   /product="putative transposase"
FT                   /note="KEGG: ava:Ava_C0088 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49991"
FT                   /db_xref="GOA:Q10V81"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q10V81"
FT                   /protein_id="ABG49991.1"
FT                   SHLN"
FT   gene            855356..855508
FT                   /pseudo
FT                   /locus_tag="Tery_0541"
FT   gene            complement(855613..855783)
FT                   /locus_tag="Tery_0542"
FT   CDS_pept        complement(855613..855783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0542"
FT                   /product="putative transposase"
FT                   /note="KEGG: gvi:gll0277 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49992"
FT                   /db_xref="UniProtKB/TrEMBL:Q118T2"
FT                   /protein_id="ABG49992.1"
FT                   KELCVKMSLNA"
FT   gene            complement(855972..858584)
FT                   /locus_tag="Tery_0543"
FT   CDS_pept        complement(855972..858584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0543"
FT                   /product="ATPase AAA-2"
FT                   /note="PFAM: AAA ATPase, central region Clp, N terminal
FT                   ATPase associated with various cellular activities, AAA_5
FT                   ATPase AAA-2; SMART: ATPase; KEGG: ava:Ava_2335 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49993"
FT                   /db_xref="GOA:Q118T1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q118T1"
FT                   /protein_id="ABG49993.1"
FT   gene            complement(858851..860560)
FT                   /locus_tag="Tery_0544"
FT   CDS_pept        complement(858851..860560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0544"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase-like histidine
FT                   kinase, HAMP region histidine kinase A-like; KEGG:
FT                   ana:all4496 two-component system sensory histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49994"
FT                   /db_xref="GOA:Q118T0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q118T0"
FT                   /protein_id="ABG49994.1"
FT   gene            complement(861724..862257)
FT                   /locus_tag="Tery_0545"
FT   CDS_pept        complement(861724..862257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0545"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:alr0761 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49995"
FT                   /db_xref="UniProtKB/TrEMBL:Q118S9"
FT                   /protein_id="ABG49995.1"
FT                   ELYIFKFCQQINKN"
FT   sig_peptide     complement(862186..862257)
FT                   /locus_tag="Tery_0545"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 24"
FT   gene            complement(862472..865609)
FT                   /locus_tag="Tery_0546"
FT   CDS_pept        complement(862472..865609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0546"
FT                   /product="DNA polymerase I"
FT                   /EC_number=""
FT                   /note="KEGG: ava:Ava_0581 DNA polymerase I; TIGRFAM: DNA
FT                   polymerase I; PFAM: DNA-directed DNA polymerase 5'-3'
FT                   exonuclease 3'-5' exonuclease; SMART: Helix-hairpin-helix
FT                   motif, class 2"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49996"
FT                   /db_xref="GOA:Q118S8"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q118S8"
FT                   /protein_id="ABG49996.1"
FT   gene            866423..866632
FT                   /locus_tag="Tery_0547"
FT   CDS_pept        866423..866632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49997"
FT                   /db_xref="UniProtKB/TrEMBL:Q118S7"
FT                   /protein_id="ABG49997.1"
FT   gene            866625..866774
FT                   /locus_tag="Tery_0548"
FT   CDS_pept        866625..866774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49998"
FT                   /db_xref="UniProtKB/TrEMBL:Q118S6"
FT                   /protein_id="ABG49998.1"
FT                   MSPE"
FT   gene            866775..867032
FT                   /pseudo
FT                   /locus_tag="Tery_0549"
FT   gene            867047..867376
FT                   /locus_tag="Tery_0550"
FT   CDS_pept        867047..867376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; KEGG:
FT                   wol:WD0627 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABG49999"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:Q118S5"
FT                   /protein_id="ABG49999.1"
FT                   GENYP"
FT   gene            867470..867970
FT                   /locus_tag="Tery_0551"
FT   CDS_pept        867470..867970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0551"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:all2115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50000"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:Q118S4"
FT                   /protein_id="ABG50000.1"
FT                   LRS"
FT   gene            complement(868419..868709)
FT                   /locus_tag="Tery_0552"
FT   CDS_pept        complement(868419..868709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50001"
FT                   /db_xref="UniProtKB/TrEMBL:Q118S3"
FT                   /protein_id="ABG50001.1"
FT   gene            complement(869106..869315)
FT                   /pseudo
FT                   /locus_tag="Tery_0553"
FT   gene            complement(869671..869743)
FT                   /locus_tag="Tery_R0006"
FT                   /note="tRNA-Phe1"
FT   tRNA            complement(869671..869743)
FT                   /locus_tag="Tery_R0006"
FT                   /product="tRNA-Phe"
FT   gene            870049..871497
FT                   /locus_tag="Tery_0554"
FT   CDS_pept        870049..871497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0554"
FT                   /product="membrane bound O-acyl transferase, MBOAT"
FT                   /note="PFAM: membrane bound O-acyl transferase, MBOAT;
FT                   KEGG: ana:alr4864 alginate o-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50002"
FT                   /db_xref="GOA:Q118S2"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:Q118S2"
FT                   /protein_id="ABG50002.1"
FT   gene            complement(871952..873634)
FT                   /locus_tag="Tery_0555"
FT   CDS_pept        complement(871952..873634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0555"
FT                   /product="Tetratricopeptide region"
FT                   /note="SMART: Tetratricopeptide region; KEGG: noc:Noc_1851
FT                   TPR repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50003"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q118S1"
FT                   /protein_id="ABG50003.1"
FT   sig_peptide     complement(873536..873634)
FT                   /locus_tag="Tery_0555"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.989 at
FT                   residue 33"
FT   gene            complement(874239..875069)
FT                   /locus_tag="Tery_0556"
FT   CDS_pept        complement(874239..875069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0556"
FT                   /product="3-mercaptopyruvate sulfurtransferase"
FT                   /EC_number=""
FT                   /note="PFAM: Rhodanese-like; KEGG: ava:Ava_1779
FT                   rhodanese-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50004"
FT                   /db_xref="GOA:Q118S0"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q118S0"
FT                   /protein_id="ABG50004.1"
FT   gene            complement(875083..875631)
FT                   /locus_tag="Tery_0557"
FT   CDS_pept        complement(875083..875631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0557"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_0818 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50005"
FT                   /db_xref="GOA:Q118R9"
FT                   /db_xref="UniProtKB/TrEMBL:Q118R9"
FT                   /protein_id="ABG50005.1"
FT   gene            complement(875936..877123)
FT                   /locus_tag="Tery_0558"
FT   CDS_pept        complement(875936..877123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0558"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_3787 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50006"
FT                   /db_xref="GOA:Q118R8"
FT                   /db_xref="UniProtKB/TrEMBL:Q118R8"
FT                   /protein_id="ABG50006.1"
FT   gene            877194..878096
FT                   /locus_tag="Tery_0559"
FT   CDS_pept        877194..878096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0559"
FT                   /product="protein of unknown function DUF752"
FT                   /note="PFAM: protein of unknown function DUF752; KEGG:
FT                   ana:alr3919 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50007"
FT                   /db_xref="GOA:Q118R7"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q118R7"
FT                   /protein_id="ABG50007.1"
FT   gene            878411..879826
FT                   /locus_tag="Tery_0560"
FT   CDS_pept        878411..879826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0560"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase /
FT                   glucosamine-1-phosphate N-acetyltransferase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: transferase hexapeptide repeat Nucleotidyl
FT                   transferase; KEGG: ana:alr3921 glucosamine-1-phosphate
FT                   N-acetyltransferase / UDP-N-acetylglucosamine
FT                   pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50008"
FT                   /db_xref="GOA:Q118R6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q118R6"
FT                   /protein_id="ABG50008.1"
FT                   SDESKKEENKSSP"
FT   gene            880082..881080
FT                   /locus_tag="Tery_0561"
FT   CDS_pept        880082..881080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0561"
FT                   /product="Alcohol dehydrogenase, zinc-binding"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding Alcohol
FT                   dehydrogenase GroES-like; KEGG: mlo:mll3915 alcohol
FT                   dehydrogenase (NADPH quinone oxidoreductase)"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50009"
FT                   /db_xref="GOA:Q118R5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q118R5"
FT                   /protein_id="ABG50009.1"
FT   gene            881101..882081
FT                   /locus_tag="Tery_0562"
FT   CDS_pept        881101..882081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0562"
FT                   /product="Alcohol dehydrogenase, zinc-binding"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding Alcohol
FT                   dehydrogenase GroES-like; KEGG: lpl:lp_0111 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50010"
FT                   /db_xref="GOA:Q118R4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q118R4"
FT                   /protein_id="ABG50010.1"
FT   gene            882334..882663
FT                   /locus_tag="Tery_0563"
FT   CDS_pept        882334..882663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr4912 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50011"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q118R3"
FT                   /protein_id="ABG50011.1"
FT                   EVGEY"
FT   gene            complement(882852..883628)
FT                   /locus_tag="Tery_0564"
FT   CDS_pept        complement(882852..883628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50012"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR036813"
FT                   /db_xref="UniProtKB/TrEMBL:Q118R2"
FT                   /protein_id="ABG50012.1"
FT   sig_peptide     complement(883554..883628)
FT                   /locus_tag="Tery_0564"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.951 at
FT                   residue 25"
FT   gene            884921..886705
FT                   /locus_tag="Tery_0565"
FT   CDS_pept        884921..886705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0565"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: bth:BT3029
FT                   Na+/glucose symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50013"
FT                   /db_xref="GOA:Q118R1"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q118R1"
FT                   /protein_id="ABG50013.1"
FT                   ILSICLYFAWYRYLKVKN"
FT   gene            887187..887558
FT                   /pseudo
FT                   /locus_tag="Tery_0566"
FT   gene            887761..889149
FT                   /locus_tag="Tery_0567"
FT   CDS_pept        887761..889149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0567"
FT                   /product="Tetratricopeptide TPR_2"
FT                   /note="PFAM: TPR repeat Tetratricopeptide TPR_2; SMART:
FT                   Tetratricopeptide region; KEGG: ava:Ava_B0009
FT                   serine/threonine protein kinase with TPR repeats"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50014"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q118R0"
FT                   /protein_id="ABG50014.1"
FT                   QLNN"
FT   gene            889556..890587
FT                   /locus_tag="Tery_0568"
FT   CDS_pept        889556..890587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0568"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:alr7233 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50015"
FT                   /db_xref="UniProtKB/TrEMBL:Q118Q9"
FT                   /protein_id="ABG50015.1"
FT                   LRR"
FT   sig_peptide     889556..889645
FT                   /locus_tag="Tery_0568"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 30"
FT   gene            890732..891178
FT                   /pseudo
FT                   /locus_tag="Tery_0569"
FT   gene            891343..901950
FT                   /locus_tag="Tery_0570"
FT   CDS_pept        891343..901950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0570"
FT                   /product="filamentous haemagglutinin family outer membrane
FT                   protein"
FT                   /note="TIGRFAM: filamentous haemagglutinin family outer
FT                   membrane protein; PFAM: Proprotein convertase, P
FT                   Haemagluttinin filamentous haemagglutinin-like; KEGG:
FT                   tel:tlr1645 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50016"
FT                   /db_xref="GOA:Q118Q8"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:Q118Q8"
FT                   /protein_id="ABG50016.1"
FT                   GFTIVGSPW"
FT   sig_peptide     891343..891429
FT                   /locus_tag="Tery_0570"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            902113..902460
FT                   /pseudo
FT                   /locus_tag="Tery_0571"
FT   gene            902632..912891
FT                   /locus_tag="Tery_0572"
FT   CDS_pept        902632..912891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0572"
FT                   /product="filamentous haemagglutinin family outer membrane
FT                   protein"
FT                   /note="TIGRFAM: filamentous haemagglutinin family outer
FT                   membrane protein; PFAM: Proprotein convertase, P
FT                   Haemagluttinin filamentous haemagglutinin-like; KEGG:
FT                   syn:slr1753 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50017"
FT                   /db_xref="GOA:Q118Q7"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:Q118Q7"
FT                   /protein_id="ABG50017.1"
FT                   WAGFTIVGSPW"
FT   sig_peptide     902632..902718
FT                   /locus_tag="Tery_0572"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 29"
FT   gene            913780..923676
FT                   /locus_tag="Tery_0573"
FT   CDS_pept        913780..923676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0573"
FT                   /product="filamentous haemagglutinin family outer membrane
FT                   protein"
FT                   /note="TIGRFAM: filamentous haemagglutinin family outer
FT                   membrane protein; PFAM: Proprotein convertase, P
FT                   Haemagluttinin; KEGG: tel:tlr1645 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50018"
FT                   /db_xref="GOA:Q118Q6"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:Q118Q6"
FT                   /protein_id="ABG50018.1"
FT                   FTMVGSPW"
FT   gene            complement(924892..925005)
FT                   /locus_tag="Tery_0574"
FT   CDS_pept        complement(924892..925005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50019"
FT                   /db_xref="InterPro:IPR002622"
FT                   /db_xref="UniProtKB/TrEMBL:Q118Q5"
FT                   /protein_id="ABG50019.1"
FT   gene            925476..926078
FT                   /locus_tag="Tery_0575"
FT   CDS_pept        925476..926078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0575"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:gll1515 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50020"
FT                   /db_xref="InterPro:IPR010903"
FT                   /db_xref="UniProtKB/TrEMBL:Q118Q4"
FT                   /protein_id="ABG50020.1"
FT   gene            complement(926399..927370)
FT                   /locus_tag="Tery_0576"
FT   CDS_pept        complement(926399..927370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0576"
FT                   /product="Rieske (2Fe-2S) region"
FT                   /note="PFAM: Rieske [2Fe-2S] region; KEGG: dre:436885
FT                   zgc:92275 Pfam: Rieske"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50021"
FT                   /db_xref="GOA:Q118Q3"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q118Q3"
FT                   /protein_id="ABG50021.1"
FT   gene            927461..929014
FT                   /locus_tag="Tery_0577"
FT   CDS_pept        927461..929014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0577"
FT                   /product="ATP phosphoribosyltransferase regulatory subunit"
FT                   /EC_number=""
FT                   /note="KEGG: mth:MTH244 histidyl-tRNA synthetase; TIGRFAM:
FT                   histidyl-tRNA synthetase; PFAM: tRNA synthetase, class II
FT                   (G, H, P and S) Anticodon-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50022"
FT                   /db_xref="GOA:Q118Q2"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:Q118Q2"
FT                   /protein_id="ABG50022.1"
FT                   "
FT   gene            929569..930585
FT                   /locus_tag="Tery_0578"
FT   CDS_pept        929569..930585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0578"
FT                   /product="ATP phosphoribosyltransferase regulatory subunit
FT                   / ATP phosphoribosyltransferase (homohexameric)"
FT                   /EC_number=""
FT                   /note="PFAM: ATP phosphoribosyltransferase; KEGG:
FT                   ath:At1g09795 ATP phosphoribosyl transferase 2 (ATP-PRT2)"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50023"
FT                   /db_xref="GOA:Q118Q1"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/TrEMBL:Q118Q1"
FT                   /protein_id="ABG50023.1"
FT   gene            930908..931135
FT                   /locus_tag="Tery_0579"
FT   CDS_pept        930908..931135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0579"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding; KEGG:
FT                   ava:Ava_0986 4Fe-4S ferredoxin, iron-sulfur binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50024"
FT                   /db_xref="GOA:Q118Q0"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q118Q0"
FT                   /protein_id="ABG50024.1"
FT   gene            complement(931529..932113)
FT                   /locus_tag="Tery_0580"
FT   CDS_pept        complement(931529..932113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0580"
FT                   /product="pentapeptide repeat"
FT                   /note="PFAM: pentapeptide repeat; KEGG: ava:Ava_0290
FT                   pentapeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50025"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q118P9"
FT                   /protein_id="ABG50025.1"
FT   gene            932940..934169
FT                   /locus_tag="Tery_0581"
FT   CDS_pept        932940..934169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0581"
FT                   /product="tryptophan synthase, beta chain"
FT                   /EC_number=""
FT                   /note="TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit;
FT                   KEGG: ava:Ava_1911 tryptophan synthase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50026"
FT                   /db_xref="GOA:Q118P8"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q118P8"
FT                   /protein_id="ABG50026.1"
FT                   VQTVGKFLEG"
FT   gene            934521..935816
FT                   /locus_tag="Tery_0582"
FT   CDS_pept        934521..935816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0582"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: reu:Reut_B3853
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50027"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q118P7"
FT                   /protein_id="ABG50027.1"
FT   sig_peptide     934521..934598
FT                   /locus_tag="Tery_0582"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.877) with cleavage site probability 0.461 at
FT                   residue 26"
FT   gene            complement(936159..936404)
FT                   /pseudo
FT                   /locus_tag="Tery_0583"
FT   gene            complement(936923..938272)
FT                   /locus_tag="Tery_0584"
FT   CDS_pept        complement(936923..938272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0584"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpX"
FT                   /EC_number=""
FT                   /note="KEGG: ana:alr3684 ATP-dependent Clp protease
FT                   regulatory subunit; TIGRFAM: ATP-dependent Clp protease,
FT                   ATP-binding subunit ClpX; PFAM: AAA ATPase, central region
FT                   zinc finger, C4-type ATPase AAA-2; SMART: ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50028"
FT                   /db_xref="GOA:Q118P6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q118P6"
FT                   /protein_id="ABG50028.1"
FT   gene            complement(938282..938977)
FT                   /locus_tag="Tery_0585"
FT   CDS_pept        complement(938282..938977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0585"
FT                   /product="ATP-dependent Clp protease proteolytic subunit
FT                   ClpP"
FT                   /EC_number=""
FT                   /note="KEGG: ava:Ava_3604 peptidase S14, ClpP; TIGRFAM:
FT                   ATP-dependent Clp protease, proteolytic subunit ClpP; PFAM:
FT                   peptidase S14, ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50029"
FT                   /db_xref="GOA:Q118P5"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:Q118P5"
FT                   /protein_id="ABG50029.1"
FT                   PGESVPAMQ"
FT   gene            complement(940019..941476)
FT                   /locus_tag="Tery_0586"
FT   CDS_pept        complement(940019..941476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0586"
FT                   /product="trigger factor"
FT                   /note="TIGRFAM: trigger factor; PFAM: peptidylprolyl
FT                   isomerase, FKBP-type trigger factor-like; KEGG: ana:alr3681
FT                   trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50030"
FT                   /db_xref="GOA:Q118P4"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q118P4"
FT                   /protein_id="ABG50030.1"
FT   gene            943156..944193
FT                   /locus_tag="Tery_0587"
FT   CDS_pept        943156..944193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0587"
FT                   /product="aspartate semialdehyde dehydrogenase"
FT                   /EC_number=""
FT                   /note="KEGG: ava:Ava_3606 aspartate-semialdehyde
FT                   dehydrogenase; TIGRFAM: aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase, NAD -
FT                   binding Semialdehyde dehydrogenase, dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50031"
FT                   /db_xref="GOA:Q118P3"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q118P3"
FT                   /protein_id="ABG50031.1"
FT                   PVGTF"
FT   gene            944659..945549
FT                   /locus_tag="Tery_0588"
FT   CDS_pept        944659..945549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0588"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: dihydrodipicolinate synthase; PFAM:
FT                   dihydrodipicolinate synthetase; KEGG: ana:all3679
FT                   dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50032"
FT                   /db_xref="GOA:Q118P2"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:Q118P2"
FT                   /protein_id="ABG50032.1"
FT                   EKLRVEMDKLGLLAR"
FT   gene            945800..947590
FT                   /locus_tag="Tery_0589"
FT   CDS_pept        945800..947590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0589"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; PFAM:
FT                   beta-lactamase-like RNA-metabolising
FT                   metallo-beta-lactamase; KEGG: ava:Ava_3608 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50033"
FT                   /db_xref="GOA:Q118P1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:Q118P1"
FT                   /protein_id="ABG50033.1"
FT   gene            complement(947925..949313)
FT                   /locus_tag="Tery_0590"
FT   CDS_pept        complement(947925..949313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0590"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gvi:glr1965 WD-repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50034"
FT                   /db_xref="GOA:Q118P0"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q118P0"
FT                   /protein_id="ABG50034.1"
FT                   LLQQ"
FT   gene            949911..952352
FT                   /locus_tag="Tery_0591"
FT   CDS_pept        949911..952352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0591"
FT                   /product="FG-GAP"
FT                   /note="PFAM: Hemolysin-type calcium-binding region FG-GAP;
FT                   KEGG: ava:Ava_0582 integrins alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50035"
FT                   /db_xref="GOA:Q118N9"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="UniProtKB/TrEMBL:Q118N9"
FT                   /protein_id="ABG50035.1"
FT                   N"
FT   gene            complement(952466..953506)
FT                   /locus_tag="Tery_0592"
FT   CDS_pept        complement(952466..953506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0592"
FT                   /product="peptidase S51, dipeptidase E"
FT                   /note="KEGG: ava:Ava_0438 peptidase S51, dipeptidase E"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50036"
FT                   /db_xref="GOA:Q118N8"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR011811"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q118N8"
FT                   /protein_id="ABG50036.1"
FT                   IDSNPY"
FT   sig_peptide     complement(953381..953506)
FT                   /locus_tag="Tery_0592"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.586 at
FT                   residue 42"
FT   gene            954378..954875
FT                   /locus_tag="Tery_0593"
FT   CDS_pept        954378..954875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50037"
FT                   /db_xref="UniProtKB/TrEMBL:Q118N7"
FT                   /protein_id="ABG50037.1"
FT                   LR"
FT   gene            complement(955170..955334)
FT                   /locus_tag="Tery_0594"
FT   CDS_pept        complement(955170..955334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50038"
FT                   /db_xref="UniProtKB/TrEMBL:Q118N6"
FT                   /protein_id="ABG50038.1"
FT                   EALWMWPQR"
FT   gene            complement(955607..957274)
FT                   /locus_tag="Tery_0595"
FT   CDS_pept        complement(955607..957274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0595"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50039"
FT                   /db_xref="GOA:Q118N5"
FT                   /db_xref="InterPro:IPR021787"
FT                   /db_xref="UniProtKB/TrEMBL:Q118N5"
FT                   /protein_id="ABG50039.1"
FT   sig_peptide     complement(957194..957274)
FT                   /locus_tag="Tery_0595"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.954 at
FT                   residue 27"
FT   gene            complement(958283..958738)
FT                   /locus_tag="Tery_0596"
FT   CDS_pept        complement(958283..958738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0596"
FT                   /product="GatB/Yqey"
FT                   /note="PFAM: GatB/Yqey; KEGG: cte:CT0607 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50040"
FT                   /db_xref="GOA:Q118N4"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:Q118N4"
FT                   /protein_id="ABG50040.1"
FT   gene            959820..960812
FT                   /locus_tag="Tery_0597"
FT   CDS_pept        959820..960812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0597"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number=""
FT                   /note="KEGG: syf:Synpcc7942_2113 ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50041"
FT                   /db_xref="GOA:Q118N3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:Q118N3"
FT                   /protein_id="ABG50041.1"
FT   gene            961521..963302
FT                   /locus_tag="Tery_0598"
FT   CDS_pept        961521..963302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0598"
FT                   /product="protein of unknown function DUF262"
FT                   /note="PFAM: protein of unknown function DUF262; KEGG:
FT                   ana:all4179 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50042"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:Q118N2"
FT                   /protein_id="ABG50042.1"
FT                   RQEILTQLAKKVWDVPE"
FT   gene            963524..966562
FT                   /locus_tag="Tery_0599"
FT   CDS_pept        963524..966562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0599"
FT                   /product="Na-Ca exchanger/integrin-beta4"
FT                   /note="PFAM: Na-Ca exchanger/integrin-beta4 peptidase-like
FT                   FG-GAP; KEGG: ava:Ava_0582 integrins alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50043"
FT                   /db_xref="GOA:Q118N1"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:Q118N1"
FT                   /protein_id="ABG50043.1"
FT   gene            966890..968791
FT                   /locus_tag="Tery_0600"
FT   CDS_pept        966890..968791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0600"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lma:LmjF27.0240 kinetoplast-associated
FT                   protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50044"
FT                   /db_xref="UniProtKB/TrEMBL:Q118N0"
FT                   /protein_id="ABG50044.1"
FT   gene            969256..972612
FT                   /locus_tag="Tery_0601"
FT   CDS_pept        969256..972612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0601"
FT                   /product="Na-Ca exchanger/integrin-beta4"
FT                   /note="PFAM: Na-Ca exchanger/integrin-beta4 peptidase-like
FT                   FG-GAP; KEGG: ava:Ava_0582 integrins alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50045"
FT                   /db_xref="GOA:Q118M9"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:Q118M9"
FT                   /protein_id="ABG50045.1"
FT                   DYRLIVNIVEF"
FT   gene            complement(973082..974287)
FT                   /locus_tag="Tery_0602"
FT   CDS_pept        complement(973082..974287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0602"
FT                   /product="ferrochelatase"
FT                   /note="PFAM: ferrochelatase; KEGG: ava:Ava_2754
FT                   ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50046"
FT                   /db_xref="GOA:Q118M8"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:Q118M8"
FT                   /protein_id="ABG50046.1"
FT                   HH"
FT   gene            975384..975956
FT                   /locus_tag="Tery_0603"
FT   CDS_pept        975384..975956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0603"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_2755 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50047"
FT                   /db_xref="GOA:Q118M7"
FT                   /db_xref="UniProtKB/TrEMBL:Q118M7"
FT                   /protein_id="ABG50047.1"
FT   gene            976490..977383
FT                   /locus_tag="Tery_0604"
FT   CDS_pept        976490..977383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0604"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: ana:alr3685
FT                   similar to esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50048"
FT                   /db_xref="GOA:Q118M6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q118M6"
FT                   /protein_id="ABG50048.1"
FT                   LEDREKYLQKVLNFVA"
FT   gene            979363..979587
FT                   /locus_tag="Tery_0605"
FT   CDS_pept        979363..979587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0605"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_B0242 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50049"
FT                   /db_xref="UniProtKB/TrEMBL:Q118M5"
FT                   /protein_id="ABG50049.1"
FT   gene            980268..980867
FT                   /locus_tag="Tery_0606"
FT   CDS_pept        980268..980867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0606"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr0963 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50050"
FT                   /db_xref="UniProtKB/TrEMBL:Q118M4"
FT                   /protein_id="ABG50050.1"
FT   gene            complement(981336..984209)
FT                   /locus_tag="Tery_0607"
FT   CDS_pept        complement(981336..984209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0607"
FT                   /product="Tetratricopeptide TPR_2"
FT                   /note="PFAM: TPR repeat Tetratricopeptide TPR_2; SMART:
FT                   Tetratricopeptide region; KEGG: ana:all1820 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50051"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:Q118M3"
FT                   /protein_id="ABG50051.1"
FT   sig_peptide     complement(984150..984209)
FT                   /locus_tag="Tery_0607"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.776) with cleavage site probability 0.775 at
FT                   residue 20"
FT   gene            984446..985642
FT                   /locus_tag="Tery_0608"
FT   CDS_pept        984446..985642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0608"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   ava:Ava_3775 response regulator receiver domain protein
FT                   (CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50052"
FT                   /db_xref="GOA:Q118M2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024186"
FT                   /db_xref="UniProtKB/TrEMBL:Q118M2"
FT                   /protein_id="ABG50052.1"
FT   gene            complement(986538..987218)
FT                   /locus_tag="Tery_0609"
FT   CDS_pept        complement(986538..987218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0609"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase; KEGG:
FT                   ana:all5167 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50053"
FT                   /db_xref="GOA:Q118M1"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q118M1"
FT                   /protein_id="ABG50053.1"
FT                   LKAL"
FT   gene            988174..989139
FT                   /locus_tag="Tery_0610"
FT   CDS_pept        988174..989139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0610"
FT                   /product="glycosyl transferase, family 9"
FT                   /note="PFAM: glycosyl transferase, family 9; KEGG:
FT                   ava:Ava_2415 glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50054"
FT                   /db_xref="GOA:Q118M0"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:Q118M0"
FT                   /protein_id="ABG50054.1"
FT   gene            complement(989491..989970)
FT                   /locus_tag="Tery_0611"
FT   CDS_pept        complement(989491..989970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0611"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all5169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50055"
FT                   /db_xref="InterPro:IPR014946"
FT                   /db_xref="UniProtKB/TrEMBL:Q118L9"
FT                   /protein_id="ABG50055.1"
FT   gene            990764..992905
FT                   /locus_tag="Tery_0612"
FT   CDS_pept        990764..992905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0612"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_4199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50056"
FT                   /db_xref="GOA:Q118L8"
FT                   /db_xref="UniProtKB/TrEMBL:Q118L8"
FT                   /protein_id="ABG50056.1"
FT   gene            993008..994957
FT                   /locus_tag="Tery_0613"
FT   CDS_pept        993008..994957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0613"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG: ana:alr0960
FT                   two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50057"
FT                   /db_xref="GOA:Q118L7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR022552"
FT                   /db_xref="UniProtKB/TrEMBL:Q118L7"
FT                   /protein_id="ABG50057.1"
FT                   RRNHEQSRRQKGSI"
FT   gene            995266..996087
FT                   /locus_tag="Tery_0614"
FT   CDS_pept        995266..996087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0614"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0827 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50058"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q118L6"
FT                   /protein_id="ABG50058.1"
FT   gene            997127..998314
FT                   /locus_tag="Tery_0615"
FT   CDS_pept        997127..998314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0615"
FT                   /product="response regulator receiver sensor signal
FT                   transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="PFAM: response regulator receiveR ATP-binding
FT                   region, ATPase-like histidine kinase A-like; KEGG:
FT                   ana:all4496 two-component system sensory histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50059"
FT                   /db_xref="GOA:Q118L5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q118L5"
FT                   /protein_id="ABG50059.1"
FT   gene            998647..999150
FT                   /locus_tag="Tery_0616"
FT   CDS_pept        998647..999150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0616"
FT                   /product="putative transposase"
FT                   /note="KEGG: ava:Ava_C0088 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50060"
FT                   /db_xref="GOA:Q10V81"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q10V81"
FT                   /protein_id="ABG50060.1"
FT                   SHLN"
FT   gene            999129..999719
FT                   /pseudo
FT                   /locus_tag="Tery_0617"
FT   gene            1002049..1004481
FT                   /locus_tag="Tery_0618"
FT   CDS_pept        1002049..1004481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0618"
FT                   /product="exonuclease RecJ"
FT                   /EC_number="3.1.-.-"
FT                   /note="TIGRFAM: single-stranded-DNA-specific exonuclease
FT                   RecJ; PFAM: phosphoesterase, RecJ-like phosphoesterase,
FT                   DHHA1; KEGG: ana:all1989 single-strand-DNA-specific
FT                   exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50061"
FT                   /db_xref="GOA:Q118L3"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:Q118L3"
FT                   /protein_id="ABG50061.1"
FT   gene            1004527..1006728
FT                   /locus_tag="Tery_0619"
FT   CDS_pept        1004527..1006728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0619"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: protein phosphatase 2C-like; KEGG:
FT                   ava:Ava_0354 protein serine/threonine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50062"
FT                   /db_xref="GOA:Q118L2"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q118L2"
FT                   /protein_id="ABG50062.1"
FT   gene            complement(1007468..1007719)
FT                   /pseudo
FT                   /locus_tag="Tery_0620"
FT   gene            1009357..1010580
FT                   /locus_tag="Tery_0621"
FT   CDS_pept        1009357..1010580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0621"
FT                   /product="serine/threonine protein kinase with FHA domain"
FT                   /note="PFAM: Forkhead-associated protein kinase; SMART:
FT                   Tyrosine protein kinase Serine/threonine protein kinase;
FT                   KEGG: ava:Ava_0353 serine/threonine protein kinase with FHA
FT                   domain modulation"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50063"
FT                   /db_xref="GOA:Q118L1"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q118L1"
FT                   /protein_id="ABG50063.1"
FT                   AEALNSCL"
FT   gene            complement(1011270..1011488)
FT                   /locus_tag="Tery_0622"
FT   CDS_pept        complement(1011270..1011488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0622"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:asl0550 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50064"
FT                   /db_xref="InterPro:IPR025477"
FT                   /db_xref="UniProtKB/TrEMBL:Q118L0"
FT                   /protein_id="ABG50064.1"
FT   gene            complement(1012706..1013788)
FT                   /locus_tag="Tery_0623"
FT   CDS_pept        complement(1012706..1013788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0623"
FT                   /product="secretion protein HlyD"
FT                   /note="PFAM: secretion protein HlyD; KEGG:
FT                   syf:Synpcc7942_1132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50065"
FT                   /db_xref="GOA:Q118K9"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q118K9"
FT                   /protein_id="ABG50065.1"
FT   gene            1017941..1018180
FT                   /locus_tag="Tery_0624"
FT   CDS_pept        1017941..1018180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50066"
FT                   /db_xref="UniProtKB/TrEMBL:Q118K8"
FT                   /protein_id="ABG50066.1"
FT   gene            1018348..1020558
FT                   /locus_tag="Tery_0625"
FT   CDS_pept        1018348..1020558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0625"
FT                   /product="bacteriocin-processing peptidase. Cysteine
FT                   peptidase. MEROPS family C39"
FT                   /note="PFAM: ABC transporter, transmembrane region ABC
FT                   transporter related peptidase C39, bacteriocin processing;
FT                   SMART: ATPase; KEGG: ana:alr5147 putative multidrug
FT                   resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50067"
FT                   /db_xref="GOA:Q118K7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q118K7"
FT                   /protein_id="ABG50067.1"
FT   gene            1020821..1027000
FT                   /locus_tag="Tery_0626"
FT   CDS_pept        1020821..1027000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0626"
FT                   /product="Tetratricopeptide TPR_2"
FT                   /note="PFAM: TPR repeat Tetratricopeptide TPR_2; SMART:
FT                   RNA-processing protein, HAT helix Tetratricopeptide region;
FT                   KEGG: mba:Mbar_A3643 TPR-domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50068"
FT                   /db_xref="GOA:Q118K6"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q118K6"
FT                   /protein_id="ABG50068.1"
FT                   DEYQALKR"
FT   gene            complement(1027704..1029122)
FT                   /locus_tag="Tery_0627"
FT   CDS_pept        complement(1027704..1029122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0627"
FT                   /product="ResB-like"
FT                   /note="PFAM: ResB-like; KEGG: ana:alr3123 c-type cytochrome
FT                   biogenesis protein Ccs1"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50069"
FT                   /db_xref="GOA:Q118K5"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="InterPro:IPR023494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q118K5"
FT                   /protein_id="ABG50069.1"
FT                   LFSDFSEGIKTSEN"
FT   gene            complement(1029386..1030117)
FT                   /locus_tag="Tery_0628"
FT   CDS_pept        complement(1029386..1030117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0628"
FT                   /product="cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein, transmembrane
FT                   region; KEGG: ava:Ava_3823 cytochrome c biogenesis protein,
FT                   transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50070"
FT                   /db_xref="GOA:Q118K4"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:Q118K4"
FT                   /protein_id="ABG50070.1"
FT   gene            1030632..1030886
FT                   /locus_tag="Tery_0629"
FT   CDS_pept        1030632..1030886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0629"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lic:LIC11192 ChpI"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50071"
FT                   /db_xref="GOA:Q118K3"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q118K3"
FT                   /protein_id="ABG50071.1"
FT   gene            1030880..1031239
FT                   /locus_tag="Tery_0630"
FT   CDS_pept        1030880..1031239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0630"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /note="PFAM: PemK-like protein; KEGG: lil:LA2843 chpK"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50072"
FT                   /db_xref="GOA:Q118K2"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q118K2"
FT                   /protein_id="ABG50072.1"
FT                   LNGVELLLKPTDMES"
FT   gene            complement(1031502..1032680)
FT                   /locus_tag="Tery_0631"
FT   CDS_pept        complement(1031502..1032680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0631"
FT                   /product="Glycosyltransferase-like"
FT                   /note="KEGG: pho:PH1844 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50073"
FT                   /db_xref="GOA:Q118K1"
FT                   /db_xref="UniProtKB/TrEMBL:Q118K1"
FT                   /protein_id="ABG50073.1"
FT   gene            complement(1033514..1033714)
FT                   /locus_tag="Tery_0632"
FT   CDS_pept        complement(1033514..1033714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0632"
FT                   /product="transposase"
FT                   /note="KEGG: ana:alr1858 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50074"
FT                   /db_xref="GOA:Q118K0"
FT                   /db_xref="InterPro:IPR001523"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q118K0"
FT                   /protein_id="ABG50074.1"
FT   gene            1034058..1035113
FT                   /locus_tag="Tery_0633"
FT   CDS_pept        1034058..1035113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0633"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   ava:Ava_0513 cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50075"
FT                   /db_xref="GOA:Q118J9"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q118J9"
FT                   /protein_id="ABG50075.1"
FT                   GKGLHSYGWFL"
FT   gene            complement(1035239..1035574)
FT                   /pseudo
FT                   /locus_tag="Tery_0634"
FT   gene            1035817..1036140
FT                   /locus_tag="Tery_0635"
FT   CDS_pept        1035817..1036140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50076"
FT                   /db_xref="InterPro:IPR014971"
FT                   /db_xref="UniProtKB/TrEMBL:Q118J8"
FT                   /protein_id="ABG50076.1"
FT                   MWS"
FT   gene            1036276..1038555
FT                   /locus_tag="Tery_0636"
FT   CDS_pept        1036276..1038555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0636"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_B0313 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50077"
FT                   /db_xref="InterPro:IPR024019"
FT                   /db_xref="UniProtKB/TrEMBL:Q118J7"
FT                   /protein_id="ABG50077.1"
FT                   QQLNQK"
FT   gene            1039586..1040161
FT                   /locus_tag="Tery_0637"
FT   CDS_pept        1039586..1040161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0637"
FT                   /product="Rhomboid-like protein"
FT                   /note="PFAM: Rhomboid-like protein; KEGG: gvi:glr0081
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50078"
FT                   /db_xref="GOA:Q118J6"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q118J6"
FT                   /protein_id="ABG50078.1"
FT   gene            1041012..1041449
FT                   /locus_tag="Tery_0638"
FT   CDS_pept        1041012..1041449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0638"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr4309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50079"
FT                   /db_xref="GOA:Q118J5"
FT                   /db_xref="InterPro:IPR025067"
FT                   /db_xref="UniProtKB/TrEMBL:Q118J5"
FT                   /protein_id="ABG50079.1"
FT   sig_peptide     1041012..1041098
FT                   /locus_tag="Tery_0638"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.910) with cleavage site probability 0.396 at
FT                   residue 29"
FT   gene            complement(1041863..1042810)
FT                   /locus_tag="Tery_0639"
FT   CDS_pept        complement(1041863..1042810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0639"
FT                   /product="WD-repeat protein"
FT                   /note="KEGG: gvi:glr1965 WD-repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50080"
FT                   /db_xref="GOA:Q118J4"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q118J4"
FT                   /protein_id="ABG50080.1"
FT   gene            1042907..1043191
FT                   /locus_tag="Tery_0640"
FT   CDS_pept        1042907..1043191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50081"
FT                   /db_xref="GOA:Q118J3"
FT                   /db_xref="UniProtKB/TrEMBL:Q118J3"
FT                   /protein_id="ABG50081.1"
FT   gene            complement(1044189..1045154)
FT                   /locus_tag="Tery_0641"
FT   CDS_pept        complement(1044189..1045154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0641"
FT                   /product="RNAse Z"
FT                   /EC_number=""
FT                   /note="KEGG: ana:alr5152 ribonuclease Z; TIGRFAM:
FT                   ribonuclease Z; PFAM: beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50082"
FT                   /db_xref="GOA:Q118J2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q118J2"
FT                   /protein_id="ABG50082.1"
FT   gene            1047480..1048646
FT                   /locus_tag="Tery_0642"
FT   CDS_pept        1047480..1048646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0642"
FT                   /product="SpoIID/LytB domain"
FT                   /note="TIGRFAM: SpoIID/LytB domain; PFAM: Stage II
FT                   sporulation D; KEGG: ava:Ava_4218 sporulation protein
FT                   SpoIID-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50083"
FT                   /db_xref="GOA:Q118J1"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:Q118J1"
FT                   /protein_id="ABG50083.1"
FT   sig_peptide     1047480..1047596
FT                   /locus_tag="Tery_0642"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.803) with cleavage site probability 0.802 at
FT                   residue 39"
FT   gene            complement(1049819..1051168)
FT                   /locus_tag="Tery_0643"
FT   CDS_pept        complement(1049819..1051168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0643"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50084"
FT                   /db_xref="GOA:Q118J0"
FT                   /db_xref="UniProtKB/TrEMBL:Q118J0"
FT                   /protein_id="ABG50084.1"
FT   gene            1051875..1053653
FT                   /locus_tag="Tery_0644"
FT   CDS_pept        1051875..1053653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0644"
FT                   /product="DNA repair protein RecN"
FT                   /note="TIGRFAM: DNA repair protein RecN; PFAM: SMC
FT                   protein-like; KEGG: ava:Ava_2236 DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50085"
FT                   /db_xref="GOA:Q118I9"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q118I9"
FT                   /protein_id="ABG50085.1"
FT                   EKNSITPISSSSFGGE"
FT   gene            1053969..1054259
FT                   /pseudo
FT                   /locus_tag="Tery_0645"
FT   gene            1054463..1054726
FT                   /locus_tag="Tery_0646"
FT   CDS_pept        1054463..1054726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0646"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50086"
FT                   /db_xref="UniProtKB/TrEMBL:Q118I8"
FT                   /protein_id="ABG50086.1"
FT   gene            1055790..1058525
FT                   /locus_tag="Tery_0647"
FT   CDS_pept        1055790..1058525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0647"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase
FT                   GAF; SMART: PAS; KEGG: ana:all1904 adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50087"
FT                   /db_xref="GOA:Q118I7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q118I7"
FT                   /protein_id="ABG50087.1"
FT   gene            1058584..1058949
FT                   /locus_tag="Tery_0648"
FT   CDS_pept        1058584..1058949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50088"
FT                   /db_xref="UniProtKB/TrEMBL:Q118I6"
FT                   /protein_id="ABG50088.1"
FT                   TAKEIKDKVADKNRSCQ"
FT   gene            1059881..1060057
FT                   /pseudo
FT                   /locus_tag="Tery_0649"
FT   gene            complement(1060928..1062169)
FT                   /locus_tag="Tery_0650"
FT   CDS_pept        complement(1060928..1062169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0650"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_2694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50089"
FT                   /db_xref="UniProtKB/TrEMBL:Q118I5"
FT                   /protein_id="ABG50089.1"
FT                   LLEMAWGFRNRNNS"
FT   gene            complement(1063223..1063879)
FT                   /locus_tag="Tery_0651"
FT   CDS_pept        complement(1063223..1063879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0651"
FT                   /product="translation factor SUA5"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5/yciO/yrdC-like; KEGG: ava:Ava_2693
FT                   SUA5/YciO/YrdC/YwlC"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50090"
FT                   /db_xref="GOA:Q118I4"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:Q118I4"
FT                   /protein_id="ABG50090.1"
FT   gene            1064179..1065519
FT                   /locus_tag="Tery_0652"
FT   CDS_pept        1064179..1065519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0652"
FT                   /product="protein of unknown function DUF111"
FT                   /note="PFAM: protein of unknown function DUF111; KEGG:
FT                   ava:Ava_2692 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50091"
FT                   /db_xref="GOA:Q118I3"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/TrEMBL:Q118I3"
FT                   /protein_id="ABG50091.1"
FT   gene            1066433..1066786
FT                   /locus_tag="Tery_0653"
FT   CDS_pept        1066433..1066786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0653"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50092"
FT                   /db_xref="UniProtKB/TrEMBL:Q118I2"
FT                   /protein_id="ABG50092.1"
FT                   EKSVKGFKLKLGI"
FT   sig_peptide     1066433..1066504
FT                   /locus_tag="Tery_0653"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.988 at
FT                   residue 24"
FT   gene            complement(1067190..1067384)
FT                   /locus_tag="Tery_0654"
FT   CDS_pept        complement(1067190..1067384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0654"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1924 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50093"
FT                   /db_xref="InterPro:IPR021336"
FT                   /db_xref="UniProtKB/TrEMBL:Q118I1"
FT                   /protein_id="ABG50093.1"
FT   gene            complement(1068070..1068591)
FT                   /locus_tag="Tery_0655"
FT   CDS_pept        complement(1068070..1068591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0655"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr1607 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50094"
FT                   /db_xref="UniProtKB/TrEMBL:Q118I0"
FT                   /protein_id="ABG50094.1"
FT                   ELNHLSRSRK"
FT   gene            1069580..1069819
FT                   /locus_tag="Tery_0656"
FT   CDS_pept        1069580..1069819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0656"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:asr2387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50095"
FT                   /db_xref="GOA:Q118H9"
FT                   /db_xref="UniProtKB/TrEMBL:Q118H9"
FT                   /protein_id="ABG50095.1"
FT   gene            1070417..1073758
FT                   /locus_tag="Tery_0657"
FT   CDS_pept        1070417..1073758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0657"
FT                   /product="Na-Ca exchanger/integrin-beta4"
FT                   /note="PFAM: Na-Ca exchanger/integrin-beta4 peptidase-like
FT                   FG-GAP; SMART: Integrin alpha beta-propellor; KEGG:
FT                   ava:Ava_0582 integrins alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50096"
FT                   /db_xref="GOA:Q118H8"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR013519"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:Q118H8"
FT                   /protein_id="ABG50096.1"
FT                   SINIIN"
FT   gene            1073905..1074138
FT                   /locus_tag="Tery_0658"
FT   CDS_pept        1073905..1074138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0658"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50097"
FT                   /db_xref="GOA:Q118H7"
FT                   /db_xref="UniProtKB/TrEMBL:Q118H7"
FT                   /protein_id="ABG50097.1"
FT   gene            complement(1074302..1075885)
FT                   /locus_tag="Tery_0659"
FT   CDS_pept        complement(1074302..1075885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0659"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /EC_number=""
FT                   /note="KEGG: ana:alr3957 NADH dehydrogenase subunit 4;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain M; PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50098"
FT                   /db_xref="GOA:Q118H6"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="InterPro:IPR022997"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q118H6"
FT                   /protein_id="ABG50098.1"
FT                   ELPTRAPEIK"
FT   gene            complement(1076583..1078646)
FT                   /locus_tag="Tery_0660"
FT   CDS_pept        complement(1076583..1078646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0660"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain L"
FT                   /EC_number=""
FT                   /note="KEGG: syn:slr0844 NADH dehydrogenase I subunit 5,
FT                   involved in photosystem-1 cyclic electron flow; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain L;
FT                   PFAM: NADH-Ubiquinone oxidoreductase (complex I), chain
FT                   5/L-like NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50099"
FT                   /db_xref="GOA:Q118H5"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR002128"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:Q118H5"
FT                   /protein_id="ABG50099.1"
FT   gene            1079303..1082704
FT                   /locus_tag="Tery_0661"
FT   CDS_pept        1079303..1082704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0661"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase
FT                   response regulator receiveR ATP-binding region, ATPase-like
FT                   histidine kinase, HAMP region histidine kinase A-like;
FT                   KEGG: ava:Ava_2148 multi-sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50100"
FT                   /db_xref="GOA:Q118H4"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q118H4"
FT                   /protein_id="ABG50100.1"
FT   gene            1082962..1086354
FT                   /locus_tag="Tery_0662"
FT   CDS_pept        1082962..1086354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0662"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase
FT                   response regulator receiveR ATP-binding region, ATPase-like
FT                   histidine kinase, HAMP region histidine kinase A-like
FT                   Cache; KEGG: ava:Ava_2148 multi-sensor hybrid histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50101"
FT                   /db_xref="GOA:Q118H3"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q118H3"
FT                   /protein_id="ABG50101.1"
FT   gene            1086668..1086862
FT                   /locus_tag="Tery_0663"
FT   CDS_pept        1086668..1086862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0663"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr1266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50102"
FT                   /db_xref="UniProtKB/TrEMBL:Q118H2"
FT                   /protein_id="ABG50102.1"
FT   gene            complement(1086982..1089591)
FT                   /locus_tag="Tery_0664"
FT   CDS_pept        complement(1086982..1089591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0664"
FT                   /product="aconitase"
FT                   /EC_number=""
FT                   /note="PFAM: aconitate hydratase-like aconitate hydratase
FT                   2; KEGG: syn:slr0665 aconitate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50103"
FT                   /db_xref="GOA:Q118H1"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:Q118H1"
FT                   /protein_id="ABG50103.1"
FT   gene            1091046..1093646
FT                   /locus_tag="Tery_0665"
FT   CDS_pept        1091046..1093646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0665"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: ana:alr3170 hypothetical protein; TIGRFAM: PAS
FT                   sensor protein diguanylate cyclase; PFAM: conserved
FT                   hypothetical protein EAL PAS fold-3 PAS fold-4 PAS fold;
FT                   SMART: PAS PAC motif"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50104"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q118H0"
FT                   /protein_id="ABG50104.1"
FT   gene            complement(1094074..1096749)
FT                   /locus_tag="Tery_0666"
FT   CDS_pept        complement(1094074..1096749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0666"
FT                   /product="Na-Ca exchanger/integrin-beta4"
FT                   /note="PFAM: Na-Ca exchanger/integrin-beta4 peptidase-like
FT                   FG-GAP; KEGG: ava:Ava_0582 integrins alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50105"
FT                   /db_xref="GOA:Q118G9"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:Q118G9"
FT                   /protein_id="ABG50105.1"
FT   gene            1096877..1097611
FT                   /locus_tag="Tery_0667"
FT   CDS_pept        1096877..1097611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0667"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="PFAM: phosphatidate cytidylyltransferase; KEGG:
FT                   ava:Ava_4221 phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50106"
FT                   /db_xref="GOA:Q118G8"
FT                   /db_xref="InterPro:IPR039606"
FT                   /db_xref="UniProtKB/TrEMBL:Q118G8"
FT                   /protein_id="ABG50106.1"
FT   gene            complement(1098292..1098864)
FT                   /locus_tag="Tery_0668"
FT   CDS_pept        complement(1098292..1098864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0668"
FT                   /product="putative transposase, IS891/IS1136/IS1341"
FT                   /note="PFAM: putative transposase, IS891/IS1136/IS1341;
FT                   KEGG: tel:tlr1113 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50107"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q118G7"
FT                   /protein_id="ABG50107.1"
FT   gene            complement(1100436..1101193)
FT                   /pseudo
FT                   /locus_tag="Tery_0669"
FT   gene            complement(1101344..1101442)
FT                   /locus_tag="Tery_0670"
FT   CDS_pept        complement(1101344..1101442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50108"
FT                   /db_xref="UniProtKB/TrEMBL:Q118G6"
FT                   /protein_id="ABG50108.1"
FT                   /translation="MVGETLPRDRMIHEQPTYIEKTACEYHYINSI"
FT   gene            complement(1101436..1102013)
FT                   /pseudo
FT                   /locus_tag="Tery_0671"
FT   gene            1102446..1102814
FT                   /locus_tag="Tery_0672"
FT   CDS_pept        1102446..1102814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0672"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:alr4308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50109"
FT                   /db_xref="InterPro:IPR014964"
FT                   /db_xref="UniProtKB/TrEMBL:Q118G5"
FT                   /protein_id="ABG50109.1"
FT                   SPRLTSPSKSRQVLSRVD"
FT   gene            1103208..1103762
FT                   /locus_tag="Tery_0673"
FT   CDS_pept        1103208..1103762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0673"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1261 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50110"
FT                   /db_xref="GOA:Q118G4"
FT                   /db_xref="UniProtKB/TrEMBL:Q118G4"
FT                   /protein_id="ABG50110.1"
FT   gene            1103770..1104519
FT                   /locus_tag="Tery_0674"
FT   CDS_pept        1103770..1104519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0674"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   ava:Ava_1262 ABC transporter-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50111"
FT                   /db_xref="GOA:Q118G3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q118G3"
FT                   /protein_id="ABG50111.1"
FT   gene            complement(1105112..1105870)
FT                   /locus_tag="Tery_0675"
FT   CDS_pept        complement(1105112..1105870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0675"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiveR transcriptional
FT                   regulatory protein-like; KEGG: ava:Ava_1263 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50112"
FT                   /db_xref="GOA:Q118G2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q118G2"
FT                   /protein_id="ABG50112.1"
FT   gene            1107525..1107776
FT                   /locus_tag="Tery_0676"
FT   CDS_pept        1107525..1107776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0676"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50113"
FT                   /db_xref="UniProtKB/TrEMBL:Q118G1"
FT                   /protein_id="ABG50113.1"
FT   gene            complement(1108732..1109067)
FT                   /locus_tag="Tery_0677"
FT   CDS_pept        complement(1108732..1109067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0677"
FT                   /product="glutaredoxin-like protein"
FT                   /note="TIGRFAM: glutaredoxin-like protein; PFAM:
FT                   glutaredoxin; KEGG: syn:slr1846 monothiol glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50114"
FT                   /db_xref="GOA:Q118G0"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q118G0"
FT                   /protein_id="ABG50114.1"
FT                   LAVASAS"
FT   gene            complement(1109390..1109647)
FT                   /locus_tag="Tery_0678"
FT   CDS_pept        complement(1109390..1109647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0678"
FT                   /product="BolA-like protein"
FT                   /note="PFAM: BolA-like protein; KEGG: syf:Synpcc7942_1146
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50115"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q118F9"
FT                   /protein_id="ABG50115.1"
FT   gene            complement(1109684..1110385)
FT                   /locus_tag="Tery_0679"
FT   CDS_pept        complement(1109684..1110385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tery_0679"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_2139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tery_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABG50116"
FT                   /db_xref="GOA:Q118F8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q118F8"
FT                   /protein_id="ABG50116.1"