(data stored in SCRATCH9089 zone)

EMBL: CP000409

ID   CP000409; SV 1; linear; genomic DNA; STD; PRO; 1159772 BP.
XX
AC   CP000409; AAFF01000000-AAFF01000001;
XX
PR   Project:PRJNA12952;
XX
DT   02-OCT-2007 (Rel. 93, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Rickettsia canadensis str. McKiel, complete genome.
XX
KW   .
XX
OS   Rickettsia canadensis str. McKiel
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales;
OC   Rickettsiaceae; Rickettsieae; Rickettsia; belli group.
XX
RN   [1]
RP   1-1159772
RA   Madan A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Dasch G., Eremeeva M.;
RT   "Complete Genome Sequence of Rickettsia canadensis";
RL   Unpublished.
XX
RN   [2]
RP   1-1159772
RA   Madan A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Dasch G., Eremeeva M.;
RT   ;
RL   Submitted (10-SEP-2007) to the INSDC.
RL   Neurogenomics Research Lab, University of Iowa, 200 B EMRB, Iowa City, IA
RL   52242, USA
XX
DR   MD5; afed91d08c768f34a76bde3edf3b5641.
DR   BioSample; SAMN02604083.
DR   EnsemblGenomes-Gn; A1E_r05748.
DR   EnsemblGenomes-Gn; A1E_r05750.
DR   EnsemblGenomes-Gn; A1E_t05682.
DR   EnsemblGenomes-Gn; A1E_t05684.
DR   EnsemblGenomes-Gn; A1E_t05686.
DR   EnsemblGenomes-Gn; A1E_t05688.
DR   EnsemblGenomes-Gn; A1E_t05690.
DR   EnsemblGenomes-Gn; A1E_t05692.
DR   EnsemblGenomes-Gn; A1E_t05694.
DR   EnsemblGenomes-Gn; A1E_t05696.
DR   EnsemblGenomes-Gn; A1E_t05698.
DR   EnsemblGenomes-Gn; A1E_t05700.
DR   EnsemblGenomes-Gn; A1E_t05702.
DR   EnsemblGenomes-Gn; A1E_t05704.
DR   EnsemblGenomes-Gn; A1E_t05706.
DR   EnsemblGenomes-Gn; A1E_t05708.
DR   EnsemblGenomes-Gn; A1E_t05710.
DR   EnsemblGenomes-Gn; A1E_t05712.
DR   EnsemblGenomes-Gn; A1E_t05714.
DR   EnsemblGenomes-Gn; A1E_t05716.
DR   EnsemblGenomes-Gn; A1E_t05718.
DR   EnsemblGenomes-Gn; A1E_t05720.
DR   EnsemblGenomes-Gn; A1E_t05722.
DR   EnsemblGenomes-Gn; A1E_t05724.
DR   EnsemblGenomes-Gn; A1E_t05726.
DR   EnsemblGenomes-Gn; A1E_t05728.
DR   EnsemblGenomes-Gn; A1E_t05730.
DR   EnsemblGenomes-Gn; A1E_t05732.
DR   EnsemblGenomes-Gn; A1E_t05734.
DR   EnsemblGenomes-Gn; A1E_t05736.
DR   EnsemblGenomes-Gn; A1E_t05738.
DR   EnsemblGenomes-Gn; A1E_t05740.
DR   EnsemblGenomes-Gn; A1E_t05742.
DR   EnsemblGenomes-Gn; A1E_t05744.
DR   EnsemblGenomes-Gn; A1E_t05746.
DR   EnsemblGenomes-Gn; EBG00001133105.
DR   EnsemblGenomes-Gn; EBG00001133106.
DR   EnsemblGenomes-Gn; EBG00001133107.
DR   EnsemblGenomes-Gn; EBG00001133108.
DR   EnsemblGenomes-Gn; EBG00001133109.
DR   EnsemblGenomes-Gn; EBG00001133110.
DR   EnsemblGenomes-Gn; EBG00001133111.
DR   EnsemblGenomes-Gn; EBG00001133112.
DR   EnsemblGenomes-Gn; EBG00001133113.
DR   EnsemblGenomes-Gn; EBG00001133114.
DR   EnsemblGenomes-Gn; EBG00001133115.
DR   EnsemblGenomes-Gn; EBG00001133116.
DR   EnsemblGenomes-Gn; EBG00001133117.
DR   EnsemblGenomes-Gn; EBG00001133118.
DR   EnsemblGenomes-Gn; EBG00001133119.
DR   EnsemblGenomes-Gn; EBG00001133120.
DR   EnsemblGenomes-Gn; EBG00001133121.
DR   EnsemblGenomes-Gn; EBG00001133122.
DR   EnsemblGenomes-Gn; EBG00001133123.
DR   EnsemblGenomes-Gn; EBG00001133124.
DR   EnsemblGenomes-Gn; EBG00001133125.
DR   EnsemblGenomes-Gn; EBG00001133126.
DR   EnsemblGenomes-Gn; EBG00001133127.
DR   EnsemblGenomes-Gn; EBG00001133128.
DR   EnsemblGenomes-Gn; EBG00001133129.
DR   EnsemblGenomes-Gn; EBG00001133130.
DR   EnsemblGenomes-Gn; EBG00001133131.
DR   EnsemblGenomes-Gn; EBG00001133132.
DR   EnsemblGenomes-Gn; EBG00001133133.
DR   EnsemblGenomes-Gn; EBG00001133134.
DR   EnsemblGenomes-Gn; EBG00001133135.
DR   EnsemblGenomes-Gn; EBG00001133136.
DR   EnsemblGenomes-Gn; EBG00001133137.
DR   EnsemblGenomes-Gn; EBG00001133138.
DR   EnsemblGenomes-Gn; EBG00001133139.
DR   EnsemblGenomes-Gn; EBG00001133140.
DR   EnsemblGenomes-Gn; EBG00001133141.
DR   EnsemblGenomes-Gn; EBG00001133142.
DR   EnsemblGenomes-Gn; EBG00001133143.
DR   EnsemblGenomes-Gn; EBG00001133144.
DR   EnsemblGenomes-Gn; EBG00001133145.
DR   EnsemblGenomes-Gn; EBG00001133146.
DR   EnsemblGenomes-Gn; EBG00001133147.
DR   EnsemblGenomes-Gn; EBG00001133148.
DR   EnsemblGenomes-Tr; A1E_r05748-1.
DR   EnsemblGenomes-Tr; A1E_r05750-1.
DR   EnsemblGenomes-Tr; A1E_t05682-1.
DR   EnsemblGenomes-Tr; A1E_t05684-1.
DR   EnsemblGenomes-Tr; A1E_t05686-1.
DR   EnsemblGenomes-Tr; A1E_t05688-1.
DR   EnsemblGenomes-Tr; A1E_t05690-1.
DR   EnsemblGenomes-Tr; A1E_t05692-1.
DR   EnsemblGenomes-Tr; A1E_t05694-1.
DR   EnsemblGenomes-Tr; A1E_t05696-1.
DR   EnsemblGenomes-Tr; A1E_t05698-1.
DR   EnsemblGenomes-Tr; A1E_t05700-1.
DR   EnsemblGenomes-Tr; A1E_t05702-1.
DR   EnsemblGenomes-Tr; A1E_t05704-1.
DR   EnsemblGenomes-Tr; A1E_t05706-1.
DR   EnsemblGenomes-Tr; A1E_t05708-1.
DR   EnsemblGenomes-Tr; A1E_t05710-1.
DR   EnsemblGenomes-Tr; A1E_t05712-1.
DR   EnsemblGenomes-Tr; A1E_t05714-1.
DR   EnsemblGenomes-Tr; A1E_t05716-1.
DR   EnsemblGenomes-Tr; A1E_t05718-1.
DR   EnsemblGenomes-Tr; A1E_t05720-1.
DR   EnsemblGenomes-Tr; A1E_t05722-1.
DR   EnsemblGenomes-Tr; A1E_t05724-1.
DR   EnsemblGenomes-Tr; A1E_t05726-1.
DR   EnsemblGenomes-Tr; A1E_t05728-1.
DR   EnsemblGenomes-Tr; A1E_t05730-1.
DR   EnsemblGenomes-Tr; A1E_t05732-1.
DR   EnsemblGenomes-Tr; A1E_t05734-1.
DR   EnsemblGenomes-Tr; A1E_t05736-1.
DR   EnsemblGenomes-Tr; A1E_t05738-1.
DR   EnsemblGenomes-Tr; A1E_t05740-1.
DR   EnsemblGenomes-Tr; A1E_t05742-1.
DR   EnsemblGenomes-Tr; A1E_t05744-1.
DR   EnsemblGenomes-Tr; A1E_t05746-1.
DR   EnsemblGenomes-Tr; EBT00001724585.
DR   EnsemblGenomes-Tr; EBT00001724586.
DR   EnsemblGenomes-Tr; EBT00001724587.
DR   EnsemblGenomes-Tr; EBT00001724588.
DR   EnsemblGenomes-Tr; EBT00001724589.
DR   EnsemblGenomes-Tr; EBT00001724590.
DR   EnsemblGenomes-Tr; EBT00001724591.
DR   EnsemblGenomes-Tr; EBT00001724592.
DR   EnsemblGenomes-Tr; EBT00001724593.
DR   EnsemblGenomes-Tr; EBT00001724594.
DR   EnsemblGenomes-Tr; EBT00001724595.
DR   EnsemblGenomes-Tr; EBT00001724596.
DR   EnsemblGenomes-Tr; EBT00001724597.
DR   EnsemblGenomes-Tr; EBT00001724598.
DR   EnsemblGenomes-Tr; EBT00001724599.
DR   EnsemblGenomes-Tr; EBT00001724600.
DR   EnsemblGenomes-Tr; EBT00001724601.
DR   EnsemblGenomes-Tr; EBT00001724602.
DR   EnsemblGenomes-Tr; EBT00001724603.
DR   EnsemblGenomes-Tr; EBT00001724604.
DR   EnsemblGenomes-Tr; EBT00001724605.
DR   EnsemblGenomes-Tr; EBT00001724606.
DR   EnsemblGenomes-Tr; EBT00001724607.
DR   EnsemblGenomes-Tr; EBT00001724608.
DR   EnsemblGenomes-Tr; EBT00001724609.
DR   EnsemblGenomes-Tr; EBT00001724610.
DR   EnsemblGenomes-Tr; EBT00001724611.
DR   EnsemblGenomes-Tr; EBT00001724612.
DR   EnsemblGenomes-Tr; EBT00001724613.
DR   EnsemblGenomes-Tr; EBT00001724614.
DR   EnsemblGenomes-Tr; EBT00001724615.
DR   EnsemblGenomes-Tr; EBT00001724616.
DR   EnsemblGenomes-Tr; EBT00001724617.
DR   EnsemblGenomes-Tr; EBT00001724618.
DR   EnsemblGenomes-Tr; EBT00001724619.
DR   EnsemblGenomes-Tr; EBT00001724620.
DR   EnsemblGenomes-Tr; EBT00001724621.
DR   EnsemblGenomes-Tr; EBT00001724622.
DR   EnsemblGenomes-Tr; EBT00001724623.
DR   EnsemblGenomes-Tr; EBT00001724624.
DR   EnsemblGenomes-Tr; EBT00001724625.
DR   EnsemblGenomes-Tr; EBT00001724626.
DR   EnsemblGenomes-Tr; EBT00001724627.
DR   EnsemblGenomes-Tr; EBT00001724628.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01774; rpsL_ricks.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000409.
DR   SILVA-SSU; CP000409.
XX
CC   Annotation was added by the NCBI Prokaryotic Genomes Automatic
CC   Annotation Pipeline Group.  Information about the Pipeline can be
CC   found here:
CC   http://www.ncbi.nlm.nih.gov/genomes/static/Pipeline.html. Please be
CC   aware that the annotation is done automatically with little or no
CC   manual curation.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1159772
FT                   /organism="Rickettsia canadensis str. McKiel"
FT                   /strain="McKiel"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:293613"
FT   gene            1..822
FT                   /locus_tag="A1E_00005"
FT   CDS_pept        1..822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00005"
FT                   /product="hypothetical protein"
FT                   /note="COG1806 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72954"
FT                   /db_xref="GOA:A8EX71"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EX71"
FT                   /protein_id="ABV72954.1"
FT                   /translation="MTKLIIHLVSDSSVQTAKYAANSALAQFTSIKPKLYHWPMIRNLE
FT                   LLNEVLSKIESKHGIVLYTIADQELRKTLTKFCYELKIPCISIIGKIIKEMSVFSDIEI
FT                   EKEQNFNYKFDKTYFDTLNAIDYAIRHDDGQMLNELPEADIILIGPSRTSKTPTSVFLA
FT                   YNGLKAANIPYVYNCPFPDFIEKDIDQLVVGLVINPNRLIEIREARLNLLQINENKSYT
FT                   DFNIIQKECLEVRKICEQRNWPVIDVSTRSIEETAALIMRIYYNRKNKYNK"
FT   gene            1065..1382
FT                   /locus_tag="A1E_00010"
FT   CDS_pept        1065..1382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00010"
FT                   /product="Thioredoxin"
FT                   /note="COG0526 Thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72955"
FT                   /db_xref="GOA:A8EX72"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8EX72"
FT                   /protein_id="ABV72955.1"
FT                   /translation="MASNVNDSSFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISK
FT                   ELQGKVKVLKMNIDENPNTPSEYGIRSIPTIMLFKNGEQKDTKIGLQQKSYLLDWIHKF
FT                   V"
FT   gene            1375..2136
FT                   /locus_tag="A1E_00015"
FT   CDS_pept        1375..2136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00015"
FT                   /product="O-antigen export system ATP-binding protein RfbE"
FT                   /note="COG1129 ABC-type sugar transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00015"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72956"
FT                   /db_xref="GOA:A8EX73"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8EX73"
FT                   /protein_id="ABV72956.1"
FT                   /translation="MFNIYFMSLNHSKVLIEITDGYVEGIDTHKRAQGLKHFFLKKGVS
FT                   LSPNILILNNINFSCYEGEKVAFIGTNGSGKSSLLKLIAGIYPLKSGTIKVHGDIAAII
FT                   DMGVGFESEQTGRENIKMLMLYNNMLDKYSEKIEKEIIDFSELGNKIDLPIKIYSSGML
FT                   SRLAFSVSIFQNPQILLLDEVFAAGDSYFIEKSLSLMKNKFKNTPISIIVSHQEEIIKD
FT                   NCDRCILLKDGNIIGDGTPLEMFKIYNRLLV"
FT   gene            2295..3071
FT                   /locus_tag="A1E_00020"
FT   CDS_pept        2295..3071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72957"
FT                   /db_xref="GOA:A8EX74"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A8EX74"
FT                   /protein_id="ABV72957.1"
FT                   /translation="MIKYFFSKKYWQAIALLVKASIIRQNKDSFLGSLWSLIQPFIHIM
FT                   VISYFFSFLLRQPREFMVMNLVGGLPLWSFIVSSLTICSSSLVTRDQIIKKVRISKTFF
FT                   PVSDSLGQLYNLICSFSAMYFAFILLFPEKFSWQIIFMPVLIFPLIICVISGSIAVAFL
FT                   TPYIRDIPQILNVILGVIYWSIPIVYPYSLIPESKRIYFEFNPFFLVIRPVQALVIDGT
FT                   LPDMILIVKSVIVAFITVCISYFIYRQFSKRVIYYL"
FT   gene            3068..6214
FT                   /locus_tag="A1E_00025"
FT   CDS_pept        3068..6214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00025"
FT                   /product="putative bifunctional glutamate synthase subunit
FT                   beta/2-polyprenylphenol hydroxylase"
FT                   /note="COG0493 NADPH-dependent glutamate synthase beta
FT                   chain and related oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00025"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72958"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8EX75"
FT                   /protein_id="ABV72958.1"
FT                   /translation="MKLGFNLDFNELDLTGLKKLDQIFLDYLFKADSSLHKDLILFRST
FT                   PFSIIPQDYSEFLLKISPYLDDFLAELFCISKEVIISRLKHKDFDIIYECKRKFVQRIA
FT                   IKKYPPEKIKNIDFEEIYLKLTDLIGTNFTSREFAKQIIIWQQEEESFVEELDIAAQYA
FT                   AYMVYGQCHSSKSVNLEKLSLDPCFYRDDITNDSILFNLPQKLDKENLIDDKKILKYQR
FT                   NQRIDFNYTNIFSNLEEALNNSHYCIYCHKQDKDSCSKGINVIRWPPRRHGIQKKIKKD
FT                   WIPRLDRTMTTGCPLKQKISEMNYVKAQGFNLSALAIIVIDNPMVAATGHRICNDCVRA
FT                   CIYQKQDPVNIPLIESNILEETLKLPYGLEIYLLLTRWNPLNIYAPLPKESTNYNILVT
FT                   GLGPAGFSLSYYLLRSGHNVTAIDGLKISLLPFDVNKPIKFWHEYKSLLSERMARGFGG
FT                   VSEYGITIRWDKNNLDILRLILERNDNFKYYDGVTLGSNIMKEQAFSLGFDHIAFCIGA
FT                   GQPKVLDIENFEAKGVKMASDFLMTLQSGGAFLENSNANMLIRMPIAIIGGGLTSIDAA
FT                   TESLYYYKMQVERFFKDYELAVQKYGKDYIEKDLTEEDKEIAEEFIAHARLFKEVKNHE
FT                   ELRKLFNKLGGSTIYYRGKLQESPAYKLNHEELIYAMALGIDFRENMQPLRINTDKYGH
FT                   VESVTFSIIPRLDHGIQIQGNYQDNIMDPAIKSWDDTEVLKAKTVIIAIGIENNLELDE
FT                   NKYSYFGDCNPEYSGSVVKALASSKEGYENINKRLINNNPSFKDSYRDFITQLDYLLIS
FT                   RIHKINILDDKTFELVIHSPLAAKNFKFGQFFRLQNYSEDIAKLIEPLALSPTDIDIEK
FT                   GLISFIVFEVGKSTSLCKTLSENEKVVLMGPTGIPLEIPQNKKIVIVDSKVSNVSLLKV
FT                   LKENNNEVIFFTYPDIKTRKLTSVDRVIINASPEIIEELQSLKNEIFGENTELIVSVNS
FT                   SMQCMMKGICGQCIQKVRGEQKYIFACSCQNQKAEIVDFESLKTRLRKNSLQEKMRRLV
FT                   "
FT   gene            complement(6333..7127)
FT                   /locus_tag="A1E_00030"
FT   CDS_pept        complement(6333..7127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00030"
FT                   /product="UDP-N-acetylglucosamine acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="COG1043 Acyl-[acyl carrier
FT                   protein]--UDP-N-acetylglucosamine O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72959"
FT                   /db_xref="GOA:A8EX76"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EX76"
FT                   /protein_id="ABV72959.1"
FT                   /translation="MSNSNIHPTAVIAEGANLGKNVKIGPYCIIGAEVVLNDNVELKSH
FT                   VVIEGITEIGENTIIYPFASIGQPPQILKYANERSSTIIGSNNTIREYVTVQAGSQGGG
FT                   MITRIGNNNLFMVGVHVGHDCKIGNNVVFANYVSLAGHIEVGDYVIISGLSAVHQYARI
FT                   GKYSMIGGLSPVGSDVIPFGLVSSKRAVLEGLNLIGMNRKGFDKAESLSALKAIKEIFS
FT                   SEGNFAERIKQVAEKYKNNSIVMQIIDFLNQDSSRAFCHFEK"
FT   gene            complement(7135..7569)
FT                   /gene="fabZ"
FT                   /locus_tag="A1E_00035"
FT   CDS_pept        complement(7135..7569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="A1E_00035"
FT                   /product="(3R)-hydroxymyristoyl-(acyl carrier protein)
FT                   dehydratase"
FT                   /note="COG0764 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl
FT                   carrier protein) dehydratases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00035"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72960"
FT                   /db_xref="GOA:A8EX77"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EX77"
FT                   /protein_id="ABV72960.1"
FT                   /translation="MMDITEIMNLIPHRYPFLLVDRVLEIDLNKSILGIKNVTVNEPQF
FT                   TGHFPARPVMPGVLMVEAMAQLAAILVAKSLGSTKNKEVFLMTIENSKFRRIVQPGDTM
FT                   HIHTVIDQQRANVWKFSSTVKIEGEITAESKFTAMIKDKA"
FT   gene            complement(7570..8598)
FT                   /locus_tag="A1E_00040"
FT   CDS_pept        complement(7570..8598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00040"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /note="COG1044 UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72961"
FT                   /db_xref="GOA:A8EX78"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EX78"
FT                   /protein_id="ABV72961.1"
FT                   /translation="MASSNFYKNLGPRKLTTIIDFLHDIIEHPKIYEDIVIHDIKILQE
FT                   ASRNDISFLSNTKYSEFLKTTNAAACIVPKNFKGEVNPNTILIHAENSYFAYGKLIDFF
FT                   YAPIKSYPAKIMKSAIVAASAIIGKNCYIGHNVVIEDDVIIGDNSIIEAGSFIGRGVNL
FT                   GRNARIEQHVSINYAIIGDDVVILTGAKIGQDGFGFSTEKGVHHQIFHTGIVKIGNNVK
FT                   IGANTTIDRGSLQDTIIEDLCCIDNLVQIGHGVKIGKGSIIIAQVGIAGSSTIGKYCAL
FT                   GGQVGIAGHLNIGDQVQVAAQSGVAQNIEAGKIVGGSPAVHIMNWHRQSIIMKQLIKKR
FT                   PK"
FT   gene            complement(8620..8695)
FT                   /locus_tag="A1E_t05682"
FT   tRNA            complement(8620..8695)
FT                   /locus_tag="A1E_t05682"
FT                   /product="tRNA-Phe"
FT   gene            8865..9845
FT                   /locus_tag="A1E_00045"
FT   CDS_pept        8865..9845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00045"
FT                   /product="nifR3-like protein"
FT                   /note="COG0042 tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72962"
FT                   /db_xref="GOA:A8EX79"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A8EX79"
FT                   /protein_id="ABV72962.1"
FT                   /translation="MIKIGDIVLSSNIILAPMSGVTDLEFRRLVKRFGVGLVVSEMVAS
FT                   RAMIVESRQSLQKSAIMRDDATSACVQLAGCEPNVIAEAAKMNEDMGAKIIDLNFGCPA
FT                   KKVVEGYSGSALMRDEQLAAKIFEATVKAVKIPVTVKMRMGWDDQTKNAPTLANIAENS
FT                   GIQMVTVHGRTRCQFYSGNADWDFIRSVKEVVNIPVIANGDITNFTKAKEALQKSGADG
FT                   IMIGRGAYGKPWLISQIDHYLKTGEAKPAPSIAEQLDIVTEHYEAIIDYYGESVGVPIA
FT                   RKHIGWYSSGLPNSAEFRGAVNLMNDSVAVKEKIKEFYTSIIDTR"
FT   gene            complement(10469..10900)
FT                   /locus_tag="A1E_00050"
FT   CDS_pept        complement(10469..10900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00050"
FT                   /product="hypothetical protein"
FT                   /note="COG0802 Predicted ATPase or kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72963"
FT                   /db_xref="GOA:A8EX80"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8EX80"
FT                   /protein_id="ABV72963.1"
FT                   /translation="MFINLNNEEETKNLAKRFAQNLKPNDIVLLNSDLGSGKTFFCREI
FT                   IKYFCGENTSIISPTFNLLQTYKASNFTIYHYDLYRLKSPEEIYELGFEEALNGNLILI
FT                   EWSQIIKHLLPTTLIEVNLEVLDENKRLCSIITNYKENS"
FT   gene            complement(10891..11694)
FT                   /locus_tag="A1E_00055"
FT   CDS_pept        complement(10891..11694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00055"
FT                   /product="zinc/manganese ABC transporter substrate binding
FT                   protein"
FT                   /note="COG0803 ABC-type metal ion transport system,
FT                   periplasmic component/surface adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00055"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72964"
FT                   /db_xref="GOA:A8EX81"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:A8EX81"
FT                   /protein_id="ABV72964.1"
FT                   /translation="MTYIILIFFTLFSFASYAKPKIVVSITPIASIVSMLVKDKADIKS
FT                   LAISSDCPHHYNLKPSDLAKVKNADIAIYINEQFDGFAKKLIDNHSQNIIKISDIKSLT
FT                   SIKDNWHIWLDLNNSAILLQEFAQIFSEKFPALQEDINNNLSAALKELNKLKEIKNNAL
FT                   ASLKDVILLSDSTEYFFLNTNIKTAKLYSESQKSLQYISNLEALIKGSNNKCLVLSNKQ
FT                   TSQLYDKLNTKIIILNSENWNVKNINSNTFQNQYLQIIDQVKKCL"
FT   gene            complement(11798..13009)
FT                   /locus_tag="A1E_00060"
FT   CDS_pept        complement(11798..13009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00060"
FT                   /product="poly(A) polymerase"
FT                   /EC_number="2.7.7.19"
FT                   /note="COG0617 tRNA nucleotidyltransferase/poly(A)
FT                   polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72965"
FT                   /db_xref="GOA:A8EX82"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A8EX82"
FT                   /protein_id="ABV72965.1"
FT                   /translation="MQIIQKTLKISSKGYKKILSLLNEKGQARLIGGCVRDALLKKDSY
FT                   DIDIDTTLIPSEVINILSRAKIKTIPTGLKFGTITAILDKEKFEITTLRKDIECNGRHA
FT                   KLVFTNDFAEDAARRDFTINALSYCPFKNKIYDYFDGFKDLQQEKVVFIGEALNRIKED
FT                   YLRILRFFRFSSYYANQLDHEGLKACKVLKYGLKTLSRERIKSEMNKIIVSKRAAQILE
FT                   AMFEIGILELIFSIQNYKIKFFEQANDFKLELATRYALLLYNQKDLNLKVFLDWKFSKY
FT                   EAMQILSITNFLNDTECNMKKIWLEKNNYKEYLLAASIIGKLDYLQVKEFIRKYDAVLR
FT                   PKFQVNGNNLLNMNIEKKEIGAKLEYLKNFWIEHDFKPSKLELLRVISRGSSNPVIKRS
FT                   KYEK"
FT   gene            complement(13738..14010)
FT                   /locus_tag="A1E_00065"
FT   CDS_pept        complement(13738..14010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00065"
FT                   /product="ComEC/Rec2-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00065"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72966"
FT                   /db_xref="GOA:A8EX83"
FT                   /db_xref="UniProtKB/TrEMBL:A8EX83"
FT                   /protein_id="ABV72966.1"
FT                   /translation="MTKTEVSLLKSGLHLSLVVIIVFLTTRFLLNHSNHLAYNFNIKLI
FT                   SAYYSLVGSFGYLELSGMLAATSAFITATIFITQTLLLSSSFIYN"
FT   gene            14292..14453
FT                   /locus_tag="A1E_00070"
FT   CDS_pept        14292..14453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72967"
FT                   /db_xref="UniProtKB/TrEMBL:A8EX84"
FT                   /protein_id="ABV72967.1"
FT                   /translation="MIFRDKYAKNKSNNHLISKMKNMLEFLVKVNIKQIQKMIKIVVNE
FT                   SSKLSINS"
FT   gene            14710..19161
FT                   /locus_tag="A1E_00075"
FT   CDS_pept        14710..19161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00075"
FT                   /product="Cell surface antigen Sca1"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00075"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72968"
FT                   /db_xref="GOA:A8EX85"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A8EX85"
FT                   /protein_id="ABV72968.1"
FT                   /translation="MSTLIEQSQLQKSRFLKYSLLASISVGTIITLPFEGMASSEPINL
FT                   DIIERGDNGLLQPVINNKFERAKSFATAGNKRKRPPTRRKILVGNETTEQNQNIDTSEP
FT                   IEQTAQKPEIIITVSSPTVSPTSGSFVTAPNTLNTTPIFSTPSTSPEHIYTTAPGTPYD
FT                   EPIPHATPNNQYAVARRLSFSEPQQIEQPTTLIKPTMSPKPTTLEITAGIVNRISTHNE
FT                   NAKRKLGMITAAIEQTSGKKAKKSAQKKAPVAEVSTAGPFLNQQRQLDVLTQKQKVNAV
FT                   RQAAVNKKKRRENEVKRNSTDVEKLITQMNQVQLEQNQRRIAAELQRKAETSTKHVTIK
FT                   NKNKSKADKVRQEKTFLQKIHLTKTEQEKKIAEDKNARAAAEKVRKEKNKQAQKAEEIS
FT                   NIKLKVSEQLIQMLDYKAKLQEKLQEVERIEAKHEVSVIKKELKNIEKLVSKAAKVVNN
FT                   AETETSRTTLQVMQDKMNGYSEQLDKIEENLKLLTPIVYSSNDSTYKQPPKAKPIMPLT
FT                   SGVQGILGKQLQLEEKYGYLVPNQTQPQTYTTVLPNQEVADPKRMDSGFVSLDKETDAD
FT                   VGFNTSCGKGTDCTQVGQELSFELPTLKVLGYQDNINQTLDTIARANSIERPILFQNLL
FT                   KDLERRKQEAKMVEEQAIMHVINNPNDDQAKEQVALVDKLLEKYNTDIKLVRKTLEDNK
FT                   ENNSRNNVKKPLERLVFEAKLPPIREYDALCEESQKVIASKRATEELRNQREDDPELEK
FT                   LAIIEYMEVQKKQSQLEQDIKAIDPLFQAAIYSDSELSRELSRSYSVGDILSNTESNLS
FT                   HSSSVSSLNNLSSSNVMKLEELKSKYEKISNDYKAKELELDALNQNDPKFKELMLEVFA
FT                   MSKDKIWLEGEIKHLETQFEPNIHSAEGKPVFSPDSINSVFSGVDYINTNDPTKLIENK
FT                   IAALRIYQMAVIVKRQELEQLPSTSSGADQTAQQIKKLQEKEVIMHDAINACIADPSKL
FT                   NNVSFEEIKEALKKLSAGIPESVINVLESKAQEDPEDILNGLTLQEMLSSNNDTTIDSL
FT                   PSGKEQSSEDEEVTKAGIQEVEDKQLLALPVSSNEYALALSDDSEKECLVLSDGSEDED
FT                   DDNDSGIDSESEEGVVDQLLDSREDNLKTTEVNTVISLKQEVIEETKKSIAAIAPTLNQ
FT                   GVQVVKNISKSILGARLDSSEALTAVAAGDEEESRIKRGLWMRGMYGTNNHGRVNNMTG
FT                   YRGINKGTTIGFDFEIDNNIVGIAYSNVYSVFKFKNSKNNDKEFINSHVVSIYGQKELP
FT                   KNFVAQALVSASKNFIKDKTTYSYGDTNIRSNVKHRNHSYNAEALLNYNYLVKNNLVIT
FT                   PNIGLRYGKSRDGVYNEIGINVQEIALTMKENNILSGIIGTKVKVPLKDVLKFNNLGLI
FT                   FQGAVEHNFKEKTQRINRVIKILDNTFKQYYLIPKQPKISYNLGVGIMGSIKNTTISLD
FT                   YNYYLNKHYRSHQGSVKLKVNL"
FT   gene            19274..19348
FT                   /locus_tag="A1E_t05684"
FT   tRNA            19274..19348
FT                   /locus_tag="A1E_t05684"
FT                   /product="tRNA-Glu"
FT   gene            19742..20143
FT                   /gene="lpxD"
FT                   /locus_tag="A1E_00080"
FT   CDS_pept        19742..20143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="A1E_00080"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /note="COG0658 Predicted membrane metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72969"
FT                   /db_xref="GOA:A8EX86"
FT                   /db_xref="UniProtKB/TrEMBL:A8EX86"
FT                   /protein_id="ABV72969.1"
FT                   /translation="MDNFKSNVYIHGHKTDCDVRNLNITTYLSTMNFVNICNLHIHKAY
FT                   KLFPKITAAEYSSKINKAISIKNYIPLLSLTGDLLDSMLDSFDHETGKPIKYEKILDWP
FT                   CIEYDPKDDTLGKKAIDKVLNFIPVNSID"
FT   gene            complement(21912..22403)
FT                   /locus_tag="A1E_00085"
FT   CDS_pept        complement(21912..22403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00085"
FT                   /product="F0F1 ATP synthase subunit B"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0711 F0F1-type ATP synthase, subunit b"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00085"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72970"
FT                   /db_xref="GOA:A8EX87"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:A8EX87"
FT                   /protein_id="ABV72970.1"
FT                   /translation="MNFLDENFCLAVSFVIFVYLIYKPAKKAILNSLDVKILEIQERVL
FT                   KAKKLKEDAILLFEQTNAQIKQLDTLRSQMIEESNKVTKKIIQEKTKEIEEFLEHKKSD
FT                   AIKLIQHQKLITSKELQDEFCDEVIKLVSKYFQSVKLSESNIAKNLMDKSDFVHNNKVT
FT                   "
FT   gene            complement(22403..22870)
FT                   /locus_tag="A1E_00090"
FT   CDS_pept        complement(22403..22870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00090"
FT                   /product="F0F1 ATP synthase subunit B'"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0711 F0F1-type ATP synthase, subunit b"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72971"
FT                   /db_xref="GOA:A8EX88"
FT                   /db_xref="InterPro:IPR003319"
FT                   /db_xref="UniProtKB/TrEMBL:A8EX88"
FT                   /protein_id="ABV72971.1"
FT                   /translation="MPQFDIATYYSQIFWLIVTFGLLYIFIYKFIIPKAEEIFNNRQTN
FT                   IQDNITQADILTLEVEKLNKYYNEEVEKTNTAIDRLKKAKIYSLESEFLIKKKNLEQDL
FT                   KNSINKNIEDINLAAKQFRTNKSEAIIKLAVNIIEKVAGTKADIDLLKKIK"
FT   gene            complement(22888..23112)
FT                   /locus_tag="A1E_00095"
FT   CDS_pept        complement(22888..23112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00095"
FT                   /product="F0F1 ATP synthase subunit C"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0636 F0F1-type ATP synthase, subunit
FT                   c/Archaeal/vacuolar-type H+-ATPase, subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72972"
FT                   /db_xref="GOA:A8EX89"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EX89"
FT                   /protein_id="ABV72972.1"
FT                   /translation="MDIVSLKFIGVGLMAIGMYGAALGVSNIFSSLLNAIARNPAAAEN
FT                   LQRMALIGAGLAEAIGLFSFVIAMLLIFS"
FT   gene            complement(23287..24015)
FT                   /locus_tag="A1E_00100"
FT   CDS_pept        complement(23287..24015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00100"
FT                   /product="ATP synthase subunit A"
FT                   /note="COG0356 F0F1-type ATP synthase, subunit a"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00100"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72973"
FT                   /db_xref="GOA:A8EX90"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EX90"
FT                   /protein_id="ABV72973.1"
FT                   /translation="MTLNPLVQFDIKKLIEIKIFGFDISFTNSSIYMLLASILALTYFY
FT                   LAFYNWKLVPSRLQVSAEIVYNLVADMLNQNIGAKGHKFIPLFFSLFIFILFCNLLGMT
FT                   PYSFTVTSHIIVTFALAILVFLTITIVGFVKHSLRFLTLFLPHGTPLWLAPLMIVIELF
FT                   TYLARPISLSLRLAANMMAGHVLLKVIASFTISLMIYLKFISIPLMVILIGFEIFIAVL
FT                   QAYIFTILSCMYLNDAINLH"
FT   gene            complement(24020..24283)
FT                   /locus_tag="A1E_00105"
FT   CDS_pept        complement(24020..24283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00105"
FT                   /product="hypothetical protein"
FT                   /note="COG5336 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00105"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72974"
FT                   /db_xref="GOA:A8EX91"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:A8EX91"
FT                   /protein_id="ABV72974.1"
FT                   /translation="MDTEKLNNIKARIKDFKSARLFNPKVQQEISSFTIAIDLVSGTMV
FT                   GVASGIFTDKLFYSKPLFLIIFTIIGMIAGFNIIRQKVNNKK"
FT   gene            complement(24453..25277)
FT                   /locus_tag="A1E_00110"
FT   CDS_pept        complement(24453..25277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00110"
FT                   /product="Protein-disulfide isomerase"
FT                   /note="COG1651 Protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72975"
FT                   /db_xref="GOA:A8EX92"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8EX92"
FT                   /protein_id="ABV72975.1"
FT                   /translation="MQSIFIVLIFLLFLSSYSEGKVQGKNHEEKQIIEQKTVQNNETSQ
FT                   KINQEAINSENAAESIVPANDNNQTNEVSTPDSQEHKDPKIKPIKVTFKVDDNDMVLGN
FT                   KKSNVIVIEYFSPTCPHCAYYHQTIFPELKKKYIDTNKIAYVVREFIATKQDLDAAILA
FT                   RCKGDINSFVQFHNIILKQQDKWAYSNKYRELLTDIGKLGGISPEEYKQCLNSDKITET
FT                   LIANTNLVAKTPKFIGTPSFFVNGVQTKNYSIDNIAKAVDKALDEQKEKAKK"
FT   gene            25444..25971
FT                   /locus_tag="A1E_00115"
FT   CDS_pept        25444..25971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00115"
FT                   /product="hypothetical protein"
FT                   /note="COG1329 Transcriptional regulators, similar to M.
FT                   xanthus CarD"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00115"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72976"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:A8EX93"
FT                   /protein_id="ABV72976.1"
FT                   /translation="MANTTQSEHKTKSEFKIGQRIVYPAHGVGEITNIEYHTIAGTEIK
FT                   VYVISFAQDKMTLKVPVNRATIVGLRAVASRKDLDVIYSTLQGKPKQGNRMWSRRAQEY
FT                   EGKINSGNIVAIAEVLRDLHKNVDNDRSYSERTLYESALNRLAGELAILENIHPTEAIN
FT                   KLVEVLREKLVA"
FT   gene            complement(26180..27784)
FT                   /locus_tag="A1E_00120"
FT   CDS_pept        complement(26180..27784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00120"
FT                   /product="F0F1 ATP synthase subunit A"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72977"
FT                   /db_xref="GOA:A8EX94"
FT                   /db_xref="InterPro:IPR018773"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8EX94"
FT                   /protein_id="ABV72977.1"
FT                   /translation="MTKQTNKISYDEVPYPPFTFSYTSPPYLRTIGKLFGLNPPSLETA
FT                   KILDIGCGVGVNLLNFAETYPKSNSLGIDLSKTQIELGKKIISDLKIKNVELNALSILD
FT                   LNESYGKFDYIVCHGVYSWVPEEVQNKILEVCNKLLNPNGIAFVSYNTLPGWNMQRTIR
FT                   EMMMFHSELFNNSHDKLQQARLLLKFINDSLESATTPYSRFLREETKLLSAYTDSYVLH
FT                   EYLGEINTGIYFNQFIEKAQRNHLNYLGDASLASMFIGNLPAQAAEKLQVIDDIVRTEQ
FT                   YMDFITNRKFRSTLLCHKNIPINRKIEFNNLKEFYTSLNIKPVTLEKEVDLTNEQENIS
FT                   FYYENLPNPLISSTSPIIKAILYVYAENISNPLSLEQVAKEAFKKLGKYRLQDFLAALE
FT                   QHFIKFIFQGYLKIFETKPHTITTITEKPKTGEFARYQARQAHFNNATNVFSITNRLND
FT                   MIGIALHEKYILEMLDGTHNINDIKKEILEKINSKLLTARDDKGQEVTDPKLLKEFIDY
FT                   IVTASLEKFRMNYLLVG"
FT   gene            complement(27939..29021)
FT                   /locus_tag="A1E_00125"
FT   CDS_pept        complement(27939..29021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00125"
FT                   /product="recombination protein F"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00125"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72978"
FT                   /db_xref="GOA:A8EX95"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EX95"
FT                   /protein_id="ABV72978.1"
FT                   /translation="MKNIFLHSLILENYRNFKNLELKIDNTPIILIGENGSGKTNILEA
FT                   ISLFYPGRGLRSAKLADICKTSEDHCSIKALLQSKLGLAEFTTQFKLSSNRRITEYNES
FT                   KIANNELSKFTSMVWLTPQMEGIFTSGKVERRKFLDRIVYNFDPKHAELVGKYEYYMHE
FT                   RNKILAEEIQDDNWLKIIEEKMADISNHIAVNRLKTLEFMQQTINNLENEFPKADLSID
FT                   GIVEQKILDGEENIVSVITAELYKTRNKDKLIGRTSFGVHKSDFLVKHKKKNILAKLCS
FT                   TGEQKAILIAIILAEMNYAIKLTKIAPVLLLDEVFVHLDDKRRDYLTEFFTYLNLQLWI
FT                   TTTNLESIENFASKAQLIKL"
FT   gene            complement(29046..29714)
FT                   /gene="recF"
FT                   /locus_tag="A1E_00130"
FT   CDS_pept        complement(29046..29714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="A1E_00130"
FT                   /product="recombination protein F"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72979"
FT                   /db_xref="InterPro:IPR020171"
FT                   /db_xref="UniProtKB/TrEMBL:A8EX96"
FT                   /protein_id="ABV72979.1"
FT                   /translation="MTNNHFSEDTKKIANQIKDALMGISDDLVLESKEVEEIFEELSQN
FT                   EKFEYEIEQMLAILNEQTMDLTQLQSRIILLIRKYLGKTKNLKLKMLKVDEKLINKNVA
FT                   EVSNYLMHQHSKIVRDANKNLAKPKDKLQGLTKQARIDLKRLLKSFAVYQIYMFMNPKR
FT                   IAGETKLMNFAYNMIRGGMKLAKKYEGGKEKDIKSYSPKLIKKLKKTYAGFKKSGGISI
FT                   "
FT   gene            complement(29838..29927)
FT                   /locus_tag="A1E_00135"
FT   CDS_pept        complement(29838..29927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00135"
FT                   /product="hypothetical protein"
FT                   /note="COG1195 Recombinational DNA repair ATPase (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00135"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72980"
FT                   /db_xref="UniProtKB/TrEMBL:A8EX97"
FT                   /protein_id="ABV72980.1"
FT                   /translation="MIGEESEDKYHSWNIATFSKENVDFLGNY"
FT   gene            complement(31347..31916)
FT                   /locus_tag="A1E_00140"
FT   CDS_pept        complement(31347..31916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00140"
FT                   /product="hypothetical protein"
FT                   /note="COG1678 Putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72981"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EX98"
FT                   /protein_id="ABV72981.1"
FT                   /translation="MSDKIFHNLSGKTLVATPHVITKGIYHKSLIYMLSHTEEGAIGLI
FT                   FNRLVNHIDLKSFFKIKNDEITNPVMVPIYLGGPVEHEKGFFLHSSDYNKNLLLDFHND
FT                   LAVSSNLEISEDIAFGKGPKNSLFIVGYTAWKSGQLEEELEKNLWLVMDCNKEFIFADN
FT                   PESKWHNALKHLGIDEIHFSSQIGNA"
FT   gene            31988..32626
FT                   /locus_tag="A1E_00145"
FT   CDS_pept        31988..32626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00145"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72982"
FT                   /db_xref="GOA:A8EX99"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:A8EX99"
FT                   /protein_id="ABV72982.1"
FT                   /translation="MITFFDVTIFAIITIFSFFGLYQGIIGFSTRILGFITSIMLAYFL
FT                   YPYISELIGKYMDNEVIRIIIAGVISYVISLILCVFIVYKFLTIISFMRNGFIDRFLGL
FT                   LVGFAIGVTISVVLFFITMIFTSENYFKSKSLKDFIVSSKQHKYSGVLKVSVTTDYLDE
FT                   LSKNIIVIIPNETLKSIEIFENRDLNNFKNSLKKSNGSNDDEDVFSQEL"
FT   gene            33032..33145
FT                   /locus_tag="A1E_00150"
FT   CDS_pept        33032..33145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00150"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72983"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXA0"
FT                   /protein_id="ABV72983.1"
FT                   /translation="MWNHGSLQHNGGNYAQQNGDNIILTENRQNINFDTKY"
FT   gene            complement(33425..34747)
FT                   /locus_tag="A1E_00155"
FT   CDS_pept        complement(33425..34747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00155"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72984"
FT                   /db_xref="InterPro:IPR020183"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXA1"
FT                   /protein_id="ABV72984.1"
FT                   /translation="MTSIYHILEHVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCN
FT                   FARFTDPALNISLMVSKEELTNPHLIPETTKLFQSLYRNSLSDQKIKSIFENLKKQIQK
FT                   LQPVKKEVTEMLARIFVQSAHPIVIRWLLLNKTEVFLTYSHNIGNMMDMVNWQRVGANS
FT                   GMQSTNGKNVAIFVSCGGNPFAENNKDHPTYGNGFAAVARLQIIAAQELGHFADIKRDD
FT                   RGKQITRHSANFSGTKAKDKVRIARRNDIIHCHNLLYKLLKAGMKKQLEYEMKLKFYNA
FT                   NKISGLKVYAIKFMIFIYKFRLLNYSSRHNLIFVKKFKTDKYMALMIDAMFKDMQANLS
FT                   PAADVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKETMQDLYKIYYNDVIPSLIT
FT                   SYNAVTGEDYKRDFKKPKSNFFSKINIFSNKKLVLKPVREL"
FT   gene            complement(34766..34900)
FT                   /locus_tag="A1E_00160"
FT   CDS_pept        complement(34766..34900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00160"
FT                   /product="hypothetical protein"
FT                   /note="COG1286 Uncharacterized membrane protein, required
FT                   for colicin V production"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72985"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXA2"
FT                   /protein_id="ABV72985.1"
FT                   /translation="MLKFLQIILEEVPEIEMVFEAVTLSFNINSSHSRDDVEIAVVNY"
FT   gene            36670..39246
FT                   /locus_tag="A1E_00165"
FT   CDS_pept        36670..39246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00165"
FT                   /product="clpB protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00165"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72986"
FT                   /db_xref="GOA:A8EXA3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXA3"
FT                   /protein_id="ABV72986.1"
FT                   /translation="MNIDKFTAHAKLVIASSQSLAAKNDHQQILSLHLLSSLLSEETGI
FT                   IRSIINNVGSDLNIIHTQVKTELNKIPQVQVAGGGQVYSSAEALKALEKASSLAKDSGD
FT                   SFVTIERILEALTYDNTIAGKILTNNGVSSKKVAASILQMRKGKKADTASAENSYDALK
FT                   KYGRDVTELAERCTLDPIIGRDEEIRRTVQVLSRRMKNNPVLIGEPGVGKTAIIEGLAQ
FT                   RIFSKDVPESLMNCRIIELDMGALIAGAKYRGEFEERLKAVLSEIKESSGEIILFIDEL
FT                   HLLVGTGKTDGAMDASNLLKPMLARGELHCIGATTLDEYRKYIEKDAALARRFQPVYVS
FT                   EPTVEDTISILRGIKEKYELHHAVQISDSAIVAAAMLSNRYITDRYLPDKAIDLIDEAC
FT                   SRMKIELSSKPEELDELDRRIIQIKIELAALKKENEDHSKKKITHLTEELKKLESKSYD
FT                   MNAKWQAEKSKLQQAQKLKEELERARIDLERAERDANLAKASELKYGIIPEIMKKIQEA
FT                   ESMDHKGLLKEIVSDSDIASIISRITGIPIDTMLSSERERLLVMEQKLRESVIGQDKAI
FT                   KSVSDAVRRSRAGIQDINRPLGSFLFLGPTGVGKTELTKALAAFLFDDRNAILRVDMSE
FT                   YMEKHTISRLIGAPPGYIGYDQGGVLTEAVRRRPYQVILFDEVEKAHTDIFNIMLQILD
FT                   EGRLTDSQGITVDFKNTIIVLTSNLGAEILVNQKEGEDSDKVKDEVMEYVRAVFKPEFL
FT                   NRLDEIILFHRLSRNNIHDIVKIQLESLKKILLAQNITLEFDESALNYLAEKGYDPSFG
FT                   ARPLKRLIQREIQNNLAKLILAGAISSGKTVKISREKEELRIKLVN"
FT   gene            complement(39386..39874)
FT                   /locus_tag="A1E_00170"
FT   CDS_pept        complement(39386..39874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00170"
FT                   /product="hypothetical protein"
FT                   /note="COG0542 ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72987"
FT                   /db_xref="InterPro:IPR035354"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXA4"
FT                   /protein_id="ABV72987.1"
FT                   /translation="MSNNNYENIYKAFNCFSEATNSAYSAVNNFLELPNVFRKYPTIIS
FT                   LIFSKTAKLDSNITNIIKNSVIIYEISTTLIGAVNTFYNDKKLVDKILKDGQNAVNKLI
FT                   ETTNYLSPIVTDITNSYLVDLYKEEKTPLFDLQIPNSTSSDYYKFSGEVINSVEIESY"
FT   gene            complement(40067..41095)
FT                   /locus_tag="A1E_00175"
FT   CDS_pept        complement(40067..41095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00175"
FT                   /product="sialoglycoprotease"
FT                   /EC_number="3.4.24.57"
FT                   /note="COG0533 Metal-dependent proteases with possible
FT                   chaperone activity"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00175"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72988"
FT                   /db_xref="GOA:A8EXA5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXA5"
FT                   /protein_id="ABV72988.1"
FT                   /translation="MTKILGIESSCDDTAVSIITENREILSNIIISQNTEHAVFGGVVP
FT                   EIAARSHLSNLDKALKSVLKESDTKLTEISAIAATSGPGLIGGVIVGSMFARSLSSALK
FT                   KPFIAINHLEGHALTARLTDNIPYPYLLLLASGGHCQFVAILGLRKYKILGSTIDDAVG
FT                   EAFDKVAKMLNLGFPGGSEIETRAKFGNSHKYKFPKPIINSGNCNMSFSGLKTAVRTLI
FT                   MSLKEINDTVVNDIAASFQFTIGEILSSKLQDAIRAYEQMINNCDKKNIVIAGGVAANK
FT                   YLQEILSSGAKTYGYQLIYPPIHLCTDNAAMIAYAGLERYNNKLFTPLNFCPKARWNLE
FT                   EI"
FT   gene            complement(41107..42300)
FT                   /locus_tag="A1E_00180"
FT   CDS_pept        complement(41107..42300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00180"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /note="COG1398 Fatty-acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72989"
FT                   /db_xref="GOA:A8EXA6"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXA6"
FT                   /protein_id="ABV72989.1"
FT                   /translation="MLSKLNKPALFSLIFYPIFIISLIVKYLFDYGIGLAEVIFIVASY
FT                   YINNITVGIGLHRLWSHNSYKINKYAEFILVMLSAGTLQGPALSWASNHYKHHAFTDKD
FT                   QDPHTPLKFDNKFLGFMWSHIGWMLVGNGSYKSIDRITWTKHGKNNLLKWQLKYYWQIA
FT                   AFMNIVVPLFIGYLVGGTMQSAYAGFLFMGLGRFLQQQATFCVNSLCHFIGSKKYYKGT
FT                   AGDIWWMSLFLLGENWHNYHHAFPSDYRNGAKWYHFDVHKWIIFLMSKVGLASELERTT
FT                   KVRIQAKMQETLSYLSEKQKQKLSLMQTKIDQLLENLCLKIKELEESSITIKAQFKKSF
FT                   VEIQESLKNLAEQISSATQITEKSSEKLLKIVNKKIIDAEQSIYKLYNQLNTFKVSN"
FT   gene            43248..43613
FT                   /gene="rpsF"
FT                   /locus_tag="A1E_00185"
FT   CDS_pept        43248..43613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="A1E_00185"
FT                   /product="30S ribosomal protein S6"
FT                   /note="COG0360 Ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00185"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72990"
FT                   /db_xref="GOA:A8EXA7"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXA7"
FT                   /protein_id="ABV72990.1"
FT                   /translation="MSFYESVFIIRQDISLNDIDKIVDDFAKIIKDNNGTIIKKEYWGL
FT                   RTLAYKIGSNKKGHYYFLGLDITPNVKEEIERKMKLNENIIRFLTIKADAISSEPSPML
FT                   KNQSTENNLVIDVTINN"
FT   gene            43638..43925
FT                   /gene="rpsR"
FT                   /locus_tag="A1E_00190"
FT   CDS_pept        43638..43925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="A1E_00190"
FT                   /product="30S ribosomal protein S18"
FT                   /note="COG0238 Ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72991"
FT                   /db_xref="GOA:A8EXA8"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXA8"
FT                   /protein_id="ABV72991.1"
FT                   /translation="MLKSNNTSEATTRKVGDKTAKKVFFRRRKGCPLSVPNAPVIDYKN
FT                   PELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARILALLPFVFQAK"
FT   gene            43937..44452
FT                   /locus_tag="A1E_00195"
FT   CDS_pept        43937..44452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00195"
FT                   /product="50S ribosomal protein L9"
FT                   /note="COG0359 Ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00195"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72992"
FT                   /db_xref="GOA:A8EXA9"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXA9"
FT                   /protein_id="ABV72992.1"
FT                   /translation="MEIILIKPVRKLGKIGDILKVADGFGRNYLLPQKLAIRATEPNKE
FT                   LIVKQKHEFEAKDKQIREEVEKINALIKEQKLVFIRQTSDDGKLFGSITNKEIADKLSE
FT                   NVSYNIFHSNIILDKKIKSTGIYTVEIRLHAELNAIVTVIVARSESEVQDYLREQKNES
FT                   LETLAESA"
FT   gene            44961..46259
FT                   /locus_tag="A1E_00200"
FT   CDS_pept        44961..46259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00200"
FT                   /product="tRNA(Ile)-lysidine synthetase TilS"
FT                   /note="COG0037 Predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72993"
FT                   /db_xref="GOA:A8EXB0"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXB0"
FT                   /protein_id="ABV72993.1"
FT                   /translation="MASIYEKFEYNINNLIGDFALSRIAVAVSGGSDSVALLYLTNVWA
FT                   KKNNIELFVISVDHNLREQSKQETHYIQNISNSLNRKHYNLSFDHQNNFSNLQERAREG
FT                   RYNLMTNLCLELDILALLTAHHEDDYVENFCLRLERNSGIFGLSSSNINWHNNIQIIRP
FT                   LYNIPKSELVEYLVNHNIKWFEDESNLSDKYKRNLVRQKLAKEEDYIKADIILQQLKIN
FT                   NLLDDKFKPELISAIAEAVKIFEYGFAFLDLVKFDKFSNEVKVQLINFLLIIISGQSRV
FT                   ARFYSVSPILELITQDINFKNTLHGCVIKRIQNELLIYREFGKKLPKSQILLDKSIIWD
FT                   SRFHIIKNQETPNCFVTHLSLEDYKTIKKQLDLEPLKNLSCKNHNAILFTLPVVKILEK
FT                   VIAIPHISYYDHDMRNFGVSFAPNFVSRFTHFC"
FT   gene            46356..48266
FT                   /gene="rplI"
FT                   /locus_tag="A1E_00205"
FT   CDS_pept        46356..48266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="A1E_00205"
FT                   /product="50S ribosomal protein L9"
FT                   /note="COG0465 ATP-dependent Zn proteases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00205"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72994"
FT                   /db_xref="GOA:A8EXB1"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXB1"
FT                   /protein_id="ABV72994.1"
FT                   /translation="MNNQGRSILVWAVLFVFVILLFNVFQSDGLLGGRNNITFSDFLTR
FT                   VDEKTVNSVKIQGRVIEGTSNDGSTFSTYSPDYPDLVNRLTSNDVNIEVVPLETRMNTF
FT                   LGFLISWFPMLLLIGVWVFFMRQMHGGGKVLGFGKSKARLLLSDKGPKITFKDVAGIDE
FT                   AKEELTEIVDFLRDPSKFQKLGGKIPKGCLLIGPPGTGKTLLAKAIAGEANVPFFSISG
FT                   SDFVEMFVGVGASRVRDMFEQGKRNAPCIIFIDEIDAVGRHRGIGMGGGNDEREQTLNQ
FT                   MLVEMDGFEANEGVVIIAATNRPDVLDRALLRPGRFDRQIAVANPDINGREQILKVHLK
FT                   KIKYNNTVLARIIARGTPGFSGAELANLVNEAALIAARLGKKEVDMHDMEEAKDKVLMG
FT                   VVRRSIAMSEKEKRLTAYHEGGHALVGLYCPAASPIHKATIIPRGNALGMVQRLPETDE
FT                   YSQNREQMESSIAVYMAGRVAEEIIFGRNKVTSGASSDIKGATNIARAMVTKAGLSDLI
FT                   GPIFHGSSSDDMYGRQSNNETSEATAELIDTEVKRIIMQGYEFAKDILTKHIDQLHTLA
FT                   NALIEYETLSGQQIKNLLSGRALDSEEENKFPFNDSSTIKIDKEKSPEKAKTTKAKKES
FT                   T"
FT   gene            48267..49052
FT                   /locus_tag="A1E_00210"
FT   CDS_pept        48267..49052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00210"
FT                   /product="succinate dehydrogenase catalytic subunit"
FT                   /note="COG0479 Succinate dehydrogenase/fumarate reductase,
FT                   Fe-S protein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72995"
FT                   /db_xref="GOA:A8EXB2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXB2"
FT                   /protein_id="ABV72995.1"
FT                   /translation="MAELRLPPNSVVEKGREHKENEEMLRPRKIKIYRYNPDLDENPTI
FT                   DSFEIDLSKTGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNIDGTNTLACIKPI
FT                   EDISGDIKIYPLPHMKVVKDLVPDMSHFYAQYESIEPWLKTDSPAPSNSERLQSIKDRE
FT                   NLDGLYECILCACCSTSCPSYWWNGDKYLGPAILLQAYRWIVDSRDDHTGERLEALEDP
FT                   FKLYRCHTIMNCTKTCPKSLNPAKAIGEIKSLITERRGM"
FT   gene            complement(50050..51126)
FT                   /gene="sdhB"
FT                   /locus_tag="A1E_00215"
FT   CDS_pept        complement(50050..51126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="A1E_00215"
FT                   /product="succinate dehydrogenase iron-sulfur subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="COG1565 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00215"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72996"
FT                   /db_xref="GOA:A8EXB3"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXB3"
FT                   /protein_id="ABV72996.1"
FT                   /translation="MSIDSKIRQLINQNGYITCDVLIQEILYSNPASYYRQTKSLASEG
FT                   DFITAPEVSQLFGEIIGLWCIKEWQRIGCPKSLSLVELGPGRGLLMRDLLRTAKLVPEF
FT                   YKALSIELIEINQNFIAHQKSNLQDINLPIKHLSFIEDIPKKPTIIVANEFFDAMPIKQ
FT                   YIKVKELWYERIFVVQPVDGRIKYDKISVNKQLQEYLLQTHIEAKDGAVLEESYKSIEI
FT                   IKFIAQHLKKLSGSCLIIDYGYDIALSNRNRYQYNPTLQAVKNHKYCPILENCGKADLS
FT                   AHVDFYTLKTVAKNSKINVINTILQRDFLIENGILLRSKTLQDKLNNEQAQIIEKQVER
FT                   LISPKQMGVLFKVLQIMN"
FT   gene            complement(51105..51884)
FT                   /locus_tag="A1E_00220"
FT   CDS_pept        complement(51105..51884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00220"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="COG0682 Prolipoprotein diacylglyceryltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72997"
FT                   /db_xref="GOA:A8EXB4"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXB4"
FT                   /protein_id="ABV72997.1"
FT                   /translation="MIFPNINPVIFSIGPFAISWYSLSYVIGILLGWFYANKIIEKFKP
FT                   QITKKNLEDFITYAVIGIIVGGRLGFVLLYNPSRYFSNPIDILKTYQGGMSFHGGALGV
FT                   IIAAYLFCRKYKVNFLSLTDIIATVVPIGLFLGRIANFINGELYGRITNSSFGIIFPNS
FT                   DLSPRHPSQLYEAFFEGLVLFCILAYATFKHKTLEKRALNLGLFLTFYALFRITIEIFR
FT                   EPDMQIGFILDSLTMGQILSIPMLILGSSLICQSTLK"
FT   gene            52158..53309
FT                   /locus_tag="A1E_00225"
FT   CDS_pept        52158..53309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00225"
FT                   /product="putative carbamate kinase"
FT                   /note="COG0668 Small-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72998"
FT                   /db_xref="GOA:A8EXB5"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXB5"
FT                   /protein_id="ABV72998.1"
FT                   /translation="MDLYYISSTELVLLFVMLVTLIPVIFLIKRLIFIPVKNYLTRHHY
FT                   DDYERIIKKYPIFRYLLHTLLAFYFVCWGNIFHPNSFKAHVFLGIKDTIVILYTSISMT
FT                   MLLLTLIDAFADLYHNRIKTVKNVPLSLYFQILKIIVMVIAVMITISYILNISLSTFLT
FT                   SLGAATALLTFVFKDTVLGLLASLQLTTQEIINIGDWVRIGKIEGIVEKITISVVTIRN
FT                   FDQSISTVPTYSILNSTVTNYRGISESGARRIKRVFNINMATIHFCDATILKELKKSPY
FT                   LSKDIINKITVDKEEKDLTNIKLFKLYVQEYLKNNPAVYTEGFTFLVRQLEPTIYGLPI
FT                   EIYIFVKEVNLVGYENIQDDISEHLISILSEFKLKIFQNVAVV"
FT   gene            53499..55181
FT                   /locus_tag="A1E_00230"
FT   CDS_pept        53499..55181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00230"
FT                   /product="putative inner membrane protein translocase
FT                   component YidC"
FT                   /note="COG0706 Preprotein translocase subunit YidC"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ABV72999"
FT                   /db_xref="GOA:A8EXB6"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXB6"
FT                   /protein_id="ABV72999.1"
FT                   /translation="MNNNIMNLIAAIVLSLSIIFGWQYFVVKPEHKKQQQQIAMQKAEN
FT                   LKKQKLKALIKPASDLVVQEANQVQRIKIESESLTGSISLKGLRFDDLILKKYKQDLSK
FT                   NSTEVRLFSPANTENAYFAEIGLVSNLSSVKLPNNDTIWNSDGEILSPEKPVNLFWVNE
FT                   DGVKFLVTITLDENYLFTVEQTIVNNSDKELPVQSYGLINRKYIAVEKAVNILHQGPIG
FT                   CINENLKEYSYDDIKDKKSEKFVASKVDWIGMTDKYWLSSLIPDKSSNYSSNFNYALTQ
FT                   GVERYQVDFISPVQIIKSGENFSITSRIFAGAKKVDLLDKYEKQYGIKLFDRAIDFGWF
FT                   YIITKPVFYAMNFFYGYVGNFGISILIVTVIIKLLMFTLANKSYCSMKKMKNLQPEIDR
FT                   IKNLYGDDKARLNQEIMALYKKEKVNPVAGCLPILVQIPVFFSIYKVLYVTIEMRQAPF
FT                   YGWIKDLSAPDPTTIFNLFGFLPFSPPSFLMIGAWPILMAITMFLQQRMSPEPADPVQA
FT                   QVMKFMPLIFLVMFSSFPVGLLIYWSWNNILSIIQQYYINKFN"
FT   gene            55181..55726
FT                   /locus_tag="A1E_00235"
FT   CDS_pept        55181..55726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00235"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00235"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73000"
FT                   /db_xref="GOA:A8EXB7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXB7"
FT                   /protein_id="ABV73000.1"
FT                   /translation="MRIDKNLPNYLTVARVMVIPIIILAFYINNSLARTFGALLFVLAS
FT                   ITDFFDGYIARKYNLVTSFGKMFDPIADKLLVGCVIIMLLKKDNVDEIPCLLILAREFL
FT                   VSGLREFLALVKVSVPVSRLAKVKTFLQMFALSILILGSKGSGIIYLDIVGEIILWIAA
FT                   FLTIITGYSYFKACKKYF"
FT   gene            56122..56274
FT                   /locus_tag="A1E_00240"
FT   CDS_pept        56122..56274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73001"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXB8"
FT                   /protein_id="ABV73001.1"
FT                   /translation="MIIENAELIKYRSGRVNIKKKETAAYAEILNKARNNIIKEKFTKL
FT                   KMYTL"
FT   gene            complement(56527..56925)
FT                   /locus_tag="A1E_00245"
FT   CDS_pept        complement(56527..56925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00245"
FT                   /product="hypothetical protein"
FT                   /note="COG0558 Phosphatidylglycerophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00245"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73002"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXB9"
FT                   /protein_id="ABV73002.1"
FT                   /translation="MTRKIIKNIIFGIAFLLSTISFANSVTSNGSKKDAAKTNDVTTQK
FT                   IIDAFSAYAGTIKPEVREEIQKYRVKIVNINKEKRKLYNSLSKEAQNFLAEQQKYKQKL
FT                   SLSKLTVENNDRKNNAVNSNDKQDKDTK"
FT   gene            58011..59516
FT                   /locus_tag="A1E_00250"
FT   CDS_pept        58011..59516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00250"
FT                   /product="ADP,ATP carrier protein"
FT                   /note="COG3202 ATP/ADP translocase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73003"
FT                   /db_xref="GOA:A8EXC0"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXC0"
FT                   /protein_id="ABV73003.1"
FT                   /translation="MSTTKSDNYLSELRKIIWPIERYENKKFLPMAFMMFCILLNYSTL
FT                   RSIKDGFVVTDIGAEAISFLKTYIVLPSAVIAMVIYVKLCDILKQENVFYVITSFFLGY
FT                   FVLFAFVLYPYPDLVHPDPETIEHLSLAYPNFKWFIRIVGKWSFASFYTMAELWGTMIL
FT                   SLLFWQFANQITKTDEAKRFYSMFGLLANLALPVASVIIGYFLHEETQIVAEHLKFVPL
FT                   FIIMITSSFSIILTYRWMNKNVLTDPLLYDPALVKEKKSKAKMSLLDSFKMIFMSKYVG
FT                   YIALLLIAYGVSVNLVEGVWKSKVKELYPTKEAYTMYMGRFQFYQGWVAIAFMIVGSNI
FT                   LRKVSWLIAAMITPLMMLLTGAAFFAFIFFDSVIAMYLTGILASGPLALSVMIGMIQNV
FT                   LSKGVKYSLFDATKNMAYIPLDKDLRVKGQAAVEVIGGRFGKSGGAIIQSTFFILFPAF
FT                   GFVEATPYFASIFFVIVILWIYAVRSLNKEYQVLVNKTDNRIC"
FT   gene            59583..60872
FT                   /locus_tag="A1E_00255"
FT   CDS_pept        59583..60872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00255"
FT                   /product="putative inner membrane protein translocase
FT                   component YidC"
FT                   /note="COG2271 Sugar phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73004"
FT                   /db_xref="GOA:A8EXC1"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXC1"
FT                   /protein_id="ABV73004.1"
FT                   /translation="MTNTKSKIKIPRSPYVKKYNSWRVRILYSIIIGYATFYFCRQNFN
FT                   IATPAIRAYFGVTKTQIGWILTASSIMYGVSKVCNGFISDKVNARIFMVLGLLLVGIIT
FT                   ILIGLSDFLWLIGILWIASNWFQSMGWPPATKMLTHWFAPKELGTKWAMGATSNQIGGA
FT                   LAMVSCGYLIDKFDWRAAFFVPGVVACIVSLFLYNRLRSSPKEVGLSTVEEYKEYPPES
FT                   IGDYEKLLTTQLLKMVFCNKLIWYVCLANMFVYIIRSGVIYWAPTFLRDLRNISLANAG
FT                   LQIGLYEMIGIPGALIAGVLSDKLFQGRRGPVAAICMISLSLLLVLFWKIPVQSELLSI
FT                   VILSLIGFFVSGPQLLVGIAAADFSSRQAVGTANGLSGLFGYLGAAIAGVGVGWISDNY
FT                   GWNGVFTFFSVSALLGGGLFTLTWNRSAKK"
FT   gene            60902..61324
FT                   /gene="ndk"
FT                   /locus_tag="A1E_00260"
FT   CDS_pept        60902..61324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="A1E_00260"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="COG0105 Nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73005"
FT                   /db_xref="GOA:A8EXC2"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXC2"
FT                   /protein_id="ABV73005.1"
FT                   /translation="MTIQYTFSMIKPDAIKRNKIGQINTYLENAGLKIVAQKMKYLTKY
FT                   EAECFYDEHRARPFFNSLVEYITSGAVVLQVLKGTDAITLNRKIMGATNPDEAEAGTIR
FT                   KDFGESIEANSIHGSDSQNSAKREIEFFFNKSEIIE"
FT   gene            61328..63202
FT                   /locus_tag="A1E_00265"
FT   CDS_pept        61328..63202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00265"
FT                   /product="glucose-inhibited division protein A"
FT                   /note="COG0445 NAD/FAD-utilizing enzyme apparently involved
FT                   in cell division"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00265"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73006"
FT                   /db_xref="GOA:A8EXC3"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXC3"
FT                   /protein_id="ABV73006.1"
FT                   /translation="MLKYDVIVIGGGHAGVEAAAASARLGVPTLLITLKPGNLGEMSCN
FT                   PAIGGIAKGILVKEIDALDGLMGYVIDQAGIHYKMLNETRGPAVWGPRAQADRKLYKKA
FT                   MYQILTNYPNLNILYGKVEDIEIKSSKVKAVVLNDGSKIPCQKIILTTGSFLSGLIHIG
FT                   STKIPAGRVDEEASYGLSNTLKRVGFKIARLKTGTPPRIDGLTIDYSKTVLQPGDKTPR
FT                   PFSALTNIVDVPQINCFITKTTSETHDIIRENLDKSAMYSGQIEAIGPRYCPSIEDKIV
FT                   RFSTKSEHRIFLEPEGLDDYTIYPNGISTSLPEEVQCKLIKTIPGLEKATILRPGYAIE
FT                   YDYVDPREISITLETKKIMGLYFAGQINGTTGYEEAAGQGIVAGINAALAVKNQPPFIL
FT                   TRANSYIGVMIDDLTIFGTKEPYRMFTSRAEYRLSLRADNADLRLTELGINIGVVSKKR
FT                   KEIFKKKCYNIEKTRNLLKTLSFTTSKLVKIGVQVAQDGTYKTVLDLFKIPNFTIEQAI
FT                   KIFPKLQEINSNILQLLYIEAKYASYLAKQQADINLFQNEEIQLIPKNIDYFKIPSISL
FT                   EIREKLSYYKPTTIGIARRIPGITPAAITAIIIYLKTKYNDGSFISNN"
FT   gene            63722..64489
FT                   /locus_tag="A1E_00270"
FT   CDS_pept        63722..64489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00270"
FT                   /product="soj protein"
FT                   /note="COG1192 ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73007"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXC4"
FT                   /protein_id="ABV73007.1"
FT                   /translation="MKVIAIVNQKGGVAKTTTTVNLATAFAALNKKVLVIDLDPQGNSS
FT                   TGFGISQQQRKNTIYQVLINLIELKDAIIATNIPNLEIITSNTNLSAAELDLTKLKDRE
FT                   YILMKLLKEIKILYNYIIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKT
FT                   IKIVEKKLNPKIKIVGILFTMYDKRNRLTEQVEDDVRKCLGALVFKTVIPRNIKLSEAP
FT                   SYGKPAIIYDYKCSGAVAYMELTKEILERYGEK"
FT   gene            64476..65336
FT                   /locus_tag="A1E_00275"
FT   CDS_pept        64476..65336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00275"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification enzyme GidA"
FT                   /note="COG1475 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73008"
FT                   /db_xref="GOA:A8EXC5"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXC5"
FT                   /protein_id="ABV73008.1"
FT                   /translation="MAKNKGLGRGLSSLLGEEVISIESEIIQIINIDKIRPNENQPRKN
FT                   FEYDKIKELADSILNNGLLQPIIVDNNFQIIAGERRWRACKLAKVLEIPVIIKNLDAKE
FT                   SVEIALIENIQRTDLTVMEEARGFKYLVDNFNYTVEKLAERLGKSRSHIANLLRLNNLP
FT                   QSIQDKVNENILSMGQARCLINHEHAEAIADYIINNNLNVRQTEKLVRQWYKNDYTKFP
FT                   KNNNKVGKPFLKDSTTDNDLELLAKALSEKFGIKITIENCSLGGKLIFHYKDLKELDLI
FT                   LLQLN"
FT   gene            65627..67294
FT                   /locus_tag="A1E_00280"
FT   CDS_pept        65627..67294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00280"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73009"
FT                   /db_xref="GOA:A8EXC6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXC6"
FT                   /protein_id="ABV73009.1"
FT                   /translation="MSYQYVYEMVGLSKIINGKQILKETNLSFLPRAKIGIIGPNGAGK
FT                   STLLKIMAGIDKEFEGKAIAKIGIKVGYLPQEPYLDPSKNVFDNIIEGLHEKKKLIEEF
FT                   NDISNKFSTEITDEKMQKLFDKQAELQEKIDNCDGWNLEREIEIAMLALRCPPKEADIT
FT                   KISGGEKRRVALCKLLLEKPDMLLLDEPTNHLDAESVSWLEDYLKHYEGTVIVITHDRY
FT                   FLDNVTEWILEIDRGNCIPWESNYSSWLEQKQKKIALESKEDNDRKKQLRRELEWIRQT
FT                   PKARQSKNKARITAYHELLNKQQDQKNDPTQIIIPNGPRLGDLVIEAEHIAKKFNNKIL
FT                   LSDFSFKVPRGAIVGIIGPNGAGKSTLFNIITGKIIPDSGSIKIGQTVKLGYVDQSRDH
FT                   LDDNKTIWEEISEGLDELQLGNKIVKSRAYCAAFNFRGSDQQKKVGQLSGGERNRVHLA
FT                   KLLKEGANVILLDEPSNDLDIDTLRALEDAILGFAGCVLVISHDRWFLDRIATHIISYD
FT                   KENNATWFEGNYQDYHEYMLSTNGESILNPKYKHKKLI"
FT   gene            67297..67614
FT                   /locus_tag="A1E_00285"
FT   CDS_pept        67297..67614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00285"
FT                   /product="putative ABC transporter ATP-binding component"
FT                   /note="COG0488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73010"
FT                   /db_xref="GOA:A8EXC7"
FT                   /db_xref="InterPro:IPR022718"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXC7"
FT                   /protein_id="ABV73010.1"
FT                   /translation="MSLTQILLILFIGILVTNPSDIFIIIKEFKKIKAYLINIKTSIIK
FT                   NVNEQLETEQLNFYLKKIINLEGYYHGDYDLTTIKEKYYTLVINNDLIDNESATDITEK
FT                   Y"
FT   gene            67649..68473
FT                   /locus_tag="A1E_00290"
FT   CDS_pept        67649..68473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00290"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73011"
FT                   /db_xref="GOA:A8EXC8"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXC8"
FT                   /protein_id="ABV73011.1"
FT                   /translation="MQKVVKLHNIKIGNDLPFILIAGPCQIEGQDHALFMAEKLVKLTS
FT                   KLDIPFIYKSSFDKANRTSINGVRGLGIEKGLEVLSKVKAEFDCPIVTDVHSESQCTET
FT                   ARVVDILQIPAFLCRQTDLLQAAAKTGKIVKVKKGQFLAPWDMKNVQTKLKAFGAENIL
FT                   FTERGTCFGYNNLVSDMRSLAIMAKLNVPVIFDATHSVQQPGGLGDSTGGERKYVELLA
FT                   KAATTVGIAGMYMEVHQDPDNAPSDGPCMIKLDNLESILIKLKKYDKITKEK"
FT   gene            69000..69086
FT                   /locus_tag="A1E_00295"
FT   CDS_pept        69000..69086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00295"
FT                   /product="hypothetical protein"
FT                   /note="COG2877 3-deoxy-D-manno-octulosonic acid (KDO)
FT                   8-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00295"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73012"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXC9"
FT                   /protein_id="ABV73012.1"
FT                   /translation="MKFITIATLDFNHDTFITKDVQPYSNYL"
FT   gene            complement(69865..70197)
FT                   /locus_tag="A1E_00300"
FT   CDS_pept        complement(69865..70197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00300"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /EC_number="2.5.1.55"
FT                   /note="COG0316 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73013"
FT                   /db_xref="GOA:A8EXD0"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXD0"
FT                   /protein_id="ABV73013.1"
FT                   /translation="MTITITDRAFQRVRKLIGLEKDKNLALRVSVDSGGCSGLMYNYEL
FT                   VSKNTIEQDDYVITKHNATIIIDPISQKFMLDCILDFIEELGSSYFNVHNPQAKAKCSC
FT                   GNSFTV"
FT   gene            70360..71490
FT                   /locus_tag="A1E_00305"
FT   CDS_pept        70360..71490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00305"
FT                   /product="deoxyguanosinetriphosphate
FT                   triphosphohydrolase-like protein"
FT                   /note="COG0232 dGTP triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00305"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73014"
FT                   /db_xref="GOA:A8EXD1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXD1"
FT                   /protein_id="ABV73014.1"
FT                   /translation="MLASYASDPLKSRGRLYKEIPNTYRNEFERDRDRIIHTNAFRRLQ
FT                   YKTQVFINHEGDHYRNRLTHSLEVSAVARSVANTLNLSSDLAETIALAHDLGHTPFGHA
FT                   GERALNACMRDYNGFSHNAQSLKILTLLEKRYAAYNGVNLTWEVLEGIVKHNGPITCEI
FT                   NEYIAEYNKQNDLELDTYASAEAQIAALADDISYISHDLEDSIGAKIIDFNSLAELKYI
FT                   DQYVFALKSKFKNISSSCLIYEVVRKLMHELITDLLWQTKENLNKEKITDIDEIRNLNY
FT                   QLVDFTANTNERIKETKKFLHERVYKSNKITAISLKCTKIVQGLFKVYMDDINLLPVNW
FT                   KMLIDSNEIYSKARVIADYIAGMTDRFAIQAYNQLC"
FT   gene            71666..73396
FT                   /locus_tag="A1E_00310"
FT   CDS_pept        71666..73396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00310"
FT                   /product="arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73015"
FT                   /db_xref="GOA:A8EXD2"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXD2"
FT                   /protein_id="ABV73015.1"
FT                   /translation="MNIFNQLKQDIIAASRQLYNNQEIANIVTIETSKDNFNGDLSSNI
FT                   AMIIAAKENMPPRTVALKFKEILITLPYIASIEIAGPGFINFTIKAESWQIAIKNILQH
FT                   EGKFFEIDIDKNKYINIEYVSANPTGPMHIGHARGAVYGDVLARILQKVGYNVTKEYYV
FT                   NDAGSQINDLVSTVLLRYREALGEKITIPVGLYPGEYLIPVGQILVKEYGNKLLVMDEE
FT                   ERFKIVKNFAVEKMLDLNRKDLEELGIKHDLFFSEQSLHDKGKIEEIVKLLTNMGLIYE
FT                   GTLPAPKGKIHAKWDNRVQKLFKSTKYGDSQDRPIEKADGSWSYFASDLAYAKDKIDRG
FT                   ANHLIYVLGADHSGYVKRIEAIVKALGKEQIKVDVKICQLVNFIENGVPVKMSKRLGNF
FT                   ASVQDVNHEVGKDIIRFMMLTRQNDKPLDFDLVKVKEQSRENPIFYVQYAHVRTVSILS
FT                   KAMELMPESYSSFEAGIYDLSLLSSEEEIDIIKLLAAWTKTLEVSAKYFEPHRIALYLI
FT                   NLASKFHSIWNFGKENSDYRFVIENNKELTTARLALAKAIQKVIASGFEVIGVEPMNKM
FT                   "
FT   gene            73472..74143
FT                   /gene="argS"
FT                   /locus_tag="A1E_00315"
FT   CDS_pept        73472..74143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="A1E_00315"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="COG0018 Arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00315"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73016"
FT                   /db_xref="GOA:A8EXD3"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXD3"
FT                   /protein_id="ABV73016.1"
FT                   /translation="MINNIFVKICIGCLICISAIYFAYQYYQSSKPIITIYPDELPTKI
FT                   KPSIIENNQAAVHSTIYENLIAKDINIKTVKLLPDPEKPINIDSCNQSQSDESFDEISN
FT                   LIALIEPSNNSKNETDLNIIKLEKGTKDKASNAKNCKNNGNYKVQLGSVKSEVEAIQEG
FT                   ERIKKRFPKILQNVVITTKKVKYDDGKFFYLILAGDYGSLSQAKVVCKKLAYNKQSCVL
FT                   K"
FT   gene            74328..76544
FT                   /locus_tag="A1E_00320"
FT   CDS_pept        74328..76544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00320"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73017"
FT                   /db_xref="GOA:A8EXD4"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXD4"
FT                   /protein_id="ABV73017.1"
FT                   /translation="MKQAKIENIDFGNALSERYLAYALSTIMSRSLPDVRDGLKPVHRR
FT                   LLYAMLQLRLEPNSGYKKCARVVGDVIGKYHPHGDGAVYDTLVRLAQYFSLRYPLIDGQ
FT                   GNFGSIDGDNAAAMRYTESRMTEICMLLMDDIDKDTVDFRPTYDDSDLEPVIMPASFPN
FT                   LLANGSEGIAVGMATNIPPHNLHELCDALIHLIDHPKAEVNDIMNFIKGPDFPTGGIII
FT                   DKAEVINAAYSTGRGSLRVRSRWKKEELSYGTYQIVVTEIPYQVQKSKLIEQIAILLKD
FT                   KKIPLVSNIRDESTDIIRLVIEPRDRNCDPQVVMESLFKLTNLESRIQLNMNVIGSNNV
FT                   PRVMNILEILQEFLDHRQSIVTRRSTYLLNKIQHRLEILEGLRIAYLNFDEIIKIIREE
FT                   DEPKAIMINWFKLTEIQVEAILNTRLRSLHRLEEQKIINEHSNLKKQQVILEEILNNPK
FT                   ELWKVVKKEIKTVQTKFGLNTVIGARRTYFEEVTLTNQVVDITAFITKEPITIICSKMG
FT                   WVRSFKGHNNDLSNIKYKEGDTEKFILKAYTTDKLLIVSSEGRFFTLLADNISKGKGTE
FT                   ESIKLLVDIGNNDITNILVYKPDQLLLLASSIGKGFLVNSNEVIAQTKTGKQIMNVPNG
FT                   HICITCLPANGDSVACIGESRKLLVFNIDEIPEMKKGQGVTLQKFKDAKLLDVKIFNKE
FT                   DGLGWNNNGKVKLEKNIITFLGKRGGAGKLPPMGFPKNNRFSSS"
FT   gene            complement(76908..78230)
FT                   /locus_tag="A1E_00325"
FT   CDS_pept        complement(76908..78230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00325"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /note="COG0188 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00325"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73018"
FT                   /db_xref="GOA:A8EXD5"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXD5"
FT                   /protein_id="ABV73018.1"
FT                   /translation="MKNLLLATSIVCFASACLATKNPTPIISNSDTSIKLEGFYLLESG
FT                   YIKQDHLILFDKNVTDNRKKLGFYTEAAFAATITKTINDIIAGAKIVLQPTTRVKTSTS
FT                   YNGSHIFIETSYGKTELGSPADASAKLRITGSQVTAGTGGWSRYALLNGQHMRYKGLKP
FT                   DFDTNASFYLESYSNYFDQINDKTERARRVNFFTPKMKGFQAAISYTPDTANTGGNRYI
FT                   NNLMPDKSSGSNVISVSKTGIQRVKLENNEAMTINQNIRDAFSAGLTYEHEISEDTDLK
FT                   LSVTGEYGKPARRLIHTKMDRTKGVEVLNTYKLSNLKAYNLGAVFTYGNFSCGASYGSL
FT                   GKSLTAKEYYKVGRDTYYYNGAVAYRQGPIKTSLEYLKTSRYKNTVNTVSLATEYKIMP
FT                   GLLPYAEISHFQAKGKPVYYPEAPRKTTRGTVGLIGTKLKF"
FT   gene            78514..79080
FT                   /gene="dcd"
FT                   /locus_tag="A1E_00330"
FT   CDS_pept        78514..79080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="A1E_00330"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="COG0717 Deoxycytidine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73019"
FT                   /db_xref="GOA:A8EXD6"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXD6"
FT                   /protein_id="ABV73019.1"
FT                   /translation="MAIMSDKWIKEAVINQSMIKPFVEKQVRVHNKDKIISYGLSSYGY
FT                   DARVSNEFKIFTNINSTTVDPKNFSEYNLVDREVDVCIIPPNSFALGRTIEYFKVPRDI
FT                   LVICVGKSTYARCGIIVNVTPLEPEWEGHVTLEFSNTTPLPAKIYANEGACQFLFLNSD
FT                   QMCDTSYADRQGKYMKQVGVTLPLT"
FT   gene            79177..79635
FT                   /locus_tag="A1E_00335"
FT   CDS_pept        79177..79635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00335"
FT                   /product="export protein SecB"
FT                   /note="COG1952 Preprotein translocase subunit SecB"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73020"
FT                   /db_xref="GOA:A8EXD7"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXD7"
FT                   /protein_id="ABV73020.1"
FT                   /translation="MSTINTNTNEVMPHISVNAQYIKDLSLENPSAPSSLAALDQRPQI
FT                   DLSLDINITNLSEENFYEVELNIEAIARNEKYTLFQIELKYAGVFNLINIDSEQHPILL
FT                   SVHCPAMIFPFARKIIASCTQDAGFQPLMIDPIDFGALYHKKMSEHQN"
FT   gene            79861..80574
FT                   /locus_tag="A1E_00340"
FT   CDS_pept        79861..80574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00340"
FT                   /product="preprotein translocase subunit SecB"
FT                   /note="COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73021"
FT                   /db_xref="GOA:A8EXD8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXD8"
FT                   /protein_id="ABV73021.1"
FT                   /translation="MRVLLIEDKPEMANLIELTLASEGIVCDKASVGVEDLRLAKVSGY
FT                   DLVILDLMLPDINSFEILLRLRAAKIKTPILILSSLTDTDQKITGFSFGADDYLTKPFV
FT                   REELIARIKAIVRRSKGHVASVFRFDKVSVNLDTRSVEVEGKKVHLTNKEYAVLELLIL
FT                   RRGTILTKEMFLNHLYNSVDEPAIKIIDVFICKLRKKLSDAAGGRDYIDTVWGRGYMLK
FT                   EYDELQQKEILAQGA"
FT   gene            80578..81399
FT                   /locus_tag="A1E_00345"
FT   CDS_pept        80578..81399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00345"
FT                   /product="hypothetical protein"
FT                   /note="COG2904 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00345"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73022"
FT                   /db_xref="GOA:A8EXD9"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXD9"
FT                   /protein_id="ABV73022.1"
FT                   /translation="MPLSASLLGKNSTYKDSYDATLLFKIPRINNRNELGINSNNLPFY
FT                   GVDIWNTYELSCLNKNGKPWVGVGTFYIPTDSENIVESKSFKLYLNSFNNFVVESIEEL
FT                   ERIILQDLSNVTHAKVTGQIFPINTKIEFGLPSGKNIDDLNIECNNYCPPDNSLIEYED
FT                   VLVEEEINSNLLKSNCLVTGQPDWGTIVIKYRGKKLKHDSFLKYLISFRNYNEFAEQCA
FT                   ERIFTDINNSINPDFLSIYIVYTRRGGIDICPYRSLDQNYNLPSNKRLIRQ"
FT   gene            complement(81672..82232)
FT                   /locus_tag="A1E_00350"
FT   CDS_pept        complement(81672..82232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00350"
FT                   /product="hypothetical protein"
FT                   /note="COG3820 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73023"
FT                   /db_xref="InterPro:IPR010421"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXE0"
FT                   /protein_id="ABV73023.1"
FT                   /translation="MNAQKILPLLPKATAMWLIEHTSLTFKQIADFCGIHEFEIKGMAD
FT                   GEVAQSIKGLSPIANGQLTLEEIERCSKDPNTSLQISYSPTDELMKNQKKQRAKYIPIA
FT                   RRQDKPDAIYWLLSNYPNIQDHQIIKLVGTTKTTINAIRTRSHWNMNSIRPRDPVLLGI
FT                   CSQIDLNKIVEVLKPIQNPTKES"
FT   gene            complement(82887..82976)
FT                   /locus_tag="A1E_00360"
FT   CDS_pept        complement(82887..82976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73024"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXE1"
FT                   /protein_id="ABV73024.1"
FT                   /translation="MVNILEHSNINVRFAAHPVAGRMAPRGGI"
FT   gene            83232..83489
FT                   /locus_tag="A1E_00370"
FT   CDS_pept        83232..83489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00370"
FT                   /product="hypothetical protein"
FT                   /note="COG1282 NAD/NADP transhydrogenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73025"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXE2"
FT                   /protein_id="ABV73025.1"
FT                   /translation="MSRLLLSVKPIPAAAKPEYEFSIDTITGISAPPIGIINNTPINSD
FT                   TKTIRLNKNILSERINDLIKRTNIIADHRILTGYFLLSQF"
FT   gene            complement(83991..84722)
FT                   /locus_tag="A1E_00380"
FT   CDS_pept        complement(83991..84722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00380"
FT                   /product="hypothetical outer-membrane protein"
FT                   /note="COG3047 Outer membrane protein W"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73026"
FT                   /db_xref="GOA:A8EXE3"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXE3"
FT                   /protein_id="ABV73026.1"
FT                   /translation="MLRIVKKLGITLLVSSISMSSFAKSMYNDIDSTEYYDSTPYYENE
FT                   GSLVFKVRLGATFSSAKQKGLPPPTSTQPVSVGEVAKNGYGGNASTTIFFNNYLATELS
FT                   LGFNVLRTKYKAIANVAHNYGAVTKLGKYKPIYMIPATITGQFHIAPYGGIRPYIGLGY
FT                   HGSYMLTQATSLKIRNGHGAVGQIGVDFYAKDDTLINLDVKQFLLNPKLEYKPNLVGNK
FT                   TVTSKVKLNPLIVSIGIGFPF"
FT   gene            84866..85750
FT                   /locus_tag="A1E_00385"
FT   CDS_pept        84866..85750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00385"
FT                   /product="S-adenosylmethionine transporter"
FT                   /note="COG0697 Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00385"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73027"
FT                   /db_xref="GOA:A8EXE4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXE4"
FT                   /protein_id="ABV73027.1"
FT                   /translation="MNDALKTYLTGIGWFLLSLVSSSANDVMSKYLGTRLDSFEVAFFR
FT                   FFFSSIVLLPFVAYYGKNTLKTSSPFVHILRGLLLFFGMTAWTYGLTIAPVTTATVISF
FT                   SIPLFTLILAVFFLNENIIWQRWVVTIVGFIGLVITLKPHAEDFNPEILYFVLAAISFA
FT                   MLDIINKKFVIKESMISMLFYSAIVTAIVSLPVASQYWLTPSSFELVLLFVLGSSGSII
FT                   LFFLLKAFSMVDATATAPYRYLELVISAIAAYLIFNEFPDKSTLYGAVIIIPATLFIIY
FT                   SEKKAMSRKHESQ"
FT   gene            85737..86999
FT                   /gene="queF"
FT                   /locus_tag="A1E_00390"
FT   CDS_pept        85737..86999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queF"
FT                   /locus_tag="A1E_00390"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73028"
FT                   /db_xref="GOA:A8EXE5"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXE5"
FT                   /protein_id="ABV73028.1"
FT                   /translation="MNRSKLVFSSVIANTFEWYDYVLFGYFAPIIGAKFFPNDEANTAL
FT                   LQAFLVFAIGYLARLLGGIFFGVIGDRFGRKVALTSALFCMSAPTVLIGILPTYHTIGI
FT                   TATILMIIVRILQGLSMGGALTGSISFVIEHTSSKHRGFTGSILMSSICSGLLLGAFVS
FT                   YIVRHILTASQFDNFGWRIPFLLGFFILFAAFYIKKHTDETPNFKNLREQKKILQSPLE
FT                   KVITNHWFDILISIFINAPGSIIFYLTTIYLVSFLKISRNFTEDEVNSLASVCYVIMIA
FT                   VTLLSGYLSDIIGRRKIFVINLVIIIVMTPFLLNNFKNGDFTSIIISQFILAVLAASYI
FT                   GPEPALQAEFYHANIRNTALSISYNTATSIFGGTTPLVFEYLVQKTGHVTSAVYYIILS
FT                   CIFALIALSFYKNRSLDKMQS"
FT   gene            87085..87159
FT                   /locus_tag="A1E_t05686"
FT   tRNA            87085..87159
FT                   /locus_tag="A1E_t05686"
FT                   /product="tRNA-Thr"
FT   gene            87321..87623
FT                   /locus_tag="A1E_00395"
FT   CDS_pept        87321..87623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00395"
FT                   /product="protein-export membrane protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00395"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73029"
FT                   /db_xref="GOA:A8EXE6"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXE6"
FT                   /protein_id="ABV73029.1"
FT                   /translation="MIDILLFVHITIAILLIIVILMQRSGSDGISSISGGNNMGVVSAK
FT                   TVSNFLTKSTVILMILFLINAIVLANLSSKKKSDLVSKINEIEENQTENSLPIAK"
FT   gene            87913..88575
FT                   /locus_tag="A1E_00400"
FT   CDS_pept        87913..88575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73030"
FT                   /db_xref="GOA:A8EXE7"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXE7"
FT                   /protein_id="ABV73030.1"
FT                   /translation="MSIEFNIKEKIYIILCTFFTVLIIVGNLIYQKFISLNIFNFYILE
FT                   LSVGTILYPLTFLFTDLITEFYSKERANFCVKLAIIFNIIVVLIISLMDKLEATNWSNV
FT                   DNITFHKVFGSYHISFLASTFACYIAQLLDINIYLWIRKITKGKYLWIRNNFSTAISLF
FT                   IDTFIVIGIMSLFNIIPLKQLDYLVLNSYSFKLFFTIFSTPIFYAGVCLISLFFKKG"
FT   gene            complement(88817..94246)
FT                   /gene="secG"
FT                   /locus_tag="A1E_00405"
FT   CDS_pept        complement(88817..94246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="A1E_00405"
FT                   /product="preprotein translocase subunit SecG"
FT                   /note="COG1738 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00405"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73031"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXE8"
FT                   /protein_id="ABV73031.1"
FT                   /translation="MNAQSFNSKKYALAFFMSTYLLAISFLSTSARAASFTQLANKTPA
FT                   LSHLSEAQRKNQWNQYSLVTKQAAWKAAKLVPDLNQAILDVQNGFDPKLLSDSNTNIRH
FT                   KAREKNADITLYIAQIAQPDYDKKFNEYINRGVIPTPEEVGENLGIVYDPRKTNSTIET
FT                   DQKVRRAEKDKKAIIDRYIDLVKIALVEKDYTTTGMVPELEELTKKLNIDKAKAKLRRT
FT                   AIRDQVMKNKKAEIITIGKIPTQETLHKLFGKDRESNDTKYINDIRMHVMHNKKQHYVD
FT                   TNHIPNTHEIMKEFNIDKGHAKLYLKQIKAETEVKHQADNKQNTTKPFTKHSRTTTDTE
FT                   EKFSQFPFDTLKKEKQPYSFDPRSTLERLLKGKGNNNFTQSQQNIYKIIQQEANIEEFK
FT                   HLIKTEPIAALNLEVDSSYKKEAVNAILSDFNNDTIQKILFSDDKGKLNFNTNIDVEHK
FT                   PILKELFKNSSEEQRKKIIENISKYAKENIIPLVFKGEVRHDKLSDLLKLAAITDKSIV
FT                   KKVLMLQLELKNNVHSYTAQGNGISPEGIKVINAILRKYHVTEKDLSSSEMIKLANSFH
FT                   SQGFEDSIKIMSFSEQELNTQIYNLFGLSIQNKTHGNGNMPPLLPPPPPPLPPLFGNPY
FT                   LDKLKSTPKLYDLYNQFIQNNKSKNKKTTENITKSNTPKRSEPKTEYAKLYKQYRAETG
FT                   GKKADDLQDQLIKKQSDITNVIRQILTASYAEQGINTEDLITLFGNPNPEVTEKAKEVF
FT                   VILVQDPYIQDITVNGKKTITSEAILQNLFNEDADDAVERILLSSCKISEALKKPIEHE
FT                   LNKSKLMRELESKQNPFEQLKFAYEKAAILGQTFDTKLAELIKNPAILTTQEQINFLTQ
FT                   ENNKLKKVIHSDQAQAKLDNLRTAILSTIKFEELTTANLSQNDFIAIVKEKDPELLKEF
FT                   LKATIIKHESNNNLDQLRLALPSFTGMSDQQVRILSSKLNMYVILKALQKYEQEESKNH
FT                   THTSNMPPPPPPPPGSKILQITYLKNLGITEDWINRITKLNENINTHTSKTVPQVYDFN
FT                   SDIALRYNGFALSGQKSAGHKAKYSDADLLQKAIIESIVLEHSKNVSEVNQNTQYFEKM
FT                   QEAVSTMKSSFIGPRTEIGQEIHNIYTSKLLELTKDKEFIRYVEDNVKPSKKRTDALIA
FT                   AFTSVNSDFIGPITEDIHNIFTQQMTKYTEEEVREAFNTANSDFIGPRTEIGQEVHNIY
FT                   NSKLLELTKDKELLLFVEELLTESTNLEQKYGSNVQPENKGKKESLVDKMKKRLQQENK
FT                   VKNDKSSIESNTKYEDNDDNNKKLELSDSKTTVSQMLSNSNDSKNDKSLTESDTKYEDN
FT                   DDNNKKLELSDSKTTVSQMLSDSNDSKNDKSLTESDTKYEDNDDNNKKLELSDSKTTVS
FT                   QMLSDSNDSKNDKSSDDKKSLLALRSSDEEDEGYETDEKELEESNNTTEEEFKKDIPLE
FT                   SEDKTINMSLETEEIARQDEAVLKEQISKETNNKVAILVKATSTLNKYIHPSILANRLN
FT                   IGIIAAGDEEASINRGLWISGLYGINKQSAWKNIPKYQGRTTGITIGTDAEFINSHDVI
FT                   GIAYSRLNSQVKYNKKLGKTAINGHLLSIYGQKELIKGFTLQAITTYSHNYIKNKSIST
FT                   NNIIGKYQNNNVSFESLLNYKYRTKYDLYLIPNISLKYDYSRASNYKEYNVDIENLMIQ
FT                   KKSNQSFESSLGGKIVFKPIATISNIVLTPSLYGNIEYHFNNKNTKVNAKATFKGQALQ
FT                   EIIILPKQPKLGYNIGSNILMSRKNINVLLEYNYYTHKKYQSHQGLVKLKVNL"
FT   gene            94415..95794
FT                   /gene="cysS"
FT                   /locus_tag="A1E_00410"
FT   CDS_pept        94415..95794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="A1E_00410"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="COG0215 Cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73032"
FT                   /db_xref="GOA:A8EXE9"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXE9"
FT                   /protein_id="ABV73032.1"
FT                   /translation="MQIQFHLYNTLTRTKELFRPQDQANVKMYVCGPTVYDNPHIGNSR
FT                   SAAVYDLLYRILIKIFGSTAVKYIRNITDVDDKIIDRAELLGSTINELTDKVTQEFHIN
FT                   MEYLGCKLPSIEPKATEHIDIMIEIIERLIAKKHAYIADKHVYFNVLSAPNYTELSNRN
FT                   LEEMFEGVRVENSKTKKHPQDFVLWKPAKPNESANMNFDSPWGLGRPGWHIECSAMSYK
FT                   YLGENFDIHGGGADLIFPHHTNEIAQSRCAFPSSTYAKYWVHHGFLTVNGEKMSKSLGN
FT                   FITVRDLMDKEISGEVIRLFLLSSHYRRPLDYNDKAIEDAKKTLDYWYRAIVNINLQKI
FT                   DIIPNDFMQSLLDDMNTPLAVKIINDYARGVFTSTTEEEKKFNASNLITCANFIGLMNK
FT                   TPHEWFNSGVNELYINELVNKRLEAKKQKNWLLADQIRNQLLEQQIVLEDKPDGTIWRK
FT                   G"
FT   gene            96094..96981
FT                   /gene="rpsB"
FT                   /locus_tag="A1E_00415"
FT   CDS_pept        96094..96981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="A1E_00415"
FT                   /product="30S ribosomal protein S2"
FT                   /note="COG0052 Ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00415"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73033"
FT                   /db_xref="GOA:A8EXF0"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXF0"
FT                   /protein_id="ABV73033.1"
FT                   /translation="MSKIPSVNIKELLDAGVHFGHKTSRWNPKMGSYIYGERDDVHIID
FT                   LRQSAVLMSVALNAIYETVKKDGKILFVSTKIQASDIIAEYAEKCGQYYVNHRWLGGML
FT                   TNWKTIAGSIEKLNKLEKTLGNEEALMGYTKKEILDMSRKKDKLLLSLAGIRNLNSKPD
FT                   LLVVIDTNKEHIAINEAVKLNVPIVAVVDTNSNPDNVDYPIPGNDDSIRSIRLYCSLFA
FT                   DAALQGLAESMKASGVDMGAIQEHTDKALTSKSVSKLKQTKKFSKMKNIDEETNTEFEQ
FT                   ALNDADKNKNSENA"
FT   gene            97003..97932
FT                   /gene="tsf"
FT                   /locus_tag="A1E_00420"
FT   CDS_pept        97003..97932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="A1E_00420"
FT                   /product="elongation factor Ts"
FT                   /note="COG0264 Translation elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73034"
FT                   /db_xref="GOA:A8EXF1"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXF1"
FT                   /protein_id="ABV73034.1"
FT                   /translation="MSEVNISAVVVKALREKTGAGMMDCKNALIETRGNFEEAIDFLRK
FT                   KGLAAAVKKAGRITSEGLTAAKVEGLTGVVIEVNSETDFVARNEQFQDLVKNIVNLAVV
FT                   AKTIDKLKTSKMLNSKSVEEGIIENIATIGENLTLRRMDILEISEGAIGSYVHNEVVPN
FT                   LGKISVLVGLESKAKDKTKLEALAKQIAVHVAGNNPQSIDDSSLDQVLVERERKIFFEK
FT                   SKEEGKPYNIIEKMVEGRIRKFFSEVVLLQQGFLFEPRLTVAEVIKNTEKELGAEIKIT
FT                   KFIRYELGEGIEHEEKNFADEVTAITQG"
FT   gene            complement(98936..100189)
FT                   /locus_tag="A1E_00425"
FT   CDS_pept        complement(98936..100189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00425"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /note="COG1519 3-deoxy-D-manno-octulosonic-acid
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00425"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73035"
FT                   /db_xref="GOA:A8EXF2"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXF2"
FT                   /protein_id="ABV73035.1"
FT                   /translation="MMLLYYTLSFILLPVYFIIILIRLLIGKEDIKRIQERFAIGKHRQ
FT                   NSSFLVWIHAASIGESMTALTLIHNISKRYPDVRFLVTSWTQASAKILSTKLPKIATHQ
FT                   FLPIDNIIVTRKFLRNWQPNLGIFIESELWPCTINEGAKQCKLLLVNARISDKSFKAWQ
FT                   KRKSFFQLILKNFSKIIVQSERDLQKFNKLGVSDAINLGNIKFANEKLPVNQEELSKLS
FT                   LHLNNRRVVVFASTHMEDEELILPIIKSLKEQFLDCYVILIPRHPERVKSIIDNCKSHN
FT                   LSSTAKSQNDSPVLSDDLYIVDRFGEMGLFFSVATISFIGGSFKQGGHNILEAAYFSNC
FT                   IIFGPDMSKNTDIAKDILQHKAAIQIKNGEDLLTKLQYLLSSNNSLELKIYRENALKFV
FT                   ENNQKVLYEYLKVITKFL"
FT   gene            complement(100186..100842)
FT                   /locus_tag="A1E_00430"
FT   CDS_pept        complement(100186..100842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00430"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /note="COG2121 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73036"
FT                   /db_xref="GOA:A8EXF3"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXF3"
FT                   /protein_id="ABV73036.1"
FT                   /translation="MWKAFKKLLKRNRCVLSIITILLYWYLRFVYLTSRQKFIFYDNGN
FT                   KAKFLNEQGVIFVFWHNMLALSPAMFIGHRNIYALISPHLDGEILNNLVGKFGCRVIVG
FT                   STNKNPIAALRNIIGNLSQGANIIVTPDGPKGPVYKVNSRITEIAYRYNKKVIPIISST
FT                   SKCFRLNSWDKLIIPLPFGTIKIIVGSPLELTNDKIQNHINLEKQLASLTESLKE"
FT   gene            complement(100917..102137)
FT                   /locus_tag="A1E_00435"
FT   CDS_pept        complement(100917..102137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00435"
FT                   /product="aspartate aminotransferase"
FT                   /note="COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00435"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73037"
FT                   /db_xref="GOA:A8EXF4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXF4"
FT                   /protein_id="ABV73037.1"
FT                   /translation="MSIISTRLNSIKPSPTLAIVKKTLELKRLGIDIIALGAGEPDFDT
FT                   PDNIKEAAIKAIKDGFTKYTNVDGMLTLKQAIKDKFKRENNIDYELDEIIVSAGGKQVI
FT                   YNLFMASLDKGDEVIIPAPYWVSYPDMVALSLGTPVFVNCGIENNFKLSAEALEPLITD
FT                   KTKWLIINSPNNPTGASYNFEELENIAKVLRKYSHVNVMSDDIYEHITFDDFKFYTLAQ
FT                   IAPDLKERIFTVNGVSKAYSMTGWRIGYGVGSKALIKAMTIIQSQNTSNPCSISQMAAI
FT                   EALNGPQDYIETNALSFQQKRDLALSILKRVKYFECYKPEGAFYLFIKCDKIFGHKTKL
FT                   AKIITNSNDFAEYLLEEAKVAVVPGIAFGLEGYFRISYATSMTELEEACLRIERAINVI
FT                   PTNTGIQ"
FT   gene            102411..103418
FT                   /locus_tag="A1E_00440"
FT   CDS_pept        102411..103418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00440"
FT                   /product="hypothetical protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73038"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXF5"
FT                   /protein_id="ABV73038.1"
FT                   /translation="MLGKIKDKIKHDCLIIMDIPNFIKNKILEFKNYISDCKYKFSHIA
FT                   ETNYQLGLDHLYRGNLNDALLRFKLVDKFFNPNNSKVYYQLGLVYFLKNNYRQAIEYLE
FT                   KSNEKYKTVFINFLKNYNDITEIPQEIWVQYRDLTAKYYPTIFNNDKNINLPYRFVNEA
FT                   LKQISDVPDNYSILELGSNIGLVGYEIQKHFPESFTLTGVEISALMNALQETYYPNTKI
FT                   YDQIYNISINKFLSQNSNKFDIIFNFCGLSFTNNLVEYFNLIYSSLSKQGYFALCLPTS
FT                   VKTQFSVKRKEFIFNLNEINNFLQKNNFTIFTSEEIILAEHNKYSIIVCCKKTT"
FT   gene            103393..104178
FT                   /locus_tag="A1E_00445"
FT   CDS_pept        103393..104178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00445"
FT                   /product="vacJ lipoprotein precursor"
FT                   /note="COG2853 Surface lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73039"
FT                   /db_xref="GOA:A8EXF6"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXF6"
FT                   /protein_id="ABV73039.1"
FT                   /translation="MFVVRKQHKSMRILIILSIILCSLFARADLEYVDNDIYNYNGGRN
FT                   EKGCLEVYDPYEKFNRKVFAFNSALDYIILRPLAVGYKNITNDYVKARVNSLVSNIDTL
FT                   LTAVNYGLQLNYDKTMKSVWRFLINTTLGIGGLFDVAGKVGLPSDRQTFGNTLAHYGVA
FT                   PGPYLVLPIIGSTNARDMTDLIFTNYVLNPLMYYTRNDFELGVLVVSKINNRCVVLPFS
FT                   DYVMKNSTDPYVAIRSALHRAREASVQYPENFKCPKPKN"
FT   gene            104204..104794
FT                   /locus_tag="A1E_00450"
FT   CDS_pept        104204..104794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00450"
FT                   /product="aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /note="COG2854 ABC-type transport system involved in
FT                   resistance to organic solvents, auxiliary component"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73040"
FT                   /db_xref="GOA:A8EXF7"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXF7"
FT                   /protein_id="ABV73040.1"
FT                   /translation="MITGLFLLVITFSAYSNEKVPAGLNDYITNLVNEASITLNNSSLS
FT                   QEAKISKARELIYNNLDFNWMARYTLGRNGVKTLSNEQIREFIKIYSKYVTKAYTDLIK
FT                   DYKGAKPKIVGVRALNSTDFMVAMNIISNKGQDPIKVEYLIREMKKDGKGFFKVSDIIT
FT                   EGVSLIGAQQDEFINTLKNEGFDQLIQNLQSRS"
FT   gene            105806..106873
FT                   /locus_tag="A1E_00455"
FT   CDS_pept        105806..106873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00455"
FT                   /product="alanine racemase"
FT                   /note="COG0787 Alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73041"
FT                   /db_xref="GOA:A8EXF8"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXF8"
FT                   /protein_id="ABV73041.1"
FT                   /translation="MSLCTLAINLSAIKNNYFLLQDICKTSLVGAVVKADGYGLGAVQI
FT                   SKALIEENCRHFFVASSEEGVNVRKALGIDVNILVLNGVFEHDALELIEYNLIPILNNL
FT                   KQIEIWQQFGNLKNLLLPCYLHFNTGINRLGLSSNEIEQLINNRDLLKGLNLQYIISHL
FT                   AISEEIDNPYNLEQLNKFKAYLRYFPSIKASLANSGGIFLGQDYHFDLVRPGAALYGLN
FT                   PLMQNPVTLKAPIIHLQNLTLDSHIGYNMTFTTKRDSVIATLPLGYADGYSRNFSNQGK
FT                   VFINGRSVPIVGRVSMDLINIDVTDLPPSDIFLGQEVEIIGNHCTPDKIASIIGTIGYE
FT                   VLTSLGNRYRRKYTR"
FT   gene            107108..107887
FT                   /locus_tag="A1E_00460"
FT   CDS_pept        107108..107887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00460"
FT                   /product="ABC transporter permease protein"
FT                   /note="COG0767 ABC-type transport system involved in
FT                   resistance to organic solvents, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73042"
FT                   /db_xref="GOA:A8EXF9"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXF9"
FT                   /protein_id="ABV73042.1"
FT                   /translation="MLLNIANAVGKRTIKFAQNIGSFSLFSFAAVSSIIRPPLYFSLII
FT                   RQLLFIGFYSLPVVTMTTFFSGAVLALQSYNGFSRFSAESSIATVVVLSLTRELGPVLV
FT                   GLMVAGRVGASIAAEIATMRVTEQVDALYTLSTDPIKYLVFPRVITAMLTMPCLVLIGD
FT                   VIGVMGGYLVGVYKLGFNSTAYLTSTFQYLEPIDVISGLVKAGVFGFIISIISCYSGYY
FT                   SGKGAKGVGRATTSAVVNSSILILISNYLITELFFKV"
FT   gene            107890..108651
FT                   /locus_tag="A1E_00465"
FT   CDS_pept        107890..108651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00465"
FT                   /product="Ribonucleotide ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00465"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73043"
FT                   /db_xref="GOA:A8EXG0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXG0"
FT                   /protein_id="ABV73043.1"
FT                   /translation="MSTKEEFKIKIRSLYKSFANHKVLDGIDLDVKNGSSLVILGGSGS
FT                   GKSVLIKNIVGLIKPDKGKIFINNVEIQDISSKRKFEIMDSIGFLFQGGALFDSLNVRD
FT                   NITFETKKLSKKEKNDLAGAKLNSVGLSPRILDLYPSELSGGMQKRVALARAICSTPSI
FT                   LFLDEPTTGLDPIMANVINELIIKIQEELGATMITITHDMIHAKKIAKEVAMIYQGKIK
FT                   WYGSKDEMCNSDNPYLKQFINGLTTGPIDFN"
FT   gene            108694..108942
FT                   /gene="alr"
FT                   /locus_tag="A1E_00470"
FT   CDS_pept        108694..108942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="A1E_00470"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="COG1127 ABC-type transport system involved in
FT                   resistance to organic solvents, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73044"
FT                   /db_xref="GOA:A8EXG1"
FT                   /db_xref="InterPro:IPR035116"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXG1"
FT                   /protein_id="ABV73044.1"
FT                   /translation="MLRNLLCVIIFLGINLNVYSVNNSSYKADDIIKIVIILGIIILIF
FT                   SPAKFRIVVIGTILGLTFAYFTYKYIVPIFISLLNGP"
FT   gene            109015..109308
FT                   /gene="rpmB"
FT                   /locus_tag="A1E_00475"
FT   CDS_pept        109015..109308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="A1E_00475"
FT                   /product="50S ribosomal protein L28"
FT                   /note="COG0227 Ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00475"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73045"
FT                   /db_xref="GOA:A8EXG2"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXG2"
FT                   /protein_id="ABV73045.1"
FT                   /translation="MSRKCDLTGVGVLYGNNVSHSQRKTRRRFEPNLRSVKFKSDITSG
FT                   AYRLLVNARCISSVEKAGGFDAYILKADDNVLSSAARAIKKKIIQTKTAKSL"
FT   gene            109305..109541
FT                   /locus_tag="A1E_00480"
FT   CDS_pept        109305..109541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00480"
FT                   /product="50S ribosomal protein L31"
FT                   /note="COG0254 Ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73046"
FT                   /db_xref="GOA:A8EXG3"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXG3"
FT                   /protein_id="ABV73046.1"
FT                   /translation="MKSGIHPEYKKLLIKVGSDVFKTMSTHPTGEILMDVDFRKHPAWN
FT                   KDSGNVVNQSNKSVSDFNKRFSGLSFGSKKGAS"
FT   gene            109832..109908
FT                   /locus_tag="A1E_t05688"
FT   tRNA            109832..109908
FT                   /locus_tag="A1E_t05688"
FT                   /product="tRNA-Met"
FT   gene            110321..110980
FT                   /locus_tag="A1E_00485"
FT   CDS_pept        110321..110980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00485"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73047"
FT                   /db_xref="GOA:A8EXG4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXG4"
FT                   /protein_id="ABV73047.1"
FT                   /translation="MTNNEKVINNKKSTDSSKLFRYQAKFVAGAMNINQIPNFLLPEIA
FT                   FIGKSNVGKSSLINTICNNKNLAKVSNIPGRTGQINFFNLADKLIIVDLPGYGFANVPI
FT                   SVKEQWEVLISYYLRNSNNLRLVNLLIDSRRGIKENDKKVAELLLKNKRSFQIIFTKFD
FT                   KVTDCKNLTDEAQNFLTTLHYSCNVMYVSSRSKEGARELKASLAKCIIKPQRSKGR"
FT   gene            111131..111256
FT                   /locus_tag="A1E_00490"
FT   CDS_pept        111131..111256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00490"
FT                   /product="Acetylglutamate kinase"
FT                   /note="COG0218 Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73048"
FT                   /db_xref="GOA:A8EXG5"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXG5"
FT                   /protein_id="ABV73048.1"
FT                   /translation="MCSPKYIVRDHINLRSSSLISQIDENFSQKISKISDFWYFR"
FT   gene            111737..112024
FT                   /locus_tag="A1E_00495"
FT   CDS_pept        111737..112024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00495"
FT                   /product="Type IV secretory pathway, VirB3-like protein"
FT                   /note="COG3702 Type IV secretory pathway, VirB3 components"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73049"
FT                   /db_xref="GOA:A8EXG6"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXG6"
FT                   /protein_id="ABV73049.1"
FT                   /translation="MAGALASDLLFVGLTRPPMIFGVSIKFAALNMIMTMIFFIWNNGI
FT                   MILFIATALHLIAYIICFKEPRFIELYLNKMSRTSQCPNKFYYRANSYGI"
FT   gene            112279..114696
FT                   /locus_tag="A1E_00500"
FT   CDS_pept        112279..114696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00500"
FT                   /product="Type IV secretion/conjugal transfer ATPase, VirB4
FT                   family protein"
FT                   /note="COG3451 Type IV secretory pathway, VirB4 components"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73050"
FT                   /db_xref="GOA:A8EXG7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004346"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXG7"
FT                   /protein_id="ABV73050.1"
FT                   /translation="MKLFRTRAAKEFRSKQERPTSHFIPYKCHWDSNTILTKDNSLLQV
FT                   IKINGFSFETADDEDLDIKKNIRNALLKNMSSGNIVMYFHTIRRRKAVIFDDTEFTYDP
FT                   TVKVPNDFITYLGVEWRKKHAGSKSFFNELYISILYKPDTGGAAIVEYFLKKLRQKSNK
FT                   IAWENDMKEMKENLQEMSTRVINTFRSYGARLLGVRQTPSGNYCEILEFLSSLVNCGDS
FT                   PGPIALPRGTIDEYLPTHRLFFDSRTIEARSPLGKKYAGIISILEYGPNTSAGIFDGFL
FT                   QMPFEFVMTQSFVFANRTVAIGKMQLQQNRMIQAGDKATSQIVEISTALDMATSGDIGF
FT                   GEHHLSLLCSANSIKALEDILSMASVELSNSGIQPVREKVNMEPSYWGQLPGNMEYIVR
FT                   KSTINTLNMASFASQHNYPLGKIKDNHWGEYVTVLDTTSGTPFYFNFHVRDVGHTLIIG
FT                   PTGAGKTVLMNFLCAEAQKFKPRMFFFDKDRGAEIFIRALNGVYTVIDPGLKCNFNPLQ
FT                   LEDTSENRTFILEWLRVLVTSNGESLTAQDNKILSQAVSGNFRLERKDRRLSNVIAFLG
FT                   IDTPNSLASRIAMWVGKGSHAKIFDNEIDDIDLQKARVFGFDMTELLKDPISLAPVLLY
FT                   IFHRINISLDGQKTMIVLDEAWALIDNPVFAPKIKDWLKVLRKLNTFVIFATQSVEDAA
FT                   KSRISDTLIQQTATQIFLPNLKATDIYRSAFMLSQREYILIKTTDPTTRYFLIKQGVDA
FT                   VVAKVNLDGMNNIISVLSGRVETVILLDQIREKYGNDPDKWLPIFYEAVKTL"
FT   gene            114838..118152
FT                   /locus_tag="A1E_00505"
FT   CDS_pept        114838..118152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00505"
FT                   /product="TrbL/VirB6 plasmid Conjugative transfer protein"
FT                   /note="COG3704 Type IV secretory pathway, VirB6 components"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00505"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73051"
FT                   /db_xref="GOA:A8EXG8"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXG8"
FT                   /protein_id="ABV73051.1"
FT                   /translation="MQLFPRSIIITLVISFVINLGLVTKTHAKDTLDSIIDVLSGLTCE
FT                   TQGVGDLLRSEFSHTCIVAPFFTFAVMNLVSPVLYMNTFLKLKINDNDLFSKNEHDDFG
FT                   YFPGGQCTRENRIDPNKPELRFALCSNAKLIVARAEAVAKSALAIAKAVLTGSDPWDDI
FT                   KEAWKNNKKDYYVPYSGKPGDDGFAFDVGFPVIYWKVIQDKDRICVSTKGFTGDVPVGC
FT                   KYMKEPFPKSMYNSFMDVGDKDLIENTNKTPTDPLALVSCSSAGGGCYQKAYNASKTAV
FT                   VMTSPLIECIRQMIARLLISKDVCSFDNVSQVINLASRQDSALFQFQVRMYKIVAAFLT
FT                   LYVMFFGFKLLLAGEVPPKSEYINFILKMIFVTYFSIGINITPGSGSPYDRLDGMIQWA
FT                   FPFLLDGINALASWVMNAAPSNLCKFNGPGISYDGSVSYIALWDALDCRVAHYLGLDIL
FT                   STLLVENAYRSHDFLNFDFFSFSAPPYIYLLIPAIISGNMMLVSLALAYPLLVISVAAF
FT                   MVNATIMCMISIVILGILAPLFVPMFLFTYTRNYFDSWVKLMISFLLQPMVVVTFMITM
FT                   FSVYDYGFYGKCQYKSKLIHNSIENLAQGSTSSRDVLIFYINNDWNDKSQYPTDEDVES
FT                   CQNSLGYMLNNPITTAFNFTKNSVSEIVGSKSGDTSTDKFLAKFQFLSGVILGPGMFFM
FT                   SPKVVFEKIKNILLALVTACFTLYLMYHVSSQLAEFAADMTEGVALNNVAIKPQAIFKA
FT                   AMALSATVAGAATKGLDQVASRRGGVSDLAGGLGGGVRDNVAASGGVSAPKVMQTTLSS
FT                   VATASPKTVSSEARSDVVTTTPASPEVVSLPSSIRSAISISEPQSNIKSESAGKIISDN
FT                   NQESKKEIDNTPPLQEKVDNASKGSGVSDLAGGLGGGVRDNVAASGGVSAPKVMQTTLS
FT                   SVATASPKTVSSEARSDVVTTTPASPEVVSLPSSIRSAISISEPQSNIKSESAGKIISD
FT                   NNQESKKEIDNTPPLQEKVDNASKGSGVIDYSFNLKEHDNPTGVKQIRENAEIRDKRAE
FT                   VEKAWNELVASGGGRIRDQQGEEISERRANAEKVWDELVKNGVVTEKKDNSSNENS"
FT   gene            118139..120157
FT                   /locus_tag="A1E_00510"
FT   CDS_pept        118139..120157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00510"
FT                   /product="TrbL/VirB6 plasmid Conjugative transfer protein"
FT                   /note="COG3704 Type IV secretory pathway, VirB6 components"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73052"
FT                   /db_xref="GOA:A8EXG9"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXG9"
FT                   /protein_id="ABV73052.1"
FT                   /translation="MKTLKTLKIFIMVCIASVSLASFAGFGESCSSLPATSDKYLETDT
FT                   AYGYIIRNIDMKDPRGNCDSAVPGITFCFKNIEGSSSPCTMYTLNEGDSKKISDLSTDN
FT                   NPDLGANPVLQNIVLTVKKLDNDLCLIMPTSRGPMPVACKSLSANPPPNPSDYENCNIG
FT                   KNCYTGASYSQSLINFSGLAVQCLSETLNKIFFVGNSCSSQDQNSRITNLAAFSTFQGY
FT                   LKRTIGAALILYIMFFAFNMALNKEYASTEKIALFIIKFLFVAYFSIGLGPLDFSSGQP
FT                   TKENGMLKYGLPLLTGAAPDFAQMIFNAAGARGLCQFDNSKYKDGYKFYGLWDAIDCRI
FT                   GYYLGLDLLYNIDKNRVLGRSVGNGPSGNNEKIPNLGNPDKNSPNDLSKAGSLRFFTVM
FT                   FGFFMAGNVIIFAAGLVFSVIFLSILLYFITHYLVCMVTIYVMTYVSPIFIPMALFTRT
FT                   KAYFDGWLKVCISCTLQPSVIAGFIALLITMYDSAIFKNCEFLRHDYEKGDIRFSTFEL
FT                   RLPISAADKCQESFGYKMLQYYAGEGWEEHLLILFPIKSIVRDVVSILAELLYVLVFSV
FT                   IFYYFSKSIGRFAADLTNGPNMDAVNARSTKIVDLVKKGAAFLKDAAIASQGKPLVGHK
FT                   LSGGSRRKGRVQSDDTLGSHGRSSDNAKDALSTSRGK"
FT   gene            120164..123070
FT                   /locus_tag="A1E_00515"
FT   CDS_pept        120164..123070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00515"
FT                   /product="VirB6-like protein of the type IV secretion
FT                   system"
FT                   /note="COG3704 Type IV secretory pathway, VirB6 components"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00515"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73053"
FT                   /db_xref="GOA:A8EXH0"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXH0"
FT                   /protein_id="ABV73053.1"
FT                   /translation="MQSNLLKVLGVLAIVATLVCFIFAALGMIGAVKIGNGCYMRYDAD
FT                   GKGGRDSITDTITLNANANYVYTSKMLSDGTTRLIPDPTRYGEWLNTKVLVENSQSVNL
FT                   QVVGQVSLCLAYIPQDNVQRTGPGSNLDDNGKMIPIPRVTDSNIPPISLIMDAKNSEWR
FT                   NIAELYANDRVLVSISPNFIGTEATVNDAFKGTAVTTDCSQGKTSYEPICGKYSFYSGQ
FT                   YVNACELKQNYWQGNQHREPCHCVFGCIYQEAVAKWVCDSANAASHCCLSLVCDSLPAW
FT                   INHYGTMPESYKDDGSFTFSWSDNLGNLFIDYSNLQCSNNANILPNGKCPDVVSNRSPK
FT                   DKDYIGGVHCTSGICNDGDFQKHRRFWYTADGKGGKGPTGLIYQMNDTGSVSQALPSNL
FT                   EFAKFVADSDQLPEYKDKDGKYIYKVIYNIPFNSNIEKSYLQYRLWSPTSQDASKNTGG
FT                   YVLNIKQTKCYRENGNSFNDTFNDRGRVQYIIVAGSENPNTSGKSYSPQGINVDSDGKA
FT                   NIIANGDGYIWMRILNDSNDYKDSDGNYKVHFSTFLKVGSFTVKVMNPLLQLFKTKVQG
FT                   AATSIFRNMVCYKASDSSSCTNFFTYIKAILILYVMTYGAMFLLGFTKINQKELVIRIA
FT                   KIGVVSGLINGNTFEFFNSYLFDVITGFSDAIIANMSGYSLFTSTNTISNPFMFLDAVM
FT                   SKIFFSQTFIAQLLALLSLGLSGIIYFIITFIALGIVIVTALRAMAVYIMAFMVTCILI
FT                   GIAPLFISFLLFDFTRYLFDNWVRFTIRYMIEPVIMMAGIIVLTQLFTIYLDFVLGYSV
FT                   CWKCALPIKIPFIGTILPIALLNVPIFCINWFAPWGMDYMSGMMGVNMQNIVALVIIAY
FT                   GMYGYVEFSGRMVVKLTSAAGPSATGMGEAMYNVAEQKTLSQVGMDAETRKGITGRAES
FT                   RLKQRNKTLDQAEKNRKHTPQEGGEKTNEEPPKPETLK"
FT   gene            123077..125743
FT                   /locus_tag="A1E_00520"
FT   CDS_pept        123077..125743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00520"
FT                   /product="hypothetical protein"
FT                   /note="COG3704 Type IV secretory pathway, VirB6 components"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73054"
FT                   /db_xref="GOA:A8EXH1"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXH1"
FT                   /protein_id="ABV73054.1"
FT                   /translation="MMKILKSLVVLVLFMTVPAKAVDTFSWMSTSFSGLKSLFGCLEVP
FT                   EFTSFQEGNIGISLSTAGTWQSTGNAVKKGKLLKINWSTSGITPEPRKYLVLYRIDPRF
FT                   STPQVFIKTYNYTKLQFEALGFPRFVTGNNGAIPPDKDLDALSFTKMSDSVKYFNYSNG
FT                   HSRIQVNAGDVVNISLVSKDKFFSPNTPKLPNTVDNILTQELDSSVFAASALYTQSNLG
FT                   NFDNRIIYLSAEQVCNMIDASRTSVCRGTGTATKYKNTDNGVIVGKPMRTGAVEHFMGL
FT                   INSCPANAGIDTSPACYYDQGRGMIIKVGRQVIKGRDQRFVNSGSTHSSFIYYQATSGG
FT                   TMDFTSDWSSTGMFDKSVLMSDWSRNYSGDYNRFVNDINKNDWSANFLYFGRYVMIVEI
FT                   GNGTNSISPGDHQNIKLEYLITPNGTLPDSSVRGMPVDYNFATDALQDGYLWLRVVNPN
FT                   SNIQGVVSVNYANYTGTTWFSDIVYYGVIKPITDQFRTFSQNFYIKLVKNSAVQNIAKA
FT                   ALTLYVTIFGLMFVAGALKLTAVEVITRICKIAIVAFLLREESWDFFNTYFFSVFTNAI
FT                   DFFVTNVVGATSSRSNIFGFIDPIFDKYTNGRIWGLLFIELLQIHNGLAFISVITIYSL
FT                   ITYFRAILEVIIGYVIAFVGVTVMISLAPFFIILMLFEKTKSLFDNWISILLSYVVQPT
FT                   ILLIFFLLIDQVLSEQLLKVVVRACWDTLIPIKIGLDLTHLGIPINFSFTLPFLPGIPF
FT                   FVPDVPEISSSNILTNNANTFLVLFTTALLFYSYCLMSYGLVTFVNVVVGMLTNVTPAR
FT                   ISGNYQERSDPVGAIMHDIDSVTKPIKKTTIVPARVFKDKIIDQNYKARKPEGGGEYTN
FT                   KFLAERNDRKKEEEVRK"
FT   gene            125852..129292
FT                   /locus_tag="A1E_00525"
FT   CDS_pept        125852..129292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00525"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73055"
FT                   /db_xref="GOA:A8EXH2"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXH2"
FT                   /protein_id="ABV73055.1"
FT                   /translation="MNKNIFITLLISLLLLSSCTGDTCIDPDDFGFIKFNISSRYDLEE
FT                   ITSRQEGDQVAPWRNSAYKVNGYPLTVMVRPWSYILGDKNTSGQLSAWCPWYGQKNDTT
FT                   TLAALCVKLQPCLFIDNDMCRPSPINQNDAAIYNAPCIMTNGVGLYFLIAAKNTDPNIS
FT                   PDSQRKPQGITQHLGEPPPNNDYAFYSISSTGQFLKAGGINYQYKGEDKSKYAQCPLYF
FT                   KIIDKFYNDNSGQYRLVIKSGISDTRPDPLQFLTNLIKKVLFGTSDQDHGIVRKVYTQI
FT                   IDTSGYRMSVSAILTLYIMFTGFSFLIGNINLTHVELIIRILKVSIVSILLSTDKAWTF
FT                   FHDYLFVFFIDGVQQILQIINEASANGPGSQTLLGLLIAPQTLSKLFSLLFVDWLGFIY
FT                   IILYFIALYFIFLLIFKATIIYLTALIIIGMIITMGPIFICFMLFNITRSLFENWLRQL
FT                   ISYAIQPLILFAGIAFISMIIRTEIYSTLGFAVCKHDFPNLGPINEIFGSFLEDIDPSL
FT                   GNSIFYWWFPVPMKGGINNFHKAKILVPEDHIRDDGKHCAAYECIDERYIELPFLDLVK
FT                   DAKRISNFINGKFVQLDGILLIFVSIYLLSKFNDIAISTAAFIAGTSGNLTDIQKVNQQ
FT                   SASLATKQMNRPLNYVAKTLSAPVTTRVSAKLEETSMFFAAKFENMMMRRLENQALGSA
FT                   ANKAVQNEVKRKYGIDSKDVKMNAITDYENSISGLLENLPKGNELKAKELSQMKFTQLR
FT                   DKIAENKYGVKDYDSLSKEQKTELDKLLKDANLRELASDANFTRDYQKAYKDAHQDMSG
FT                   RGIGLFGKNIGVLRSWQEMQHRVKSKRALKEQKRVGIGEKIYAGYTGITRAALTAIVGK
FT                   DLRDAYEGNLTSAEWHDFEYNDPRLRTYSEKLKDEEKVREFQELQMHINKETLAAQADV
FT                   LSPEYLARLEQTGRQSDVEYYQELAQRKLIHEVRSRLSEEDDPVMMGDRFMREKATDSQ
FT                   MRDMIDNAHRKYVQFIDEDRYIRRQEYYDIMHEKAQENLEQTYKELKDHFKRDDIKLEE
FT                   MPVLIAQKFKDTDGGAEIDKKITEEINNFNANVNNYEYSTEVLNKIEDRKQVITDEVNA
FT                   QINQINKYRENAKMQTYVKPIVNKGRKLRKLEDHLRNMK"
FT   gene            130793..130897
FT                   /locus_tag="A1E_00540"
FT   CDS_pept        130793..130897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00540"
FT                   /product="GTPase EngB"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73056"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXH3"
FT                   /protein_id="ABV73056.1"
FT                   /translation="MTSAMPTTIDIAALSKMADCGQITNAIVDGPLAL"
FT   gene            130964..131041
FT                   /locus_tag="A1E_00545"
FT   CDS_pept        130964..131041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00545"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73057"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXH4"
FT                   /protein_id="ABV73057.1"
FT                   /translation="MRAKQLKYLDQAVMTGIVLETRRLF"
FT   gene            132049..132165
FT                   /locus_tag="A1E_00550"
FT   CDS_pept        132049..132165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73058"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXH5"
FT                   /protein_id="ABV73058.1"
FT                   /translation="MMQKTKKTIISTKDSRIKVFAVLMNEELILAEEVMKFL"
FT   gene            132389..132664
FT                   /locus_tag="A1E_00555"
FT   CDS_pept        132389..132664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00555"
FT                   /product="hypothetical protein"
FT                   /note="COG0280 Phosphotransacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00555"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73059"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXH6"
FT                   /protein_id="ABV73059.1"
FT                   /translation="MKQQIIAEKASKDYNKVLEIDYKAAKAGIKLDKTAMRRLDKIIST
FT                   CFKQLRRKVILNNIKAIMLIERVNKKLKYLGVVQQLLLESKKKRKL"
FT   gene            132753..133415
FT                   /gene="trmD"
FT                   /locus_tag="A1E_00560"
FT   CDS_pept        132753..133415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="A1E_00560"
FT                   /product="tRNA (guanine-N(1)-)-methyltransferase"
FT                   /note="COG0336 tRNA-(guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73060"
FT                   /db_xref="GOA:A8EXH7"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXH7"
FT                   /protein_id="ABV73060.1"
FT                   /translation="MFPGTLGYSLAGQALHKNIWSYDIINIRDFGLTKHKNIDDAAYGG
FT                   GDGLIMRPDVLGNSIDHALSLNSNAKIYYPSPRGRVFTQSFAKEMIKTKNIIFLCGRYE
FT                   GIDERVIQEYSIMEISVGDYILSGGEIPTLTILDCLIRLLPGVLINQNTLSSESFEEDG
FT                   EFKGGLECGLYTRPEVWRGIKVPEILLSGNHKLINEWKREQSRMITKSRRPELLKDL"
FT   gene            133672..134088
FT                   /locus_tag="A1E_00565"
FT   CDS_pept        133672..134088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00565"
FT                   /product="50S ribosomal protein L19"
FT                   /note="COG0335 Ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00565"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73061"
FT                   /db_xref="GOA:A8EXH8"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXH8"
FT                   /protein_id="ABV73061.1"
FT                   /translation="MNIIDSFEQKNIAKLTANKNIPDFEAGDTVKVTVKIIDRSIEKDG
FT                   KEKLTERFQAYEGVVIAKRNRGITSSFLVRKISHGEGVERRFMTYSPIVHSIDVVKYGV
FT                   VRRAKLYYLRNRSGKSARIKERHIPIAKNQAVKA"
FT   gene            complement(134364..134600)
FT                   /gene="rplS"
FT                   /locus_tag="A1E_00570"
FT   CDS_pept        complement(134364..134600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="A1E_00570"
FT                   /product="50S ribosomal protein L19"
FT                   /note="COG3750 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73062"
FT                   /db_xref="InterPro:IPR018753"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXH9"
FT                   /protein_id="ABV73062.1"
FT                   /translation="MSEVVVKEQLEQYISKIERLEQEKADLLEEIKNIFQDASSHGFDV
FT                   KAMKSILKLKKLDKDKLAEQDAMLELYRDTLGI"
FT   gene            134672..135604
FT                   /locus_tag="A1E_00575"
FT   CDS_pept        134672..135604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00575"
FT                   /product="protein export protein SecF"
FT                   /note="COG0341 Preprotein translocase subunit SecF"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00575"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73063"
FT                   /db_xref="GOA:A8EXI0"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXI0"
FT                   /protein_id="ABV73063.1"
FT                   /translation="MQIYPLRLLPNKIDFDFMNFKKVSYTFSIILSLISVISIGIYKFN
FT                   FGIDFVGGIVIEVRLDQTPDLPKMRQILGELGIGEVVLQNFGSERDLSIRLGSSSEANL
FT                   MENIELIKASLHNNFPYKFEYRKVDFVGPQVGRQLIEAGTMAMLFSFLAIMVYIWVRFE
FT                   WYFGLGILIALMHDLILALGFMSMTKLDCNLSTIAAVLTIIGYSVNDSVVIYDRIRENL
FT                   RKYYKKNITEIINLSINETLSRTILTVITTLLANLALILFGGEAIRSFSVLVFFGIIAG
FT                   TYSSIFISAPILTMFANKKFNNKKFNNKR"
FT   gene            135718..136980
FT                   /locus_tag="A1E_00580"
FT   CDS_pept        135718..136980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00580"
FT                   /product="NADH dehydrogenase I chain F"
FT                   /note="COG1894 NADH:ubiquinone oxidoreductase, NADH-binding
FT                   (51 kD) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73064"
FT                   /db_xref="GOA:A8EXI1"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXI1"
FT                   /protein_id="ABV73064.1"
FT                   /translation="MLKEEDKIFINLHGQQSHDLKSSKKRGDWDNTKALLDKGRDFIIE
FT                   EVKQSGLRGRGGAGFSTGMKWSFMPKNSEKPCYLVVNADESEPGTCKDRDILRFEPHKL
FT                   IEGCLLASFAIGANNCYIYIRGEFYNEASNIQRALDEAYKDGLIGKNACGSGFDCNIYL
FT                   HCGAGAYICGEETALLESLEGKKGMPRLKPPFPASFGLYGCPTTINNVESIAVVPTILR
FT                   RGANWFASIGKPNNTGTKVFCISGHVNKPCNVEEVMGIPLKELIEKYAGGVQGGWNNLK
FT                   AIIPGGSSVPLIPKSICETVDMDFDSLRTAGSGLGTGGIIVMNQSTDIVYAIARLSKFY
FT                   MHESCGQCTPCREGTGWMWRVMMRLVKGNAKKSEIDQLLSVTKAIEGHTICALGDAAAW
FT                   PIQGLIRHFRDEIEERICHLM"
FT   gene            137144..137941
FT                   /gene="secF"
FT                   /locus_tag="A1E_00585"
FT   CDS_pept        137144..137941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="A1E_00585"
FT                   /product="preprotein translocase subunit SecF"
FT                   /note="COG0681 Signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00585"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73065"
FT                   /db_xref="GOA:A8EXI2"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXI2"
FT                   /protein_id="ABV73065.1"
FT                   /translation="MQIDTKTNTNKTTAQEWKSFAFVVCIALLIRILIMEPFTVPTGSM
FT                   KATILENDYIFSTKYSYGYSNYSLSFFDFIPLFKGRIFACEPERGDIVVFRPPNDMSVR
FT                   YIKRLIGLPGDKIQLIDDIIYINDKKIERTEVGTYISEEGRKYLKFKETLPNGRTYFSY
FT                   KLAPIFGVISDDRYGNTDVFYVPEGKYFFLGDNRDQSNDSRVNLGFVPFENFIAKAQFI
FT                   WFSTKITWWDNDIGVINLILKLKPWIESVRLNRIFRNLYNTDE"
FT   gene            137941..138624
FT                   /gene="rnc"
FT                   /locus_tag="A1E_00590"
FT   CDS_pept        137941..138624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="A1E_00590"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="COG0571 dsRNA-specific ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73066"
FT                   /db_xref="GOA:A8EXI3"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXI3"
FT                   /protein_id="ABV73066.1"
FT                   /translation="MSSFNELEKLLGYSFKNKELLIEALSHPSLRQHHEYKDNKDYERL
FT                   EFLGDAVLNLVITKILFSNFASYNEGNLAKIRSYLVCKETICMVGAKLALKDYIIMTYG
FT                   EEVAGGRDNPNNIENATEALIAAIYLDSNIETTHNIIGQLWAEFIKVQNLTDYDPKTAL
FT                   QEWAQASDHHLPIYCLIKREGAAHSSTFTVLVKVKDYEQIGIGYSIKEAEKNAARSLLH
FT                   RLKND"
FT   gene            138617..139504
FT                   /gene="era"
FT                   /locus_tag="A1E_00595"
FT   CDS_pept        138617..139504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="A1E_00595"
FT                   /product="GTP-binding protein Era"
FT                   /note="COG1159 GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00595"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73067"
FT                   /db_xref="GOA:A8EXI4"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXI4"
FT                   /protein_id="ABV73067.1"
FT                   /translation="MTKQIQKTVSVCIIGRPNSGKSTLLNRIIGEKLSIVTPKVQTTRS
FT                   IITGIITLKDTQVILYDTPGIFEPKGTLEKAMVRCAWSSLHSADLVMLIIDSLKPFDDV
FT                   THNILDKLCSLNIVPVFLLNKIEIESKYLNNLKAFLTENHPDSLLFPISALSGKNIDRL
FT                   LEYITSKAKIAPWLYAEDDITDLPMRFIAAEITREQLFLNLQQELPYKLTVQTEKWEEL
FT                   KDKSVKINQVIVVARESYKTIILGKNGSKIKEIGAKSRMQMEQFFSCPIHLFLFVKVRE
FT                   LWENNQEFYQYMKI"
FT   gene            139628..140170
FT                   /locus_tag="A1E_00600"
FT   CDS_pept        139628..140170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00600"
FT                   /product="Holliday junction resolvase"
FT                   /note="COG0817 Holliday junction resolvasome, endonuclease
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73068"
FT                   /db_xref="GOA:A8EXI5"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXI5"
FT                   /protein_id="ABV73068.1"
FT                   /translation="MESWIPAFVGLTSESCIKNKIITMIVLGIDPALGSLGWAVVVRQS
FT                   TKLKYLASGTIKTNSKDEIHHRLAFINITLEKVILEYQPNMAAIEEIFVNTNSLTSLKL
FT                   GYARGVIMSLIGRYNLGLREFKPNMVKKSVTGYGHAEKEQILHMIKLLLPGTSLITNSD
FT                   EGDAIAIAYTCLVTKSY"
FT   gene            140172..140864
FT                   /locus_tag="A1E_00605"
FT   CDS_pept        140172..140864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00605"
FT                   /product="tRNA/rRNA methyltransferase"
FT                   /note="COG0565 rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00605"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73069"
FT                   /db_xref="GOA:A8EXI6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXI6"
FT                   /protein_id="ABV73069.1"
FT                   /translation="MNPIIILVAPQMGENIGATARAMKNFGLNELRIVAPRDGWPNEQA
FT                   RSNAVGAVNIIDNTKIYDNLEDSIKDLEYLYATTCIKRAMNKDYVFSQNLSLDYPNSAK
FT                   VGIMFGRENNGLSNEEISLANKIITINTTEFSSLNIAQAVIIICYELFRNFTLREDIHN
FT                   IQKLATKEEIEHFLTNLFGKLDKLGFFKAPDKKPAMQQNITNIFTRINNLSSHEVQILQ
FT                   GIIKSLYT"
FT   gene            complement(141014..142102)
FT                   /locus_tag="A1E_00610"
FT   CDS_pept        complement(141014..142102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00610"
FT                   /product="hypothetical protein"
FT                   /note="COG3660 Predicted nucleoside-diphosphate-sugar
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00610"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73070"
FT                   /db_xref="InterPro:IPR009367"
FT                   /db_xref="InterPro:IPR022439"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXI7"
FT                   /protein_id="ABV73070.1"
FT                   /translation="MKIYVLTDERTGNTHQAIALAEKLATDYTLIKLQYNCLAKLPNFL
FT                   LKYYPIHIKSELLQDILDQSLPDMIIAAGRRTTVLAFYLKKKFKDIKLIQIMQPNLPYN
FT                   IFDAVILPYHDCHLSSSRNLIAGSSKNSKIINTINYFLDIVVKPRYDKVDSSFRGNDIK
FT                   HKNIIAINGAINNVTDKFAAVSLELQKYYPDLKQFIAVIIGGNNKKFNFNKDEAILFSS
FT                   LLNKIYTNQKIPFFISFSRRTPLEVKSIIKNNMPSSTIIYDPNKDIGYNPYIAMLANAK
FT                   YIIVTADSISMCSEAASSGKPLYIFHPPNFNSSKHKIFIKQLVEQKIARIFDESVISLE
FT                   EYNYKSLNESERVAEIIKSLIK"
FT   gene            complement(142099..143205)
FT                   /locus_tag="A1E_00615"
FT   CDS_pept        complement(142099..143205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00615"
FT                   /product="Mrp protein"
FT                   /note="COG0489 ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00615"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73071"
FT                   /db_xref="GOA:A8EXI8"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXI8"
FT                   /protein_id="ABV73071.1"
FT                   /translation="MAKLHQRQIIDKIQNITFKDGTFLKQVISDIVIKDNNIGFSIDIS
FT                   GKTKLEAEEIRLKAINKLNKISEIGNITIVFTSHKTSERKSQKPKHFVENVKKIILVAS
FT                   GKGGVGKSTISALIAQQLSLENYRVGIVDADIYGPSIPHIFGINEVPKTIKGQIIPITA
FT                   KNRYLSKFAYREEFEGNTEHSTTTYKEVCKDASTGSTYKLPLELKFGKISTIQIMSIGF
FT                   FVKDYSAIIWRGPMASKTIYQLLSVTKWDNLDYLIIDMPPGTGDIHLSILENYHLDGVI
FT                   IVTTPQKISEIDVIRSIDLYQKLGLPILGIIENMSYMLEDNSGHHLSQKYNIPLMAQIP
FT                   ITLQIADACDKSLPLTDLLTLPLEKYLS"
FT   gene            143306..144346
FT                   /locus_tag="A1E_00620"
FT   CDS_pept        143306..144346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00620"
FT                   /product="protease activity modulator HflK"
FT                   /note="COG0330 Membrane protease subunits,
FT                   stomatin/prohibitin homologs"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73072"
FT                   /db_xref="GOA:A8EXI9"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXI9"
FT                   /protein_id="ABV73072.1"
FT                   /translation="MLNKKYILILKKSPWQDFDSNKVDNIFTRPRKNQFNFDKFQFQFN
FT                   FNAKTIILAIVVVAALWLASGIYEIKEGEEAAVIRFGRFVRKGYPGLNYHLPAPFEKII
FT                   VEKVKQSRRIEIGYRTNSSIRSGGDNTKNIAGESIMLTGDENIVALNCDVMWHINNLED
FT                   FIFNVQRPEETVKATVESAVREVIGNTPISWVLSDQKQEITYKIEKLAQKILDSYNAGV
FT                   MIEKVQLLKAEPPAEVIDAYRDVQTSKADKEKEINQAQAYNNKILPEARGAAAKIIQEA
FT                   EGYREEVISKAEGDSQRFNAIYKQYTTGRQVTRDRLYLEVAEEILSGSNKTIINNVLLP
FT                   HMAIKP"
FT   gene            144517..145377
FT                   /locus_tag="A1E_00625"
FT   CDS_pept        144517..145377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00625"
FT                   /product="hflc protein (hflc)"
FT                   /note="COG0330 Membrane protease subunits,
FT                   stomatin/prohibitin homologs"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00625"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73073"
FT                   /db_xref="GOA:A8EXJ0"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXJ0"
FT                   /protein_id="ABV73073.1"
FT                   /translation="MQQKVYYIIFTIVFGLMLISSSLFSVDQRQSAVVFQFGEAVRTIE
FT                   NPGLHIKIPFIQNVEFFDKRLLDVEVEAKELTAADGKRVIVDAYAKFQINNPVMFYKTV
FT                   HNYQGVKIRLTRNLESSMRKVIGKISLSTLLSQERSNVMLNILNQVDGEAKSFGINVVD
FT                   VRILRADLPQENSAAIYRRMQTAREKEATQIRAEGQEESVRIRSKADKESKIILAKAYR
FT                   DAQIIKGDGDEKAAKIYNAAYSVDPEFYKFYRSLLVYKNSLKKEDTKFVISPEAEVFKY
FT                   LNLAK"
FT   gene            145398..146933
FT                   /gene="ruvC"
FT                   /locus_tag="A1E_00630"
FT   CDS_pept        145398..146933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="A1E_00630"
FT                   /product="Holliday junction resolvase"
FT                   /EC_number="3.1.22.4"
FT                   /note="COG0265 Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73074"
FT                   /db_xref="GOA:A8EXJ1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXJ1"
FT                   /protein_id="ABV73074.1"
FT                   /translation="MFKYIFAVIVIILLNNAVLAKENIKKPGKILEENEFTEINSVPLK
FT                   VSEAARYSFADIVEPLIPAVVNISTIEYVNSKSENAEKDPLQEKKPLDFINDFLERLNI
FT                   PLNLEEVDQNPKNVPLGSGFIIEPNGLIVTNYHVIANVEKINIKLADNTELPAKLIGSD
FT                   TKTDLALLKIDREEPLPFVEFGDSNDARVGDWIIAIGNPFGNLGGTVTAGIISSKGRDI
FT                   DIDTDNIVDNFIQTDAAINNGNSGGPMFNWDQKVIGVNTAIFSPLGTNIGIGFAIPSNT
FT                   AKPIIERLKKDGKINRGRLGVTIQDLTEEISEGLGLKDTSGVLVAKVQKDGPGDKAGIK
FT                   TGDIIIEFAGIPVKNTKKLRVIIADAPIDQEVKVKILRDKKEFELPIKVTADNEEINKD
FT                   LAERVNKEAVTNKGDNNLSITKNNITFSNLTQELRQKYTIPQDKTGVVITNINEEENSF
FT                   KIGDLITNVNQENIEDISKLEQLYENAKKSNKQNILLLIERGDRYMFVPLQVM"
FT   gene            147028..147777
FT                   /locus_tag="A1E_00635"
FT   CDS_pept        147028..147777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00635"
FT                   /product="hypothetical protein"
FT                   /note="COG1054 Predicted sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00635"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73075"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXJ2"
FT                   /protein_id="ABV73075.1"
FT                   /translation="MNEKIAILSTYSFVNIEEPANLIPKLLLIAKRKYVRGTILLSKEG
FT                   FNGSFSGSYENVNLVLEELIKLTVPKDVNVKINYSDLHPFQKLKVRLKKEIVAMNVDDL
FT                   NVDLFKGEYIESKDWDSFITKQDVIVIDTRNDYEVEIGTFKSAINPYTKTFKQFPAWVH
FT                   QNEKLLKGKKIAMFCTGGIRCEKSTSLLKSIGYDDVYHLKGGILQYLEDTQNKNNLWQG
FT                   ECFVFDDRRAVEDDLSPSERHTRLPST"
FT   gene            147799..148173
FT                   /locus_tag="A1E_00640"
FT   CDS_pept        147799..148173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00640"
FT                   /product="Succinate dehydrogenase cytochrome b-556 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73076"
FT                   /db_xref="GOA:A8EXJ3"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXJ3"
FT                   /protein_id="ABV73076.1"
FT                   /translation="MTKTKQEIYNKRPISPHLSIYKMQISSTLSILHRITGVALFFAVS
FT                   ILAWWLILSKYDNNYLYLASCYIIKICLVAVSYAWFYHLCNGIRYLFWAIGYCFSIKAV
FT                   NITGWCVVICSTLLTILLWV"
FT   gene            148506..148625
FT                   /locus_tag="A1E_00645"
FT   CDS_pept        148506..148625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00645"
FT                   /product="hypothetical protein"
FT                   /note="COG2009 Succinate dehydrogenase/fumarate reductase,
FT                   cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00645"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73077"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXJ4"
FT                   /protein_id="ABV73077.1"
FT                   /translation="MLFLIKQEILLLYDRGEFILSEAKDLPWSEEIAKDCYEK"
FT   gene            149004..149381
FT                   /locus_tag="A1E_00650"
FT   CDS_pept        149004..149381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00650"
FT                   /product="hypothetical protein"
FT                   /note="COG2142 Succinate dehydrogenase, hydrophobic anchor
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73078"
FT                   /db_xref="GOA:A8EXJ5"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXJ5"
FT                   /protein_id="ABV73078.1"
FT                   /translation="MVYDFKVEIVKAKASGSAKSGSHHWLLQRVTAIILALCSIWLIYF
FT                   TLTNKSSDLSIIMWELKKPFNVVALLITVIISLYHAMIGVQIVIEDYIRCNKLLNTLII
FT                   VVKLFCLVTIAAFVTAMFYKG"
FT   gene            149579..151369
FT                   /locus_tag="A1E_00655"
FT   CDS_pept        149579..151369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00655"
FT                   /product="succinate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00655"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73079"
FT                   /db_xref="GOA:A8EXJ6"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXJ6"
FT                   /protein_id="ABV73079.1"
FT                   /translation="MTKAYNIIHHKFDVVVVGAGGAGLRSAFGMAKEGLNTACVTKLFP
FT                   TRSHTVAAQGGISAALGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAADAVLELE
FT                   HYGVPFSRTEEGKIYQRPFGGMTTEYGKGKAAYRTCAAADRTGHVILHTLYQQSLKHKV
FT                   QFFVEYFAIDLLMEDGQCRGVVAWNLDDGSMHCFRAHNVVLATGGYGRAYFSATSAHTC
FT                   TGDGGGMAIRAGLPLQDMEFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYA
FT                   PATKDLASRDVVSRAMTIEIREGRGVGKYKDHVFLHLNHLSPEILYSRLPGIAETAKIF
FT                   AGVDVTKEPIPVLPTVHYNMGGIPTNYHGQVIIKEGENHNTIVKGLMAIGEAACVSVHG
FT                   ANRLGSNSLLDLVVFGRSSALKAAELIKPASPHKSLKEESLEKVINRFDKVRHSNGNIL
FT                   VADLRLKMQRTMQSHAAIFRTQEVLDEGAEMISEIRAGYKDIKVNDKSLIWNSDLVEAL
FT                   ELDNLLDQALVTVYSAAARKESRGAHAREDYPDRNDLDWMKHTLSSINDVGTVVLDYKP
FT                   VTLTTLTDEVKAIPPAKRVY"
FT   gene            complement(151411..151509)
FT                   /locus_tag="A1E_00660"
FT   CDS_pept        complement(151411..151509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00660"
FT                   /product="hypothetical protein"
FT                   /note="COG1053 Succinate dehydrogenase/fumarate reductase,
FT                   flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00660"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73080"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXJ7"
FT                   /protein_id="ABV73080.1"
FT                   /translation="MTKQGRNKNASLQHFIIFTGLQRSEQMRAIMI"
FT   gene            151578..152234
FT                   /gene="sdhA"
FT                   /locus_tag="A1E_00665"
FT   CDS_pept        151578..152234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="A1E_00665"
FT                   /product="succinate dehydrogenase flavoprotein subunit"
FT                   /EC_number="1.3.5.1"
FT                   /note="COG0765 ABC-type amino acid transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00665"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73081"
FT                   /db_xref="GOA:A8EXJ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXJ8"
FT                   /protein_id="ABV73081.1"
FT                   /translation="MFEYLIKFYPKILFIVEGTLVTLKYSVIAVIFGLVIGMLLAICKV
FT                   NKNYALRFFANFYTSIFRGTPLLIQLSIIYFASPYIVGIKFSVFTAGAISFSLNSGAYV
FT                   SEVIRAGINAVDKGQFEAAEALAIPRYLIMQDIILPQAVKNIFPSLVNELVSLIKESAI
FT                   ISMLGEIDLMRRAQIVSIETYNYFFPMLIAACCYYILVMLISFIAKIIEKKMIVN"
FT   gene            152392..152781
FT                   /gene="rpsL"
FT                   /locus_tag="A1E_00670"
FT   CDS_pept        152392..152781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="A1E_00670"
FT                   /product="30S ribosomal protein S12"
FT                   /note="COG0048 Ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00670"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73082"
FT                   /db_xref="GOA:A8EXJ9"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXJ9"
FT                   /protein_id="ABV73082.1"
FT                   /translation="MPTYNQLVRFGRKSKTRKTKSPALESNPFKSGVCLVVKTVTPKKP
FT                   NSALRKIATVRLSNKRTVNAYIPGEKHSVKEHDRVLVRGGQVPDLPGVKYHIVLGAYDI
FT                   AGVKGRKQGRSRYGAPSKQVAVTKK"
FT   gene            152809..153291
FT                   /locus_tag="A1E_00675"
FT   CDS_pept        152809..153291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00675"
FT                   /product="30S ribosomal protein S7"
FT                   /note="COG0049 Ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00675"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73083"
FT                   /db_xref="GOA:A8EXK0"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXK0"
FT                   /protein_id="ABV73083.1"
FT                   /translation="MSRRHAAGKRVILPDMKYNSILLSRFINNLMKEGKKALAEKIVYS
FT                   AFNKIEKKHRVDPYQIFNNAMHNVKPHLEVTSVRVGGANYQVPTHVDESRGYALASRWI
FT                   INAALKRSEKMMIDKLAEELFEASNNRGVAIKKKEDTHKMAEANKAFSHFSPKKMK"
FT   gene            153304..155376
FT                   /locus_tag="A1E_00680"
FT   CDS_pept        153304..155376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00680"
FT                   /product="elongation factor G"
FT                   /note="COG0480 Translation elongation factors (GTPases)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00680"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73084"
FT                   /db_xref="GOA:A8EXK1"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXK1"
FT                   /protein_id="ABV73084.1"
FT                   /translation="MTKINKLEYIRNIGICAHIDAGKTTTTERILYYTGKSHKIGEVHE
FT                   GGATMDWMEQEQERGITITSAATTCRWQDKIINIIDTPGHVDFTIEVERSLRVLDGAVA
FT                   VFDGVAGVEPQSETVWRQADKYNVPRMCFINKMDRMGADFYRCVEMIKDRLGAKPLVIQ
FT                   LPVGIEENFKGIIDLVKMKAVIWKDESLGAEYFAEDIPADMKYKAEEYRTKLLDMVVEL
FT                   DDHIMEKYLSGEEVTEEEIERLIRNGTISAAFYPVLCGSAFKNKGVQPLLDAVVGFLPS
FT                   PIDIGIVKGIEVSTGEEKDFPISVTEPFAALAFKIMNDPFVGSLTFIRIYSGKITSGST
FT                   VINTVKNKREKIGRMLLMHANNREDVKEASAGDIVALAGLKDTTTGDTLSDIDKQVILE
FT                   RMEFPEPVIELAVEPKSTADQEKMGLALSRLAAEDPSFRVSMDHETGQTVIKGMGELHL
FT                   EIIIDRMRREFKVEANIGAPQVAYRETITKICEIDYTHKKQSGGAGQFARVKIIFEPLN
FT                   PGEGFVFESKIVGGAVPKEYIPGIEKGLNNIRETGVIAGYPMIDFKATLVDGAFHDVDS
FT                   SVLAFEIAAKAAFREGMLKGNPKLLEPIMKVEVITPDEYMGDIIGDLNSRRGQIQSMDP
FT                   RANAQVVTSNVPLAEMFGYVNTLRSLSQGRAQFSMIFSHYDQVPSQIADVIKAKK"
FT   gene            155537..155612
FT                   /locus_tag="A1E_t05690"
FT   tRNA            155537..155612
FT                   /locus_tag="A1E_t05690"
FT                   /product="tRNA-Trp"
FT   gene            155746..156009
FT                   /gene="secE"
FT                   /locus_tag="A1E_00685"
FT   CDS_pept        155746..156009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="A1E_00685"
FT                   /product="preprotein translocase subunit SecE"
FT                   /note="COG0690 Preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00685"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73085"
FT                   /db_xref="GOA:A8EXK2"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXK2"
FT                   /protein_id="ABV73085.1"
FT                   /translation="MSQLPREVACYDKSNKLPNKNMFKEYKIYKFFEQVKQETYKVVWP
FT                   TRKELVASTLVVVVAVFIFSLICLVLDYSIHNIMKLLLNIGK"
FT   gene            156025..156603
FT                   /gene="nusG"
FT                   /locus_tag="A1E_00690"
FT   CDS_pept        156025..156603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="A1E_00690"
FT                   /product="transcription antitermination protein NusG"
FT                   /note="COG0250 Transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00690"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73086"
FT                   /db_xref="GOA:A8EXK3"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXK3"
FT                   /protein_id="ABV73086.1"
FT                   /translation="MTAQSLDNILPSSKKNIKQWYVVHTASGAEKRIKEDMLRKIAKQK
FT                   MTDFFEDILIPVFGVSEVKRGKNVKVEKKLMPSYLLIKMNMTDKSWHFVKNIPGVTGFL
FT                   GSKTMPKALTEGEIQNIFNNLEAEAKEAKNSKLYEVGEIVTVTDGPFETFMGTVEEIDQ
FT                   EKNRLKVSVSIFGKATPIELNFSQVKKND"
FT   gene            156835..157272
FT                   /gene="rplK"
FT                   /locus_tag="A1E_00695"
FT   CDS_pept        156835..157272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="A1E_00695"
FT                   /product="50S ribosomal protein L11"
FT                   /note="COG0080 Ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00695"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73087"
FT                   /db_xref="GOA:A8EXK4"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXK4"
FT                   /protein_id="ABV73087.1"
FT                   /translation="MSQKAIKGYINLIIPAAGATPAPPIGPALGQRKVNIAAFCKDFND
FT                   ATQAMEKGIPLPTVITVYEDRSFSFKIKTSPASYFLKKYAKITKGSSATKKEAVVGKVT
FT                   MDDCREIAKLKMPDLNTKNIEAATKIICGSAASMGLEVVGN"
FT   gene            157278..157997
FT                   /gene="rplA"
FT                   /locus_tag="A1E_00700"
FT   CDS_pept        157278..157997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="A1E_00700"
FT                   /product="50S ribosomal protein L1"
FT                   /note="COG0081 Ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00700"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73088"
FT                   /db_xref="GOA:A8EXK5"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXK5"
FT                   /protein_id="ABV73088.1"
FT                   /translation="MSNKKDIAVKNSGGKKIREAREKVKSDTLYNLTNAVERLKSASYV
FT                   KFDPTLEIVMKLGIDPRHSDQMIRGVVNLPAGTGKTVRVAVICKAERVEEAKSAGADLV
FT                   GSTSIIDEIKAGKINFDVCIATPDMMAAIGSVARILGPKGLMPNPKLGTVTLDIKNAIK
FT                   NAKSGQVEYRAEKAGIIHAGLGKLSFSDQDLLQNLNEFIEAVIKAKPAGLKGSYLKAMY
FT                   LSSTMGASVQIDLTSIA"
FT   gene            158282..158791
FT                   /gene="rplJ"
FT                   /locus_tag="A1E_00705"
FT   CDS_pept        158282..158791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="A1E_00705"
FT                   /product="50S ribosomal protein L10"
FT                   /note="COG0244 Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00705"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73089"
FT                   /db_xref="GOA:A8EXK6"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXK6"
FT                   /protein_id="ABV73089.1"
FT                   /translation="MLRSEKSVAVEDIVNIYKESPSVIITHYHGLTVSQVSSLRESLKS
FT                   QEAGFKVVKNTLAKIAANQTGLNNIVELFAGPTAIAYSKEPVGMAKLVVNFAKANDNLK
FT                   IIGGVVDNHVLDKHSIKELSKLPLLNELRGKIVELLQAPATKVLGVLQAPSSSMARVIQ
FT                   AHASKN"
FT   gene            158823..159200
FT                   /gene="rplL"
FT                   /locus_tag="A1E_00710"
FT   CDS_pept        158823..159200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="A1E_00710"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="COG0222 Ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00710"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73090"
FT                   /db_xref="GOA:A8EXK7"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXK7"
FT                   /protein_id="ABV73090.1"
FT                   /translation="MADLAKIEEQLSSLTLMQAAELVKMLEEKWGVSAAAPVPMAAASA
FT                   PAAAEEAVAEKTDFEVVLTAVGGKKVEVIKVVREITGLGLIEAKKLVDEAPKAVKQSVK
FT                   KAEAEEIKSKLEAAGAKVELK"
FT   gene            159903..164024
FT                   /gene="rpoB"
FT                   /locus_tag="A1E_00715"
FT   CDS_pept        159903..164024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="A1E_00715"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG0085 DNA-directed RNA polymerase, beta
FT                   subunit/140 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00715"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73091"
FT                   /db_xref="GOA:A8EXK8"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXK8"
FT                   /protein_id="ABV73091.1"
FT                   /translation="MVLLRDNIEVQPLSNNRRIRKNFGHINLVADIPNLIEIQKNSYEK
FT                   NFLQLNIKDSERKNKGLQSILNSIFPISDSSNIANLEFVKYEFDTPKYDVEECSQRSLS
FT                   YAAPLKVTLRLSIWDIDEDTGTREIKGIKEQEVYMGDIPLMTKNGTFIINGTERVVVSQ
FT                   MHRSPGVFFYHDEGKIHSSGKLLYSARVIPYRGSWLDLEFDAKDIIYFRIDRKRKLYAT
FT                   TLLRAIGMSTEEIIKFYYNSVTYKLVQNKGWAVKFMPGHITAHRLTSDLVDADTGNVLL
FT                   KAGQKITPRLAQKYFREGLNNVLVARETLIGKYLSEDLRDPVSDEILAKIGEMITADML
FT                   NVINDLKIKNVNVLVVNPQSGPYIRNTLFADKNQDRETALCDIFRVLRPGEPANIEAAE
FT                   GLFYNLFFDAERYDLSEVGRIKMNSRLELNISEEVTVLTIDDIKNIVRVLVELKDGKGI
FT                   IDDIDHLGNRRVRSVGELIENQFRIGLVRMEKSVIERMSAGDVDTLMPHDLVNSKILVS
FT                   VVKEFFSTSQLSQFMDQTNPLSEITHKRRLSALGPGGLSRDRAGFEVRDVHPTHYGRIC
FT                   PIETPEGQNIGLINSMATYARINKHGFIESPYRRVKDGRVTDEVVYLSAIEEGKYKIGQ
FT                   ANSKVDKDGVLQGEFINCRVEGGNFVMVEPHEVDFIDVTPMQVVSVAASLIPFLENDDA
FT                   NRALMGSNMQRQAVPLIKTDAPFVGTGVEGVVAKDSGASVLALHDGIVEQVDSNRIVIR
FT                   TLAQKADGSPSVDIYNLLKFQKSNHNTCINQKPLVKVGHYVKKNDIIADGPSTDNGEIA
FT                   LGRNVLVAFLPWNGYNFEDSILISERIVKEDIFTSIHIEEFEVIARDTRLGPEEITRDI
FT                   PNVSEEALSHLDEVGIIYVGAEVKAGDILVGKVTPKSESPITPEEKLLRAIFGEKAFDV
FT                   KDSSLHVPSGVSGTVVEVRIFSRRGVEKDQRAIAIEKQQIEKLAKDRDDELEIVEHFVF
FT                   SWLEKLLVGQVIINGPKQVKAGQTITTEVLKGLSKGQFWQLTVEDANIMNEIEQIKTHY
FT                   DEKKEALNKRFATKVEKLQSGDDLPQGALKVVKVFIATKHKLQPGDKMAGRHGNKGVIS
FT                   RIVPEEDMPFLEDGTVVDIVLNPLGLPSRMNIGQILETHLGWASINLAKKISTLVQEYQ
FT                   NKKIAIEQIKKFLIKLYGENINSVLERSEEEIISFCKKVSKGVHFATPVFDGAKVQDVK
FT                   DMLKLADQDPSGQVKLIDGRTGEYFDRLVTVGQKYLLKLHHLVDNKIHSRSIGPYSLVT
FT                   QQPLGGKSHFGGQRFGEMECWALQAYGAAYTLQEMLTVKSDDVNGRIKTYDSIVRGENN
FT                   FESGIPESFNVMIKEFRSLCLNVKLEVTSS"
FT   gene            164217..168353
FT                   /locus_tag="A1E_00720"
FT   CDS_pept        164217..168353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00720"
FT                   /product="DNA-directed RNA polymerase beta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00720"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73092"
FT                   /db_xref="GOA:A8EXK9"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXK9"
FT                   /protein_id="ABV73092.1"
FT                   /translation="MSLVNFYGQLSNTQQFDQIRINIASPDQVRSWSFGEVTKPETINY
FT                   RTFKPEKDGLFCARIFGPVKDYECLCGKYKRMKNRGIICEKCGVEVTVSRVRRERMGHI
FT                   ELAAPIAHIWFLKSLPSRISTLLDMTMRDLEKILYFENYVVLDPGLSILQKGELLTEEE
FT                   LQKAKDKYGEDAFTASIGAEVIQQMLKDLDFAKLKQELYEELQNTTSEVKKKKLVKRLK
FT                   LVEDFLESENKPEWMIIDVLPVIPPEIRPLVMLDGGRFATSDLNELYRRVINRNNRLKK
FT                   LIESKAPDIIVRNEKRMLQEAVDALFDNGRRGRAAKNANKRPFKSLSDMLKGKQGRFRQ
FT                   NLLGKRVDYSGRSVIVVGPELKLHQCGLPKKMALELFKPFIYSKLELYGIATTIKAAKR
FT                   MVEAEKPEVWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPLLIEGKAIQLHPLVCAAFN
FT                   ADFDGDQMAVHIPLSIEAQLEARVFMMSTNNILSPANGRPIIVPDKDIVLGLYYLTIAF
FT                   DNEVGEGLMFSDLAEMEHALYNKFITIHTKIKYRRNQLNAEGKMVPVIVDTTYGRLMVG
FT                   ELLPSNPNIEFKFINKQLTKKDISLVIDLVYRHCGQKATVIFADQLMKLGFKYACSSGI
FT                   SFGMDDMVVPESKSTHINETQLEIKEFEQQYSNGLITYGEKYNKVVDAWSRCTDRVAND
FT                   MMKEIATPPINDEPNHQKINAIYMMAVSGARGSFQQIKQLGGMRGLMTKSNGQIIQTPI
FT                   ISNFKEGLTEFECFNSANGMRKGQIDTALKTASSGYLTRKLVDVAQDCIITEKDCGTDK
FT                   GIEVKSVIEGGEVIVSLAEKILGRTAAIDIFHPVTNDLILNKGELINEVKLEQIESAGL
FT                   DRIMIKSVLTCESTTGICSICYGRDLATGTLVSEGEAIGVIAAQSIGEPGTQLTMRTFH
FT                   IGGAATKGAEISSVEASYDAKVKIISRNVVINSEERKIVMSRNCELLLLDNNGNEKARH
FT                   KIPYGARLLVDDGDMVIKTQKLAEWDPYTIPIITEKSGKVLFKDMVEGISIRDVTDEAT
FT                   GIPSKVIIESKQYSRGAELRPRIQLLDAKGEVITLSNGLEARYYLPVGAVLSVEDGVQI
FT                   SVGDIIARIPKESTTTKDITGGLPRVAELVEARRPKDHAVIAEVDGRVEFGKDYKSKRR
FT                   IIIHPIDETMSIEYMVPKGKHVVVNEGDFVKKGDLLIDGNPVLQDILKVMGVEVLANYI
FT                   VKEVQAVYRLQGVKIDDKHIEVIIRQMLQKVEITDSGGTTLLVGEKVDRHEFDEINEKA
FT                   IKNGLKPAEAQLILQGITKASLQTRSFISAASFQETTRVLTEAAIAGKVDKLRGLKENV
FT                   IVGRLVPAGTGYFMDKMRKAAVKLDEENSINADKG"
FT   gene            complement(168570..169487)
FT                   /locus_tag="A1E_00725"
FT   CDS_pept        complement(168570..169487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00725"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG0086 DNA-directed RNA polymerase, beta'
FT                   subunit/160 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00725"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73093"
FT                   /db_xref="GOA:A8EXL0"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXL0"
FT                   /protein_id="ABV73093.1"
FT                   /translation="MDEIYSLTPHPIRYACLNYLKLLSLPISLAFYLIKFCFTANPVWT
FT                   WIGVNILYKKMDQSIATKILHGLPDGIETEQDILKTVEYVFKKYEENPTLAPLIEPTFI
FT                   QKFLAKAGKYIPAFSKIIKFWNEGGINYSYEIQTKRELINVIYKQIVSKAYEVGKKGEK
FT                   LEITDVQAIFPKINFKEKIKAESEDLQIDKVEVSNRPLSNNQKYEEVNTNNPLMNLIML
FT                   KALYDRVGQEIQKVYIENYLAEYQIRIRHHYTMLKNAYIDDDLTKLQLYANYNYDNNNT
FT                   YIPEQPISYLGQNYEHLTTSISCY"
FT   gene            169864..171366
FT                   /locus_tag="A1E_00730"
FT   CDS_pept        169864..171366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00730"
FT                   /product="leucyl aminopeptidase"
FT                   /note="COG0260 Leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00730"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73094"
FT                   /db_xref="GOA:A8EXL1"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXL1"
FT                   /protein_id="ABV73094.1"
FT                   /translation="MLNVNFTNGELLNTQGLVVFIDEQLKLDSNLITLDQQHHGLISKT
FT                   IADKLQFTGKYGQIKVIPSVIKSGEIKYLIIAGLGTEEKLTEAKVEELGGKILQYATSA
FT                   KISTISLKIINRISRFTSQTFASLVASGAFLASYRFDKYRTNLKEAEKFAVESIEVFTD
FT                   NNTEAAKLFEVKKLVAEAVFFTRDISNEPSNIKTPQVYAERIVDILEPLGVDVDIIGER
FT                   EMKNLGMGALLGVGQGSQNESKLVVMEYKGGSKYPTIALVGKGVIFDTGGISLKPSSNM
FT                   HLMRYDMGGSAAVVGSMIAVAGQKLPVNIVGVVGLVENMLSGNAQRPGDVVTTMSGQTV
FT                   EVLNTDAEGRLVLADAVWYAQEKFKPKCLIDVATLTGAITVALGSTYAGCFSNNDELAS
FT                   KLIKAGEEVNEKLWRMPLHDEYDAMIGSDIADMANISNIPRAAGSCIAAHFIKRFIKDG
FT                   VDWAHLDIAGVANSNKVSSLGPKGAVGYGVRLLEKFIKEYNR"
FT   gene            171560..172354
FT                   /locus_tag="A1E_00735"
FT   CDS_pept        171560..172354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00735"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73095"
FT                   /db_xref="InterPro:IPR015223"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXL2"
FT                   /protein_id="ABV73095.1"
FT                   /translation="MNSKPYIFVIGNEKGGAGKTTCSMHLIIALLYQNYSVVSIDTDSR
FT                   QSSLTNYLKNRDLYNKQNPDKTVLVPKHFYISESEVGEQTKSFEQVLKNNQDTDYIVID
FT                   TPGSHTPLSRLAHSYADMIITPINDSFLDLDVIAKIDSKDEIISPSIYSQMIWEQKMER
FT                   ASRDRVSIDWIILRNRLSNLDALNKRRVGNVLAKLAKRINFKLAEGFSERVIYRELFLQ
FT                   GLTLLDLKTAKYDRAFNSSHVLARQELRNFLDFLGIKTMFKG"
FT   gene            172435..172866
FT                   /locus_tag="A1E_00740"
FT   CDS_pept        172435..172866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00740"
FT                   /product="leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="COG1192 ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00740"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73096"
FT                   /db_xref="GOA:A8EXL3"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXL3"
FT                   /protein_id="ABV73096.1"
FT                   /translation="MQNISENISPEQRKQVDELINKYKHLTLAEQKEVDRKLELHFREK
FT                   DLERNELQLRMNKIFGNLSRENQEKLQVNNNPINKIKEELLPLIKGIINLVENVAEIIK
FT                   NPKKVIYEWIKGELNQVKPQQQNHIQSLPKQKNVPTLSR"
FT   gene            172942..174750
FT                   /locus_tag="A1E_00745"
FT   CDS_pept        172942..174750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00745"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="COG0173 Aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00745"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73097"
FT                   /db_xref="GOA:A8EXL4"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXL4"
FT                   /protein_id="ABV73097.1"
FT                   /translation="MHKYRTHNCNALQISDVGKEVKLSGWVHRRRDHGNLVFIDLRDHY
FT                   GITQIVFTDQNLQLMEMASRLRYESVITVIGKVVARSGDTINDTLTTGHIEILAREFIV
FT                   ESAADTLPFVINTEKDAPEDLRLKHRFLDLRREKLHNNIILRSQIISHIRHLMTARGFT
FT                   EFQTPILTASSPEGARDFLVPSRMHSGKFYALPQAPQQFKQLLMVSGFDRYFQIAPCFR
FT                   DEDARADRSPGEFYQLDVEMSFVTQEDVFSTIEPVMYDLFTKFTDKKVSETPFIRIPYN
FT                   ESMLKYGSDKPDLRNPIIIADVTEIFRDSDFTIFRENIKKGSVVRAIPAPKAAAHARSF
FT                   FDKMIEFAISEGAGGLGYIQFSKNDKAKGPVAKFLSPQQLESLKATVNISDGDAVFFVS
FT                   DKKEKAAKLAGKVRIRISDELDLLEKDCFKFCWITDFPFYELNEETAKIDFSHNPFSMP
FT                   QGGLDALKNAKTTAELLELTAYQYDIVCNGIELSSGAIRNHKPEIMYKAFSIAGYSEEE
FT                   VNKRFGSMIRAFKFGAPPHGGIAPGIDRIVMLLAEATNIREIIAFPLNQQAEDLLMNAP
FT                   NYVEDKALKELGIMLLPSARKNVEQE"
FT   gene            complement(175182..175892)
FT                   /gene="aspS"
FT                   /locus_tag="A1E_00750"
FT   CDS_pept        complement(175182..175892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="A1E_00750"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /note="COG0670 Integral membrane protein, interacts with
FT                   FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00750"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73098"
FT                   /db_xref="GOA:A8EXL5"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXL5"
FT                   /protein_id="ABV73098.1"
FT                   /translation="MIDYTKTLTATAKNKTFDEGLRKYMLKVYNYMALALLLTGVAALT
FT                   TISVEPIYNLMFQTSFGTIIMFAPLGIALYFFMGFGRMNLQTAQILFWVYTTLTGMSLA
FT                   YLALIYTGTSIARTFFICSSVFGAMSLYGYSTSRDLTSMGSFFAMGLIGLIIASLVNLF
FT                   LKSSALSFATSLIGIVVFMGLIAWDTQKIKSMYYMAGNNEVGQKLSIMAAFTLYLDFIN
FT                   LFLHLVRFLGNRRD"
FT   gene            complement(175958..176680)
FT                   /locus_tag="A1E_00755"
FT   CDS_pept        complement(175958..176680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00755"
FT                   /product="dihydrodipicolinate reductase"
FT                   /note="COG0289 Dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00755"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73099"
FT                   /db_xref="GOA:A8EXL6"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXL6"
FT                   /protein_id="ABV73099.1"
FT                   /translation="MINIGLSGSTGKMGRAIAERIDEFENCKISAKFSSTNSLYDLDNF
FT                   CKHSDVFIDFSTPEILETLVNYALKHNTKLVIGTTGLQPKHFKLLEKAAQTLPILYSAN
FT                   MSIGANLLSYLAKEAIKILDDYDVEILDIHHRNKKDSPSGTAIMLAETIANGKDLDIIF
FT                   NRGNRPRKKEEIGISSLRGGNVHSIHEISFLDDNEIITLKHEALNNNSFANGAIKAAIW
FT                   LQDKPSALYSMQDIYKIY"
FT   gene            complement(176688..177170)
FT                   /locus_tag="A1E_00760"
FT   CDS_pept        complement(176688..177170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00760"
FT                   /product="hypothetical protein"
FT                   /note="COG1853 Conserved protein/domain typically
FT                   associated with flavoprotein oxygenases, DIM6/NTAB family"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00760"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73100"
FT                   /db_xref="GOA:A8EXL7"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXL7"
FT                   /protein_id="ABV73100.1"
FT                   /translation="MAGTVTESQFKDAMSRFPQGVTIITTNYNNELFGFTASSFTSVSL
FT                   RPSLILFCLNKNSYSINSFQKSNNFAVSILAENQIDISKHFAKSQLNKFTKIDYTLGNK
FT                   TDCPLINGATCHIECNKYAAYDAGDHTIFIGKVINTTIKNNLKPLLYFHKSYTNLQ"
FT   gene            complement(177155..177880)
FT                   /locus_tag="A1E_00765"
FT   CDS_pept        complement(177155..177880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00765"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00765"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73101"
FT                   /db_xref="GOA:A8EXL8"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXL8"
FT                   /protein_id="ABV73101.1"
FT                   /translation="MKFLKIFLLSFLLVSCEKKETEKTLIVGTAADNPPYEFIQGGKIV
FT                   GIDIDIIKAIGERLNKKVIIKNFDFNGLLAALVSENIDVAVAELSVTPERAEYISFSDN
FT                   YATARFAIIYRTGDNIQSSKELENKIVGVQLGSVLEKKAQDLSQTMNIKVHSLANHLML
FT                   VEELKARVIDAIISEEFQGIKLKENNPNLESCTLEEFSSDFAIGMSKNSGLINEINEAI
FT                   YSLKKDGTINKIMKKWLGQ"
FT   gene            complement(177877..177960)
FT                   /locus_tag="A1E_00770"
FT   CDS_pept        complement(177877..177960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00770"
FT                   /product="hypothetical protein"
FT                   /note="COG0834 ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00770"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73102"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXL9"
FT                   /protein_id="ABV73102.1"
FT                   /translation="MFSIPNVIPQFDHGMTQDMLKLKTLFL"
FT   gene            complement(177960..179411)
FT                   /gene="gatB"
FT                   /locus_tag="A1E_00775"
FT   CDS_pept        complement(177960..179411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="A1E_00775"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   B"
FT                   /note="COG0064 Asp-tRNAAsn/Glu-tRNAGln amidotransferase B
FT                   subunit (PET112 homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00775"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73103"
FT                   /db_xref="GOA:A8EXM0"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXM0"
FT                   /protein_id="ABV73103.1"
FT                   /translation="MTYIKGNTGKWEYVIGLEIHAQISSKSKLFSGSSTTFAAMPNSQV
FT                   SYVDAAMPGMLPVLNKHCVHQAIKTGLALKAQINKYSVFDRKNYFYADLPQGYQISQFY
FT                   YPIVQNGTMKILTSTGDLKTIRINRLHLEQDAGKSIHDQSPHYSFIDLNRAGIGLMEIV
FT                   TEPDISSPEEAAEFVKKLRSLLRYIGSCDGDMEKGSMRCDANISVRRSGEPLGIRCEIK
FT                   NINSIRNIIKAIEFEAKRQVDLIESGGIVIQETRLFNADSGETRTIRLKEEAIDYRYFP
FT                   DPDLLPLIISDELINKLKANLPELPDQKIEKYMKEFGLSKYDAEVIVADESVAEYFEQA
FT                   ANECNPKMLTNWLTSELFGQLNKASIGISKCKITPSNFAKLIKLIENDTISGKIAKTVF
FT                   EIMFETGKAPDKIVEEKGLVQVSDNNVLNTVIDEVITENPKSVEDYRSGKEKLFSFFVG
FT                   QIMKKTGGKANPILVNQLLKEKLGS"
FT   gene            complement(179414..180895)
FT                   /gene="gatA"
FT                   /locus_tag="A1E_00780"
FT   CDS_pept        complement(179414..180895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="A1E_00780"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   A"
FT                   /note="COG0154 Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit and related amidases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00780"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73104"
FT                   /db_xref="GOA:A8EXM1"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXM1"
FT                   /protein_id="ABV73104.1"
FT                   /translation="MTELNKLTLADSIKGLKNKDFTSTELVNAHIQQIEKHKNLNAYVT
FT                   KTFDLALKGAQIADQNYAQNKARTLEGIPFAAKDLFCTKGIRTTACSNILKNFIPNYES
FT                   SVTQNIFNNGGVMLGKTNMDEFAMGAANITSCFGNVINPWKANNDNSDLVPGGSSGGSA
FT                   ASVSGFMASAALGSDTGGSVRQPASFTGLVGFKPTYGRCSRYGMVSFASSLDQAGIFTR
FT                   SVLDSAIMLEAMMGFDEKDSTSLKAEVPQLQSAIGSSVKNMKIGVPLSLGEGSIIEPDV
FT                   MKMWQDTIELLKNAGTEIVDITLPYAKYGVAVYYVIAPAEASSNLSRYDGVRYGLRVER
FT                   ENMTLDEMYEMTRSAGFGEEVKRRIMIGTYVLSSSCMDAYYLKAQKVRSLVANDFNNAF
FT                   TKVDTILLPAAPSEAFKIGEKQNDPTIMYLNDLFTIPASLAGLPCVSVPAGLSARGLPL
FT                   GMQIIGKQLDEYNVLKVASTIESGVKHIKFEPKGF"
FT   gene            complement(180898..181200)
FT                   /gene="gatC"
FT                   /locus_tag="A1E_00785"
FT   CDS_pept        complement(180898..181200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="A1E_00785"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   C"
FT                   /note="COG0721 Asp-tRNAAsn/Glu-tRNAGln amidotransferase C
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00785"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73105"
FT                   /db_xref="GOA:A8EXM2"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXM2"
FT                   /protein_id="ABV73105.1"
FT                   /translation="MITKEEAQKIAKLARLKFEEDTVEKFSTQLSSIMNMIDILNEIDC
FT                   KDIEPLTSVSNMNARMREDEVTSSDLSDKLLDHVSGQSAQLAKEVKYFITPKVIE"
FT   gene            complement(181370..181930)
FT                   /gene="frr"
FT                   /locus_tag="A1E_00790"
FT   CDS_pept        complement(181370..181930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="A1E_00790"
FT                   /product="ribosome recycling factor"
FT                   /note="COG0233 Ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00790"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73106"
FT                   /db_xref="GOA:A8EXM3"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXM3"
FT                   /protein_id="ABV73106.1"
FT                   /translation="MDTETLKKNLQEKMEKALKVLDHELKGLRTGRASVNLLDSVIVEA
FT                   YGSKIPLSQVASISTPDARTINVQVWDKSMVSLVEKGITIANLGLTPATDGQLIRLPIP
FT                   ILTEERRKELVKLAHKYGEDTKISLRNIRRDGNEELKKLEKNNILTKDEHHSLSEQVQK
FT                   LTNDYSNKVDSAIKQKEQEIMTV"
FT   gene            complement(181934..182662)
FT                   /gene="pyrH"
FT                   /locus_tag="A1E_00795"
FT   CDS_pept        complement(181934..182662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="A1E_00795"
FT                   /product="uridylate kinase"
FT                   /note="COG0528 Uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00795"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73107"
FT                   /db_xref="GOA:A8EXM4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXM4"
FT                   /protein_id="ABV73107.1"
FT                   /translation="MTSDINALKYKKVLLKVSGEALMGDKQFGHEYDVIKKIAGDIKEV
FT                   IDLGVEVTIVVGGGNIYRGINAALVGMDRASADYIGMLATVINALTLQNVMESLNIYTR
FT                   VLSAIPMMSVCEPYIRRKAKRHMEKKRVVIFAGGTGNPFCTTDSAAVLRAIEMNCDILL
FT                   KATQVDGVYDSDPKKNPNAKKYFTISYKDVITNNLQVMDMAAIAVAQENKLPIRIFSIK
FT                   DQGNFAKVIQDKGKYTTIEE"
FT   gene            complement(182659..182991)
FT                   /locus_tag="A1E_00800"
FT   CDS_pept        complement(182659..182991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00800"
FT                   /product="hypothetical protein"
FT                   /note="COG1863 Multisubunit Na+/H+ antiporter, MnhE
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00800"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73108"
FT                   /db_xref="GOA:A8EXM5"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXM5"
FT                   /protein_id="ABV73108.1"
FT                   /translation="MLMSTKIKFILYFPWLLLEIWKSAFSVIKIIWQRKIKIEPVFEWI
FT                   DAEGLEVIGEIVYAHSITLTPGTVTLDINNNMLLVHALNKSSITTLQRGIMIKKIKQLK
FT                   ATSNRK"
FT   gene            complement(182975..184537)
FT                   /locus_tag="A1E_00805"
FT   CDS_pept        complement(182975..184537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00805"
FT                   /product="Multidrug resistance protein B"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00805"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73109"
FT                   /db_xref="GOA:A8EXM6"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXM6"
FT                   /protein_id="ABV73109.1"
FT                   /translation="MSNNNLQVTSNLSKRQLFAFYGMVVGMFMSVLDIQIVASSLSVIA
FT                   AGLAASSNELSWVQTSYLIAEVIIIPTSGFLARLLSTRIAYFIATLGFTVMSVLCSLAT
FT                   NIESMVIFRALQGFFGGAMIPTVFSTVFTIFPASQRPTVTILIGLVVTVAPTLGPTLGG
FT                   YITEILSWHFMFLLNVIPGIFVCSVVFLYGDFDKPNYKLLKNFDFLGILLMALTLGLLQ
FT                   YVLEEGNKKGWLEDNLILFLSIAVALGFILLIIRELTFINPILDLKTFLYKDFTFGCLY
FT                   SFVMGIGLYGAVYILPLFLFTIAGYDTLQIGATMMVTGGAQFLSAQLAGRMLGLGVDLR
FT                   LMLIIGLGGFALGCHLNSFLTPDSKFAAFVLPQFVRGISLMFCFIPTNNIALGNMPKER
FT                   IGNASGLYNLTRNLGGAVGLAIISTILTNDTKTFMQYFSENISSTSIMALEQLDSYTEL
FT                   LSRKVLNPEKASYLLLANKLNNDAFVIAINNIFNMIGLVFVFIMLLIPFTSNIKLTKNV
FT                   NVH"
FT   gene            184863..185066
FT                   /locus_tag="A1E_00810"
FT   CDS_pept        184863..185066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00810"
FT                   /product="hypothetical protein"
FT                   /note="COG1104 Cysteine sulfinate desulfinase/cysteine
FT                   desulfurase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00810"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73110"
FT                   /db_xref="InterPro:IPR024246"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXM7"
FT                   /protein_id="ABV73110.1"
FT                   /translation="MQNPAQKVISFSEHKSDIERIKKSIEEGWAIVKLVPNKNRFIGLL
FT                   EKISHAEDETIYIPPRKKIIVN"
FT   gene            complement(185675..185750)
FT                   /locus_tag="A1E_t05692"
FT   tRNA            complement(185675..185750)
FT                   /locus_tag="A1E_t05692"
FT                   /product="tRNA-Thr"
FT   gene            complement(185970..188276)
FT                   /locus_tag="A1E_00815"
FT   CDS_pept        complement(185970..188276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00815"
FT                   /product="Outer membrane protein omp1"
FT                   /note="COG4775 Outer membrane protein/protective antigen
FT                   OMA87"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00815"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73111"
FT                   /db_xref="GOA:A8EXM8"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXM8"
FT                   /protein_id="ABV73111.1"
FT                   /translation="MKSRSISKLTILLLTIFYYQISLADTVIRKITITGDHRVERSTIE
FT                   SYLKLKVGETYNNSKEDEAIKRLYATSLFKKINMYITNKGHLIVNVTETPFISSVVFSG
FT                   NSKIKTNMLAKEIYTMSGESLSQSKLELDVKKILEIYKRSGRFATTVTAKIENLENNRV
FT                   KVIFDIAEGPKTVIKYIYFNGNDNYSDSELKSIVLTKESRWFRFLESNDTYDPDRVEYD
FT                   KELLREFYQSVGFADFRVISALAELNNTKEYFTLTYSIEEGEKYSFGNVTIDNKLTNID
FT                   ITPLNKIVNIKQGQVFNMQIVNDIAKKIGEYFTASGYPAVNVYPDIMKNVNHTTDIKFI
FT                   IEKADKVYINKINIINNLKTEDHVIRREFKIEEGDIINRSYIEKGERNLRNLDYFEKVT
FT                   ISLAPTKAKDKYDVNVEVDEKSTSSIGFDLGYNTAGGLFGRFSFLERNLVGTGKLLNTG
FT                   VQVSKNSTSYYGTIIEPHFLDRDLSLSVNAFRNYAGYGGSVLNTTDQNYKLHSIGLKTS
FT                   LGYEIKEGLGHEIDYLIKRDILSAPTLSTSMFLKEQMGRFITSAIGHTITYNQTDNNIV
FT                   PKNGYLISGTQEFAGVGGDNKYIKHEVDGKYYKSFIHNKLTLKLSASGGDIAGLGGKIV
FT                   RISDRFNLGDYSLRGFASGGVGPREKNTNEGLGGERYYTLSTELNFPTPVPEEFNLTGA
FT                   VFIDLGSVWGVGLNKKRYETLNGFYNDKSLRASVGFGFIWVTRFAPIRMDWGFPVKKKK
FT                   YDDTQHFHLRFSTHL"
FT   gene            complement(188580..189656)
FT                   /locus_tag="A1E_00820"
FT   CDS_pept        complement(188580..189656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00820"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   E"
FT                   /note="COG0750 Predicted membrane-associated Zn-dependent
FT                   proteases 1"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00820"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73112"
FT                   /db_xref="GOA:A8EXM9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXM9"
FT                   /protein_id="ABV73112.1"
FT                   /translation="MLSIVGFIITISFLVFIHEFGHYAVARYVNVKVEEFSIGFGKELI
FT                   GISDKKGVRWKIGLVPLGGYVKIYGYDRTLIANAKEVNEKVAFYTKSCLERFLIVAAGP
FT                   LINYLLAIIIFAGLYCYFGKTEIPPIIGDVVASSPAETADLREGDKIIKVNNKPVKDFG
FT                   DVQKEILINGFSSSTLTIERNNEEFTVNIMPQEIIITHPEAKNVKKTLRIGIIAKNAPI
FT                   HTKIGILIGFWEAINTTIDMSALTLKAISQMIVGKRSLDEIGGPVAIARESGKSIAQGP
FT                   QMYLLFIAMLSVNLGLLNLLPIPVLDGGHLIFILYEAITGRLPNPKTKNILLQLGAAII
FT                   VFLIIISVSNDIQNLFFK"
FT   gene            189855..190391
FT                   /locus_tag="A1E_00825"
FT   CDS_pept        189855..190391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00825"
FT                   /product="transcription antitermination protein NusB"
FT                   /note="COG0781 Transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00825"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73113"
FT                   /db_xref="GOA:A8EXN0"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXN0"
FT                   /protein_id="ABV73113.1"
FT                   /translation="MRNSSHVTILPRNDVNLKILFSMGSNKINKKSIARIAAVQAMYQH
FT                   ILQDNQDMEYILQNVLSFYQNNNSITDLSENLKISLSISHFKMLVKSVFENFNKLDEMI
FT                   DNHLTNDKDPAHMPILLRALFRVSICELLFCHTTPAKVVINEYTDIANDMLNEHEIGFV
FT                   NSVLDKIAKENKKIL"
FT   gene            190388..191071
FT                   /locus_tag="A1E_00830"
FT   CDS_pept        190388..191071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00830"
FT                   /product="Ribosomal RNA large subunit methyltransferase J"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00830"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73114"
FT                   /db_xref="GOA:A8EXN1"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXN1"
FT                   /protein_id="ABV73114.1"
FT                   /translation="MTNNLSGYRNKFVRVKTSRKRTVSSNNWLRRQLNDPYVAKARTQG
FT                   FRSRAAYKLLEIHEKFKLFTPNMKIVDLGAAPGGWSQIASKLIKASDNSLNNKIISIDL
FT                   LEIRPIVGVEFFQKDFFEEDTEKLIIQALDGKANIVMSDMASNTIGHKATDHIRTLLLC
FT                   EQALEFALKVLKPSGHFIAKIFRGGAENKLLNKVKHEFRTVKHFKPLSSRSESTEIYLV
FT                   ALNKK"
FT   gene            complement(191118..191339)
FT                   /locus_tag="A1E_00835"
FT   CDS_pept        complement(191118..191339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00835"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00835"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73115"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXN2"
FT                   /protein_id="ABV73115.1"
FT                   /translation="MLDNIIFGIARFIRGAADTASNIVEANINIISTTLSTITDNEDIV
FT                   NNPTIIEQLDGNWVVVSLGDESSSVTKS"
FT   gene            complement(191333..192448)
FT                   /locus_tag="A1E_00840"
FT   CDS_pept        complement(191333..192448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00840"
FT                   /product="hypothetical protein"
FT                   /note="COG0293 23S rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00840"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73116"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXN3"
FT                   /protein_id="ABV73116.1"
FT                   /translation="MKEFESLTVEEIPINTINYKEFAHLGVNLAYKTDDAQRYLAEALV
FT                   TDGSHLVGSGWEILAASCNNANTAQYGYKAVAFINKETKTIHIASAGTKADMHDIWDDA
FT                   RITFHYNPNKLVTVKKFIDEVIDKIGGIEKAAEYIFDTSGHSLGAIVADLTGVELHSRN
FT                   LNFNQSVTFDSPGSQEVIKYAIDQDLFTGKVTTPLEELAKHSEVYNAKPNIINTTNYHS
FT                   GKINLVLPKVNNIETSESSTTDGWGSYLYNMVGSVVQTASKYLGINKIMEGIDNHKLKN
FT                   FANLEDQIILPIADWEQQILENNEYTQQLKTISGQGKDLFLLDTYVADECSSMVGVNMY
FT                   HWGYSDLQQSCAMEVKQIGNIDLYNSIEIVC"
FT   gene            complement(193122..193562)
FT                   /gene="nusB"
FT                   /locus_tag="A1E_00845"
FT   CDS_pept        complement(193122..193562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="A1E_00845"
FT                   /product="transcription antitermination protein NusB"
FT                   /note="COG2867 Oligoketide cyclase/lipid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00845"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73117"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXN4"
FT                   /protein_id="ABV73117.1"
FT                   /translation="MPSFEQIKVLPYKPQELFDLVWDIKSYPKFLPWCVASRILSEDPY
FT                   EIIAELVIQLKGFSEKYNSRVTNAITDNGIYLIDTVAIAGPFEYLTSTWQFVPRTAGTK
FT                   LKFFIDLKMQSVILDKLISTYFTKATEKIIVAFEKRAQDIIR"
FT   gene            complement(194099..194923)
FT                   /locus_tag="A1E_00850"
FT   CDS_pept        complement(194099..194923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00850"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00850"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73118"
FT                   /db_xref="GOA:A8EXN5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXN5"
FT                   /protein_id="ABV73118.1"
FT                   /translation="MYDLIKEIEEAWQIKDMLLQDSAKLITLQKTLNYIIESLNQGTIR
FT                   VCEKKENGWQVNEWVKKAILLYFITTESQLYSNNYNSWYDKVAPKFSADIDKNIFKEAS
FT                   IRTVPGAFVRTGTYIAKNVVIMPSFINLGAYIDERTMIDTWATIGSCAQIGKNCHISGG
FT                   TGIGGVLEPLQAKPVIIEDNCFIGARSEIAEGVIVEEGAVISMGAFIGSSTKIVYRDTG
FT                   EIIYGRVPAYSVVVPGVLPAKEAGKPGLYCVVIIKQVDKTTRARVSINDLLR"
FT   gene            195003..195623
FT                   /locus_tag="A1E_00855"
FT   CDS_pept        195003..195623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00855"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00855"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73119"
FT                   /db_xref="GOA:A8EXN6"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXN6"
FT                   /protein_id="ABV73119.1"
FT                   /translation="MYITCPNCQTKFIVTSNQIGINGRRVKCSKCSHLWYQKLDYNTSK
FT                   LNDCKDKVNTETITNHYNANVPVILPCIPPKKKYNIFPILWTHFIIFCLVILLVDSFKF
FT                   LGKYDQLKIEQINLGKSLHIGRMRIFYKLSNESDYLISDPIIKVRVMDTNNQALDEYIS
FT                   ITRLQTKIPAKQAIYLEMNLAGIPITAKYINIAIGNRLGLLFK"
FT   gene            complement(195946..196302)
FT                   /locus_tag="A1E_00860"
FT   CDS_pept        complement(195946..196302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00860"
FT                   /product="hypothetical protein"
FT                   /note="COG2171 Tetrahydrodipicolinate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00860"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73120"
FT                   /db_xref="GOA:A8EXN7"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXN7"
FT                   /protein_id="ABV73120.1"
FT                   /translation="MNFHIRELNEELINYKLSLRILFTILSVAIIIVAFDSLGSSSDPV
FT                   GDTLCKLIKVFRGNTAKGIAVVGIIVLGIQTLRGKLQWEVALVVVTAIIILFKAPDIVN
FT                   MVSSDTNSSNCGVS"
FT   gene            complement(196452..197303)
FT                   /locus_tag="A1E_00865"
FT   CDS_pept        complement(196452..197303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00865"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /EC_number="1.9.3.1"
FT                   /note="COG1845 Heme/copper-type cytochrome/quinol oxidase,
FT                   subunit 3"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00865"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73121"
FT                   /db_xref="GOA:A8EXN8"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXN8"
FT                   /protein_id="ABV73121.1"
FT                   /translation="MSQKIILNNSHPITKSHLFHVVDPSPWPVLTSFALLLLVIGSVSF
FT                   MHGYKFNVYILSAGVISVVYCLYSWWRDVVKEGIVEHQHTIPVRKGLQIGMALFILTEI
FT                   VFFGVFFASFFKSSLSPVGLLDGVWVVKQGVWPPPTIKTFDPFDIPFINTLILLLSGTT
FT                   VTWAHYALEEKNQKDCVTALALTILLGIFFTTMQAYEYYHAAFKFTDGIYASNFYLATG
FT                   FHGAHVIIGTIFLIVCYFRAKRGDFTTEGNGHLGFKFAAWYWHFIDLVWLFLFTFVYIF
FT                   GS"
FT   gene            complement(197901..198440)
FT                   /gene="dapD"
FT                   /locus_tag="A1E_00870"
FT   CDS_pept        complement(197901..198440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="A1E_00870"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="COG2941 Ubiquinone biosynthesis protein COQ7"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00870"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73122"
FT                   /db_xref="GOA:A8EXN9"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXN9"
FT                   /protein_id="ABV73122.1"
FT                   /translation="MPRPDFSDPHKQIHEIIRVNHAGEYGATRIYQGQLKYIKSQNDYI
FT                   LIKEMLDHEEIHLNFFEKKLLEKKVRPTILLFLWHYYGFLLGALSSLMGIKTAMLITES
FT                   VEEVIEKHYEQQINDWHGLGCEQELLDNITKFRLDEIEHKNIAIMHDSTKTIFAEISSK
FT                   VVKIICRISIILSKKI"
FT   gene            complement(198589..199560)
FT                   /locus_tag="A1E_00875"
FT   CDS_pept        complement(198589..199560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00875"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00875"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73123"
FT                   /db_xref="GOA:A8EXP0"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXP0"
FT                   /protein_id="ABV73123.1"
FT                   /translation="MKFYFSQIKRLFALITAGKIRALLLYGPDKGYIEKICKHLVKSLN
FT                   MLQTSIEYTELNIASLEILLNSPNFFGQKELIKVRSVGNSIDQNLKIILSRDYINFPVF
FT                   IGEEMTSSSSFRKFFETEEYLAATACYHDDEVKIERIILDKVGKTNKIISKEANAYLKA
FT                   HLKGDHNLVCNEINKLIYFVHDRKEITLNDVLEVISSEITANGSDLAIYFSKKDYSNFL
FT                   QELDILKKQNINEVLMIRALIRHYLNLYIVLSKVKNGECLELAIKSLSPPIFYQYINDF
FT                   TKIASSLSLAECLETLKLLQQAEVEYKLNPASFDLLQKIYTR"
FT   gene            complement(199727..200197)
FT                   /locus_tag="A1E_00880"
FT   CDS_pept        complement(199727..200197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00880"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73124"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXP1"
FT                   /protein_id="ABV73124.1"
FT                   /translation="MRSVFIIIFFLISSCNLKPVYREAYNRNDDLEAIEVEPIKTIEGA
FT                   EFYHRLTSILPQRTKAKYLLKVELIATTMPATIDKKSNILREYINQLVRYKLIDIESQK
FT                   VLIEEQFYQNTSYNAIFTPYATNVERHGTGIDLAYQAAEEIRSRLILYFIRK"
FT   gene            200419..200691
FT                   /locus_tag="A1E_00885"
FT   CDS_pept        200419..200691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00885"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00885"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73125"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXP2"
FT                   /protein_id="ABV73125.1"
FT                   /translation="MKLYITCSSIQKCSKSNKNIYINTDKAKTVKITKEDLEKSFKLHE
FT                   EKLIILAQKLSSQEPINNDNYNPQTEYYRLIGDDGISQYIPTTEL"
FT   gene            complement(200877..200969)
FT                   /locus_tag="A1E_00890"
FT   CDS_pept        complement(200877..200969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00890"
FT                   /product="hypothetical protein"
FT                   /note="COG1466 DNA polymerase III, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00890"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73126"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXP3"
FT                   /protein_id="ABV73126.1"
FT                   /translation="MFLESNPNVLIHEVAEHGKKDLVVEILDAN"
FT   gene            complement(201646..203139)
FT                   /gene="holA"
FT                   /locus_tag="A1E_00895"
FT   CDS_pept        complement(201646..203139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="A1E_00895"
FT                   /product="DNA polymerase III subunit delta"
FT                   /note="COG0265 Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00895"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73127"
FT                   /db_xref="GOA:A8EXP4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXP4"
FT                   /protein_id="ABV73127.1"
FT                   /translation="MILQEVKMTKLSIVLKLLFIINLVFLNKIVLASAEMNSTIFEKAK
FT                   KAIVTIDTRIAVSAYEDTSSWTGTGFINDKQNGYIITNTHVVGVASIGTYFVTFYNGEQ
FT                   AEAKLIYYDIWQDYAILKVESKDIPASVTQISFASELPKLNQKVFVVGNTEAQGFSFHT
FT                   GYLSDLYNIAGMMPQCTYVISLNTTGGASGSPVLNDKIEAIGVLYGGGKTHSLALHGDY
FT                   VARTLESLKNNKEPKRHHIGVISELYSLNKAVKHHNFPKEEMDKYINKFPDSRNRVISV
FT                   KTILAGSPAEKLLKAGDIIWAVNDKELGGNLALFDKEMDNFKGIAIKLTIFRDGKKLEQ
FT                   VVDLYDINSNKITKMVNFGGAIFFETDDYFSNKSGIPLKALSIASVQSGSSFSSIPTFF
FT                   TKDYKNIYRLQMLEIKDLNLSNIDDLVKFLPAITKEKFITVRFRNYQPYYANFGYNELI
FT                   SSHNNMIADVTLDSIDIKPYILKYNTISHDWDMENIKFQ"
FT   gene            203206..205089
FT                   /locus_tag="A1E_00900"
FT   CDS_pept        203206..205089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00900"
FT                   /product="molecular chaperone DnaK"
FT                   /note="COG0443 Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00900"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73128"
FT                   /db_xref="GOA:A8EXP5"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXP5"
FT                   /protein_id="ABV73128.1"
FT                   /translation="MGKVIGIDLGTTNSCVAVMEGKEPKVIENSEGERTTPSIIAFANG
FT                   EKLVGQSAKRQAVTNPRNTIYAVKRLIGRNFTDPMVKKDQDIVPYNIVKAQNGDAWVEA
FT                   DNNKYSPSQISAFILQKMKETAENYLGEKVTQAVITVPAYFNDAQRQATKDAGKIAGLE
FT                   VLRIINEPTAAALAYGFDKSASKTIAVYDLGGGTFDISILEIGDGVFEVKSTNGDTFLG
FT                   GEDFDTRILNHLIDVFKKASGIDLRNDPLALQRLKEAAEKSKKELSSAVTTDINLPYIT
FT                   ADSSGPKHLNIKFTRAELEKLVDDLIEKTIEPCRQALKDAGLKPSNIQEVVLVGGMTRM
FT                   PKVQEAVKKFFGREPHKGVNPDEVVALGAAIQGGVLNKEVTDILLLDVTPLSLGIETLG
FT                   GVFTRLIERNTTIPTKKSQIFSTADDNQHAVTIRVFQGERQMAKDNKLLGQFNLEGIPP
FT                   APRGVPQIEVTFDIDVNGIVHVSAKDKASGKEQKVTIQASGGLSDAEIAQMVKDAEQNA
FT                   DEDKKRKELIETKNAADSLVYSTEKTLKDYSDKLSSEDKGLVEEALAALKAVLDSEDAA
FT                   LIKEKTESLTAASMKIGEAMYKAQSEGQPSEENTANDEKVVDADFKDVEKK"
FT   gene            205199..206326
FT                   /locus_tag="A1E_00905"
FT   CDS_pept        205199..206326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00905"
FT                   /product="DnaJ"
FT                   /note="COG0484 DnaJ-class molecular chaperone with
FT                   C-terminal Zn finger domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00905"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73129"
FT                   /db_xref="GOA:A8EXP6"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXP6"
FT                   /protein_id="ABV73129.1"
FT                   /translation="MSQDYYQILGVSKTASSAELKKAYHKLAKQYHPDNAAAGDTNAEK
FT                   KFKEINAAYDVLKDEQKRAAYDRFGHDAFQNQQSRRGAGGGTSSFHPDINDIFGDFFSD
FT                   FMGGSRRSRPTSSKVRGSDLKYDLTINLEEAFHGIEKNISFSSEVQCDTCHGNGSEKGE
FT                   TITTCDACSGVGVTRIQQGFFTIEQTCHKCQGNGQMIKNPCKKCHGMGRYHKQRNLLVN
FT                   IPAGVENGTRIRHTGEGEAGIRGGNSGDLYVDISIKPHDIYKVDGANLHCKLPISFVNA
FT                   ALGGEVEVPIIEGGKVNLTIPAGTQNGDQLRLRSKGMSKMRSTIRGDMLTHIHVEVPKN
FT                   LSKRQRELLEEFKKESMSEKENDSSFFNKMKSLWS"
FT   gene            206461..206649
FT                   /locus_tag="A1E_00910"
FT   CDS_pept        206461..206649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00910"
FT                   /product="hypothetical protein"
FT                   /note="COG4572 Putative cation transport regulator"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00910"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73130"
FT                   /db_xref="InterPro:IPR009317"
FT                   /db_xref="InterPro:IPR037205"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXP7"
FT                   /protein_id="ABV73130.1"
FT                   /translation="MLRIFYREAFNHAFERYNDADKRHKDDSREAVAHKVACSAVEKQY
FT                   HKNDKGHWVEKISPRNL"
FT   gene            206730..207473
FT                   /locus_tag="A1E_00915"
FT   CDS_pept        206730..207473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00915"
FT                   /product="hypothetical protein"
FT                   /note="COG4105 DNA uptake lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00915"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73131"
FT                   /db_xref="GOA:A8EXP8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXP8"
FT                   /protein_id="ABV73131.1"
FT                   /translation="MKLAKLLSVLFIIGLSLSGCKSKKNSDDVVVPIPTLYNEGIILLE
FT                   KKKYKKAAEEFGRVFYQHPGNEMTPQAELMQAYSLFLATQYEEAVDVLDMFINLHPANV
FT                   DIAYAYYLKALSYYMLISDVNHDQSRTFLAKDSFKDIIEKFSNTKYAIDASLKIDLVND
FT                   HLAGKEMMVGRFYLKKKNPIAAINRFEEVINHYQTTSHSVEALYRLAESYMMLGLPDEA
FT                   KKYASVLGYNYPDSQWYSYAYKLVK"
FT   gene            207631..209271
FT                   /locus_tag="A1E_00920"
FT   CDS_pept        207631..209271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00920"
FT                   /product="DNA repair protein RecN"
FT                   /note="COG0497 ATPase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00920"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73132"
FT                   /db_xref="GOA:A8EXP9"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXP9"
FT                   /protein_id="ABV73132.1"
FT                   /translation="MLQSLLVKNFILIDELEIEFNKGLCVITGETGAGKSILLDAILFC
FT                   LGYKISNNIIKRGKDYAVVSIIYSLNEEIKNFLLQNFIEPEELLLVKCLHKTEGRKKFF
FT                   INNQVVNKTLMQQLATYLFELHGQNHNISLLEANTQRDILDSYGNILDFRAELSKCYQI
FT                   WKDTQKEIAEITLKQNSIEQEIDYLSFATEELTKLNIQIGEEEKLANIRKDLQNKDKEL
FT                   QLIKDTLEQINNPEINISINRAEKLLARQGQNKHFKTIATSLEEAYNNLEEARQELSNL
FT                   LDSFNYKESNLEETEERLFLIKAISRKYNVPANGLGVFLDKSLEQLGILKNKIANSNEL
FT                   KAQEVLLQQKYYELASSLSKKRLIAAKHLEESLHQELKQLKMAKTIFRIEITARKEPTA
FT                   CGNDDIVFKASTNPGTAAEVINKIASNGELSRCMLALKTSLFDKMVKASIIFDEIDVGI
FT                   GGEVADKVGERLKKLSTVTQVIVITHQPQVAGKADLHIKIEKTQLEKETKVTAKALNLS
FT                   ERQEELARMISGKTITKTSLKAAKELLHL"
FT   gene            209552..210946
FT                   /gene="dnaK"
FT                   /locus_tag="A1E_00925"
FT   CDS_pept        209552..210946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="A1E_00925"
FT                   /product="molecular chaperone DnaK"
FT                   /note="COG2317 Zn-dependent carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00925"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73133"
FT                   /db_xref="GOA:A8EXQ0"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXQ0"
FT                   /protein_id="ABV73133.1"
FT                   /translation="MPIGSGESRSNEIITLTSLVHSMLKSPLLKELLSKAKEESKNLNN
FT                   WQNANIREIERKITDANCIDEQLQKKLVAATNKAELVWREARKNNDYNLFKPHLQKVLD
FT                   YTKEVAKARADVFNCGLYDSLIDMYDPSRKSNEIKQFFSVLKKELRELINKVLEKQKGE
FT                   KKLVKISRLDPKMQKRIGKRIMEIMQFDLAKGRLDESNHPFCSGTPNDIRLTTRYDKDN
FT                   FISGLMGIIHETGHALYEQNLPEMYKGQPVGLAKGMAFHESQSLFMEMQVGRSREFTEF
FT                   LAKLLHDEFNIKGEEYSAENLYRKITRVMPDFIRVDADEITYPMHVILRFEIEELLING
FT                   NLNLDDLPTFWDSNMVEYLGIKPTSFSNGCLQDIHWSHGSFGYFPAYTNGAIIAAMMMK
FT                   KVKEMHPNIKDDILNGDFSNLNNYLNKNFRNLGSLNNSADLLKSASGEDKINPEVYIKY
FT                   LEGKYL"
FT   gene            211183..213972
FT                   /gene="kgd"
FT                   /locus_tag="A1E_00930"
FT   CDS_pept        211183..213972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kgd"
FT                   /locus_tag="A1E_00930"
FT                   /product="alpha-ketoglutarate decarboxylase"
FT                   /EC_number="1.2.4.2"
FT                   /note="COG0567 2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase (E1) component, and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00930"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73134"
FT                   /db_xref="GOA:A8EXQ1"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXQ1"
FT                   /protein_id="ABV73134.1"
FT                   /translation="MEEYLKKTDFLFGGNAVFLEELYRQYLTNPTSVDQTWRKFFSQIK
FT                   DNNESLFNKSTAKIIISNDTKKESLNNNLSSEILNSFKAKEMINAYRKYAHYLANLDPL
FT                   GLEIRKTKNDLKLNIETFGFDSGQLEDNINITDEFVGTWNCKLSELVTKLDKVYTNSIG
FT                   IEFEQIENVEEKNWLYNKLESEVIFSSEEKKAILNDLVEVEGFEQYLHTKFPGAKRFSI
FT                   EGGDASIVAMSKAIDLSMHQGVEELVIGMAHRGRLNTITKVVGKPYKAVIAGFISGSVF
FT                   PDELNVSGDVKYHLGYSSDRVVGDKKIHLSLAYNPSHLEAVNPIVAGKVRAKQDILKDT
FT                   KRNKVKAILVHGDAAFCGQGVVAESLSMSPLAAYDIGGILHFVINNQLGFTANAADTRA
FT                   SRYSTEFAKIIAAPILHVNGDDIEAVLKATNIAVEYRQKFGKDVVVEIVCYRKYGHNEG
FT                   DEPMYTQGQMYNIIKSKLTPGNIYANELVKSGIIDHNYFPKLKEAFKAKLDKEYEHAKS
FT                   YKHEAHFLGGLWQGISRTLKSTSVTGINKKTLQDLGIKLCTIPKNFTVNAKLVKLFDAR
FT                   KASLTTDKPIDWATAEQLAFATLLNTGTYIRLTGQDSERGTFSHRHSVLHNQIDDTTYI
FT                   PLNNLSKNQAKCEVADSNLSEYAVLGFEYGYSLANPKNLILWEAQFGDFANGAQIIFDQ
FT                   FIASAETKWLRMSGLVVLLPHAFEGQGPEHSSARLERFLQLAAEDNMYVTYPTTPASIF
FT                   HLLRRQILDDTRKPLIVMSPKSLLRHKYAVSKLDELGENTTFLPVLDEVNKVDANNITK
FT                   VILCSGKVYYDLFEMRGNNSNIAIIRLEQLYPFEKKVVASLLKKYNRTQEFIWCQEEPK
FT                   NMGAWRYIVSHLNDALKEAAINNEFKYVGREESASPAVGSLQVHNKQQERLLKEAIEI"
FT   gene            214141..215346
FT                   /locus_tag="A1E_00935"
FT   CDS_pept        214141..215346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00935"
FT                   /product="dihydrolipoamide acetyltransferase"
FT                   /note="COG0508 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide acyltransferase (E2) component,
FT                   and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00935"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73135"
FT                   /db_xref="GOA:A8EXQ2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXQ2"
FT                   /protein_id="ABV73135.1"
FT                   /translation="MSIKIIVPSLGESVTEATIAKWYKKEGDSVKTDDLLLEIETEKVT
FT                   LEVNAPCNGTIGKILKTDGANVEVGEEIGEINEGAVANTAGTNNESANSQAATQPTSEK
FT                   PIEKPAVANNTLAPSVQKLVTENKLDPNNIKGTGRDGRITKGDVLETLNTPPAATTAPA
FT                   MSKANEDRVQRVRMSRLRKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEK
FT                   KHAVKLGFMSFFVKATIEALKLIPSVNAEIDGNDLVYKNYYDIGVAVGTELGLVVPVVR
FT                   GADKMEFAEVEKAIGTLAKKAREGKLSMADLSGGTFSISNGGVYGSLLSTPIINPPQAG
FT                   ILGLHKTEERPVVIDGKIEVRPMMYIALSYDHRIIDGKEGVSFLIKIKQLIEHPEKLLL
FT                   NL"
FT   gene            215505..215921
FT                   /locus_tag="A1E_00940"
FT   CDS_pept        215505..215921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00940"
FT                   /product="hypothetical protein"
FT                   /note="COG0720 6-pyruvoyl-tetrahydropterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00940"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73136"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXQ3"
FT                   /protein_id="ABV73136.1"
FT                   /translation="MIKCTRRIEFDSGHRIIGHQNKCQFLHGHRYVLEITIAANKTDTL
FT                   GMVIDFGLIKDLAKKWIDKNFDHSLILHQDDKEMGQQIENCTGQKIYYMRNNPTAENIA
FT                   IHLKNEIFPKLFINQQFSVTSLKLFETPNCFVEV"
FT   gene            215924..216388
FT                   /locus_tag="A1E_00945"
FT   CDS_pept        215924..216388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00945"
FT                   /product="Periplasmic divalent cation tolerance protein"
FT                   /note="COG1324 Uncharacterized protein involved in
FT                   tolerance to divalent cations"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00945"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73137"
FT                   /db_xref="GOA:A8EXQ4"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR022438"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXQ4"
FT                   /protein_id="ABV73137.1"
FT                   /translation="MHLDEMKMGYMQITLDKGKESVSRGTEHTKVREYPRTYKDDIVNF
FT                   SSSSSIQDYCLTLTTTNDLQIAEKIASVLLELNLAACIQIDNVKSYFRWDSRVTLETEY
FT                   RLIIKAKSSNYKKIENKILEIHNYELPQIIKINIDYGFQKYLKWIDQNSK"
FT   gene            216429..217628
FT                   /locus_tag="A1E_00950"
FT   CDS_pept        216429..217628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00950"
FT                   /product="proton/sodium-glutamate symport protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00950"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73138"
FT                   /db_xref="GOA:A8EXQ5"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXQ5"
FT                   /protein_id="ABV73138.1"
FT                   /translation="MKLWQKVTLGLILGIIFGIYLPQYVNYIKPIGDIFLRLIKMIITP
FT                   LIFFSLVSGITSMNDTSALGRVGMKAVAAFLGTTFFATVFGLTVALVLKPGVGIHIDFA
FT                   SSETTSRTSFNIIDFFVNIVPDNAVGAFAKGDVLQVVFFAIFVGITLNKMKSINEPITD
FT                   LIHVMSKLILKMISFVIQLSPYGAFALTGWIVGMQGVEVMISLSKLVVAVVVAMTFQYL
FT                   VFGLLIYLFCRVSPIPFYKKSFEYQMLAFATSSSKATLATTMQVCREKLGISESSTAFV
FT                   LPIGASINMDGFAINLSLTTIFFAQMMGVTLTPHDYLVIIITSTLGSIGGAGIPGASLI
FT                   MLPMVLSSVHLPIEGVAIIAGIDRILDMLRTTINITGDATITMIIDNSEDTLDKEVYLS
FT                   "
FT   gene            217966..218178
FT                   /locus_tag="A1E_00955"
FT   CDS_pept        217966..218178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00955"
FT                   /product="dihydrolipoamide acetyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00955"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73139"
FT                   /db_xref="GOA:A8EXQ6"
FT                   /db_xref="InterPro:IPR007072"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXQ6"
FT                   /protein_id="ABV73139.1"
FT                   /translation="MIGTTQGLIQALKPKTIIKFGSFKGGSAILVGDIQSLSVKDGKII
FT                   SIDIDFDNIDQTVKEDNRIEFLQGD"
FT   gene            complement(219739..219831)
FT                   /locus_tag="A1E_00960"
FT   CDS_pept        complement(219739..219831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00960"
FT                   /product="hypothetical protein"
FT                   /note="COG1301 Na+/H+-dicarboxylate symporters"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00960"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73140"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXQ7"
FT                   /protein_id="ABV73140.1"
FT                   /translation="MLGGWPPLDYAISNNNIEIANFVLQSGVHL"
FT   gene            complement(220076..221236)
FT                   /locus_tag="A1E_00965"
FT   CDS_pept        complement(220076..221236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00965"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00965"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73141"
FT                   /db_xref="GOA:A8EXQ8"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXQ8"
FT                   /protein_id="ABV73141.1"
FT                   /translation="MKVTTDDLSIYIHWPFCLSKCPYCDFNSHVASTIDHEQWLKSYER
FT                   EIEYFKPIIQNKYIKSIFFGGGTPSLMDPVIVEVIINKIINIAIIDHQTEITLETNPTS
FT                   FETEKFKAFKSAGINRVSIGVQSLKEDDLKKLGRTHDCMQAIKTIETANTIFPRVSFDL
FT                   IYARSGQKLKDWQEELKQAMQLATSHISLYQLTIEKGTLFYKLFRDGTLILPHSDEAAE
FT                   MYEWTNHYLESKKYFRYEISNYALVSQECLHNLTYWNYNSYLGIGPGAHSRIIEPSSSV
FT                   LAIMMWHKPEKWLDSVKIKNVGIQTNIKLTHQEVIAEMLMMGLRLKSGINLSILEQKLN
FT                   TKLENILDMNNLKHYQNQDLIKLDQNVYLTDKGLMLHSYIVPRLIK"
FT   gene            complement(221532..221672)
FT                   /locus_tag="A1E_00970"
FT   CDS_pept        complement(221532..221672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00970"
FT                   /product="Transposase and inactivated derivative"
FT                   /note="COG0635 Coproporphyrinogen III oxidase and related
FT                   Fe-S oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00970"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73142"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXQ9"
FT                   /protein_id="ABV73142.1"
FT                   /translation="MFDHGALKNTWINDYQLINVYDISDQKLKENALSGILQFFMKHIH
FT                   A"
FT   gene            complement(222056..223405)
FT                   /locus_tag="A1E_00975"
FT   CDS_pept        complement(222056..223405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00975"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /note="COG0541 Signal recognition particle GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00975"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73143"
FT                   /db_xref="GOA:A8EXR0"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXR0"
FT                   /protein_id="ABV73143.1"
FT                   /translation="MFKTLTQNLTKAFDQLVGSGILTEAQIDATMRDIRVALLESDVAL
FT                   PVIKDFIAEVKQKALGQEVIKSVSPGQMIIKIIHEEMINLLAASESETKLNLNSKPPVN
FT                   FLMVGLQGSGKTTASGKLALRLKNHNKKVLLVSLDTYRPAAQEQLAILANLVQINSLPI
FT                   VQGEKPLDIVKRAIAEAKLSAYDVVIYDTAGRTQIDKEMMEEALSIKKIVEPTETLLVI
FT                   DSMTGQDAVVTASSFNEKLEISGLILSRIDGDSKGGAALSVKYITKKPIKFLSNGEKLT
FT                   DLEEFDAKRLASRILDMGDIISFIEKASGLVNREEAEKTAAKLKKGKFDLNDYMQQIRS
FT                   IKKMGGFGSILSMLPGSGKIMDQIDQSKLNSKIIEHQEAIILSMTPKERKNPDIINASR
FT                   RKRIALGAGTTVQKVNILLKQYKQISDMMKKASKVNPKNLLRSGLGKVFS"
FT   gene            complement(223601..224395)
FT                   /locus_tag="A1E_00980"
FT   CDS_pept        complement(223601..224395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00980"
FT                   /product="DNA polymerase III subunit delta"
FT                   /note="COG0470 ATPase involved in DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00980"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73144"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXR1"
FT                   /protein_id="ABV73144.1"
FT                   /translation="MIIERLEFNLKYNKLYNSWLIEAENIEQALKDVEDFIYVKLFKNN
FT                   IPLENNPDYHFIARETSSISNVKNISIEQIRKLQDFLNKTSAVSGYKVAVIYSADLMNL
FT                   NAANSCLKILEDVPKNSYIFLITSRAASIIATIRSRCFKINMRSSIHNTQNPLYSEFIQ
FT                   PIADDKTLDFINRFTTKDRELWLDFIDNILLLMNRILKKSANVNIELLDLENKIFNKLS
FT                   NQHPSYLLQKFTNIKKLIYNTIDYDLDLKASYILVVNEFSSN"
FT   gene            complement(224693..225025)
FT                   /locus_tag="A1E_00985"
FT   CDS_pept        complement(224693..225025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00985"
FT                   /product="DNA-binding protein HU"
FT                   /note="COG0776 Bacterial nucleoid DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00985"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73145"
FT                   /db_xref="GOA:A8EXR2"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXR2"
FT                   /protein_id="ABV73145.1"
FT                   /translation="MSAHNKHESKKMNKTEFIAFMTNHGRNHKHASYKSLTKADAEKAL
FT                   NLVLDSVINAIKSHYNINITGFGSFEIHHRKAREGRNPKTGAKMKIDAYNQPTFRAGRK
FT                   MKEACN"
FT   gene            225535..228561
FT                   /locus_tag="A1E_00990"
FT   CDS_pept        225535..228561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00990"
FT                   /product="Hydrophobe/amphiphile efflux-1 HAE1 family
FT                   protein"
FT                   /note="COG0841 Cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00990"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73146"
FT                   /db_xref="GOA:A8EXR3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXR3"
FT                   /protein_id="ABV73146.1"
FT                   /translation="MLLSEICIKRPVFTTVLSLVIVALGGFFVTKLQIRGTPDISVPII
FT                   NVNAYYAGADALYMEKEITTRIEKALKTVKNLDYITSHSSTGKSSITLSFLLSTDIEVA
FT                   LNDVRSKISDITYMFPHDMKTPSVAKLDTNSFPSLIISIESDQYSDLELTKIVKDSLQT
FT                   PLDKLTSVGQSQIYGGREYIMRIEPDSKKLYQYKISLLEIESAIKEQNKDYPAGTIKTR
FT                   SNNFIVTLQGSLSTPEEFGNIILKVQNRSIIKLRDIAKISLTSPDKDIIFRYNGKSSIA
FT                   LGLIKESKANVIDLSNEVTKELERIKKLMPKGISMGVVYDGATPIKESIYAVFQTIVEA
FT                   LILVVLVIYLFLASAKMTLILFVTIPVSLIGTFSVMYAFGFSINIFTLLAMILAIGIVV
FT                   DDAIVMLENIFRYNEMGHKPMAAAMLASKEIGFAIIAMTITLAAVFLPVGFIEGFIGKL
FT                   FIEFAWTLACCVLFSGFVALTLTPMMSSRMVTKHSKDLPKFLVKFNDILQFIQNKYIYY
FT                   LNLTFENKKKIVIIIASSFIVLIISFKFTQKVFIPQEDDGFLQLSLKGPEGSSLESSTK
FT                   VVTEAEKILANYKDILGYLMIIGAGGSDNVFGFIPLKDWSDRSRSQETIKNILNKQFSE
FT                   IPGMSIFAMAPRSMVSGNAISPIEFTIQTSLEYDDLDKISQQFIDIMKTNPIFLNVNRN
FT                   LQSTIPTISIDVKRDKAYLYGMDLANIGKTVQYLLAGQQIGDFRIGNDLYNVILQFNPK
FT                   DRKDISAFSKILIRAKNNNMLPLESIANITEKISVKSYSHYNNSKSVTISSDLTPDGKI
FT                   NDAIDEINKIAAKLLDPSNTIIEYIGEIKQMREANSNMLITFVFALVFIYLVLAAQFES
FT                   FTDPLLILLAVPFSITGGVLTLWLAGNSLNMYSNIGLITLIGLITKNSIMIVEFANQLR
FT                   EKGVKVRTAIIESSKLRLRPILMTNLAAVVGALPLVFADGTGAAARNSIGFVIVGGLSF
FT                   GTIFTIFVIPVIYQTFKKD"
FT   gene            228648..228857
FT                   /locus_tag="A1E_00995"
FT   CDS_pept        228648..228857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_00995"
FT                   /product="hypothetical protein"
FT                   /note="COG2155 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_00995"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73147"
FT                   /db_xref="GOA:A8EXR4"
FT                   /db_xref="InterPro:IPR007211"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXR4"
FT                   /protein_id="ABV73147.1"
FT                   /translation="MLINTSNNLLITTIHLLSSIGAINWGLVGLCNFNLVTLLFGSFPI
FT                   IVTILYIIIGFCGVYSFLYLGKLF"
FT   gene            complement(228970..229743)
FT                   /locus_tag="A1E_01000"
FT   CDS_pept        complement(228970..229743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01000"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73148"
FT                   /db_xref="GOA:A8EXR5"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXR5"
FT                   /protein_id="ABV73148.1"
FT                   /translation="MKYNRIYINSHLAENSKLELANDHIHYIKTVLRLKVNDGLRIFNG
FT                   TDGEFLAQITDIGKNNLSVKLKEQLKKPDTESALTLAVAIIKQDKLMLTINMATQLGIT
FT                   KIIPLITKRCQFRSVNIKRLTKCMIEATEQSERLIPPIIEQAIKLQDYLKKNNNLMLYA
FT                   NEYEKEENSILQITSLLNNSDIDIVIGPEGGFTIDELQLLASYKNTKSISLGSNILRAE
FT                   TAAITAIAQVALTISFLRRWKSEKKYNNTSSIYAF"
FT   gene            complement(230225..230386)
FT                   /locus_tag="A1E_01005"
FT   CDS_pept        complement(230225..230386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01005"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73149"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXR6"
FT                   /protein_id="ABV73149.1"
FT                   /translation="MKFKIPIEVDIKSLTDEETALDSLNANILNALTEVNDSLIQDSIN
FT                   YVILIHWQ"
FT   gene            complement(230518..230709)
FT                   /locus_tag="A1E_01010"
FT   CDS_pept        complement(230518..230709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01010"
FT                   /product="Bifunctional penicillin-binding protein 1C"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01010"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73150"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXR7"
FT                   /protein_id="ABV73150.1"
FT                   /translation="MWETTLILFDAYKYLFTKCLAAHPQDIMYNQLISLPIKFNQKNLM
FT                   QSTIIKLIISFGLQVMHE"
FT   gene            231923..232018
FT                   /locus_tag="A1E_01015"
FT   CDS_pept        231923..232018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01015"
FT                   /product="hypothetical protein"
FT                   /note="COG1385 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01015"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73151"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXR8"
FT                   /protein_id="ABV73151.1"
FT                   /translation="MLSNAAVVAGDKDARVLDKDVWIASIYCTNK"
FT   gene            complement(232940..233386)
FT                   /locus_tag="A1E_01020"
FT   CDS_pept        complement(232940..233386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01020"
FT                   /product="hypothetical protein"
FT                   /note="COG0589 Universal stress protein UspA and related
FT                   nucleotide-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01020"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73152"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXR9"
FT                   /protein_id="ABV73152.1"
FT                   /translation="MSGNIRFKNILIPIDLNDKKSIKGILSKALMLATSFQAKLYFMYV
FT                   IPEFGTKLFEDYLPKNWRTEKKEKYQAQIKELIKQYIPDEIATDYYIGSGAVYDEIIKH
FT                   SNEIKADLIIISAVRLQLKDYMLGPNASKIVRHSDISVLVVRDQ"
FT   gene            complement(233396..234346)
FT                   /locus_tag="A1E_01025"
FT   CDS_pept        complement(233396..234346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01025"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73153"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXS0"
FT                   /protein_id="ABV73153.1"
FT                   /translation="MNSLKLGLYTTIVSILLIYSNIYAAPKVIKIGTGSILKGYYAIGL
FT                   DLCKTITNDNKNNEHIKCEVVATNGSIENLKLLQQGKIDLALVQANIALEAYEGIGYYH
FT                   DQEKMQNLRQVLNLHDEFFTVIVKDEDKIKVFADIDGKKITNGPAFSGSNITYDAVRSL
FT                   YKFSKAPEELQINYEDSIDKFCNKEIDAIIMMVGHSNPLVNLIANKCKVDFISIENDKI
FT                   AKLVKQNRAFHKTILHKGLYPAIANDQTTIKVSAILVTRDDANRDILDKFIGAFHRNVA
FT                   NFKLSNYLLNNFDINYFADTKNFVLPKHDAVRNKN"
FT   gene            complement(234351..235421)
FT                   /locus_tag="A1E_01030"
FT   CDS_pept        complement(234351..235421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01030"
FT                   /product="hypothetical protein"
FT                   /note="COG2358 TRAP-type uncharacterized transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01030"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73154"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXS1"
FT                   /protein_id="ABV73154.1"
FT                   /translation="MIRKILLFVFLAFTIIWFAIAYTIKNNVVSLIKNSESDNLKIYYN
FT                   VVKFSGYPFNWKITVTDPKVKLIDHVNSKEFTSENIVLNIAFSTKRATLNFGPFIREVA
FT                   NYGDKTFTYDIRSDDDIKSIGKFNKPLYKISKDDNLKEIFKSIQLNNKALSIFKDNYEI
FT                   FKINNLAFLIRKQNLASKENISLSLNMNYDSTKDILHFKNANLDIAISLKFAEDRENSA
FT                   ILQNFNIERLIFTCDNDSKVTVNGALQFFANKLPEGKLYFELENYNSIVDKLLPNNIIF
FT                   SKKIIKTIIAKAINKASDTDLNIDQNDTNWAYNNMDKAKFNIEFSDKGINIGSINLLEL
FT                   KLGEHEEEQNTANNLN"
FT   gene            complement(235434..235772)
FT                   /locus_tag="A1E_01035"
FT   CDS_pept        complement(235434..235772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01035"
FT                   /product="DNA polymerase III subunit delta'"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG0633 Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01035"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73155"
FT                   /db_xref="GOA:A8EXS2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXS2"
FT                   /protein_id="ABV73155.1"
FT                   /translation="MSGKIKVTFIINDGEEKTVEAPIGLSILEIAHSNDIDLEGACEGS
FT                   LACATCHVILEEEFYNKFKKPTEAEEDMLDLAFGLTDTSRLGCQIILTEELDGIKVRLP
FT                   SATRNIKL"
FT   gene            complement(235834..237771)
FT                   /gene="hscA"
FT                   /locus_tag="A1E_01040"
FT   CDS_pept        complement(235834..237771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscA"
FT                   /locus_tag="A1E_01040"
FT                   /product="chaperone protein HscA"
FT                   /note="COG0443 Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01040"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73156"
FT                   /db_xref="GOA:A8EXS3"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXS3"
FT                   /protein_id="ABV73156.1"
FT                   /translation="MQIIEIKEPEQADFKQERQIAVGIDFGTTNSLIAVSTNRKVKVIK
FT                   TIDDKELIPTTIEFTDGNFTIGNNNGLRSIKRLFGKTLKEILNTPILFSLVKDYLDINS
FT                   DKPKLNFANKRMRIPEIAAEVFIYLKNQAEKQLKTNITKAVITVPAHFNDAARGEVILA
FT                   AKIAGLEVLRLIAEPTAAAYAYGLNKNRLTRKLPYREEFVGNMLQHSTATYKAVREDPS
FT                   SGLTHKLPLEVELPEESNQNGYYLVYDLGGGTFDVSILNIQEGIFQVIATNGDNMLGGD
FT                   DIDVVITQYLCNKFDLPDSIDTLQLTKKVKETLTYEDNFNNDNISLNKQTLELLILPLI
FT                   KRTINIAKECLEQAGNPNIDGVILVGGATRISLIKNELYKAFKVDILSDIDPDKAVVWG
FT                   AALQAENLITPHTNSLLIDVVPLSLGMELYGGIVEKIIMRNTPIPISVVKEFTTYADNQ
FT                   TGIQFHILQGEREMAVDCRSLARFELKGLPPMKAGDIRVEVTFAIDADGILSVSAYEKI
FT                   SHTSHTIEVKPNHGIDKTEIDIMLEKAYKNAKIDYTTRLLQEAVINAESLIFNIERAIA
FT                   KLTTLLSESEISIINSLLDNIKEAARTRDPILINNSIKDFKSKIQKSIDTKFNIIINDL
FT                   LKGKNINHIQ"
FT   gene            complement(237762..238262)
FT                   /gene="hscB"
FT                   /locus_tag="A1E_01045"
FT   CDS_pept        complement(237762..238262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscB"
FT                   /locus_tag="A1E_01045"
FT                   /product="co-chaperone HscB"
FT                   /note="COG1076 DnaJ-domain-containing proteins 1"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01045"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73157"
FT                   /db_xref="GOA:A8EXS4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXS4"
FT                   /protein_id="ABV73157.1"
FT                   /translation="MQNYFQLLGLQQDYNIDLKILEKQYFAMQVKYHPDKAKTLQEKEQ
FT                   NLIIAAELNKAYSTLKDALKRAEYMLLLQNINLNDQKARTLLSSLELSIFWDEMEIIEN
FT                   TTICSDLEKIKAKYELMEKHEIDSLKQAFEEQNLSDATIKTSKLKYIGTLLNKLQKKIK
FT                   SCK"
FT   gene            238535..239125
FT                   /gene="rnhB"
FT                   /locus_tag="A1E_01050"
FT   CDS_pept        238535..239125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="A1E_01050"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="COG0164 Ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01050"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73158"
FT                   /db_xref="GOA:A8EXS5"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXS5"
FT                   /protein_id="ABV73158.1"
FT                   /translation="MEIDLLQYEKKYQEYIVAGIDEAGRGPLAGPVVASAVVIDNTNII
FT                   TGIKDSKKLSKRKRELLYEQITSNYIWSTAIISHTEIDEINILEATKKACSIAAANLTI
FT                   KPEIVLVDGNMQFNDKRFVSIIKGDNLSLSIAAASIVAKITRDRLMLDLSTEFPQYLWY
FT                   KNSGYGTKEHIQAINTHGLSPYHRKSFRYSCFI"
FT   gene            complement(239262..241247)
FT                   /locus_tag="A1E_01055"
FT   CDS_pept        complement(239262..241247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01055"
FT                   /product="excinuclease ABC subunit B"
FT                   /note="COG0556 Helicase subunit of the DNA excision repair
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01055"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73159"
FT                   /db_xref="GOA:A8EXS6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXS6"
FT                   /protein_id="ABV73159.1"
FT                   /translation="MNNFSIISEYKPAGDQPKAIDEIIAGLNSKKRSQMLLGITGSGKT
FT                   FTMANIIARMNRPTLIMAHNKTLAAQIYSEMKLMFPKNAIEYFVSYYDYYQPEAYIART
FT                   DTFIEKDSSINEQIDLMRHSATRSLLERRDVIVVSSVSCIYGLGSPNLYYQMTVNLESG
FT                   KSYPRDKLLSDLVNLQYERNDIGFERGCFRVKGDNIDIFPSHYSDKAWRLSFVGNELEY
FT                   IHEFDPLTGTKLAKLDKAMVFGNSHFVIPQETVNKAISEIEVELQKRLELLKSQNKILE
FT                   TQRLNQRTQYDLEMLTTTGSCKGIENYSRFLTGRNAGEPPPTLFEYLPKDALLFVDESH
FT                   VSVPQIRAMYNGDRARKKVLVEHGFRLPSALDNRPLKFEEWEKFRPQTIFVSATPGPFE
FT                   LEETGGLVVELIIRPTGLLDPECIIKPATNQVEDLISEIQTTIAKGLRVLVTTLTKKMA
FT                   EDLTTYLQELKYKSSYLHSNVHTLERLEILRDLRQGTINILVGINLLREGLDIPECGLV
FT                   AILDADKEGFLRSEVSLIQTIGRAARNSEGRVILYADKITKSIDKAVSETMRRRQIQQE
FT                   YNEKHGIIPQTINRTIYALTALKKIDSKLDKKQAHILFDNPAKLKAHIYKLKKAMLKAA
FT                   SNLEFEQATKLRDQLKNLEEAALELS"
FT   gene            241318..241629
FT                   /locus_tag="A1E_01060"
FT   CDS_pept        241318..241629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01060"
FT                   /product="Glutaredoxin, GrxC family protein"
FT                   /note="COG0695 Glutaredoxin and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01060"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73160"
FT                   /db_xref="GOA:A8EXS7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXS7"
FT                   /protein_id="ABV73160.1"
FT                   /translation="MNKTILHTIIIYTLASCPYCIKAKALLDKKEVVYEEIEVSNFTQE
FT                   EKEKLIKKAGGSRTVPQIFINNIHIGGNDDLQKLNEEGRLDKLLEGQPKKTPPAAASV"
FT   gene            243888..243989
FT                   /locus_tag="A1E_01080"
FT   CDS_pept        243888..243989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01080"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73161"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXS8"
FT                   /protein_id="ABV73161.1"
FT                   /translation="MMRQNIRNNADIETTTVNQNLIAVSVVDTIIFS"
FT   gene            244036..244212
FT                   /locus_tag="A1E_01085"
FT   CDS_pept        244036..244212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01085"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73162"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXS9"
FT                   /protein_id="ABV73162.1"
FT                   /translation="MIIDSTSTDLPIARVSGINLPMAGLVSSETTNTNLTNYTDIGAVI
FT                   LVHKMQLLAWHVC"
FT   gene            244206..244334
FT                   /locus_tag="A1E_01090"
FT   CDS_pept        244206..244334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01090"
FT                   /product="hypothetical protein"
FT                   /note="COG5265 ABC-type transport system involved in Fe-S
FT                   cluster assembly, permease and ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01090"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73163"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXT0"
FT                   /protein_id="ABV73163.1"
FT                   /translation="MLANTMRSRAVPNSASNNQNRIDILIRALWKLLLLELRILIK"
FT   gene            complement(245722..248340)
FT                   /locus_tag="A1E_01095"
FT   CDS_pept        complement(245722..248340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01095"
FT                   /product="ATP-dependent helicase"
FT                   /note="COG1074 ATP-dependent exoDNAse (exonuclease V) beta
FT                   subunit (contains helicase and exonuclease domains)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01095"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73164"
FT                   /db_xref="GOA:A8EXT1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR022438"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXT1"
FT                   /protein_id="ABV73164.1"
FT                   /translation="MSDLQQEASDPKYSVWVSASAGTGKTKVLTDRFLRLLIKGVEPAN
FT                   ILCLTFTNAAAVEMQARINSKLKYLSLCNAEKLEEELFLMLGNKPLQPELENAKTLYDK
FT                   ILNSNEPLNIYTIHAFCQKILKTCPLEAGITPEFKILEETKLQDIFLNIRNEIYLSDEH
FT                   NDLMKILLNRFHEITLQDIFSEIIEQKIKFKKLFTHKTIPGEIQNKRLALGELNNIYDK
FT                   VKNLFVKYDLEIEPKEFFFTKDGKKRKSLLSKELIRKYPKLLLELEKITSEIYHLDELR
FT                   RIEELEYHTNLLTKLAYIILKKYDSYKEENNLLDYDDLIYYTEKLLNNKATHEWLLHKL
FT                   ESKINHILVDEAQDTTPTQWNIITTLITEFNAMDKPNNSIFIVGDDKQSIFSFQGADLR
FT                   NFSLVNEQLKANLTKANKKFKNITLEYSYRSCTEILQFTHYVLQNIKSDYPNLFFPDNP
FT                   LISSFRTHQGTVTVWPLVTSKKQEELFWALPEDYKNSKSAADLLIEQIVNFIKEKIESK
FT                   EILPSICAMKSGYTKINLENSKEFVNQGAECILNVQCPSHSDYKNDSANFSNSSRISEK
FT                   DFMILVRKRDEFSNNLIKELSKAKLKIEISDRINLKDHLSIMDLMSVAKFVLLPDDDLN
FT                   LACLLKSPIIGINEQQLYELLINKKDQSLWDTLSLYLDIYEKLNSFIEIYKTSTAENFF
FT                   TIVVNSLNLRELLNVHNGDDSDDMINELLTLSSNYANDIDNSLQGFVAWFENNNIYIKR
FT                   NMEHSDKIRVMTVHGSKGLEAPIVILCDSTSLPVSSNKFIWNDNGEMFFSANAADTPQF
FT                   LQELKEAEKLKDLQEYIRLLYVAMTRAKDHLIICGFSNKATTSENSWYKIAKQTFDKFF
FT                   N"
FT   gene            complement(248521..249222)
FT                   /locus_tag="A1E_01100"
FT   CDS_pept        complement(248521..249222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01100"
FT                   /product="excinuclease ABC subunit B"
FT                   /note="COG3346 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01100"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73165"
FT                   /db_xref="GOA:A8EXT2"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXT2"
FT                   /protein_id="ABV73165.1"
FT                   /translation="MTNKINLTNFFVLITFITLISLGFWQISRLKEKKLFLASMQANLT
FT                   SPAINLEELGSNFIYRKVKITGQFLLNKDIYLYGRRSMSSEKDGYYLVTPFKTLEEQII
FT                   LVARGWFSNRNKNIITQAANNQKHEIIGVTMPSEKTRSYLPANDIKNNVWLTLDLKAAS
FT                   KALGLNLENFYIIEEGKNISNLDILLPLSINHVKAIRNDHLEYALTWFGLAISLIVIYV
FT                   IYKRHYKIHNF"
FT   gene            complement(249422..250111)
FT                   /locus_tag="A1E_01105"
FT   CDS_pept        complement(249422..250111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01105"
FT                   /product="DNA polymerase III subunit epsilon"
FT                   /note="COG0847 DNA polymerase III, epsilon subunit and
FT                   related 3'-5' exonucleases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01105"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73166"
FT                   /db_xref="GOA:A8EXT3"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXT3"
FT                   /protein_id="ABV73166.1"
FT                   /translation="MSSLREIILDTETTGLDPQQGHRIVEIGAIEMVNKVLTGRNFHFY
FT                   INPERDMPFEAYRIHGLSDEFLKDKPLFHTIADDFLEFISDSKLIIHNAPFDIKFLNHE
FT                   LSLLKRTEIKLLELANTIDTLVMARSMFPGAKYNLDALCKRFKVDNSGRQVHSALKDAA
FT                   LLAEVYVALTGGRQSTFKIVDRSIRINNLATHQVNNKTQQTTIVIKPTKEELQKHKDFI
FT                   NKILTPA"
FT   gene            complement(250099..250674)
FT                   /locus_tag="A1E_01110"
FT   CDS_pept        complement(250099..250674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01110"
FT                   /product="dephospho-CoA kinase"
FT                   /note="COG0237 Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01110"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73167"
FT                   /db_xref="GOA:A8EXT4"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXT4"
FT                   /protein_id="ABV73167.1"
FT                   /translation="MLAIGITGNYASGKTFILDYLAEKGYKTFCADRCIKKLYQDLRVQ
FT                   TQILKLLPELEYFNIRKISNLIYNNDLSREKLQNFIYPLLIDKLILFKKENATSKFGFA
FT                   EIPLLYEAKFDQYFDFVVTIYCSEEVRMQRAMTRSSFDIAIYNKIKEIQLPQESKIAKA
FT                   DFSINSGVDMLDLEKQISNLIKKLECQV"
FT   gene            complement(250668..251480)
FT                   /locus_tag="A1E_01115"
FT   CDS_pept        complement(250668..251480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01115"
FT                   /product="hypothetical protein"
FT                   /note="COG3494 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01115"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73168"
FT                   /db_xref="InterPro:IPR010415"
FT                   /db_xref="InterPro:IPR041255"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXT5"
FT                   /protein_id="ABV73168.1"
FT                   /translation="MLPNLGIIAGRGSLPYLIAKNYTTQGGKCYITAIQGETDINQIKN
FT                   FEYKVFKIGMVGEAIKYFKENEVQNIIFIGGVNRPNFKNLAVDKIGGLLLFKILGQKIR
FT                   GDDSLLKTVADFFESYGFKVISSNKIYKNQQCDSNIITDTHPKSSDKNDIELGIKILNH
FT                   LSPFDIAQSVIIESGYILGIEAAEGTDNLIARCADLRKNHHEGVLVKIPKLGQDTRLDI
FT                   PTIGPGTIQNLAKYNYCGIAIKAGEMIVVEQELTVKLANEHKIFIAKC"
FT   gene            252225..252704
FT                   /gene="coaE"
FT                   /locus_tag="A1E_01120"
FT   CDS_pept        252225..252704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="A1E_01120"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="COG3814 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01120"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73169"
FT                   /db_xref="GOA:A8EXT6"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXT6"
FT                   /protein_id="ABV73169.1"
FT                   /translation="MNTEYKKFVNEYMLEFVKKILTKIQHENLYWDQLIYISYRTDNPA
FT                   VILPLKVKQAYPKQITIVLQYQFENLIVNDTGFSLTVSFYGVKEIIYVPFDALISFIDS
FT                   NNNYSLTFNQLLNVQEYHQHEKEIRNNKSCKTSLSPNPNVIMLDKFRNSSKPKPH"
FT   gene            252709..253176
FT                   /gene="rnhA"
FT                   /locus_tag="A1E_01125"
FT   CDS_pept        252709..253176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="A1E_01125"
FT                   /product="ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="COG0328 Ribonuclease HI"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01125"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73170"
FT                   /db_xref="GOA:A8EXT7"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXT7"
FT                   /protein_id="ABV73170.1"
FT                   /translation="MNENISKVVIYTDGACAGNPGPGGWGALLQFNDTSKEILGYELDT
FT                   TNNRMEITAALEALRILKKSCNVEIYTDSKYLQQGITTWIHNWVKNNWCKSNNEAVKNA
FT                   DLWQKLYAELSKHTIIWKWVKGHANNSGNIAADKLAAQGRQTAIEILKCRV"
FT   gene            253164..253607
FT                   /locus_tag="A1E_01130"
FT   CDS_pept        253164..253607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01130"
FT                   /product="hypothetical protein"
FT                   /note="COG3761 NADH:ubiquinone oxidoreductase 17.2 kD
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01130"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73171"
FT                   /db_xref="GOA:A8EXT8"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR007763"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXT8"
FT                   /protein_id="ABV73171.1"
FT                   /translation="MSCIDKFFITFFHKKVGEDEFLNQYYESRNIDYLGRPRRFVIYNN
FT                   VNEPTKIAPSWHVWLHHLVNEIPKNIQLFPWQDNTHLAKFTYREEFKGDTECSTAAYIN
FT                   IREDASTGSTYKLPLEVECAKMSNKIAKKPPKTSYLKYNRWQP"
FT   gene            253629..254081
FT                   /locus_tag="A1E_01135"
FT   CDS_pept        253629..254081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01135"
FT                   /product="ABC transporter substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01135"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73172"
FT                   /db_xref="GOA:A8EXT9"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXT9"
FT                   /protein_id="ABV73172.1"
FT                   /translation="MKQNVIETIIGFVVLIIVLLFLIFAYKTGYSITSSKGYQVTANFQ
FT                   SAEGIAVGSDVMISGIKIGSIKKITLDPNSFYAIVYLNINDDVKIPKDSKAQVVTSGLF
FT                   GSKYISIVPGNDDENLAANEEIRYTQSAINIELLINKIVSSFGSKW"
FT   gene            complement(254695..254877)
FT                   /locus_tag="A1E_01140"
FT   CDS_pept        complement(254695..254877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01140"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73173"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXU0"
FT                   /protein_id="ABV73173.1"
FT                   /translation="MIDYSTLEMIKLYFKLRTAKSLSYYEELENDEKLSKLFRDSLNYF
FT                   IDNMAINYSKLSPIV"
FT   gene            255361..255621
FT                   /locus_tag="A1E_01145"
FT   CDS_pept        255361..255621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01145"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73174"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXU1"
FT                   /protein_id="ABV73174.1"
FT                   /translation="MSIHILILKTALSYDKLIFAKISVVRVTWRETQDIISRDMSRGID
FT                   LFKKIYAVSIYVGLTSSAGEEGCFNVRFVTLEEAGKLKHRK"
FT   gene            complement(257158..257229)
FT                   /locus_tag="A1E_01150"
FT   CDS_pept        complement(257158..257229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01150"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73175"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXU2"
FT                   /protein_id="ABV73175.1"
FT                   /translation="MEEKAAEYKLQQEQEVTINNKTA"
FT   gene            complement(257257..257397)
FT                   /locus_tag="A1E_01155"
FT   CDS_pept        complement(257257..257397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01155"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73176"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXU3"
FT                   /protein_id="ABV73176.1"
FT                   /translation="MKNKEKEILTSALIVDEEEEKLLKAQNAREDLKLILIHLLLFLLV
FT                   F"
FT   gene            258853..259002
FT                   /locus_tag="A1E_01160"
FT   CDS_pept        258853..259002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01160"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73177"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXU4"
FT                   /protein_id="ABV73177.1"
FT                   /translation="MSKKTKHTNGAIGTVIKDFLPHPKELLLKDDSVKVTIWLSKESIE
FT                   FFKG"
FT   gene            complement(259101..259192)
FT                   /locus_tag="A1E_t05694"
FT   tRNA            complement(259101..259192)
FT                   /locus_tag="A1E_t05694"
FT                   /product="tRNA-Ser"
FT   gene            complement(259271..259483)
FT                   /locus_tag="A1E_01165"
FT   CDS_pept        complement(259271..259483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01165"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73178"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXU5"
FT                   /protein_id="ABV73178.1"
FT                   /translation="MIDKYKDDMDSICHITTQLVNICENTTEPKVIEYFIDYLEPWQEL
FT                   PIHWYYNTMLPMAKVSSKLLNYDYK"
FT   gene            complement(260074..260217)
FT                   /locus_tag="A1E_01170"
FT   CDS_pept        complement(260074..260217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01170"
FT                   /product="hypothetical protein"
FT                   /note="COG1463 ABC-type transport system involved in
FT                   resistance to organic solvents, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01170"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73179"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXU6"
FT                   /protein_id="ABV73179.1"
FT                   /translation="MLRNNLKDISNPEIYIIANYEEPIIKNYTITDKIVKGKVYYLERL
FT                   KY"
FT   gene            complement(260563..261450)
FT                   /locus_tag="A1E_01175"
FT   CDS_pept        complement(260563..261450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01175"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73180"
FT                   /db_xref="GOA:A8EXU7"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXU7"
FT                   /protein_id="ABV73180.1"
FT                   /translation="MGRDFYNNFKPAKETFQTIDEALNRKLTDIIFNSTPEELTLTTNA
FT                   QPALMAVSMAIINTIKAETGKSLDSLCDYAAGHSLGEYSALCAAESISLIDTAKLLHVR
FT                   STSMQEACPEGEGSMAACINIPLQKLEQILEDINKINLCQIANDNIEGQIVISGKVDAI
FT                   DYAISIIKDLGYKAIKLKVSAPFHCSLMKLAEHKMQLALDKTVINKPIIPVIQNYTAKP
FT                   TTNPLEIKQNLILQICGRVRWRETLELFNTLEITHIVEIGAGNVLTNMLRKSDYPFKLS
FT                   NISELQHFLDNVHK"
FT   gene            261693..261899
FT                   /locus_tag="A1E_01180"
FT   CDS_pept        261693..261899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01180"
FT                   /product="hypothetical protein"
FT                   /note="COG0331 (acyl-carrier-protein) S-malonyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01180"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73181"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXU8"
FT                   /protein_id="ABV73181.1"
FT                   /translation="MKLGDYCTELEDIACGPYLTAFKKLFSKLLYSGRNKEKEIYLDIY
FT                   KEVIDQIQASIKIIELNKLHSKS"
FT   gene            263214..265898
FT                   /locus_tag="A1E_01185"
FT   CDS_pept        263214..265898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01185"
FT                   /product="DNA gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01185"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73182"
FT                   /db_xref="GOA:A8EXU9"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXU9"
FT                   /protein_id="ABV73182.1"
FT                   /translation="MTDKYSSNLVPVNIEDEMKVSYLDYAMSVIVSRAIPDVRDGLKPV
FT                   HRRIIYSMYEAGNHASKPYRKSARIVGDVMGKYHPHGDSAIYDSLVRMAQDFSLRLPLV
FT                   DGQGNFGSMDGDAAAAMRYTESRMAKVSHKLVEDIDKETVSFNPNYDGSEEEPSVLPAM
FT                   FPNLLVNGSGGIAVGMATNIPPHNLGEVIDACCLYIDNNDIEILDLLEVVKGPDFPTGS
FT                   MILGISGIRSAYLTGRGSIIMRGRAEIENIGNSRQAIIITEIPYMVNKARLVEKIAEMV
FT                   KEKRIEGISDLRDESNKNGVRIFIELKKDVEAEVVLNQIYACTQLQTSFGVIMLALKDG
FT                   LPKVMNLKEVIAAFVSFREVVITNRTVYLLNKARDKAHILLGLTIAVSNIDEIIRIIKA
FT                   SNDPNTAKQEVMARKWNALNILPLVKLVDDKAMLNEHGKCSFTEVQAKAVLEMRLQRLT
FT                   AMEKNKLEEDLKTLATEISEYLNILGSRERLLKILKEELIKVKEEFATPRLTSIEFGEF
FT                   DKDIEDLIQREEMVVTVTLGGYIKRVPLSSYRSQKRGGKGRSGLSMRDEDMTTQVFVGS
FT                   THTPMLFFSNIGKVYSLKLYKLPLSNPQGKGRPMVNILPLKENEHITNIMPLPENQDEW
FT                   DNLNIMFATAKGNIRRSDLLDFKKIQSNGKIAIRLDEDDKLIDVKPCKEDEHILLATKA
FT                   GKALRFPVESLRVIKSRTSDGVRGMKLAGDDSVISMTVLKGISSTKEDRDAYLSVSWEQ
FT                   RLEIAKGKSFNPEELGVSLTLDSILEMANSEEFILTVTENGFGKRSSAYGYRITDRGGS
FT                   GIINMDINDKTGLVVGVMPVKMDDELMLITNNGKLIRCKLESVRITGRNTSGVILFKLD
FT                   DGEKVVSVSLIADTSASEEDNEL"
FT   gene            266245..266418
FT                   /locus_tag="A1E_01190"
FT   CDS_pept        266245..266418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01190"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73183"
FT                   /db_xref="GOA:A8EXV0"
FT                   /db_xref="InterPro:IPR007667"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXV0"
FT                   /protein_id="ABV73183.1"
FT                   /translation="MIWLLIVISLTLTVLVIGVVLMAVGGKFDKKFSSKLMTLRVFFQA
FT                   VAIFLLIIIYFL"
FT   gene            complement(266693..266797)
FT                   /locus_tag="A1E_01195"
FT   CDS_pept        complement(266693..266797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01195"
FT                   /product="hypothetical protein"
FT                   /note="COG0188 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01195"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73184"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXV1"
FT                   /protein_id="ABV73184.1"
FT                   /translation="MHLGDIEEITAQLKEYSSDQYNEKNFIIEARETD"
FT   gene            266962..267489
FT                   /gene="def"
FT                   /locus_tag="A1E_01200"
FT   CDS_pept        266962..267489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="A1E_01200"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="COG0242 N-formylmethionyl-tRNA deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01200"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73185"
FT                   /db_xref="GOA:A8EXV2"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXV2"
FT                   /protein_id="ABV73185.1"
FT                   /translation="MSILPIVTAPDERLKQKSHRVLEVTDQTRKFMDDMLKTMYHEDAA
FT                   GLAAVQVGILKRILVIDIKDHDPVERPKDFYPLFIVNPDIIDKSEELVTANEGCISVPR
FT                   QRVEVARPESIKIKYLDYHNKQQELEANDWLARVIQHEYDHLEGKLMIDYLSSLKRDVV
FT                   LRKLKKLKNNIV"
FT   gene            267486..268397
FT                   /locus_tag="A1E_01205"
FT   CDS_pept        267486..268397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01205"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01205"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73186"
FT                   /db_xref="GOA:O33520"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:O33520"
FT                   /protein_id="ABV73186.1"
FT                   /translation="MKVIFMGTPEFAVPTLKKLIAHHEVTAVFTQQPKAKGRGLSLAQS
FT                   PIHQLACEHQIPVYTPSTLRNDKTINLINKVNADIIVVIAYGFIVPKAILDAKKYGCLN
FT                   IHPSDLPRHRGAAPLQRTIIEGDKTSSVCIMRMDTGLDTGDILMKEDFDLEERTTLKEL
FT                   HNKCANLGAELLINTLVNIDNIVPIKQSSDGITYAHKLTKQEGKINWQDSAYSIDCKIR
FT                   GMNPWPGVYFSYDDKIIKILEAEYLNVDHHFTPGTVISDKLEIACGSGILQVKKLQQES
FT                   KKALNIEEFLLGTRILKATVLK"
FT   gene            268733..268897
FT                   /locus_tag="A1E_01210"
FT   CDS_pept        268733..268897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01210"
FT                   /product="hypothetical protein"
FT                   /note="COG0223 Methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01210"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73187"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXV4"
FT                   /protein_id="ABV73187.1"
FT                   /translation="MVNISNGFEIDENILFRKDNKLLFITTQNSLITRGDEIKAEIIFY
FT                   KKAGSFLKL"
FT   gene            272249..272367
FT                   /locus_tag="A1E_r05748"
FT   rRNA            272249..272367
FT                   /locus_tag="A1E_r05748"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(273032..274213)
FT                   /gene="fmt"
FT                   /locus_tag="A1E_01215"
FT   CDS_pept        complement(273032..274213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="A1E_01215"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="COG1485 Predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01215"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73188"
FT                   /db_xref="GOA:A8EXV5"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXV5"
FT                   /protein_id="ABV73188.1"
FT                   /translation="MTIPLDVKQIALSKELTEIALELNKPRTLLQIFSKNNLKSGIYLY
FT                   GPVGSGKTMLMNSFFEELTASKIIIHYQNFMQEIHKIMHKLQTENQKDIILKIAKDYAK
FT                   NTRVLCIDEFEIKDITDAMIIGRLFDKLIKQNIFIFITSNTSPNNLYKNGLQRESFLPC
FT                   IKIINNTFYVKYLDNHHDYRFDKALGVKGERIIYPLTLENQKKLEKIITDISDNRVLSK
FT                   LTYREEFIGDTEYSTTAIPVHEDTSSELTYKLPLEGECAKNSTNFTPQNIEVLGRKISF
FT                   QKVHKRILVTDYNELFTRDLSYIDYVNICQNFNVIIVQNVHTIDANDTNTVVRFINFID
FT                   NAYFYKILLFMSLEDDPNKIYQGSNRSEEFKRTISRLNEMNSAAYLLNNNLRN"
FT   gene            complement(274733..275893)
FT                   /locus_tag="A1E_01220"
FT   CDS_pept        complement(274733..275893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01220"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /note="COG0809
FT                   S-adenosylmethionine:tRNA-ribosyltransferase-isomerase
FT                   (queuine synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01220"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73189"
FT                   /db_xref="GOA:A8EXV6"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXV6"
FT                   /protein_id="ABV73189.1"
FT                   /translation="MKLSDFDFDLPSELIAQYPSSKRDHSDLLIAATPPIKTKFYNIID
FT                   YLKEGDLLVFNNSKVIKAKLNLEKNRPLSKLAYRDKFEGDMECRTAVYTNVREDSSTGS
FT                   TYKLPLEVELEKRSNITINLNQRLSNNCWSAFAKPARRLNIGDEFHFDNHKVIIVEKLA
FT                   IGEIKVKFELDDISVFEFLDKYGEMPLPLYIRHHEAQKSNNERYQNIYSSIEGSVAAPT
FT                   AGLHFTNDILNKLKAKNIQTTFLTLHVGAGTFLPVKTENIHEHKMHTEYCSITPDTARL
FT                   INKAKQEKQRIIAVGTTTLRTLESSCNNGTVKACDFETDIFITPGFKFQTADILLTNFH
FT                   FPKSTLFMLICAFAGFKEMHKLYKYAIKEKMRFFSYGDATLLYRKI"
FT   gene            complement(276529..278298)
FT                   /locus_tag="A1E_01225"
FT   CDS_pept        complement(276529..278298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01225"
FT                   /product="Multidrug resistance ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01225"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73190"
FT                   /db_xref="GOA:A8EXV7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXV7"
FT                   /protein_id="ABV73190.1"
FT                   /translation="MIKYPTLSKSTFSLGIYFLKFDKVKITLLTVICILLGMIPAIDSI
FT                   LLQKIIDLIESFRDKNTHNFLSSMIYWAVFYALWWESINIAYRSYDYLYLKTMPVIKGT
FT                   ILNELYNYTQYHSHKFFQDNLAGHISNRITETARSFEMIISIFGEKILRKLAIIVFALI
FT                   ALYSVHYVFTTIFILWITVFLGLSVLFSDRINKYSLNYARSQSFVAGSIVDAISNINAV
FT                   RMFTAHKFERQHLETRVENAIADEQTMQFFMFKLRYALGTSCSIMIFIMIYYLSVLRSE
FT                   LSITIGDCVLVLTLCINVADDIWDLTQEIGDVFEQIGAFNQGLSLMAPHIITDIENATP
FT                   LDIKEGVIEFRNVTFNYHHNNNLFYNKSVLIPSKQKVGLVGFSGSGKTTFISLLTRLHD
FT                   ITEGMILIDNQNIKNVTQDSLRKAISLIPQEPVLFHRTILENIRYGTKEATIEEVIEAA
FT                   KSAHIHDVINNLPDGYDTMCGERGNNLSGGQRQRIIIARAILKNAPILILDEATSSLDS
FT                   ETESLIQESMEYLMQNKTVIVIAHRLSTLLNMDRILVFEKGSIIDDGSHAELLKNSKLY
FT                   QKLWNSQVKGLIV"
FT   gene            278483..278755
FT                   /locus_tag="A1E_01230"
FT   CDS_pept        278483..278755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01230"
FT                   /product="hypothetical protein"
FT                   /note="COG1132 ABC-type multidrug transport system, ATPase
FT                   and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01230"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73191"
FT                   /db_xref="InterPro:IPR022715"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXV8"
FT                   /protein_id="ABV73191.1"
FT                   /translation="MQEQELSSNFLEEQEKSKEDPSPFFDVKYICQASLLITDSIQKGY
FT                   DVTQLPNGDVNVTEVRIVNVHYNWNSEKGKFVKTNQIEFNNSKSV"
FT   gene            278927..280291
FT                   /locus_tag="A1E_01235"
FT   CDS_pept        278927..280291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01235"
FT                   /product="cytochrome d ubiquinol oxidase subunit I"
FT                   /EC_number="1.10.3.-"
FT                   /note="COG1271 Cytochrome bd-type quinol oxidase, subunit
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01235"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73192"
FT                   /db_xref="GOA:A8EXV9"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXV9"
FT                   /protein_id="ABV73192.1"
FT                   /translation="MEFDQVLLSRIQFAFTISFHVIFPAFTIGLASFLVVIEGLWLNTK
FT                   KQVYKEIYKFWMKIFAVTFGMGVVSGVVMSYQFGTNWSNFSDKVGNVLGPLLGFEVFTA
FT                   FFLESSFLGIMLFGFNKVSKKVHFISTLIVAIGTVISAFWILAASSWMHTPAGFELQGK
FT                   WFFYPLNWLEIIFNPSFPYRFFHMITAAYLTTSFVIGGVGSFYLLNNRYKEHAKIMLFM
FT                   AVLMALIVAPIQIFIGDLHGLNTLKYQPVKVAAIEGIWNTEKGAALNLIGFPDEEEEKT
FT                   KYAIEIPYASSLILTHSLEGEVKGLKEWTQEERPPVAVVFFSFRIMVGIGFLMVFTGVA
FT                   GLYLYLKKRLYTTHWFQYWYILMSPSGFIAVLAGWFVTEVGRQPYIVYNILKTMDTVSP
FT                   VLGKYVFISLIAFIVVYALIFGAGIYYIMHLIKKGIEAIDNKEMYGEISLNNPLL"
FT   gene            280975..281994
FT                   /locus_tag="A1E_01240"
FT   CDS_pept        280975..281994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01240"
FT                   /product="Cytochrome d ubiquinol oxidase subunit II"
FT                   /note="COG1294 Cytochrome bd-type quinol oxidase, subunit
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01240"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73193"
FT                   /db_xref="GOA:A8EXW0"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXW0"
FT                   /protein_id="ABV73193.1"
FT                   /translation="MLNFASYIDLPLVWGGLIATAICLYVLLDGFDLGIGILFPFAPTD
FT                   DCRHKMINSIAPFWDGNETWLVLGGGGLFAVFPLAYSLLMPALYIPITFMLLGLIFRGV
FT                   AFEFRFKAHIGHRYIWDYAFHFGSMLAVFCQGLMLGTFVQGIEVEGREFAGGSFDFLTP
FT                   FSVMTGIALMFGYALLGATWLILKTEKKTQDWAYKSALYILFYVALFMGLVSLWVPFLN
FT                   NHINHRWFSVPNIYYLSIVPIVTALIFIKLIKAIKQKKEVKPFIYTTLLFLLGYLGLAI
FT                   SIWPYIVPYKVTLETAAAAPESQSLLLIGAGIFLPIILSYTFYCYYIFRGKSSHHPIY"
FT   gene            282300..283106
FT                   /locus_tag="A1E_01245"
FT   CDS_pept        282300..283106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01245"
FT                   /product="Beta 1,4 glucosyltransferase"
FT                   /note="COG0463 Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01245"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73194"
FT                   /db_xref="GOA:A8EXW1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXW1"
FT                   /protein_id="ABV73194.1"
FT                   /translation="MTKISAFIITKNEAARIARAINSVKNIVDEVVVVDSESSDGTVSI
FT                   AEELGATVVIKPWLGYVGQKSFAESLCIHDWILNIDADEELSKDLQDEIEYIFVSGNQD
FT                   HYLAYKIKLLIMHRDDRKPRMFAPFNKCIRLYNKKFASFANNVNSTTHDSVVFNKDVDF
FT                   TNKVYLLNEPAYHYSGISIEQLVTKANFYSSEQAKDLMVQDKKVSNIRIATEMLWWFLK
FT                   AFFIRRYFVFGFDGFVDSMIFAFARFLRLAKLRDKTKNNYERKFSR"
FT   gene            283084..284325
FT                   /locus_tag="A1E_01250"
FT   CDS_pept        283084..284325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01250"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /note="COG0612 Predicted Zn-dependent peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01250"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73195"
FT                   /db_xref="GOA:A8EXW2"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXW2"
FT                   /protein_id="ABV73195.1"
FT                   /translation="MKENFHVSTLKNGLTILTYNMPYVNSVAINLIVKVGSRYENPEEE
FT                   GISHFLEHMAFKGTKTRTAKQIAEEFDEIGGHFNAYTGHEKTVYYARVLSENCNKALNI
FT                   LADIIQNSIFSEEDIVKEYQVILQEIAHSQDNPDDLIYEKFYSSVYKDQPLGKSILGTS
FT                   KTLASFTKEHFLSFIDKHYNARNLYLSVAGNVDHNKIVCTAEQLFSSLKQGIKSSFLPA
FT                   KYIGGNSFIKKDLAQTTLILGFEGTPYINLERLYRTQLFAIIFGGGMSSRLFQHIRERL
FT                   GLAYAVGSYNSTYIDSGVFTIYASTAHDKLELLCKELKNEITKMTEKVNEEEMIRAKTQ
FT                   LRSNLLMAQEKVAYKSEEIGKHYAAFGKYISPEEIMEIITNIKADDIINTANKIFSGTT
FT                   TSAIIGPSILYYEF"
FT   gene            284335..285045
FT                   /locus_tag="A1E_01255"
FT   CDS_pept        284335..285045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01255"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01255"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73196"
FT                   /db_xref="GOA:A8EXW3"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXW3"
FT                   /protein_id="ABV73196.1"
FT                   /translation="MKKKLYEGSSKILYSAEEDFLLIMAFSDKAILETGKTVDISGKGV
FT                   LNNNISSFLMDKLEMIGIANHFIEKINMREQLIQYVEVFPIQVIISSVACGRFVKEFGL
FT                   DEGYVFDKPIMDFKVRSREFKYPIVNEYQILNFGWLTRDEITAVKEQALHIYDFLSGLF
FT                   IGVGIRLVECKLEFGRVFNGEESIIMLTDEISPDNCRLWHINSNEKLGFELLENEPSKV
FT                   FESYQLIAERLKEK"
FT   gene            285235..286830
FT                   /locus_tag="A1E_01260"
FT   CDS_pept        285235..286830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01260"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="COG0152
FT                   Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01260"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73197"
FT                   /db_xref="GOA:A8EXW4"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXW4"
FT                   /protein_id="ABV73197.1"
FT                   /translation="MKIRFIIISFLVLILVGWGYAAYKFASQSKENIISILDKYEEYIT
FT                   YDSIKVNKYSFSVTLNKVMLKPIDFYYDEIVIRHVPFLNITKIDSYGNNVKITTAKDGE
FT                   NIFYSPDHHTTIWFRKSLFNRLPDYWKLSMSDRKSTLYSARDAEKLAESISNSVITNTK
FT                   TSDNLNLLTLDGKTVVSFISENYSKNLSDKVFKFLRDKIGEEAPFDSFEYDVGYLDVLD
FT                   VPTTYKGQLKLKYSNELVALGKLLIQNFSLDQKQDENVHAIFMQILGELVKGKPFLFAC
FT                   DIERKGKVKSNLYKLNVEKNKIFDFALNIKSTIEPSEIYQKTAVEALGRYFSNGLNKRA
FT                   ELDKVFKLSSPITQEDGEKIMAVFAKINNVKFNLKGEFDPEEKKLSGKTNLVMDDFNFA
FT                   IDIDMPNLDNPLNLESVIKLSDPNAFINNFVHYTNNAIIPVLNKIEDSKEFALNLGKQS
FT                   SVIEQYGFRVIEAFSKNSELQDGESLIVDIKGKDDGLTINDKTIDQIFSDARVLEFINA
FT                   MAQIDQERKQVVGK"
FT   gene            287042..288949
FT                   /locus_tag="A1E_01265"
FT   CDS_pept        287042..288949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01265"
FT                   /product="threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01265"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73198"
FT                   /db_xref="GOA:A8EXW5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXW5"
FT                   /protein_id="ABV73198.1"
FT                   /translation="MINISLSDGSVRQFEKGMTIYEVANAISMSLAKQAIVAEINGELK
FT                   DLSTVIENNCKLRILTAKDPECLEIIRHDAAHLTAEAVKELFPETQVTIGPAIENGYYY
FT                   DFARDKPFTVDDLAVIEAKMQELAKKNEKVTRELWNRDKAIEFFRSIGEHYKAEIIASI
FT                   PTDEPITLYRQGNFIDLCRGPHAPSTGFVKYFKLMKVAGSYWRGDSRNQVLQRIYGTAW
FT                   ATKEQLDHYLFMLEEAEKRDHRKLGRELDLFHFQEEAQGMVFWHDKGWSIYNIVEQYIR
FT                   KKIRKNGYTEVKTPVLVDKRLWEASGHWEKFRDNMFALEADNKILALKPMNCPCHVQIF
FT                   KQGIKSYRDLPLRMSEFGLCHRNEASGALHGLMRVRSLVQDDAHIFCAEEQITDETVSF
FT                   CKLLTEVYKDFGFTDIKVKFSDRPEIRAGSDEVWDKAENALKEAVEKAGFTYTLNPGEG
FT                   AFYGPKLEFVLTDAIGRQWQCGTLQMDFVLLEQLDASYVAASGEKKRPVMLHRAILGSL
FT                   ERFIGILIEEYAGCFPLWLAPVQVAIATITSDLNDYALAVQKALIDNGVRTDINISPDK
FT                   INYKIREFSNHKVPLIAIIGKKEKENKQVTIRRLGTTDQQVLSVKQLITLISEENSKYL
FT                   "
FT   gene            289923..290054
FT                   /locus_tag="A1E_01270"
FT   CDS_pept        289923..290054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01270"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73199"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXW6"
FT                   /protein_id="ABV73199.1"
FT                   /translation="MQISQDNIDKENLAELKISKGKEISFAYKEGSKWLLYGVFRRW"
FT   gene            complement(290550..290768)
FT                   /locus_tag="A1E_01275"
FT   CDS_pept        complement(290550..290768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01275"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73200"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXW7"
FT                   /protein_id="ABV73200.1"
FT                   /translation="MIKILILKKILLLGKMIMQRLTTYSFQAIKLEPLMETQLSKEGRK
FT                   ISKQIQKCLKKKVFYSRTGIRKLICTF"
FT   gene            complement(291489..291902)
FT                   /locus_tag="A1E_01280"
FT   CDS_pept        complement(291489..291902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01280"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73201"
FT                   /db_xref="GOA:A8EXW8"
FT                   /db_xref="InterPro:IPR022589"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXW8"
FT                   /protein_id="ABV73201.1"
FT                   /translation="MSNSHIHILITIGCLALIVIFLMYKKIAARKKNILPTKGSNVDNT
FT                   KNVALNSKKPKNKKLTLQERIELSWKFLYDITEIILNKFSKEDVIQVNKCGQILLENGV
FT                   RYEHVVDLAIPQAKSHTQTVEQEQSKGKKALGV"
FT   gene            complement(292204..292371)
FT                   /locus_tag="A1E_01285"
FT   CDS_pept        complement(292204..292371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01285"
FT                   /product="hypothetical protein"
FT                   /note="COG0441 Threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01285"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73202"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXW9"
FT                   /protein_id="ABV73202.1"
FT                   /translation="MLNIYQKVKDKVEENIVELKSNIKIAMPKDINIDKLNPVKNTIIN
FT                   IISMKLKQNY"
FT   gene            293262..293462
FT                   /locus_tag="A1E_01290"
FT   CDS_pept        293262..293462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01290"
FT                   /product="transposase IS200-family protein"
FT                   /note="COG1943 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01290"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73203"
FT                   /db_xref="GOA:A8EXX0"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXX0"
FT                   /protein_id="ABV73203.1"
FT                   /translation="MREIIAVVVEELNVKIENGVISSDHIHIFANIPPHIKVSEFVQKA
FT                   KGRSSKKNTRRISNIKKKVLG"
FT   gene            293377..293595
FT                   /locus_tag="A1E_01295"
FT   CDS_pept        293377..293595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01295"
FT                   /product="transposase IS200-family protein"
FT                   /note="COG1943 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01295"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73204"
FT                   /db_xref="GOA:A8EXX1"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXX1"
FT                   /protein_id="ABV73204.1"
FT                   /translation="MNLCKKPKGDHQKKIQEEFPILRKKYWGRHLWVVREYFSATSGNV
FT                   TDDMINEYINRHTDAHEPVMTTNIRLE"
FT   gene            293909..295273
FT                   /locus_tag="A1E_01300"
FT   CDS_pept        293909..295273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01300"
FT                   /product="outer membrane protein tolC precursor"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01300"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73205"
FT                   /db_xref="GOA:A8EXX2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXX2"
FT                   /protein_id="ABV73205.1"
FT                   /translation="MRKLTTFIVILLLTSSATSVDLQEALTEGYKNNEELKAARIKFLN
FT                   SIESFPRAFAEFMPSAGLQINRNNTKNKYNKKYADRLGLILRETDSDQGAFTIEQSLFN
FT                   GGSSVAALKAAQAGFRASRGEYYAGEQKVLFNLITVYLDCFESKEKYDISESRVRTNIQ
FT                   QVNTVEEKLRLGEATAIDIATARAGLAAAETNKLAAYADFQGKKANFIRVFGIAPTNIT
FT                   MPDLPKMLPASLDELTKKAAKLNPDIDSARHNVTSAKASEMAAKGKLLPQVSVKLQSGR
FT                   THYNPQDPVVQNINTKSVTTTLSVNIPIYPEGGAQYSRIRSAQNQTRNSAVQLDSAIKQ
FT                   TQAWVVSVWEGFEAAKSRIVAANQGVDAAQISYDGTVQEEIVGSKTILDVLTAEEKLYE
FT                   AKITRVDAYKSLVLAAYHMKLLTGELTAQNLKLKVKYFSPEEEFKTIKKKMFIGF"
FT   gene            295305..295673
FT                   /locus_tag="A1E_01305"
FT   CDS_pept        295305..295673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01305"
FT                   /product="hypothetical protein"
FT                   /note="COG1538 Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01305"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73206"
FT                   /db_xref="InterPro:IPR019632"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXX3"
FT                   /protein_id="ABV73206.1"
FT                   /translation="MSIEDILKSIKGVINEPKNPIHGNDSENEDILELTEIVNQVEEEK
FT                   LISTKSAEAIGDILKNFTDTIKDKKLDNNFPSKNALEELVVEMLKPELKLWLDKNLPLL
FT                   VKELVEIEIKKLVQNSKR"
FT   gene            295853..297634
FT                   /gene="thrS"
FT                   /locus_tag="A1E_01310"
FT   CDS_pept        295853..297634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="A1E_01310"
FT                   /product="threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01310"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73207"
FT                   /db_xref="GOA:A8EXX4"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXX4"
FT                   /protein_id="ABV73207.1"
FT                   /translation="MLNKLCKILFFIKLLLMTGQSYAVPPTLPPSLPDVEVATTEDKEF
FT                   RYNSDTSIFDKFKQFFSKPQKKYISPKSTNEQTKTADQEEPKLSQEPNENEHADSFMDI
FT                   SNVVLPSAASNNDVYTNTNHESSVNLASYDNIPDIQVMQQEPSESEIAETFIDIGSTKL
FT                   PSATSDEMRDAEIAANVHDENLASNIITRNNIPRPMVSIPLARPGSYVVPPSPPVQIYK
FT                   PTNLLAVHKKHILLNPPPDVHKTQESIIPIAPPATSSIPNMPAISLPAVSTPVTQDTNP
FT                   STIPAIVPLVGTPVVPSNVPVPLAMPTDQPSTQPIMPSSTNTAISTTPIVVPDTNFSAD
FT                   INNSQETLTASSNIPKKQDWNTPLIPVVVVNPNQSKSSEMQVKNSQTTNNQEKSLPVSS
FT                   PNVMMQEQYNNINNETLESATKFVKDETQMLLLPDDDIVLGKLTEQATLEQMDMYAYIR
FT                   LFQKKEEWIVNAERRKVVESFIKYDNDINKKKDIYANLSYYGAVDNAFRAVDRNNLFGL
FT                   RALLDVYPILQEKSRLGETLLTAATYNDNYYLAKFLVIRGIKISTLNYKCQYPLDIALV
FT                   QGNSNIACILIKAKGYN"
FT   gene            297801..299789
FT                   /locus_tag="A1E_01315"
FT   CDS_pept        297801..299789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01315"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /note="COG0187 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01315"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73208"
FT                   /db_xref="GOA:A8EXX5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXX5"
FT                   /protein_id="ABV73208.1"
FT                   /translation="MHDLFSFNKEKKIKLVNNSYSAKDIEVLEGLEPVRKRPGMYIGGI
FT                   DSSAMHHLVSEVLDNAMDEAVAGYASIITIKMHQDHSITIFDNGRGIPIDNHPKFPDKS
FT                   ALEVILTTLHSGGKFSNNVYHTAGGLHGVGISVVNALSKHLDVKVYKQGKLYSQSYSKG
FT                   EKLTGLICEEAPKRLRGTSINFTPDPEIFGEKLHFNPKKIYELARSKAYLYRGVTIEWE
FT                   CEVEVSSDIPKKALINFPNGLKDYLSSKITLDNLITQEIFSGNIESKPDGVILEWAICW
FT                   QNNDNSAFIQSYCNTVPTPQGGTHEQGLKSAILRGLKTYGEMIGNKKAANLTIEDILET
FT                   ASVVLSIFISEPSFQGQTKEKLVSQGVSKPVENIIKDHFDHFLSSNKALATNLLEHVIA
FT                   IAEFRISKKNTKNISRKNATQKLRLPGKLADCTRTSPEGTELFIVEGDSAGGSAKQARN
FT                   RETQAVLPLWGKVLNVASSRLEKIVNNQAIQDLEIALACGSLKNYKEENLRYEKIIIMT
FT                   DADVDGAHIASLLMTFFFLRMPKLVEKGHLYLAKPPLYRLTQSNKTYYAADEEEKARLT
FT                   DKLSKTSKAQIEVGRFKGLGEMMPAQLKETTMHPEKRSLLKVTLEDFQNVDKIVDDLMG
FT                   KKPEKRFQFIYEQALVKMDKIINDLDI"
FT   gene            299958..301334
FT                   /locus_tag="A1E_01320"
FT   CDS_pept        299958..301334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01320"
FT                   /product="tail-specific protease precursor"
FT                   /EC_number="3.4.21.-"
FT                   /note="COG0793 Periplasmic protease"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01320"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73209"
FT                   /db_xref="GOA:A8EXX6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXX6"
FT                   /protein_id="ABV73209.1"
FT                   /translation="MLLRLIITLWFSINSICTFAEEEKEPENKISNQEAYKQFQNVFER
FT                   IEKDYVQIPDRQKMIDAAINGMLNSLDPHSSYYTDEDLEDIFTFTKGEFGGIGVEIMYD
FT                   SGVIKIISPIDDLPAFKAGLKGGDYIVGVNDELVSTLGPHKAIKEMRGTAGTKVKLLII
FT                   KEEEAKPQEIELTREIVKIKPIKAHLEKNNIAYIRITTFNESTISELKAAVKKLKIESK
FT                   DNLRGIILDLRNNAGGILDQAIAVSDYFIDSGVIVTTKGRTASSNSEIKANEFSLKAPK
FT                   VPMIVLINGNSASASEIVAGALQDHKRAIILGTKSFGKGSVQSLTQINSRAAVKLTISK
FT                   YYTPSGRSIQAEGIEPDIIIEPAKVEYPEVKKIDKRFSESSLKNYLKNDNEKNKDHSSK
FT                   NKDSKKETKTKNNKQEENELSELYKKDYQFARAYDVITGLIINKKLETSDIKQEDKDKE
FT                   "
FT   gene            301577..303070
FT                   /locus_tag="A1E_01325"
FT   CDS_pept        301577..303070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01325"
FT                   /product="Histidine kinase sensor protein"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01325"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73210"
FT                   /db_xref="GOA:A8EXX7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXX7"
FT                   /protein_id="ABV73210.1"
FT                   /translation="MNHNKYIVRLSFIILFLNIVINMMFYRYFMIKEMIVKHVALEHTQ
FT                   IVKLYTDNIWNTHKNVISKLHKFGYLKLLQDQEFIDFVKITAQWFTNLNINISIYDLKG
FT                   NKFITSNMLHMYSVENYKDDSLVEMVTAKIDKFFLKSFTSKAPLQDAFEGIASHILLPR
FT                   VIIENESDLTVEEASFVTSYIPVIDNNLDYPVNAVFEINTNITNQWKNITSLEQKVFIT
FT                   FIIIFIIFCTIIISNTNYARQIIEEQLETNRNLKAQIVKLERTSSSNTKFFANISHELR
FT                   TPLNSIIGFSEILMSERDAEKSKNYIKDINDAGKHLLSMINDILDLSKASADKLKVDSM
FT                   DLDLNKLISSSLALVKSRADQAEVALISKLPKEHVVIKADPKRLKQVLLNLLSNAVKFT
FT                   NSGGSVTIALKKDELAKLVYIKVIDTGIGIEEKDIPKTLSVFGQIDSELSRKYEGTGLG
FT                   LPLTKKLVELMKGKFDLQSKINKGTTVTITFTYDDSIEI"
FT   gene            303325..304065
FT                   /locus_tag="A1E_01330"
FT   CDS_pept        303325..304065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01330"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73211"
FT                   /db_xref="GOA:A8EXX8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXX8"
FT                   /protein_id="ABV73211.1"
FT                   /translation="MRLIILLFTFLFSIVSFGESETIKGKPLKYVVNNDFENRLDEQEK
FT                   EIRRLIGEVEVLQHKIDLLTQNSNIPNQEENTEISEDNNSKSQDVFDVVLLRDMPDDTA
FT                   SKKPITVNQDIAPDKQAYDLALAAYKDNKLTEAQDKFKDFIKKYTNSSLISNAYFWYGE
FT                   CFFKQKDYNGAAVNYLKGYKESPKGAKSSDGLLKLALSLGELKKTQEACNMLAKLDREF
FT                   PTNRTVALKKMTEDAKIKFGCKNK"
FT   gene            304078..304740
FT                   /locus_tag="A1E_01335"
FT   CDS_pept        304078..304740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01335"
FT                   /product="hypothetical protein"
FT                   /note="COG1729 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01335"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73212"
FT                   /db_xref="GOA:A8EXX9"
FT                   /db_xref="InterPro:IPR022588"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXX9"
FT                   /protein_id="ABV73212.1"
FT                   /translation="MTDILNEVLSDQNEVKRLIFFKKLLPIIIIISIIVITIMVVINNN
FT                   KDKRIKNNQKNGDILVKTVGLEIIKDNKELAFNTLENLVTNSNTRIKEIAALEQVAIKI
FT                   SEKKYSEVKDLLNKIIANKEYSEISTSYARIAWCALAIDDQNLDIQDKAKLTKYLNYFD
FT                   DEKKPFWATATIMKAMWDIKNNMTLQVEKNLKNLLISNNVSDLLKDQAKALLVNLNK"
FT   gene            304763..306007
FT                   /locus_tag="A1E_01340"
FT   CDS_pept        304763..306007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01340"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /note="COG1520 FOG: WD40-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01340"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73213"
FT                   /db_xref="GOA:A8EXY0"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXY0"
FT                   /protein_id="ABV73213.1"
FT                   /translation="MTKKIALLLLPWILISCNGLGPQRVKNIVELTPKLSIQTNEPIYL
FT                   DSNANIYAFNVNMLKNKQYSVTTSKTITEPVFIGNIIYALDVRSNISAFSIEKNKIIWS
FT                   YNLSRHKKDNYIGGGILHYNGKLYVTYGSRLLVVLDAKSGYEIIRKELPDIIRMKPVML
FT                   NDNTVLVQTISNQTIALNAETLKTVWEHESLAEVLSASYFMRPIVQHDNVIVTYNSGQV
FT                   LALNIKNGEVRWNFDFANLSDHIAIPNFDESSILCAPVHDNMNLYIATGLGKLIKLSTA
FT                   TGSVIWHVNAEGIQSMSLIGNSLFVTNNARQIAAFNPETGKVKFVADLNDRKDPKKLKS
FT                   ATFLAPFIGVDNNNKRSLNVISINGVLYSFDLDNNELNIMPHIGKIIKNIRYYGLSTNN
FT                   HLYFSTERNIIFGSK"
FT   gene            306100..306576
FT                   /gene="rplM"
FT                   /locus_tag="A1E_01345"
FT   CDS_pept        306100..306576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="A1E_01345"
FT                   /product="50S ribosomal protein L13"
FT                   /note="COG0102 Ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01345"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73214"
FT                   /db_xref="GOA:A8EXY1"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXY1"
FT                   /protein_id="ABV73214.1"
FT                   /translation="MKTYSAKPSEIEKKWWVIDAKNIVLGRLASRVANMLRGKHKPSFT
FT                   PHLDCGDNIIIINAAHVKLTGKKANTKDGKIYYRHTGFPGGIKNTTAGKILAGKHPERV
FT                   IKMAVKRMITRNALGAKQMSNLYVYANSDHPHVGQEPVIYDFASQNPKNKSNYL"
FT   gene            306573..307058
FT                   /locus_tag="A1E_01350"
FT   CDS_pept        306573..307058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01350"
FT                   /product="30S ribosomal protein S9"
FT                   /note="COG0103 Ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01350"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73215"
FT                   /db_xref="GOA:A8EXY2"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXY2"
FT                   /protein_id="ABV73215.1"
FT                   /translation="MTKLKIKTDKPLTTAVLTSKKLTVKAPREKIDSASKFYATGKRKN
FT                   AIARVWLKVGKGKIVVNKKTIDQYFSSETYVKTILQPFVLTKTIDQYDVICTVRGGGIS
FT                   GQKGAILHGISKALDKSAPDFHAMLRKGGLLTRDSRVVERKKYGQRKARKKTQFSKR"
FT   gene            307168..307244
FT                   /locus_tag="A1E_t05696"
FT   tRNA            307168..307244
FT                   /locus_tag="A1E_t05696"
FT                   /product="tRNA-Met"
FT   gene            307503..307691
FT                   /locus_tag="A1E_01355"
FT   CDS_pept        307503..307691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01355"
FT                   /product="D-alanyl-D-alanine dipeptidase"
FT                   /note="COG2173 D-alanyl-D-alanine dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01355"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73216"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXY3"
FT                   /protein_id="ABV73216.1"
FT                   /translation="MYLKDIDPTIIQSMCYYADENFVGKKVEGYKAPEAILTIDAAMII
FT                   HLIIYDAYRPQKAVEHF"
FT   gene            308111..308440
FT                   /gene="rpsI"
FT                   /locus_tag="A1E_01360"
FT   CDS_pept        308111..308440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="A1E_01360"
FT                   /product="30S ribosomal protein S9"
FT                   /note="COG2154 Pterin-4a-carbinolamine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01360"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73217"
FT                   /db_xref="GOA:A8EXY4"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXY4"
FT                   /protein_id="ABV73217.1"
FT                   /translation="MTVLSEKKCIPCEGGVPPLEKKEIDKLLAELQNEWQVNELGHLYK
FT                   KYKFPNFVKALDFANKIAAIAEQEVHHPNLNISWGVCNVEIWTHKINGLTENDFILAAK
FT                   IESKI"
FT   gene            complement(309068..309553)
FT                   /locus_tag="A1E_01365"
FT   CDS_pept        complement(309068..309553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01365"
FT                   /product="dinucleoside polyphosphate hydrolase"
FT                   /note="COG0494 NTP pyrophosphohydrolases including
FT                   oxidative damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01365"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73218"
FT                   /db_xref="GOA:A8EXY5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXY5"
FT                   /protein_id="ABV73218.1"
FT                   /translation="MRNASKKHLDLPYRPGVGMMILNADNHIFVGKRIDTKISAWQMPQ
FT                   GGIVPGETPSIAAMREMLEEIGSDKGYIIAESKCWYSYDLPSFLIPKLWNGNFRGQKQR
FT                   WFLIRFTGNNEDININTSNPEFDQWRWASLNELLSIIIPFKRKLYQAVVKEFDSLIQ"
FT   gene            complement(309578..310930)
FT                   /gene="pleD"
FT                   /locus_tag="A1E_01370"
FT   CDS_pept        complement(309578..310930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pleD"
FT                   /locus_tag="A1E_01370"
FT                   /product="response regulator PleD"
FT                   /note="COG3706 Response regulator containing a CheY-like
FT                   receiver domain and a GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01370"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73219"
FT                   /db_xref="GOA:A8EXY6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXY6"
FT                   /protein_id="ABV73219.1"
FT                   /translation="MTTILVVDDIETNIKLLTAKLLKEYYTVLTANSGKEALAILTKEK
FT                   IDIILLDVMMSEMDGFEVCKRIKTNLETTHIPVVMVTALSDIDDRVKGLEAGADEFLTK
FT                   PINDTALFVRLKSLYRMKSLIDELKLRNSTNALLGVTNIEMHDTFADKKILLINDDVVQ
FT                   AKNIRQMLLKITASIKVISNSDELDIINEYTPDLVIISSTLENDDPLRISVILRRKAKI
FT                   SGVVIILQIDEDGMPLVVKGVELGINDYFVYPIEESELLARIRTQLRRKQYQDNLRNYL
FT                   EQSVNLAAKDCLTGLFNRRYFDIHLKQMIEKANKESIKLYLLMCDIDNFKYVNDTYGHQ
FT                   AGDKILTIVSRILKNNLRVTDLIARFGGEEFTILLTDIDISKAIETAERVRVKIEYMDF
FT                   HIEDQIEPLKKTISIGVTEYKKEESIESFIARADNAMYEAKRTGKNKVVKL"
FT   gene            311006..311572
FT                   /locus_tag="A1E_01375"
FT   CDS_pept        311006..311572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01375"
FT                   /product="elongation factor P"
FT                   /note="COG0231 Translation elongation factor P
FT                   (EF-P)/translation initiation factor 5A (eIF-5A)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01375"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73220"
FT                   /db_xref="GOA:A8EXY7"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXY7"
FT                   /protein_id="ABV73220.1"
FT                   /translation="MKISANSIRTGNILVYSNDLWVVSRTPEHTQPGKGGAYVQVEMKN
FT                   LKTGTKRNERFSSSDYLEKAELEQKDYQFLYFEGNDLVLMDIKHFDQINVPKEILEEKL
FT                   PFLAENMIVKVEFYNEKPLNIELPPTVIIEISETDPVIKGATATASYKPAILTNGIKVK
FT                   VPQYLEIGEKIVVKTDDMTYVERAK"
FT   gene            311723..312466
FT                   /locus_tag="A1E_01380"
FT   CDS_pept        311723..312466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01380"
FT                   /product="Extragenic suppressor protein SuhB"
FT                   /note="COG0483 Archaeal fructose-1,6-bisphosphatase and
FT                   related enzymes of inositol monophosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01380"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73221"
FT                   /db_xref="GOA:A8EXY8"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXY8"
FT                   /protein_id="ABV73221.1"
FT                   /translation="MQPITNLLINALRKAVKFLHRDFLELEMLQKNAVRNEEFCKRSYL
FT                   KLKTLLCEELQKHTKYLFFSEDKFDLNNNYDSVFLMNPIDSLNNFVRSIPFFAISVTYL
FT                   KRNQGVLTPISTVIYFPALNEIYYAEKGKGAWIEKNNLNSHYQRLRLRVSDNADLKNCL
FT                   AIIEDLNRNNLGEEIDNIRSFGSPCYAATLVASGKADLICLSLLNFTLYYAFELLIKEA
FT                   GGIIIDSSNKFIYSNRYLAKKLKKY"
FT   gene            312532..312861
FT                   /locus_tag="A1E_01385"
FT   CDS_pept        312532..312861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01385"
FT                   /product="elongation factor P"
FT                   /note="COG0012 Predicted GTPase, probable translation
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01385"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73222"
FT                   /db_xref="GOA:A8EXY9"
FT                   /db_xref="InterPro:IPR021277"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXY9"
FT                   /protein_id="ABV73222.1"
FT                   /translation="MHKVMAHYKQFEFDCDFGGQRSKFKFYIGTPQEGHHPLQFQAKWL
FT                   SEERGGTIPDEVMKAISQLNDLAKKNGVPLSDLCVYALGTAQEVQTQEEYEDKNENQED
FT                   KAEQA"
FT   gene            312893..313588
FT                   /locus_tag="A1E_01390"
FT   CDS_pept        312893..313588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01390"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /note="COG0688 Phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01390"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73223"
FT                   /db_xref="GOA:A8EXZ0"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXZ0"
FT                   /protein_id="ABV73223.1"
FT                   /translation="MKHYNDLFKIIHREGYIFIASFALVSFLLASFNTKLGCIGFIATA
FT                   WCIYFFRNPDRYVPINDDLVISPADGVIQEIKEALPPPELGLGDVAMIRVSIFLNIFNV
FT                   HVNRIPANGKILALHYNPGKFFNASLDKASIYNERQSVLMETDQGQKIIFVQIAGLIAR
FT                   RIICDLEEGNEVKTGERYGIIRFGSRVDVYLPLKTALLVSKGQTTIGGETIIADFGRKK
FT                   TAQFKFKRK"
FT   gene            313815..314588
FT                   /locus_tag="A1E_01395"
FT   CDS_pept        313815..314588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01395"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /note="COG1183 Phosphatidylserine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01395"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73224"
FT                   /db_xref="GOA:A8EXZ1"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR012616"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXZ1"
FT                   /protein_id="ABV73224.1"
FT                   /translation="MLKIRKSIITKPVPIIKLIPNFITLLGLVTGMSSIKFALDSRWEL
FT                   AVYCIIVAAIIDGIDGRIARMLNAASPFGAELDSLCDFANFGIAPAYLIYLWSFQQYEY
FT                   KVLSSAVMLLFIVCMALRLARFNVGIYQPTQDKKTEYFFTGLPAPCGALLALTPVMIDF
FT                   EIGTLLNINTRTHTITINIYLAIIALLLASRLPTISTKNLSIKPEYLSLAMILVAIVII
FT                   NLIIYPWYSMPLIAVIYILSIPICYFFKHRGYWSN"
FT   gene            314589..315641
FT                   /locus_tag="A1E_01400"
FT   CDS_pept        314589..315641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01400"
FT                   /product="Multidrug resistance protein A"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01400"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73225"
FT                   /db_xref="GOA:A8EXZ2"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXZ2"
FT                   /protein_id="ABV73225.1"
FT                   /translation="MLRVLQHAINKYTHHPFTKYVIIIALVIFIYFGYRIYVWANTQST
FT                   DNAYIDADISNVSAEVSGVLIKLFVTNNTKVNKGDLIGEIDDRDYKAKLAALEASIEAC
FT                   KKNIEIIEQKTSIGRISLEQAAEKLKLTKISFDIATTDFTRVQELNKAKLASSKTLDDA
FT                   RNNYQKAKTAYKQAQLDLDISKQNVALLDLEKSAAKEKFKELTENKKVTLRSLQSTKLI
FT                   AMVSGIFGNSSLAIGNYILPGRVLFSIVQDNTMYIQANFKETQIKKFKSGMKVKIEFDA
FT                   LPKKVIYGKIRNIAPATGSKFSLIPPDNAAGNFTKIVQRVPVLIDFESPNANLVPGMSA
FT                   IVSIRTDQKI"
FT   gene            complement(316140..316343)
FT                   /locus_tag="A1E_01405"
FT   CDS_pept        complement(316140..316343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01405"
FT                   /product="hypothetical protein"
FT                   /note="COG1566 Multidrug resistance efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01405"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73226"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXZ3"
FT                   /protein_id="ABV73226.1"
FT                   /translation="MKTNDIIKVAVGASSVAQKALNSIVDKSCSIIEDKILKGHYVTRE
FT                   EFEKLQILVIKLKKELAELTGK"
FT   gene            complement(316343..316585)
FT                   /locus_tag="A1E_01410"
FT   CDS_pept        complement(316343..316585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01410"
FT                   /product="hypothetical protein"
FT                   /note="COG0271 Stress-induced morphogen (activity unknown)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01410"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73227"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXZ4"
FT                   /protein_id="ABV73227.1"
FT                   /translation="MSRIERIQAKLSVLKPYFQEIIDESYKHTSHYDGIHSHIKIRISA
FT                   KILQGKSLIANHRTINNLLVDEFNNGLHALSIEVL"
FT   gene            316647..317888
FT                   /locus_tag="A1E_01415"
FT   CDS_pept        316647..317888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01415"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="COG2200 FOG: EAL domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01415"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73228"
FT                   /db_xref="GOA:A8EXZ5"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXZ5"
FT                   /protein_id="ABV73228.1"
FT                   /translation="MIKMAMSELITDYKDLQDEIDKLEKGVCFACRLVNYDEIEFIEQD
FT                   KYFIIKDLAQIIENVSAELNILSKFKKIKQDRILFILNTIDSNLIKNFARKLYLFSQLY
FT                   INEQKPAIYMNCCIASIKFPKVSNNAKEIEKTLNMLLAQNNNYYYREYSSTAHDLGNIR
FT                   KSNLQLNLLRQALANKTMRFAYQPIIDRSTMKIQYYECLLRIPDENGVYISVGPIIPIA
FT                   ENKGLIFIIDQIVLDMTVNELAQNPNLILAVNISNIGTIDEALWEIAENLLKAYNVRDR
FT                   LIIEITETSFNEHYDKIILFINKLRQYGCKFALDDFGSGFTSFKQLQSLPIDIIKIDSK
FT                   YVRSITSDVQSRYFVERLIRISEDLGIATVAEFVENGEIAKFLIDLKVGGLQGNFYSEA
FT                   KFDRVDVIPTESGI"
FT   gene            318046..319479
FT                   /gene="murC"
FT                   /locus_tag="A1E_01420"
FT   CDS_pept        318046..319479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="A1E_01420"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="COG0773 UDP-N-acetylmuramate-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01420"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73229"
FT                   /db_xref="GOA:A8EXZ6"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXZ6"
FT                   /protein_id="ABV73229.1"
FT                   /translation="MLLLELKKINQTLETIHFIGIGGVGMSGIAEILHNLGYKVQGSDL
FT                   VENYNTKRLESYGIKIFLGHVPQNITNVSYVVISSAINPDNPEIQEALERKIPIIRRAE
FT                   MLAELMRLKCSVAVSGSHGKTTTTSLVACLFEAAGLCPTVINGGIINNRSTNAYLGSSN
FT                   YLIAEADESDATFIHIPSTIAIITNIDPEHLDYYKDFATLISAFRSFIINLPFYGFAVC
FT                   CIDHKIVRKLVDDITERKIVTYGIDSADAHIIAFNINTDIASSTFDVKISLPNVLGTTI
FT                   IEKITIPIPGRHNILNSLAAIAVGIELDFGIKAIKNGFNNFKGVKRRFTKVAEYNMASI
FT                   IDDYAHHPEEIKATLATAKNIANKQNGKVIAIFQPHRYSRMQHLFDDFMLCFADADILY
FT                   ITDIYAAGENPIEGITGQSLVDKITKNKYHDQANFLATLDDAVGVIIDNAVSGDVIIMM
FT                   GAGNISSFANELPKKFGNL"
FT   gene            319476..320369
FT                   /gene="murB"
FT                   /locus_tag="A1E_01425"
FT   CDS_pept        319476..320369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="A1E_01425"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="COG0812 UDP-N-acetylmuramate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01425"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73230"
FT                   /db_xref="GOA:A8EXZ7"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXZ7"
FT                   /protein_id="ABV73230.1"
FT                   /translation="MMTLPIVKGEYKKDYNLKHLTWFKVGGNAEIFFKPFDSEDLASFL
FT                   RQNKQKLPITTFGAGSNIIIRDGGIEGVTIKLGQSFSNIDFIDDNHLVVGSSCLNYNLA
FT                   KFCQANAISGFEFLVGIPGTIGGGAAMNAGAYGSEFKDIIVRIEAIDFAGNFLTFTNEE
FT                   IGFKYRSNNLPKNLIILKAIFKVNKGDSENILLRMNEINATRSRTQPIKERTGGSTFAN
FT                   PEGGLKSWQLIDKAGLRGYRIGGASVSELHCNFMINNGDATAKDLEDLGNFVRQNVFED
FT                   SGVKLNWEIKRIGKYV"
FT   gene            320438..321502
FT                   /locus_tag="A1E_01430"
FT   CDS_pept        320438..321502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01430"
FT                   /product="D-alanylalanine synthetase"
FT                   /note="COG1181 D-alanine-D-alanine ligase and related
FT                   ATP-grasp enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01430"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73231"
FT                   /db_xref="GOA:A8EXZ8"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR022436"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EXZ8"
FT                   /protein_id="ABV73231.1"
FT                   /translation="MHQYQIHWVEHSEVKILSNIVVRLEYKERGVKSITNRRARHDAVS
FT                   ESKSIDYSGKKHIALVAGGMSAEREVSLVSSKGVSKALIALGYKVTFIDMGADIAFKLQ
FT                   EIKPDIVFNCLHGTYGEDGCLSGLLNIMRIPYTHSGVLSSALAFDKIYSRSWFLTNNIN
FT                   MAESIVVNKSDNIKIEPMKRPYVIKPITQGSSIGIEVIFEEDDFNFANYDFPYGDQVII
FT                   EKYIKGRELQVAVLNGKALGVLEIKLLKNRFYDYETKYTEGFAEHLCPAPIPTNLYDKL
FT                   LIESEKIYKTMNCKGPARVEFLLEDQTNKLYALEINTHPGMTPLSIVPEIAAYAGINFT
FT                   NLIEEIIKAASFES"
FT   gene            321499..322302
FT                   /locus_tag="A1E_01435"
FT   CDS_pept        321499..322302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01435"
FT                   /product="cell division protein ftsQ"
FT                   /note="COG1589 Cell division septal protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01435"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73232"
FT                   /db_xref="GOA:A8EXZ9"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXZ9"
FT                   /protein_id="ABV73232.1"
FT                   /translation="MRQKTISNKQKQTKKTNNISLRRKLGLMYTKAILALKVALMIFVC
FT                   LFVFTKYFAGVKTYLTTNIYKITTKLGFKLENVIIEGQQNVDEPTILKVLNASSGSPIF
FT                   ALKLDAIRNNLKKNKWIKEVYVTRRLPNTVYIKLFEREPIAIWQINNQLFLVDEEGYKI
FT                   SKNIQPFPHLLHVVGEGANIYAGKLVSELQKYPALINKTSAAVRLGDRRWDLNLEGNIS
FT                   IKLPEKEFEEALKYIDALNKANKLFNQNYKVLDLRDRNKYYIEKY"
FT   gene            322331..323566
FT                   /locus_tag="A1E_01440"
FT   CDS_pept        322331..323566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01440"
FT                   /product="Cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01440"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73233"
FT                   /db_xref="GOA:A8EY00"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY00"
FT                   /protein_id="ABV73233.1"
FT                   /translation="MKEKISNFVTLDFGSSKIAVIAAYISKKGEIKVASQNLHHSKGIK
FT                   SGVISDLKNAETSIVSAIYALEKDCGKNIKKIILSLSGADTKSYYINYTMKVNGQTVTQ
FT                   QDIKKLLQKALLEFKVKHQEIIHYFPLEFTLDNNSVENPIGMYGRELSCELHIIAASSN
FT                   MLSNIVQCFAKCHVEVTNITLAIYASAISCLTNDEKNLGSLIIDMGDKTTSFGIFFAGK
FT                   LIYTGHINVGGFHISSDIAKVFGIDFVTAEKLKILYGNATIPLFEKDSIINMDDFQVDT
FT                   HHNLNTSVTLYQLAEVIRARAEEILSMVKAEYDKATKGQVEVLRVVITGGGSQLRGLKE
FT                   LSNRVFEKQSRIGKPEIIAGFIEDNNPAIYAATIGMLKIHALKQQKEFAHIRFDENSSF
FT                   FKKAFDWFKENV"
FT   gene            complement(323713..323946)
FT                   /locus_tag="A1E_01445"
FT   CDS_pept        complement(323713..323946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01445"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73234"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY01"
FT                   /protein_id="ABV73234.1"
FT                   /translation="MVKTNDSYWTIKTIAKILTGEEKATDSHTVITIKTGNPYIVKAVI
FT                   EKTVITYNRFKIARTTSTPEWLLCNSISSMDE"
FT   gene            complement(325123..325590)
FT                   /locus_tag="A1E_01450"
FT   CDS_pept        complement(325123..325590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01450"
FT                   /product="hypothetical protein"
FT                   /note="COG0849 Actin-like ATPase involved in cell division"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01450"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73235"
FT                   /db_xref="GOA:A8EY02"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY02"
FT                   /protein_id="ABV73235.1"
FT                   /translation="MIHNYLTEIWLIIGIICVVIEFFTVPSIGFLFLGLGALSNTLVVY
FT                   NYDINLQNQIMIFGILSLIWFSILYLPLKKYVYSTTAKAENYSDMVGKTVEVHSSTISS
FT                   HTIVRQVKWSGVIMNAYLAPNEEEAKTGDQLFIIKVKGNILVCSRHKPNHH"
FT   gene            complement(325580..326101)
FT                   /locus_tag="A1E_01455"
FT   CDS_pept        complement(325580..326101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01455"
FT                   /product="cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01455"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73236"
FT                   /db_xref="GOA:A8EY03"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY03"
FT                   /protein_id="ABV73236.1"
FT                   /translation="MSGKELNKIVAAILLASLIAMMVGFVANILYKPNLQVLHRGYSVA
FT                   VHENSVASTSEAPAAVNIAELMKTANADNGREIAKKCLMCHSLDKDGPNKLGPHLWDVA
FT                   GRPKASIADYKYSSALSKLDGVWDDDSLFAFLHKPSSYAPGTKMSFAGISKLQEIADII
FT                   LFLKTYVHDT"
FT   gene            326646..326819
FT                   /gene="ddl"
FT                   /locus_tag="A1E_01460"
FT   CDS_pept        326646..326819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="A1E_01460"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="COG3474 Cytochrome c2"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01460"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73237"
FT                   /db_xref="GOA:A8EY04"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY04"
FT                   /protein_id="ABV73237.1"
FT                   /translation="MKSTGQIFGNHLGGAANLAASIIKGASGNVLDILKNMGYGIVTTA
FT                   SLIINGLSLCRI"
FT   gene            complement(327248..328114)
FT                   /locus_tag="A1E_01465"
FT   CDS_pept        complement(327248..328114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01465"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01465"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73238"
FT                   /db_xref="GOA:A8EY05"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EY05"
FT                   /protein_id="ABV73238.1"
FT                   /translation="MQQSTLLKPVSCYGIGVHSGKRTQLTIEPAKENTGIIFIRTDISS
FT                   ENNYIEASYLNVSGTLLSTTISNDHKVQISTIEHLMAALWGCEIDNAIIKIDGPEVPIM
FT                   DGSSKLFVFMIECAGKKLQNAPRKYLKILKDIKVIHKDCELYCTPSNHMTVDLTIDFNS
FT                   KAIGKQNLSFSNQESFTKNIADARTFGFIKDVHDLQSKGLALGASFENAIAINEEDKIL
FT                   NPNGLRYEDEFVRHKLLDLFGDLYTSGTNVVSSIKGYKTSHALNNELLHKIFCDTTSYK
FT                   FVTASEL"
FT   gene            complement(328307..329455)
FT                   /locus_tag="A1E_01470"
FT   CDS_pept        complement(328307..329455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01470"
FT                   /product="hypothetical protein"
FT                   /note="COG0774 UDP-3-O-acyl-N-acetylglucosamine
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01470"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73239"
FT                   /db_xref="GOA:A8EY06"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY06"
FT                   /protein_id="ABV73239.1"
FT                   /translation="MTFKNDYKTIFFSLLGIFIFSCINAINFYNFQNFLLINKNLGGEQ
FT                   INHINQTKFIGSIIAGFALTQLINKLSNTKIILISLSLLIICTINLILLNNYTLIKINF
FT                   ILINFGIFSYFTSITLHIIESVKGKKYFFLACIILLWAGGNLMVDLLNPFIKPTNNTIV
FT                   MCALLYCINILTEFLHYNPTSHKLNLNSQFSSLIKNVELQLLTGFVVAYVTLDILWYYE
FT                   AFALKKKLALINLRLILKYIFLLIGLSIIPICYILSKVNKYLANLSLTIILLICFILLP
FT                   LHGTNKKLNILYIILIGNCLGAIFICNILILIDKFRDYELRTALFSYFSMCSIGIYAGA
FT                   LSSHVPYGTINGSDFLFSVFAVVGSFVAYHFWYFIKYKLYRF"
FT   gene            329882..331948
FT                   /locus_tag="A1E_01475"
FT   CDS_pept        329882..331948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01475"
FT                   /product="Ribonuclease E"
FT                   /note="COG1530 Ribonucleases G and E"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01475"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73240"
FT                   /db_xref="GOA:A8EY07"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY07"
FT                   /protein_id="ABV73240.1"
FT                   /translation="MNKKIIIDANFPTETRVVLLGQSNNIEDIEFQTTVRQQNKGNIYL
FT                   AQVTRIEPSLQAVFIEYGMDKSGFLPFSEIHPNYYNLPASERNFPVNAFPEIALANITV
FT                   EDDQEKPIAIYDSLVDSEEIDLKTIEDLVESKLQSELNLEGADDIEIIQSGIDSNIPQY
FT                   KQYKVQEVIRKNQILLVQVTKEERGNKCAAFTTYISLAGKYCVLMPNKGSQNGISRKIS
FT                   NVEERKRLKDILNKIVSGNSYSVIVRTAGRGSSSLDLKKDYNYLVRLWNKIRKSTIKFP
FT                   APCFIHEEDSIIRKTIRDMCDHNVKEVVIQGQEAYDDAAKFMQDLLPSELSKLKAHKNK
FT                   TPIFTQFQVEEQLVKLYQPVVTLPSGGYIVINPTEALISIDVNSGKSTSEKNIEETALK
FT                   TNLEAAKAVAKQVKLRDLSGLIVVDFIDMSEAKNRKIIERSFKEFLSRDRARIQTGNIS
FT                   QFGLLEFSRQRLRSSFLETNSSICSHCNGKGVIRANDANAMLILRTIENEIFEERIDVI
FT                   NVFTNIASVIYLLNNKRAEIKFIEEKYNIKLNFYSDPNATSDSYSIEKVKLLKKNNNNV
FT                   NSVKPVIQNHSADYTEDEPQKEQLRKNKHKWKTVNNNVSVEEKNKKLETKQEVEQSTQN
FT                   VEVVNEESQIIENDVVTAEVPATKTLKRRYRNKKSNKKGAANTATDTAKNADS"
FT   gene            332200..333171
FT                   /locus_tag="A1E_01480"
FT   CDS_pept        332200..333171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01480"
FT                   /product="Cytochrome c oxidase assembly protein"
FT                   /note="COG1612 Uncharacterized protein required for
FT                   cytochrome oxidase assembly"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01480"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73241"
FT                   /db_xref="GOA:A8EY08"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="InterPro:IPR023754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EY08"
FT                   /protein_id="ABV73241.1"
FT                   /translation="MVIAMIVIGGITRLTGSGLSIVEWRPITGILPPLSFEAWQVEFAK
FT                   YKAFPEYNYVNYRMTLSQFKFIYLLEFIHRLLGRITALIYIVPLIYFYFKGIIKNRDIA
FT                   PYIIALLLLYVQGFMGWYMVKSGLLNNPSVSHLRLAFHLIIAVIIYHILFYQLIKNRCD
FT                   ILLILSQTDLKLPLRFSSVAITVIYLQIFLGALVAGLDAGLIYNSFPLMGDNFIPTAIK
FT                   DNFFDLKNWYDPVFIQCIHRLGGYSVFLVVMALATYLLKIEHPKLNKIAYFLIIALLMQ
FT                   ISTGIITLLYSVPIIIASTHQFFAIVLLSVIIWCYFLIKTSK"
FT   gene            333168..334079
FT                   /locus_tag="A1E_01485"
FT   CDS_pept        333168..334079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01485"
FT                   /product="ribosomal large subunit pseudouridine synthase C"
FT                   /EC_number="4.2.1.70"
FT                   /note="COG0564 Pseudouridylate synthases, 23S RNA-specific"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01485"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73242"
FT                   /db_xref="GOA:A8EY09"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY09"
FT                   /protein_id="ABV73242.1"
FT                   /translation="MIIDVNTPISSRLDKYLKRLYPLLTQGVIEKALRQKQIIVNARKA
FT                   EASLRVIDGDKIFISDKFNLPVKQPEKLVFTDAEIKLAKKITTDYLIYEDDNLIAINKP
FT                   AGLATQGGSKINLSIDSALKYLNYKGADFKLVHRLDKETSGLLLIAKNYLSSIKFHDAF
FT                   KDKLVVKTYFAVTYGKPIKNVGEVRSNIEKSKGSTRKITDIDSENGKLAITYYKLLKSL
FT                   DNNLFLIEFTPITGKMHQLRLHAKLLGCPILGDDKYGNKEIMPYSQYMFLHANHICLSE
FT                   KVFGTEINLEAKLPFYFTRRLT"
FT   gene            334241..335422
FT                   /locus_tag="A1E_01490"
FT   CDS_pept        334241..335422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01490"
FT                   /product="Penicillin-binding protein 4*"
FT                   /note="COG1680 Beta-lactamase class C and other penicillin
FT                   binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01490"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73243"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY10"
FT                   /protein_id="ABV73243.1"
FT                   /translation="MIRRYLLLLLFLINNCINCFADIQQRINEAEKEYLSNRFLNAVFM
FT                   FADDYKPLLTGAKGIFALNGEQLKANEMMPIASATKPFTAAGILKLQEQELLNINDKIY
FT                   KYLDPEMWGGKVPDWAYKISIHNLLTHSSGIAEYFSFVKLDFNMSKKEIHKKILQFVSS
FT                   KPLEISIGKKFKYSNTNFVILGMIIEKVAKKDLGNFFYDEFFKPLNMKSTSFASYSEAA
FT                   RIQKNVISSNYPVRYFLTPNNSNKPIFTPVTADFLAVPYADGGIISTPNDLVKWYRALN
FT                   DGKILSKKSYKLMTTKYFLAKDIDGRKSYMGYGIFLTDLDSKHLMIHYTGKALGIQSEV
FT                   GYVLPNNLYFAILSNTMIKIPEAEKDKIDMKNPLNQLGIIYFRDAIIGAAIKN"
FT   gene            335423..336244
FT                   /locus_tag="A1E_01495"
FT   CDS_pept        335423..336244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01495"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="COG0708 Exonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01495"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73244"
FT                   /db_xref="GOA:A8EY11"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY11"
FT                   /protein_id="ABV73244.1"
FT                   /translation="MKIVTWNINSLRLRIDLLRKLAHEHKPDIILLQETKVADSLFPLE
FT                   VIKNIGYEHIIYSGQKSYNGVAIISKFPLNNVFSLELYNSDKRHIAATVNDIEVHNFYV
FT                   PAGGDIPDIEINLKFKHKLEYVRLMQEWLTVNRTKNDKIIIVGDLNIAPHEHDVWSSRQ
FT                   LRNVISHTDIERSLLVGLQNSLGFIDSSRHFISLDEKFYTWWSYRNIDWKKSNRGRRLD
FT                   HIWVSNNLKDALFSINLLSEARDWVPPSDHVPYFVNFNFDGVMPRACNRIQ"
FT   gene            336312..337301
FT                   /gene="lpxC"
FT                   /locus_tag="A1E_01500"
FT   CDS_pept        336312..337301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="A1E_01500"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /note="COG1071 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dehydrogenase (E1) component, eukaryotic type,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01500"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73245"
FT                   /db_xref="GOA:A8EY12"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY12"
FT                   /protein_id="ABV73245.1"
FT                   /translation="MDIKLGKYKPIKEEYIKSFKNMILLRRFEEKCSQLYGMGEIGGFC
FT                   HLYIGQEAVISAVDIVKKKGDSTITSYRDHAHVILAGTEPKYVLAELMGRATGCSKGKG
FT                   GSMHLFDVPNKFYGGHGIVGAQVPIGTGLAFAEKYNGTNNICFTFLGDGAVNQGQVYEA
FT                   FNMAALWGLAVVYIIENNEYSMGTSVVRSTFMRDLYKKGESFGIKGFQLDGMNFEEMYD
FT                   GTKQAAEYVRETSQPLILEVKTYRYRGHSMSDPAKYRSKEEVEQYKKRDPLVIIRKTIL
FT                   DDKYATEADLKEIEQSVKEILKEAVEFSENSPLPDEGELYTNIFHTMV"
FT   gene            337430..338416
FT                   /locus_tag="A1E_01505"
FT   CDS_pept        337430..338416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01505"
FT                   /product="dihydrolipoamide acetyltransferase"
FT                   /note="COG0022 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dehydrogenase (E1) component, eukaryotic type,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01505"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73246"
FT                   /db_xref="GOA:A8EY13"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY13"
FT                   /protein_id="ABV73246.1"
FT                   /translation="MQITVREALRDAMQEEMIRDDKVFIMGEEVAEYQGAYKVTQGLLE
FT                   QFGPKRVIDTPITEYGFAGLAVGAALAGLRPIVEFMTFNFAMQAMDHIVNSAAKTHYMS
FT                   GGQVKCPIVFRGPNGAASRVAAQHSQNYTACYSHIPGLKVVAPYNAEDHKGLMITAIRD
FT                   DNPIIFLENEILYGHSFDVPEETIEPIPFGKAKTLIEGNSVTIVTFSIQVKLALDAANV
FT                   LQNDNNIDCEVIDLRTIKPLDTQTIIESVKKTNRLVVVEEGWFFAGVGASIASIVMKEA
FT                   FDYLDAPIEIVSGKDVPLPYAVNLEKLALPSESDIIEAVKKVCYYSV"
FT   gene            complement(338639..340483)
FT                   /locus_tag="A1E_01510"
FT   CDS_pept        complement(338639..340483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01510"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01510"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73247"
FT                   /db_xref="GOA:A8EY14"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY14"
FT                   /protein_id="ABV73247.1"
FT                   /translation="MRILKMQSIRNIAIIAHVDHGKTTLVDNMLKQSGTFRANQAVAER
FT                   AMDSNDLERERGITILAKCTALMWNDIRINIVDTPGHADFGGEVERILSMVDGVVLLVD
FT                   ASEGPMPQTKFVLSKALNLSLKPIVVINKIDRDDQRIKEVIDDVFELFVALEANNDQLD
FT                   FPIVYASGRAGRAALTFDDKINPLDNLADDLSPLFDLIVTHVPTPVADDKAPFSMLVTT
FT                   REYNSFFGRVLTGRVQSGTVKINQNVKVLNRENKVLENGRITKILAFRGLERIAIDEAT
FT                   AGDIIAMAGLENANVADTICSPEVTQAIPSLPIDPPTLSITFSVNDSPLAGSEGTKVTS
FT                   SLIGNRLMRELESNVALKVTEAAEKNTFQVAGRGELQLGILIETMRREGFELSISRPEV
FT                   LFQTDENGNKQEPMEEIQVDVDDDYVGVVVKSLALRKAEMTDMRPSGGGKTRVTFIGPS
FT                   RGLIGYHSQFLTETRGTGIINRIFHGYADYKGNIEGRRNGVLISNSDGEAVAYALWNLE
FT                   ARGKMFIKPSDKVYRGMIIGEHNRDNDLEVNPLKAKQLSNVRAAGKDEAIRLTPPMLLT
FT                   LEQAISYIQDDERVEVTPKSIRLRKALLDPNDRKRAVK"
FT   gene            340784..340918
FT                   /locus_tag="A1E_01515"
FT   CDS_pept        340784..340918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01515"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73248"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY15"
FT                   /protein_id="ABV73248.1"
FT                   /translation="MTSFKYYIIIRYNIAIASFNAYHDAVKYVLEQLLGEQMVKNILE"
FT   gene            340987..341250
FT                   /locus_tag="A1E_01520"
FT   CDS_pept        340987..341250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01520"
FT                   /product="hypothetical protein"
FT                   /note="COG1217 Predicted membrane GTPase involved in stress
FT                   response"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01520"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73249"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY16"
FT                   /protein_id="ABV73249.1"
FT                   /translation="MLQTNYKIQAVWVKKDDKDYIQEACNFLYDFNEKHEIYVELEDPA
FT                   TEIYDKNSICFSQEEINTIPFEPFSSGYDSDGEYTTMGVGMC"
FT   gene            341499..342005
FT                   /locus_tag="A1E_01525"
FT   CDS_pept        341499..342005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01525"
FT                   /product="pyruvate dehydrogenase subunit beta"
FT                   /EC_number="1.2.4.1"
FT                   /note="COG2825 Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01525"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73250"
FT                   /db_xref="GOA:A8EY17"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY17"
FT                   /protein_id="ABV73250.1"
FT                   /translation="MITEAQNVPIKEDNFKVRVAVADVQSILEGSIAIKDLRNKIEKLN
FT                   HKIQEDIAAKEAEFKPLEEQLLNERSNLSETEFEHKVNEFNAKVSHVRKEIQIKKTKLE
FT                   QAHAEAMSRVHGTTITIISELAEKYNLNLVIPSAQVLYAKNNLNITSEVTFMLNERLKE
FT                   VTINY"
FT   gene            342140..343606
FT                   /locus_tag="A1E_01530"
FT   CDS_pept        342140..343606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01530"
FT                   /product="isocitrate dehydrogenase"
FT                   /EC_number="1.1.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01530"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73251"
FT                   /db_xref="GOA:A8EY18"
FT                   /db_xref="InterPro:IPR014273"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="InterPro:IPR040978"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY18"
FT                   /protein_id="ABV73251.1"
FT                   /translation="MSVFNMAEFTPITIAYGDGIGPEIMEAVLYILREAEARIRLETIE
FT                   IGEKLYKKHYTSGISEESWASIQRTGVILKAPITTPQGGGYKSLNVTIRKTLQLFANIR
FT                   PSVSFYPFTRTLHPNLNLTIIRENEEDLYAGIEYRQTHNMYESVKLISHTGCEKIIRYA
FT                   FEYAVKNNRKKVTCLSKDNIMKFSDGIFHKVFNEIAKEYLQINNEHYIIDIGVARLATK
FT                   PEMFDVIVTSNLYGDIISDVAAEISGSVGLAGSANVGQHYAMFEAVHGSAPDIAGQDIA
FT                   NPSGLLNAAIMMLVHIGQCDVASLIENAWKKTIEDGIHTADIYNDQTSSKKVGTKEFVE
FT                   AVVKRLGQLPVELSKADYPLIAKKQESNIDYKIDTKEVKKLVGTDIFVNMNVLSAHDIA
FT                   DKINKLDIGNFELKTISSKGLKLWPRDARFETVADHWCCRFMNKDGTEIKYLDITRLLE
FT                   ALSKANITFIKVENLFEFDGVAGYSLAQGE"
FT   gene            343783..344064
FT                   /locus_tag="A1E_01535"
FT   CDS_pept        343783..344064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01535"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   G"
FT                   /note="COG0473 Isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01535"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73252"
FT                   /db_xref="GOA:A8EY19"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY19"
FT                   /protein_id="ABV73252.1"
FT                   /translation="MGILLVIIGLFAIFSGIIGFFRFSGFYPKLHAASVIESFGVPICL
FT                   IGFACIKADIINFVKLILAALLILLLNPVATHALGKASLLSMSFPRKQ"
FT   gene            344228..345277
FT                   /locus_tag="A1E_01540"
FT   CDS_pept        344228..345277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01540"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73253"
FT                   /db_xref="GOA:A8EY20"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY20"
FT                   /protein_id="ABV73253.1"
FT                   /translation="MNIALNFNLSNYLLNLIAFLLILISIKIIFAKDLLNAVIASSVFS
FT                   LLIGISYLIMDAPDVAMTEAALGACLSTCVYLNLLCTLPPDLKNIENTNIIPASLICLV
FT                   FVIILTYMGLELPNYGDDNAPLHMHSSKYYIENTTNDIGIPSLVAAILASYRGYDTLGE
FT                   TSVILIAGIAVLLVFSKKFEGDDVSKDVIPQLDRGIRKNINWMPWRDYGMTKIIKYITS
FT                   FIIPYIILYSIYIQLNGESSPGGGFQAGVIFVSSFIAYDLVYGNQKLNRYFSPNVLIYI
FT                   AILGVAIYVIVGTISLFFNDNYLNYYSLTNFINDKLLAQHIGIFIVEIVIGVTVAAIMY
FT                   LIYNLFNHE"
FT   gene            345270..345917
FT                   /locus_tag="A1E_01545"
FT   CDS_pept        345270..345917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01545"
FT                   /product="Heme exporter protein B"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01545"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73254"
FT                   /db_xref="GOA:A8EY21"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY21"
FT                   /protein_id="ABV73254.1"
FT                   /translation="MNNLFVLIKREFIVQNRINNIIKYLVIFCLFCIISTVLVNSERDI
FT                   NKFGLIFSVICLLISLINFSSIIFKSDLEDGSLELLLSIVSYEEIILAKFFAIFISSTV
FT                   GLVFILPIIYIFFDQTLLEIIFFFMSVWLMLGLSSSLVVLSGSVQCYFKKNANFVGTFI
FT                   MPLLIPDIIMTGLILQDNNLQLIFIMIGINLVFLPISFFLSSYLIKNIYNIT"
FT   gene            345992..346393
FT                   /locus_tag="A1E_01550"
FT   CDS_pept        345992..346393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01550"
FT                   /product="hypothetical protein"
FT                   /note="COG1563 Predicted subunit of the Multisubunit Na+/H+
FT                   antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01550"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73255"
FT                   /db_xref="GOA:A8EY22"
FT                   /db_xref="InterPro:IPR022714"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY22"
FT                   /protein_id="ABV73255.1"
FT                   /translation="MWQALRRLIAANPMGFFLWSIITKWYLIITVASLITLYYTVLGLK
FT                   KIGFIDYFTKTMVEILDVSKAVAQNCTTKLGPDWNHLVSFWNCLSEPGEYQYEERIGAK
FT                   ELEDAINKLRPKQVDSVADAEHPIINPYE"
FT   gene            346466..346999
FT                   /locus_tag="A1E_01555"
FT   CDS_pept        346466..346999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01555"
FT                   /product="Ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /note="COG0723 Rieske Fe-S protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01555"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73256"
FT                   /db_xref="GOA:A8EY23"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY23"
FT                   /protein_id="ABV73256.1"
FT                   /translation="MSDTEDNKNKQTTRRDFMVLTASSVAVVGAACALLPLIDSLNPSA
FT                   DVLALSSIEVDLSNIAVGQTVTVKWQGKPVFITNRTPDKIAAARAVKMSELIDPETDEA
FT                   RIKAGYDNWLVTIGICTHLGCVPLANQGEYDGWFCPCHGSQYDSSGRVRRGPAPLNLAV
FT                   PPYTFISDKKIRIG"
FT   gene            347008..348204
FT                   /locus_tag="A1E_01560"
FT   CDS_pept        347008..348204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01560"
FT                   /product="Cytochrome b"
FT                   /note="COG1290 Cytochrome b subunit of the bc complex"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01560"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73257"
FT                   /db_xref="GOA:A8EY24"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY24"
FT                   /protein_id="ABV73257.1"
FT                   /translation="MNEDITTKKSNAIIEWIDYRLPIFSFLKHFSHYQTPKNLSYLWNL
FT                   GSIAGIALVIQIITGVVLAMHYTPHVDHAFDSVERIMRNVNYGWLLRYTHAVGASMFFA
FT                   AVYLHIARGLYYGSYKTPRELLWHIGIIIFLTMMATAFMGYVLPWGQMSYWGATVITNL
FT                   FSAIPLIGESIVTWLWGGFSVDNPTLNRFFSLHYLLPFIIVALVMLHLVALHQHGSNNP
FT                   KGIDVKSSQDTIPFHPYYTVKDFVGFGVYFMIFAYFIFYAPNYLGHPDNYIQANPLVTP
FT                   AHIVPEWYFLPFYAILRAVPSKLGGVLLMFGSIFVLFLLPWLDTSKVRSSNYRPIYRIA
FT                   FWIFMADCLLLGYLGGQPVEEPYIIISRFAACYYFFHFLVAVPLIGKYEKPLPLPEQL"
FT   gene            348475..349143
FT                   /locus_tag="A1E_01565"
FT   CDS_pept        348475..349143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01565"
FT                   /product="Cytochrome c1, heme protein precursor"
FT                   /note="COG2857 Cytochrome c1"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01565"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73258"
FT                   /db_xref="GOA:A8EY25"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR021157"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY25"
FT                   /protein_id="ABV73258.1"
FT                   /translation="MKWSFDGVFGTVKREAAQRGFQVYKEVCSVCHGLNNLYYRNLKDI
FT                   GFSDDEIKEIAKVYTVKDGPNDAGEMFDRPALPSDRFVTPYPNEQAARSANNGAYPPDL
FT                   SLIIKARHDGANYIYSLLTGYKEPPADFKLMQGTHYNPYFPSEQIAMPPPLTDGQVTYM
FT                   DGTNASVEQMSHDVTVFLQWAAEPEMEHRKAMGLKVMMFLVVFTIFFYIAKNRIWSNLK
FT                   "
FT   gene            349815..350318
FT                   /locus_tag="A1E_01570"
FT   CDS_pept        349815..350318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01570"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   B"
FT                   /note="COG0071 Molecular chaperone (small heat shock
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01570"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73259"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY26"
FT                   /protein_id="ABV73259.1"
FT                   /translation="MLKNVRLYIPSIAAIILSSNIAMANKNYDAGHATALRQVADLIDN
FT                   QMTNIDNLFRNRLSLYESNSIKSNFITKDKQYIVVMEVPGFEKSQIKVKVSRNKLFITG
FT                   NIEEKNKSDDLDNYMNKNFNYVISLYEDVDQTNISSNLKNGILTIILPRTEVKEQDARE
FT                   IPIN"
FT   gene            complement(350444..351496)
FT                   /gene="prfB"
FT                   /locus_tag="A1E_01575"
FT   CDS_pept        complement(350444..351496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="A1E_01575"
FT                   /product="peptide chain release factor 2"
FT                   /note="COG1186 Protein chain release factor B"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01575"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73260"
FT                   /db_xref="GOA:A8EY27"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY27"
FT                   /protein_id="ABV73260.1"
FT                   /translation="MRGLFDIKTATKRLKELAELTTNPDLWNDQVNAQTLLREKSTLEE
FT                   KLNTLNKLKSNLKDTLELEALAETENDLETLAQVKQDLKNLSIIAAKFETEYLFSGEAD
FT                   CNNCFLEINAGAGGTESHDWASIMMRMYLRFAERLDFKTEIINMINGEEAGIKSCTIRI
FT                   IGKRAYGWFKTEAGVHRLVRISPFNAAGKRMTSFASSWVYPEIDDNISITIDDKDLRID
FT                   TFRASGAGGQHVNTTDSAVRITHIPTGTVTQCQSDRSQHKNKAQAMRMLKAKLYELEMQ
FT                   KRTDNINEQNAAKTDNSWGHQIRSYILQPYQMVKDLRTDYETSDTRGVLDGNLEEFVSA
FT                   SLAMNAGSKR"
FT   gene            351834..353636
FT                   /locus_tag="A1E_01580"
FT   CDS_pept        351834..353636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01580"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01580"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73261"
FT                   /db_xref="GOA:A8EY28"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EY28"
FT                   /protein_id="ABV73261.1"
FT                   /translation="MNNQKYIRNFSIIAHIDHGKSTLADRLIEHCGGFQAREMSKQVLD
FT                   SMDIEKERGITIKAQTVKLLYKAKDGNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLV
FT                   VDSTQGVEAQTLANVYKAIENNHEIVPVLNKIDLPASEPEHVKQQIEDIIGIDASEALL
FT                   ISAKSGIGIDLVLEAIVNKLPPPKESSDDILKALLVDSWYDPYLGVVILVRIIDGALRK
FT                   NMRIKMMATNSVYKVEHVGYFTPKKHIADVLYAGEIGFFTASIKQVADCKVGDTITDEK
FT                   KPCEQALPGFKPNLPVVFCGFYPTDSSEFEYLKDSLAKLHLNDSSFEYEMESSSALGVG
FT                   FRCGFLGLLHLEIIQERLSREFDLDLITTAPSVIYKIYMRDGESLEIYNPADLPNLQKI
FT                   ESIEEPWIKAIIIVPDEFLGAVLSLCTEKRGVQLDHSYIANRARIVYKLPLNEIVYDFY
FT                   DRLKSCSKGYASFEWQMDVYAPSELVKLGILVNGKAVDALSTIVHRSRAEQTGRALCVR
FT                   LKDLIPIQQIDIVIQASIGSRIIARETIKALRKDVLSKCYGGDITRKRKLLEKQKIGKK
FT                   RMRQYGNIEIPQSAFIAALKIGDE"
FT   gene            353735..353809
FT                   /locus_tag="A1E_t05698"
FT   tRNA            353735..353809
FT                   /locus_tag="A1E_t05698"
FT                   /product="tRNA-Asn"
FT   gene            354301..354540
FT                   /locus_tag="A1E_01585"
FT   CDS_pept        354301..354540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01585"
FT                   /product="hypothetical protein"
FT                   /note="COG0481 Membrane GTPase LepA"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01585"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73262"
FT                   /db_xref="GOA:A8EY29"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY29"
FT                   /protein_id="ABV73262.1"
FT                   /translation="MDNQEEEILTSESYIDEEEEKHLKAKNARTELKLILITFTIILTS
FT                   FLTFTYFFLNYVEEKAAEYKLQQEQEAKAANKPK"
FT   gene            complement(356372..357040)
FT                   /locus_tag="A1E_01590"
FT   CDS_pept        complement(356372..357040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01590"
FT                   /product="hypothetical protein"
FT                   /note="COG0593 ATPase involved in DNA replication
FT                   initiation"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01590"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73263"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY30"
FT                   /protein_id="ABV73263.1"
FT                   /translation="MQQYIFRFTTPNKYHPDEFIVSSSNDQAYNIIQNWQHRFGVNPYK
FT                   FTLLIKGPSSSGKTYLTKIWQNLSNAYIIKDIFFNEEILEQYNAFIIEDIENWQEPALL
FT                   YIFNIINEKRKYLLLTSFDKSKNFALPDLSSRIKSVLSIVLNSPDDELIKVLIFKHFSI
FT                   SSVIISRQIIDFLLVNLPREHSKIIEILENINQIALTSKRKITTSLVKEVLNKYSHTIL
FT                   "
FT   gene            complement(357249..358304)
FT                   /locus_tag="A1E_01595"
FT   CDS_pept        complement(357249..358304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01595"
FT                   /product="hypothetical protein"
FT                   /note="COG0628 Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01595"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73264"
FT                   /db_xref="GOA:A8EY31"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY31"
FT                   /protein_id="ABV73264.1"
FT                   /translation="MSKTAILWLVFLGIFISGFMLISDAVKPFFIAFIISYLLQPTINF
FT                   IASKFKISNKFASSIIYLIFLNIFFLSLTILVPIIYGQIFTFIHNIPKYKNYFQGEILP
FT                   PIMVKIYSIEPDIAYKIKDSLSNFINSIFTILSSIANNLWRYTIITINIFVLLLLIPII
FT                   LFYFLRDWNNIIENMKSLLPIKSRNKILEIISEINDLLSAYIRGQLNICLLLSTYYSIA
FT                   FTVIGIDLALLLGILTGFLVIIPFIGTFIAFLLTLIIGYVTFSMTAKLLYIMMIYLVGN
FT                   ICESYVLTPKIIGDKIGLHPLWIIFSIFACGSLFGIIGIFFAIPIAGITKILLLNLITF
FT                   YKFSKFYRLEG"
FT   gene            complement(358306..358845)
FT                   /locus_tag="A1E_01600"
FT   CDS_pept        complement(358306..358845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01600"
FT                   /product="hypothetical protein"
FT                   /note="COG0576 Molecular chaperone GrpE (heat shock
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01600"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73265"
FT                   /db_xref="GOA:A8EY32"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EY32"
FT                   /protein_id="ABV73265.1"
FT                   /translation="MTDNNIENNEEEIRKAPSANDREELTELKAQIEELKDKLIRTTAE
FT                   IDNTRKRLEKARDEAKDYAIATFAKELLNVSDNLARALAHTPAKLDVEVINIIEGVQMT
FT                   KDELDKIFHKHHIEEIKPEIGSMFDYNLHNAISQIDNTKYAPNSVITVMQSGYKIKDRL
FT                   LRPATVQVTKKPKQEE"
FT   gene            358922..359641
FT                   /locus_tag="A1E_01605"
FT   CDS_pept        358922..359641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01605"
FT                   /product="ribonuclease PH"
FT                   /note="COG0689 RNase PH"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01605"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73266"
FT                   /db_xref="GOA:A8EY33"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EY33"
FT                   /protein_id="ABV73266.1"
FT                   /translation="MRQSGRKSNQLRPISLELSPLVNAEGSCLIKIGKTHVICSATCET
FT                   TVPPFLRGQNQGWVTAEYGMLPSSTSQRIKREAVLGKQGGRTQEIQRLIGRAMRCVIDL
FT                   KKLGERQIIIDCDVINADGGTRTAAITGSYIALHLAIRLLMKKSILKVNPLISQIAAIS
FT                   CGIYKGETILDLDYLEDSDAEVDINFVFAGNGNLIEVQGTAEKKPFSEEQFLAMLKLAK
FT                   VGAAELFKLQNQVLLGS"
FT   gene            360130..360339
FT                   /gene="rph"
FT                   /locus_tag="A1E_01610"
FT   CDS_pept        360130..360339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="A1E_01610"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="COG1215 Glycosyltransferases, probably involved in
FT                   cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01610"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73267"
FT                   /db_xref="GOA:A8EY34"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY34"
FT                   /protein_id="ABV73267.1"
FT                   /translation="MIKEIALYNLLSYSYVIFVLKSLPGTKPKALNDALEYLRGEYLVV
FT                   YDAEDNPESDQLLKDLAMFRNLPS"
FT   gene            361264..361551
FT                   /gene="groES"
FT                   /locus_tag="A1E_01615"
FT   CDS_pept        361264..361551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="A1E_01615"
FT                   /product="co-chaperonin GroES"
FT                   /note="COG0234 Co-chaperonin GroES (HSP10)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01615"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73268"
FT                   /db_xref="GOA:A8EY35"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EY35"
FT                   /protein_id="ABV73268.1"
FT                   /translation="MSFKPLHDRIAIKPIEHEEKTKGGIIIPDTAKEKPMQGIITAVGT
FT                   GTRNEKGEVYPLELKVGDKVLYGKWAGTEIEIKGEKLIVMKENDVLGIIN"
FT   gene            361581..363224
FT                   /locus_tag="A1E_01620"
FT   CDS_pept        361581..363224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01620"
FT                   /product="chaperonin GroEL"
FT                   /note="COG0459 Chaperonin GroEL (HSP60 family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01620"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73269"
FT                   /db_xref="GOA:A8EY36"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EY36"
FT                   /protein_id="ABV73269.1"
FT                   /translation="MATKLIKHGSEAREEMLKGVDILANAVKVTLGPKGRNVLIEQSFG
FT                   APKITKDGVTVAKSIELKEKIRNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGN
FT                   KLVAAGYNPMDLKRGMDLAVNTVVEEIKKSSKKINSQEEIAQVGTISSNGDKEIGEKIA
FT                   KAMEEVGKEGVITVEEAKNFSFDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENPFILL
FT                   FEKKLSNLQPMLPILEAVVQSQRPLLIIAEDVEGEALATLVVNRLRGGLKVAAVKAPGF
FT                   GDRRKAMMEDIAILTKGELITEDLGMKLENVSIKSLGTAKRVTISKENTVIVDGSGDKK
FT                   SIEDRVLQIKSQIAETTSDYDKEKLQERLAKLSGGVAVLKVGGATEVEVKERKDRVEDA
FT                   LAATRAAVEEGVVAGGGVTLLHTSQILTKLKVENKDQQAGIEIVIEALKDPLKQIVENA
FT                   GENGGVVVGKLLEHKDKNFGFNAQDMQYVDMIQAGIIDPAKVVRTALQDAASVASLIIT
FT                   TETLIVDEPSKEEPMPMRGSGMGGMGGMDF"
FT   gene            363625..364005
FT                   /locus_tag="A1E_01625"
FT   CDS_pept        363625..364005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01625"
FT                   /product="hypothetical protein"
FT                   /note="COG0317 Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01625"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73270"
FT                   /db_xref="GOA:A8EY37"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY37"
FT                   /protein_id="ABV73270.1"
FT                   /translation="MNHNLSKHDITAQITGRIKHPISILYKLYRKGIKLEELTDIFAIR
FT                   IVVIDEEKCYKALKVVHNLYEYEKDKFKNYILNPKPNGYQSLHTIIITEDNYKIEIQIR
FT                   DHKMHYHAESGEAAHWKYKNSF"
FT   gene            complement(364741..365274)
FT                   /gene="groEL"
FT                   /locus_tag="A1E_01630"
FT   CDS_pept        complement(364741..365274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="A1E_01630"
FT                   /product="chaperonin GroEL"
FT                   /note="COG5342 Invasion protein B, involved in
FT                   pathogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01630"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73271"
FT                   /db_xref="GOA:A8EY38"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY38"
FT                   /protein_id="ABV73271.1"
FT                   /translation="MKDYVKKIAFVFSGLFIITGNFVLYSIQNVNASTTPKKYGAWTLN
FT                   CTLNEKKKLCFLSQQINNLEKDKEKEILAIYHIGYFNQEQEEQELKIIEIVPSNVQIPA
FT                   GTIINSGDKRIAAGKYVNCTVNGCQALATITQNDLDIILSNNNYVELITADGKQAKISF
FT                   IKDGLKEGIKALSR"
FT   gene            complement(365271..366662)
FT                   /gene="gltX"
FT                   /locus_tag="A1E_01635"
FT   CDS_pept        complement(365271..366662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="A1E_01635"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="COG0008 Glutamyl- and glutaminyl-tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01635"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73272"
FT                   /db_xref="GOA:A8EY39"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EY39"
FT                   /protein_id="ABV73272.1"
FT                   /translation="MTNVITRFAPSPTGFLHIGSARTALFNYLFARHHNGKFLLRIEDT
FT                   DKERSTNEAVEAIFSGLKWLGLDWDGEVIFQSKRNDLYKETALKLLQAGKAYYCFTSQE
FT                   EIEKQRQKALENKQYFIFNSDWRDKDPAAYPTDIKPVIRLKTPREGSITIRDTLQGDVV
FT                   IENSHIDDMVLLRSDGTATYMLAVVVDDHDMGITHIIRGDDHLTNAARQIAIYQACGYA
FT                   VPSMTHIPLIHGADGAKLSKRHGALGVAAYKDMGYLPESVCNYLLRLGWSHGDDEIISM
FT                   DQAIKWFNLDSLGKSPAKLDFANMNSLNAHYLRLLDNDSATSKTVERLRQNYNVSKQEV
FT                   IYINQAIRSLLVRSETLLDLVQLAQIYLVDSPIIYKQDAKEIIENCDKDLIKQVIENLN
FT                   KLKQFDKESVQNKFKEIATHNGLKLNELMKPVRALITGMTASPSVFEIAEILGKENILK
FT                   RLKII"
FT   gene            complement(366755..367465)
FT                   /locus_tag="A1E_01640"
FT   CDS_pept        complement(366755..367465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01640"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /note="COG2227
FT                   2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01640"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73273"
FT                   /db_xref="GOA:A8EY40"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EY40"
FT                   /protein_id="ABV73273.1"
FT                   /translation="MSSIDKKELEKFEKISHNWWNKDGDFGILHCINPIRLEYIIEKIT
FT                   SHYNDISKLEILDVGCGGGLIATPLAAQGFNVTAIDALQSNIETATAYAKENGVKINYL
FT                   QSTIEELKSNKLYDVVICLEVIEHVENVQQFILNLVQHIKPNGIAIISTINRMKKAYIL
FT                   GIIVAEYILGWVPKNTHNYSKFLKPSEIYEMLTDTGIEIKELKGLIYDMAKNEWKLSDN
FT                   IEVNYFMYLERNTH"
FT   gene            367641..368408
FT                   /locus_tag="A1E_01645"
FT   CDS_pept        367641..368408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01645"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /note="COG1108 ABC-type Mn2+/Zn2+ transport systems,
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01645"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73274"
FT                   /db_xref="GOA:A8EY41"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY41"
FT                   /protein_id="ABV73274.1"
FT                   /translation="MTLIILALILISCIFAPLGCIALWKRYIYFSDGLAHSSFLAASIS
FT                   IIAHFPLIYSGIIVAILFSFFVFIFKNNAEKNAVINLISSFMLAIALVINYFTSLQNNI
FT                   VNLLFGDILSVSFNDFIILAIVLITIIGFIIYFYNQILLIIINRDIAVIKGLKVNIIEL
FT                   IFLLLLSLSVFSAIKIVGVLMVTAILLIPAMIARFMSYSPSQMIIISILISLFINFCAA
FT                   LSSFYFDLPLTPIFIIIGVLIYGLLYLKQLFVD"
FT   gene            complement(368952..372380)
FT                   /locus_tag="A1E_01650"
FT   CDS_pept        complement(368952..372380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01650"
FT                   /product="acylglycerophosphoethanolamine acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01650"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73275"
FT                   /db_xref="GOA:A8EY42"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY42"
FT                   /protein_id="ABV73275.1"
FT                   /translation="MDTNKLYLFKDRRFLPNFIIQLCGCLNDNILKNAIVILITYSISG
FT                   ALSKYNNLLVLIANATFVLPFIICASIAGQIADKYERANLIKIIKICEIGIIAFTIYGF
FT                   HYNNLLILFCSICLMGIHSTFFGPIKYSVIPDHLNKYELLGANGFVEAGTFLSIFIGTI
FT                   IGSYYTISNNFIIYSLITIAFLGFITSLFVPKSGNANRDIKINLNIIDESINMIKYAKA
FT                   KKQIYLAILGISWFWFIGAAIISQIPLLAKITFKADENVANLFLAVFSLGVGVGAFLCS
FT                   KIFEDEITVKYLFISALGISIFGIDLFFASRISSVNYEPTQLKSILVFLSKRHNWRIVI
FT                   DLFFLAAIGGLYLVPLFAILQHYANPAHRSRIIAVNNLINSIFMMGSTIILSLLFYLNF
FT                   TIPWIILFISLANIIVTIHIYQLIPEVKIIPYTLLRRILQICFDLMYKVEVKGFKNFQK
FT                   AGKKVVVVANHISYLDPPLIATYLREEMTFAISPDIQKIWWIKPFLRMAKTLPVDPSNP
FT                   MAIKTLIKEVQKEQKVAIFPEGRISVTGSLMKIYEGPGMIADKAGATILPVRIDGTQFT
FT                   HLSKLKHILKRKIFPKITITVLPPVKFANMNAVSNQERRSYIARTLYDIMADMMFESSD
FT                   YKNTLFSSLIEAAKIHGFKKKIVDDFENNVVTYRELILKSFILGNLIKTNNIFGRNLGL
FT                   MLPNTTNTLIAFYAMQSSDYVPAIINWSSSISTIIKSCKLAQIKVVYTSKQFIEKANLH
FT                   ELITNLLDFGIKIIYLEDFTNQISIALKLKAKIGSYFAHTYYNYLCRNRDDEKPSVIIF
FT                   TSGTEGEPKAVLLSHRNLQTNRYQITAKVPFSPEDIVFNSLPLFHCFGLGGAIITTLNG
FT                   IKLFLYPSPLNYSTIPEVIYDVGATILISTDTFLNGYANYAHPYDFYSLRYIFAGSEKL
FT                   KESTRKFWLNKYGIRIFEGYGITEASPIIACNTPMHNKAGTVGRLLPKIDYKLEKVEGI
FT                   NEGERLFIRGPNIMLGYLESENNHTYREWYDTNDIVKIDSEGYITILGRVKHFAKIAGY
FT                   MISLTKIEELASEIDPDSLHAAISVPDKTHGEKIILFTTGSIINSKNFTDVVSKAQISL
FT                   LHLPKVIITDSEIPLLANGKIDYLEIMKNVDRYIQ"
FT   gene            complement(372407..372565)
FT                   /locus_tag="A1E_01655"
FT   CDS_pept        complement(372407..372565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01655"
FT                   /product="hypothetical protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01655"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73276"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY43"
FT                   /protein_id="ABV73276.1"
FT                   /translation="MSSIEDTKEKPKSVKSTAKFNDLSIALKKNLQRRKKVQKEKNNIG
FT                   NKPDLTY"
FT   gene            372645..374189
FT                   /locus_tag="A1E_01660"
FT   CDS_pept        372645..374189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01660"
FT                   /product="propionyl-CoA carboxylase beta chain precursor"
FT                   /EC_number="6.4.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01660"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73277"
FT                   /db_xref="GOA:A8EY44"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY44"
FT                   /protein_id="ABV73277.1"
FT                   /translation="MNQSNIISPELLDERKNIARQGGGEARINAQHHKGKLTARERIEV
FT                   LLDPNSFTETGMFVAHRCANFGMQDKKFLGDGVVTGHGTINGRLVFIYSQDFTVLGGSL
FT                   GEYHAKKICDIIDQAIATAAPVIGINDSGGARIQEGVDALAGYGELFQRNVLASGVIPQ
FT                   ITLIMGPCAGGAVYSPALTDFIFMVKNSSYMFVTGPDVVKTVTGEEVSQEKLGGARMHT
FT                   TKSGVADLAFNNDIEALLEIRKFFNFLPSSNRSPLPVRSTVDPADRVDMSLSTLIPNTP
FT                   NKPYDMKELVERIVDEGEFFELQPDFAKNIIIGFGYMEGYPVGFVANQPLHLAGCLDIN
FT                   ASRKAARFIRFCDAFNIPIVSLVDVPGFLPGTSQEHDGIIKHGAKLLYAYAEATVPKIT
FT                   VITRKAYGGAYIVMNSKHLRGDINYAWFNSEIAVMGAEGAAEIIFKEECKAPEAKKQKI
FT                   DEYRKVVTSPFVAASRGYLDDIIRPQNTRWRICKALNFLRTKKVELPWKKHDNLPL"
FT   gene            374232..374357
FT                   /locus_tag="A1E_01665"
FT   CDS_pept        374232..374357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01665"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73278"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY45"
FT                   /protein_id="ABV73278.1"
FT                   /translation="MLKISILNWIVSILCSVIAMTKKVDLCGNDIENQAIKTAAV"
FT   gene            374354..374755
FT                   /locus_tag="A1E_01670"
FT   CDS_pept        374354..374755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01670"
FT                   /product="hypothetical protein"
FT                   /note="COG4799 Acetyl-CoA carboxylase, carboxyltransferase
FT                   component (subunits alpha and beta)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01670"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73279"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY46"
FT                   /protein_id="ABV73279.1"
FT                   /translation="MTVMKKFEYKYWIVNMKTTIPPPLELTKILEIIYMKHPIPKDQNS
FT                   NKLVNAYTVTRIIRDIKEIKDTSTVSMTLVTPITPHAPTLDNKFYHLESQNYYLCYIKH
FT                   TLISPIKHLAEEALTLVPVQVQDIYAQCR"
FT   gene            374891..376888
FT                   /locus_tag="A1E_01675"
FT   CDS_pept        374891..376888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01675"
FT                   /product="acylglycerophosphoethanolamine acyltransferase"
FT                   /EC_number="6.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01675"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73280"
FT                   /db_xref="GOA:A8EY47"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR041265"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY47"
FT                   /protein_id="ABV73280.1"
FT                   /translation="MNKPLFDKILIANRSEIAVRIIRTLKKMGIKSVAVYSEADTNSIY
FT                   VQHADEAYYIGDSPATESYLSIKNIISAIRESGASAVHPGYGFLSENPNFANILKREGV
FT                   VLIGPSATTIKKMGDKIEAKKIAIEAGVSTVPGYMGTIKDVKQAVDIAKEIGFPIIVKA
FT                   AAGGGGRGMRVVNNPAEMANAFESAKLEAANSFSDDRLFIEKLIQTPRHIEIQLLADQY
FT                   GNSVCLGERECSIQRHHQKVIEEAPSSFITEDVRQEMYKQVISLSQKVGYYSAGTVEFI
FT                   VDSNKNFYFLEMNTRLQVEHPVTELITGIDIVEEMIKIAAGAKLSFTQDDVKLKGWAFE
FT                   SRICAENPSRGFLPSSGRIIAYSEPAKSPNIRIDTGIGLGGEVSMFYDSMIAKLCTYGE
FT                   TREQAIEVMRSALSSYIINGIAHNISFLEAVMLHPRFVSGDISTAFIQEEYPDGFSGAS
FT                   LTSEVTTVFLATAIFIYISEQRRASLISGNINNQANKIGTRWVVTIDDKLFPVLITPVE
FT                   NGYNIRHESDRIYIRSNWNLGNELFTAIINGKKTNVKIENIRTGYLLSHAGISVKAFVR
FT                   SPRISELEALMVSKVVVEENTELQAPLSGQIVSIKVMEGQQVIAGQEIMVLTAMKMENL
FT                   ILAERDGKIAKIYVNEKDNVVRGQILLEFA"
FT   gene            complement(378084..378203)
FT                   /locus_tag="A1E_01680"
FT   CDS_pept        complement(378084..378203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01680"
FT                   /product="hypothetical protein"
FT                   /note="COG4770 Acetyl/propionyl-CoA carboxylase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01680"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73281"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY48"
FT                   /protein_id="ABV73281.1"
FT                   /translation="MNLINIILHRKVDKYKALEFAIQKKNYQQTDDLIALTLM"
FT   gene            complement(378459..381698)
FT                   /locus_tag="A1E_01685"
FT   CDS_pept        complement(378459..381698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01685"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="COG0060 Isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01685"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73282"
FT                   /db_xref="GOA:A8EY49"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EY49"
FT                   /protein_id="ABV73282.1"
FT                   /translation="MTNTKYYPEVSSNADFAAIEREILKLWQDNNIFQKSIDNRIKDAE
FT                   FIFYDGPPFANGLPHYGHLLTGFIKDVYARYQTIKGKKVERRFGWDCHGLPAEMQSEQE
FT                   LGISGRLAITNFSIEKFNSHCRASVMKYTGEWEQYVTRQARWVDFKNSYKTMDTHFMES
FT                   VLWAFKELYNKGLLYESMRVMPYSWACETPLSHFETRLDNSYRERADKAVTVSFMLRDK
FT                   LPHSEYKEYRIFAWTTTPWTLPANLALAVGSDIDYALVPKNDICYIIAAASVSKYAKEL
FT                   ELKGDEQFTIIKGSELEGLRYKPLFNYFENHPNSFKIFACDFVVEGDGTGVVHMAPGFG
FT                   EDDQILCESKGIELVCPVDNSGKFTKEIPDLEGLQVFDANDKIIIKLKEQGNWLKTEQY
FT                   IHNYPHCWRTDTPLIYKAVPSWYVKVTNFKDRIVELNQQINWIPSHVKDNVFGKWLENA
FT                   RDWSISRNRFWGTPLPVWKSDDPKYPRIDVYGSIEELEKDFGVKVTDLHRPFIDELTRA
FT                   NPDDPTGKSTMRRIEDVFDCWFESGSMPYSQAHYPFENKKWFEDHFPADFIVEYVAQTR
FT                   GWFYTLMVLSTALFDRPPFLNCICHGVILDTTGQKLSKRLNNYADPLELFDKYGSDALR
FT                   ITMLSSNVVKGQELLIDKDGKMVFDTLRLFIKPIWNAYHFFTMYANADSLKGKSDFASE
FT                   NVLDIYILSKLKIAVQKIEKSLDNFDTQAAYHQVSEFFEVLNNWYIRRSRARFWKSEKD
FT                   ADKQNAYNTLYSCLETMAIAMSALVPMISEAIYLGLHNTVIPQLDYGISGDKPGAQDPI
FT                   IKSQDGIRGCRNDNLSVHLCNYPKLSNFEVNHELVATMDTVLDICSNSLFIRSNENVRV
FT                   RQPLASITIISKHNDKLKDFEDLIKDEINVKAIIYRDDLENYATTKLSLNFPMLGKRLP
FT                   YKMKEIIAASKKGEWEATASALAICGETLKSEEYKLVLEPYSHIKGAASFADNSSLLIL
FT                   DLELTPELIKEGIARDIVRFIQQARKDADCSITDRILIEIISESDLSKIINIYGDYIKE
FT                   QTLSEFAKDFTPDYVNEIELENHKIQLKIKR"
FT   gene            complement(382168..382779)
FT                   /gene="ileS"
FT                   /locus_tag="A1E_01690"
FT   CDS_pept        complement(382168..382779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="A1E_01690"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="COG5590 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01690"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73283"
FT                   /db_xref="GOA:A8EY50"
FT                   /db_xref="InterPro:IPR012762"
FT                   /db_xref="InterPro:IPR013718"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY50"
FT                   /protein_id="ABV73283.1"
FT                   /translation="MSIQEEYYIKKLSFVQSSLELLPFNEWNNKLLKEAEEKCGFDKGY
FT                   SLILFPEGLSEIVEFCESYLDKILLESLSIIEEPAKIREKISLAIKIRIKSTLPIIHSK
FT                   NAAYFALNPIQGAKVAFRSCDTIWRYAGDKSLDFNYYTKRSVLLSVYVSSILVYIQDES
FT                   EHYIDTDKFIENSVENIVKTFSQMRKLLDPSNIPIVRMFT"
FT   gene            382865..383065
FT                   /locus_tag="A1E_01695"
FT   CDS_pept        382865..383065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01695"
FT                   /product="30S ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01695"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73284"
FT                   /db_xref="GOA:A8EY51"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EY51"
FT                   /protein_id="ABV73284.1"
FT                   /translation="MILVNVHAGNCDNTLKNFKKKLQRELYFRKMKEQRYYETPSAKRV
FT                   RKAQEAARRQRKFARKKMFDE"
FT   gene            complement(383216..383350)
FT                   /locus_tag="A1E_01700"
FT   CDS_pept        complement(383216..383350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01700"
FT                   /product="hypothetical protein"
FT                   /note="COG0828 Ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01700"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73285"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY52"
FT                   /protein_id="ABV73285.1"
FT                   /translation="MCTLRFDYINKQMRDFLEKNSAKYNTQVMDIEQNIFLLQLKKKI"
FT   gene            383944..385746
FT                   /locus_tag="A1E_01705"
FT   CDS_pept        383944..385746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01705"
FT                   /product="nitrogen regulation protein ntrY"
FT                   /note="COG5000 Signal transduction histidine kinase
FT                   involved in nitrogen fixation and metabolism regulation"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01705"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73286"
FT                   /db_xref="GOA:A8EY53"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY53"
FT                   /protein_id="ABV73286.1"
FT                   /translation="MLSYFKQNLRSYFSSRMLIFILMASSVIVACATFYVISLESKSFS
FT                   TIIGFLLVDLAVFLILGILLTQKFFAKNNNNDTSKLQNRIVIAFSLVAAIPTIIVSVFS
FT                   VYFFNLSVQAWFDKKISTVLDQSVIVAESYIAEHKLQLKETALAVAEDLGDMYYDLIHN
FT                   PALFTKTLNTEAEMRSLDEAIVLNKSTNTIVANSYLSFSLSFATIPAHLIKKADLGEPV
FT                   EVKSDPTKIRMLIKLKEYNDVYLLVGRLVDNKIIDHIDATNGAAAEYNSLKNEIDNIQI
FT                   KFSIMFIFIALLLLFVAISFGVIFTAKIVNPIKKLVTATDKVKDGDLTVQVPENEVDKD
FT                   EIGTLYAAFNRMIKQISRQQRDLVIAQRAMVWSDVAKKVAHEIKNPLTPILLASERLFK
FT                   KFSPEIKERTEFENYLKMIIRHTNDIKSIVSEFVLFARLPAPKFTKSEIVYLVKHIVEA
FT                   RKLLNDHILYKFESNVDQFDFMCDATQINQVMINLLKNAEESIEGREDGKIEVTIDAKD
FT                   DFISVIVIDNGKGFPPELIGKATESYVTTSSKGMGVGLAIVKRIVEEHCGVLDIANREE
FT                   KGAIIDIKFDLKELDLKILKIGLK"
FT   gene            385940..387447
FT                   /locus_tag="A1E_r05750"
FT   rRNA            385940..387447
FT                   /locus_tag="A1E_r05750"
FT                   /product="16S ribosomal RNA"
FT   gene            388111..388425
FT                   /locus_tag="A1E_01710"
FT   CDS_pept        388111..388425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01710"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73287"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY54"
FT                   /protein_id="ABV73287.1"
FT                   /translation="MGVKTLNVVDKKRGNDALYLVILDSSENDTELITCLIKNGININH
FT                   HNSLGNTALLTSGYLSVVRILLENGADINIKNNENITSAILLQNEMFRYTIFLLIDLLL
FT                   "
FT   gene            388422..388532
FT                   /locus_tag="A1E_01715"
FT   CDS_pept        388422..388532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01715"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01715"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73288"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY55"
FT                   /protein_id="ABV73288.1"
FT                   /translation="MINKNSLAVKKIYEKINNKITKELAEALIKKYEVFK"
FT   gene            388589..388687
FT                   /locus_tag="A1E_01720"
FT   CDS_pept        388589..388687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01720"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73289"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY56"
FT                   /protein_id="ABV73289.1"
FT                   /translation="MNKGNTSIVKSADISKKDYYISSTDFKGHIAN"
FT   gene            389243..389380
FT                   /locus_tag="A1E_01725"
FT   CDS_pept        389243..389380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01725"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01725"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73290"
FT                   /db_xref="GOA:A8EY57"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY57"
FT                   /protein_id="ABV73290.1"
FT                   /translation="MNLAAMLEFKSPYGFFYSLVLMLLSINFLRKRTNYKFLLIIYSFI
FT                   "
FT   gene            389492..391237
FT                   /gene="rpsU"
FT                   /locus_tag="A1E_01730"
FT   CDS_pept        389492..391237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="A1E_01730"
FT                   /product="30S ribosomal protein S21"
FT                   /note="COG0666 FOG: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01730"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73291"
FT                   /db_xref="GOA:A8EY58"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY58"
FT                   /protein_id="ABV73291.1"
FT                   /translation="MQKILLKGRNVNIKNPNPNIKEIKTLAELPSGTGHEYFINSHGLE
FT                   IKSFLKKDYSFLYITGLSAEDGTKISILDITLLNNIQNGIHADQCNIVHIYSCYSGAAQ
FT                   HHLNCIHGNIVLCTYNKASDVNVILLAQSNYDARIKNDSSLIEYIRDNFHLLAASDFSI
FT                   SYKLDDQIYNFSLSADEIKKMKSIEELPAFLHKKYDAFVKFYTKIYAEYHESYPEIFNL
FT                   KIEPEPKALTQADLIRVFNRVVVLEVYNFNKSSLSNIKTMLNQEGLNINICIDRAIRQG
FT                   NCELLICLLNYYNTKEVEPYILDKAIERGDINILKAILEHSTTKIGSYTLNQVIERGDV
FT                   NILKAILEHSTTKIESYTLNQVIERGDVNILKAILEHSTTQMDFYTLAQVIKKGDVNIL
FT                   KVVLEHNTKEVEFCSLFLIYQAIERGDVNILKAILEHSTTKIGSYTLNQVIERGDVNIL
FT                   KAILEHSTTQIESYNLAKVVEKGDVNILKAVLEHNTKEVEFCTLFLIYKAIERGDVNIL
FT                   KAILEHNTKEVDSYNFNLEILFNDPTVNSYNNTAEETNDVENTSTINTMLNVVEEVTIL
FT                   GESSE"
FT   gene            complement(391306..391662)
FT                   /gene="rnpA"
FT                   /locus_tag="A1E_01735"
FT   CDS_pept        complement(391306..391662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="A1E_01735"
FT                   /product="ribonuclease P"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01735"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73292"
FT                   /db_xref="GOA:A8EY59"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EY59"
FT                   /protein_id="ABV73292.1"
FT                   /translation="MSITSLKNQKEFELINKLGKKFHERYFILVIAKNLPKIFLETKYN
FT                   IFLGIKVSKKLNKKAVVRNKIKRRIRHLIRMNVSDSKLKAIKLAMIIIPRKGFEEINFS
FT                   HLNDELSNIILKNI"
FT   gene            complement(391682..391816)
FT                   /locus_tag="A1E_01740"
FT   CDS_pept        complement(391682..391816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01740"
FT                   /product="hypothetical protein"
FT                   /note="COG0594 RNase P protein component"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01740"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73293"
FT                   /db_xref="GOA:A8EY60"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EY60"
FT                   /protein_id="ABV73293.1"
FT                   /translation="MKRTFQPSNLVRKRRHGFRARMATPSGRAILRRRRAKGRHKLSA"
FT   gene            complement(391948..392301)
FT                   /gene="rplT"
FT                   /locus_tag="A1E_01745"
FT   CDS_pept        complement(391948..392301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="A1E_01745"
FT                   /product="50S ribosomal protein L20"
FT                   /note="COG0292 Ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01745"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73294"
FT                   /db_xref="GOA:A8EY61"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EY61"
FT                   /protein_id="ABV73294.1"
FT                   /translation="MTRAKSGKISKNRHKKILKLAKGYRGRANSCFRVAIAKVEKALQY
FT                   AYRDRRNRKRNFRGLWIQRINAAVRTHGLIYSQFMGTLKKAGIDIDRKVLAELAVNNSD
FT                   GFASIVEKAKAHI"
FT   gene            complement(392317..392523)
FT                   /locus_tag="A1E_01750"
FT   CDS_pept        complement(392317..392523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01750"
FT                   /product="50S ribosomal protein L35"
FT                   /note="COG0291 Ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01750"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73295"
FT                   /db_xref="GOA:A8EY62"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EY62"
FT                   /protein_id="ABV73295.1"
FT                   /translation="MPKLKTKSAAKKRFKLTASGNVIASQAGKKHFMRRRTKAQIRNLR
FT                   GTTILCNQEGYNIKKYFLPYGTN"
FT   gene            392810..393487
FT                   /gene="rpmI"
FT                   /locus_tag="A1E_01755"
FT   CDS_pept        392810..393487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="A1E_01755"
FT                   /product="50S ribosomal protein L35"
FT                   /note="COG0602 Organic radical activating enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01755"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73296"
FT                   /db_xref="GOA:A8EY63"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY63"
FT                   /protein_id="ABV73296.1"
FT                   /translation="MFGQNPKRSILNGDGTKLEVKSIFKTIQGEGIFVGSPAIFVRLGG
FT                   CNLACHFCDTEFEDFDLVDITEILNKVESLALNSKNEKSVNLVVITGGEPMRQPIALLC
FT                   QKLLDRDFKVQIETNGTLYRSLPNEVSIICSPKAGQTGYSKIREDLLSQISAVKFIVAK
FT                   NILEYSFIPEVGQTAYNIPVFVQPMDQNNPKLNDENNALAVKLALESGSKLSLQTHKFL
FT                   GID"
FT   gene            393570..394184
FT                   /locus_tag="A1E_01760"
FT   CDS_pept        393570..394184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01760"
FT                   /product="50S ribosomal protein L25/general stress protein
FT                   Ctc"
FT                   /note="COG1825 Ribosomal protein L25 (general stress
FT                   protein Ctc)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01760"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73297"
FT                   /db_xref="GOA:A8EY64"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EY64"
FT                   /protein_id="ABV73297.1"
FT                   /translation="MSKILELEAQSRTEFGTGAARALRREGRVPAIIYGAGKTPVSISL
FT                   EEKEITKYYRKPAFISQLINLTIDKKQYKVLPKAVELHPVTDIVRHVDFVFLEEKKQKM
FT                   EVPVVYEGKERALGVKRGGYFNIVKRRVTLLCDVNNIPRNVTIDVTNMPIATSLNSSKI
FT                   VLPKGCSFASKKEFVLATIIGRRGVKTEAEGEQQAAAEAGK"
FT   gene            394400..394957
FT                   /locus_tag="A1E_01765"
FT   CDS_pept        394400..394957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01765"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01765"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73298"
FT                   /db_xref="GOA:A8EY65"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EY65"
FT                   /protein_id="ABV73298.1"
FT                   /translation="MIFVIGLGNPGKEYQYTRHNIGFIVIEKIANQYNLSFSTKKKFNC
FT                   EIVESSVEKQKLIFIKPTTYMNLSGKSVISVKTYYNICSEKIFVIHDDIDLETGRIKFK
FT                   TGGGNGGHNGLKSIDRVIGNNYNRIRIGVGRPQNNQDVADYVLNNFPRSEYEIVIQSID
FT                   KITNNFDLILENKLEEFKNKIG"
FT   gene            395240..395416
FT                   /locus_tag="A1E_01770"
FT   CDS_pept        395240..395416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01770"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="COG0193 Peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01770"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73299"
FT                   /db_xref="GOA:A8EY66"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY66"
FT                   /protein_id="ABV73299.1"
FT                   /translation="MLEQKNGVVGDVDFFSFSCFDQNKNFVAGIRGMNSWGGFDSLFVN
FT                   QNIRNQNYGTLLI"
FT   gene            395577..396674
FT                   /locus_tag="A1E_01775"
FT   CDS_pept        395577..396674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01775"
FT                   /product="translation-associated GTPase"
FT                   /note="COG0012 Predicted GTPase, probable translation
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01775"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73300"
FT                   /db_xref="GOA:A8EY67"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY67"
FT                   /protein_id="ABV73300.1"
FT                   /translation="MTLKLGIVGLPNVGKSTLFNALTASQAADAANYPFCTIEPNSSKV
FT                   SVPDKRLHKLASLTGSRKIISSYIDFVDIAGLVKGASKGEGLGNKFLSHIREVDAILHV
FT                   LRCFEDEDIMHVHNKVDPLHDLEIIETELILADIELVEKRLATSEKRLKSGDKTMAAQI
FT                   ELLKEVYKWLADGKPARVLNEILGLDKLKQLQLITFKPVLYVCNVLEQDAVDGNELTKL
FT                   VVERAKKENAKSVVVSSKIEADIALLESIEEKEEFLKDIGLDETGLSKVIKEGYNLLNL
FT                   KSFFTIGPKEVHSWTFKDGTLASAAAGIIHTDFEKGFIRAEVIGYEDYISLGSEAKAKA
FT                   VGKMRLEGKEYKMQDGDIVHFRFNV"
FT   gene            396688..396903
FT                   /locus_tag="A1E_01780"
FT   CDS_pept        396688..396903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01780"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73301"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY68"
FT                   /protein_id="ABV73301.1"
FT                   /translation="MKTILPKWSLEVQDRLDYIVQQILTGAKDKIAMIILYGSYARGDW
FT                   VKDMYKEGSYYLCYISAFDCLIVLKK"
FT   gene            397585..398814
FT                   /locus_tag="A1E_01785"
FT   CDS_pept        397585..398814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01785"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01785"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73302"
FT                   /db_xref="GOA:A8EY69"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY69"
FT                   /protein_id="ABV73302.1"
FT                   /translation="MKIIKQIPAWILLCLFILSPTTETIYTSGLPSVTKYFGIDGGITQ
FT                   ITSTLYFLGFAFGILSLGRLSDIYGRRPIVLLGLVIYVISSIISIFAVNIEMLMIARFT
FT                   QAFGVSVGSVIGQAMARDSYQGSELSYVYASLSPWLLFIPAVGSSIGGYIIEYLNWHYV
FT                   FVFFSLTGTILLALYYKVLPETNSYINFSQSSKYCEVLQVIIKDKILWLYAFIIGAFNG
FT                   IYYGFYIEAPFIFIDKMKVAPSFYGKLAFLLSFAGIVGGFLGGYLIKKCHIHDKKVMGL
FT                   GCIFSLCGCILFAINAFMLEAVQTSKNLTIIIIFVPMMTHMLGHNLLIPMTLRYALEDY
FT                   AKVTGTAGSIFGAIYYVLIAVITYIVAQIHAETISNFALLCVALSISSAAAFYYIWRLY
FT                   KKKQYRKVIY"
FT   gene            complement(399150..399293)
FT                   /locus_tag="A1E_01790"
FT   CDS_pept        complement(399150..399293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01790"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73303"
FT                   /db_xref="InterPro:IPR020954"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY70"
FT                   /protein_id="ABV73303.1"
FT                   /translation="MNSYRTTDFPIKPDKAVGSMDLSIVALDENGNKPTASTAIFYCSL
FT                   CT"
FT   gene            complement(399405..399518)
FT                   /locus_tag="A1E_01795"
FT   CDS_pept        complement(399405..399518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01795"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01795"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73304"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY71"
FT                   /protein_id="ABV73304.1"
FT                   /translation="MQTTKAELEKIEISGYKKIHEKCRDQIQPKMGKLREY"
FT   gene            complement(399878..400150)
FT                   /locus_tag="A1E_01800"
FT   CDS_pept        complement(399878..400150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01800"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73305"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY72"
FT                   /protein_id="ABV73305.1"
FT                   /translation="MQIAYAVIGYEVVNKTLTDKSTSDVSLLNEITSGKFSKDDTPEVS
FT                   NQNGNKVRIEFNKPHFTLQLLGKETTVKIQSVCEEGVTPTRPQNT"
FT   gene            complement(400155..400316)
FT                   /locus_tag="A1E_01805"
FT   CDS_pept        complement(400155..400316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01805"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01805"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73306"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY73"
FT                   /protein_id="ABV73306.1"
FT                   /translation="MTRYLDNYLKTFNFPQGVEKITKLVEAFSNNYYKYKNPKENKQIL
FT                   EEIYNIKK"
FT   gene            complement(400327..400533)
FT                   /locus_tag="A1E_01810"
FT   CDS_pept        complement(400327..400533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01810"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73307"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY74"
FT                   /protein_id="ABV73307.1"
FT                   /translation="MDTPNYIYKGTKGVAHFFQNLCETTKTDLDFVRKYLADNADVLKL
FT                   LLTQVHLEISTRIINKEPEQEDK"
FT   gene            complement(400704..402545)
FT                   /locus_tag="A1E_01815"
FT   CDS_pept        complement(400704..402545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01815"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01815"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73308"
FT                   /db_xref="GOA:A8EY75"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY75"
FT                   /protein_id="ABV73308.1"
FT                   /translation="MTGKIANIKTNRVLALSGGGVKGISELIVLIAIEEKTGKSISELF
FT                   PIISGTSVGGLIAALLTIPKELGAKEAKYSAREALEIFKTNANYIFPDNFLGSVKQIFT
FT                   HKYSQKPLKELLEKYLGDNRMDSTTSRLVIPVNDLTANGGKLEVFDSFHGYSPHVRVKD
FT                   VLLATTAAPTYFKPIMDKAAIQEYNYASGTPYAYADGGLNANRPASEVLKLLKKGYIHK
FT                   EQNHTRIDKNLTREEQKEILDHTMVCAFNFSNNIEPTNSIPKIGSDGIIGWLVKGKLIS
FT                   RLMHNMENSSTTEVKNDLSGKDEFFEVGLPITKETKSLDNASPKNIERLEEIGYKYVQE
FT                   NNELIQKLCDNLLDNLNKEQAANQTVDLIDGCFAEEENIENNQETINKPITQALEPDDE
FT                   GFEEEENIENNQETINKPITQALEPDDEGFEEEENIENNQETINKPITQALEPDDEGFE
FT                   EEENIENNQETINKPITQALEPDDEGFEEEENIENNQETINKPITQALEPDDEGFEEDT
FT                   EYEKEELLTGIKKFLNAFSEQNPTLKNDIDNFLQTAENYTLNEIKECIVSFEQASLKWQ
FT                   AEQKKHDVFSSCSMEALKEEMNLEGIDDEVLNHEIIA"
FT   gene            complement(403657..403941)
FT                   /locus_tag="A1E_01820"
FT   CDS_pept        complement(403657..403941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01820"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73309"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY76"
FT                   /protein_id="ABV73309.1"
FT                   /translation="MPSKNYFVKELVLRLSGQYQIKRIIDNHGYGKWVAYFLPESLNEL
FT                   IYKEELKIHYHDYDHQISANKEYRYLFKNSNVTKYFIAHKNSLFYLFYR"
FT   gene            complement(404050..405441)
FT                   /locus_tag="A1E_01825"
FT   CDS_pept        complement(404050..405441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01825"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01825"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73310"
FT                   /db_xref="GOA:A8EY77"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EY77"
FT                   /protein_id="ABV73310.1"
FT                   /translation="MSTNQIILTDQGDNYLNVWSHVAQDLYNHYGETLYNSWFSKVNFI
FT                   ESSLNTVILCAPTNFVRDWIKSKYSMVILQLFQHYNNTIKSVEIITKELPGTSKTVIEL
FT                   PTKTFADIGSSELNAENIFSTLDVRFTFDNFVVGVPNELAYAAARAVAESTDAVSESNP
FT                   LFLYGGVGLGKTHLMHAIGWYIKQNNPNRKVIYMSAEKFMYQFVKALRNKEVISFKEKF
FT                   RSVDVLMIDDIQFICGKDSTQEEFFHTFNTLIDNNRQIVISCDRSPSDLDNIEDRIKSR
FT                   LGWGLVADVHSTTYELRLGILESKIEQMNVKIPKNVIDFLASKIVSNVRELEGALNKVI
FT                   AHSNFTLKEITLENTQNILRDLLRSNERIITVEDIQKKVASRYNIKLSDMSSSRRLREV
FT                   ARPRQIAMYLSKTLTPKSLADIGKKFGKKDHTTVMHAIKKVEELLENDIELREEINLLM
FT                   KILQN"
FT   gene            complement(405472..405798)
FT                   /locus_tag="A1E_01830"
FT   CDS_pept        complement(405472..405798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01830"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73311"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY78"
FT                   /protein_id="ABV73311.1"
FT                   /translation="MSVQNICCTKAYNILVSNDNVFLVDVRTREEWKQVGIPHKVIFLS
FT                   WQLNKDFEDNFLSIINDKIHAMIFLLFRSGYRSFTAANFITNIGYKNCYNISDLFEGNN
FT                   QNKG"
FT   gene            406123..406386
FT                   /locus_tag="A1E_01835"
FT   CDS_pept        406123..406386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01835"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01835"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73312"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY79"
FT                   /protein_id="ABV73312.1"
FT                   /translation="MNKLNKNSLQKKLLYLSKNRGCKEMDYILGSFTEKYLSLMDEKKL
FT                   ESYALILDQNDNDLYNWINNKSSAPSYLDIEIIDKLRKIAKV"
FT   gene            406399..409758
FT                   /locus_tag="A1E_01840"
FT   CDS_pept        406399..409758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01840"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73313"
FT                   /db_xref="GOA:A8EY80"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY80"
FT                   /protein_id="ABV73313.1"
FT                   /translation="MLQQKFPAAAKSFFAIDNLTKNLKQDLILSVSNEEDVLQLYKQAL
FT                   FFSSNESIYYFPSYDTVPYDHASPSPSIVSKRAETLTKLTTNNSNSKLLITHAANLLNK
FT                   LPPKDFFSKYFLKLFPKMKFTTDELAMFLVENSFTRNTSSVDVGEFVVRGEIIDIILPG
FT                   PKAYRINFSWDYIESIKEFDIDTQISTKSCTELVITPVNEIVLNSETIGNFKNNYLRNF
FT                   GVNYTDNPLYEAVTSGRKFSGYEQLLPLFYNSCSNLVDYLNDPIIIFDNLSKQAILEFE
FT                   RSYNDFYSARSEANKFNRFYPTLAPTRLYFTISEIMELLEQKNNILISYDNSEQATLIE
FT                   NIRSTSFIEKKIVFDKLFEIIKAHSSKKIVIGVASLSGLERVKSIIQNYEYTYNEINKL
FT                   DEAKIGIINIAILPLNQSFDTKEYLFITVSELLEEKPSSINTNKKLKNILLELDNLAEG
FT                   EFVVHKDHGIGKFLKLEALEIKGKLHDFLKILYAGNDKLYIPVENIEVIKKYGNDNAEL
FT                   DKLGSVSWQRSKAKLKNRIKEIALHLIQIAAQRKLNTNASIEFDLEEYDKFCAHFPFSE
FT                   TEDQLTAINDIREDLRSGMLMDRLICGDVGFGKTEVAMRAVFMVAKSLNEYSPQVAVVV
FT                   PTTILCSQHVSRFTERFKGFGLNIKQLSSIISPKEAKIIRSELESGKINIIIGTHSLLH
FT                   KNTKFFNLKLLIIDEEQHFGVSQKEFLKQLKSSSHVLAMSATPIPRTLQMSMTGLKELS
FT                   IIATPPLNRLEVRTSVMPFNPVIIRDALLREHFRGGRSFYVVPRINDILDIEKQLKQIV
FT                   PELSYKIVHRKMPYNKIDEVMSEFYAGKFDILVSTTIIESGIDIQGANTMIIHKADMLG
FT                   LSQLYQLRGRIGRGKMRGYAYLIVESHKKMTAHSLRRLEIIQNSCALGSGFTIASHDMD
FT                   LRGFGNLIGEEQSGQIREVGTELYQEMLEEQIALFKDEPVVSEQPFIPTINLGLSVFIP
FT                   DHYVSDSALKIGIYRRIGNLSNEIEVEKFKDEMIDRFGSLPTEFNNLLDIVKIKLLCFK
FT                   LNIENLDSGDNGFVIKFYKNADMADKILKFVSTYHSQAKIKPDNRLVFIKKLVGKNVIV
FT                   EANQLLWNLAEI"
FT   gene            409875..411311
FT                   /locus_tag="A1E_01845"
FT   CDS_pept        409875..411311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01845"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01845"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73314"
FT                   /db_xref="GOA:A8EY81"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY81"
FT                   /protein_id="ABV73314.1"
FT                   /translation="MLFNLKQLFQQHNIKGLSTNSKNIKEGEVFFAVKGRTVDGNDFIN
FT                   DALNKGAVLVITDNEKNTAINKVIYVEDLQKALYEVIEIFYPKKPKHLIAVTGTNGKSS
FT                   VISYIAQLYSLLGEKAASIGTIGVEIFGCDNFINDVPELTTFDYLSFRKIAHNLAEIGI
FT                   EYLAFEASSHGLDQTRLGENKVNIACFTSFSHDHLDYHHTKENYLLAKLKLFTNHLLPN
FT                   AISILNSDIEEIEFIKAYLNKHNIKFITVGIKGDLQITRINSSLKGQNIDFTFNNRKYS
FT                   FNTPIIGSFQASNLLIAALSEYYTGVAFDEVIGSLVDVKPVKGRMQQIENTNIFVDYSH
FT                   TPDALEKALLELKNIQVLGSKLNVIFGCGGNRDKKKRSLMGQIAAKLADNVIITDDNPR
FT                   LEDPKLIRAEIISGIDKANYIEIENREKAIKYGINNLNQDDILLIAGKGHENYQIIGNK
FT                   KIPFDDAEIVKKYIKYHAVT"
FT   gene            411460..412968
FT                   /locus_tag="A1E_01850"
FT   CDS_pept        411460..412968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01850"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73315"
FT                   /db_xref="GOA:A8EY82"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY82"
FT                   /protein_id="ABV73315.1"
FT                   /translation="MIWNSETLSKALGITISNSINCNEVQFNSKDVKKGDLFIALKGNG
FT                   DGHDYVLDAIDKGANAIIVSKHIDIVDKNKIILVDDCFEALQKMALYKRGSSKAKFIAI
FT                   TGSVGKTSTKGALKTLLTETSDKSLHLLYNEANKEEFEGNTEYSTTEYKKVCDAASTRL
FT                   TYKLPLEVSYIKGLVFASRGNFNNHLGLLINLASMSDDTEYAIFELGMNHKGEIRELVQ
FT                   ILKPNIAMITNVSEAHLEFFNSLEDIAEAKCEIFENFSKNDIAVINANTNCYNKILSIL
FT                   KNLSIDKIYNFGASYNTSAELTLYANLGKQVHLKYKINNKTIEITIPFIPRHFAENYIG
FT                   VLLIINILGKNLDIAANHLANISPTKGRGEMINIQNCCVICDYYNASPQSMKAALEYLK
FT                   QVPAENKTAIIGDMLELGQNSEALHKELVPYILDADCSKVFLVGKNTKYIYNLLPFKIA
FT                   KKYFKNVDELITHITVTDLFKNNELILIKGSRGIKLDKIVDCYK"
FT   gene            413061..414146
FT                   /locus_tag="A1E_01855"
FT   CDS_pept        413061..414146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01855"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01855"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73316"
FT                   /db_xref="GOA:A8EY83"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EY83"
FT                   /protein_id="ABV73316.1"
FT                   /translation="MLYNLLLPHIHNSHIANLFHYITFRSGLAIIITLSLSFVTGPILI
FT                   KFLRTLQKNGQPIRLDGPESHQTKAGTPTMGGIMIILSSCLATLLLADLTNKYIWITLF
FT                   GFISFGIIGFMDDYAKVTKNNHYGVRGKSKLLLQGIISLIICILLEYTDKNPSHLLNIP
FT                   FFKNLSLDLGYFYIVFAIFVIVGSSNAVNLTDGLDGLATVPIAFTAGSFALISYLVGNL
FT                   IYSNYLQLTYIPNTGELTVLCAGLVGSCLGFLWFNAQPAEVFMGDTGSLSLGSILGIIS
FT                   VITKHEVVLSIVGGLFVVETTSVILQVYYFKATKGKRIFKMAPLHHHFEKHGWEESKVV
FT                   IRFWIISVIFALIGLSSLKLR"
FT   gene            414312..415991
FT                   /locus_tag="A1E_01860"
FT   CDS_pept        414312..415991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01860"
FT                   /product="Actin polymerization protein RickA"
FT                   /note="COG0472 UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01860"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73317"
FT                   /db_xref="GOA:A8EY84"
FT                   /db_xref="InterPro:IPR003124"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY84"
FT                   /protein_id="ABV73317.1"
FT                   /translation="MAKETKETKETKETKETDINKLLTQENNALNTILRQVNELCEQNQ
FT                   KLQGVLEIQNEAKELEKEHNRSLPWFKKFVKTVSNVKYIFIKSEEQLTHEAIKHNTKIL
FT                   KDIDNKIYNIVAKSAPLKQALQEEIKKNFEDLTKKDLSKDQRERLAELFFSYKDKPERF
FT                   SALRMTHPLQFTNAAVLENQYNALNTTKQNIRNLISENSNIKELKEIQKQVAEIREEIP
FT                   HTFFEKLNSIWQNVKNVFINNSEQVLAKNKESNTRAIRKIEEQLYSTKHQFEKLIENQE
FT                   KNINDIIGKLPDNEKLQKIVSNLADHMTAKKEPILTTSSLTKPLENNMPPPPPPPPLPQ
FT                   NNMPPPPPPPPLPQNNMPPPPPPPPLPQNNMPPPPPPPPPLPQNNMPPPPPPMPTMAPA
FT                   QTETLLKSIEATTVKNPENQSHPSIDTSDLMKEIVGPRNLKEVKKIDAKAQDPRDLLLQ
FT                   SIRGEHKLKKVEFDPNGRPVAHSRSKPAQNVNKSNEIVEILARRVAMEMSSSGSESDSD
FT                   SGNWSDVSTKSKVLKTKGERDARKGMNSKQVGRNSKSSFVRS"
FT   gene            complement(416516..416677)
FT                   /locus_tag="A1E_01865"
FT   CDS_pept        complement(416516..416677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01865"
FT                   /product="hypothetical protein"
FT                   /note="COG2057 Acyl CoA:acetate/3-ketoacid CoA transferase,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01865"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73318"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY85"
FT                   /protein_id="ABV73318.1"
FT                   /translation="MPTIDLTLLGAMQSHKKAILPNWNYLPGKMVKDMEGAMDLATNNQ
FT                   KTSSNNGT"
FT   gene            complement(416760..416924)
FT                   /locus_tag="A1E_01870"
FT   CDS_pept        complement(416760..416924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01870"
FT                   /product="Succinyl-CoA:3-ketoacid-coenzyme A transferase"
FT                   /note="COG1788 Acyl CoA:acetate/3-ketoacid CoA transferase,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01870"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73319"
FT                   /db_xref="GOA:A8EY86"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY86"
FT                   /protein_id="ABV73319.1"
FT                   /translation="MAGAAKVTVCEVETIVEVGELYPNNIHTPNIFIQRLIVGTKYEKR
FT                   IEQLTIREQ"
FT   gene            complement(417034..417243)
FT                   /locus_tag="A1E_01875"
FT   CDS_pept        complement(417034..417243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01875"
FT                   /product="Succinyl-CoA:3-ketoacid-coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01875"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73320"
FT                   /db_xref="GOA:A8EY87"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY87"
FT                   /protein_id="ABV73320.1"
FT                   /translation="MISSYIGENKICEQQYLDKILELELKPQGTLDERIRAACMGIPPF
FT                   YTKIGIGTIVEEGKEKRNLIARNI"
FT   gene            418000..418290
FT                   /locus_tag="A1E_01880"
FT   CDS_pept        418000..418290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01880"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73321"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY88"
FT                   /protein_id="ABV73321.1"
FT                   /translation="MFSTKFNDKDKNGNDINAYVKVMSSIYGYITKNKICSYAYLDLFD
FT                   SFLFYSGYSFIMNTNINNITMFKLEKYLLSTRVMLAPYGLEYSLVNHFCCG"
FT   gene            418398..418607
FT                   /locus_tag="A1E_01885"
FT   CDS_pept        418398..418607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01885"
FT                   /product="hypothetical protein"
FT                   /note="COG1788 Acyl CoA:acetate/3-ketoacid CoA transferase,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01885"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73322"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY89"
FT                   /protein_id="ABV73322.1"
FT                   /translation="MAFWNQPKILTATHLKESCRQGRLGVVNFELSLNKTFKIFGSGGY
FT                   KTAEFIEGMTLKSSAILRAWFKLD"
FT   gene            418671..420788
FT                   /locus_tag="A1E_01890"
FT   CDS_pept        418671..420788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01890"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="COG1200 RecG-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01890"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73323"
FT                   /db_xref="GOA:A8EY90"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY90"
FT                   /protein_id="ABV73323.1"
FT                   /translation="MLTILEKFLFSSVKTFINIREDTVSALKRLGINNIRDLLFYIPVS
FT                   YQNKTLSPNLTKVRDGEIIQTEIVIESISLPKNSNQPLKITARNDTGSLLLVFFHRPPP
FT                   FIFNKLKVGTSHIISGKVQFFDHHLQISHPEFIVNPTLAKEIEPIYSLTYLLSNKQLYS
FT                   YIIKAMDIFERKCKGLEDKEVKDYLDSILQNLKVLHSLCHLRKSRNSEKMDIMVKSWDD
FT                   TRVCLNNAKKHLAAKELIANQISLFNVRTQISRRQGNIFPKAAGPQVNILNELGFELTP
FT                   YQKQVIEEIELDQSDKVEMMRLLQGDVGSGKTLVALLTMVNVAVAGFQATLMAPTDLLA
FT                   NQHYEFFVKALKNTNIRVGLLTGKILGLARKNIMIQLENGEIEILLGTHALFQEKVSFK
FT                   KLGYIVIDEQHRFGVQQRLNLINKGVNPDVLVMTATPIPRSLALTMFGDMTISKLQGKP
FT                   KNRLPIATNIMSTNKIEHVIEAINKKLILGERIYWICPLIERGKQEEQEDDSVLMDVMN
FT                   RFNSIENIYQGYTGIIHGKMKNEQKDIIMKQFKEGEIKILVATTVIEVGIDVPEATLII
FT                   IENAEQFGLAQLHQLRGRVGRGNLQSYCILLYNPKRLGQVARGRFEIMQQTNDGFYIAE
FT                   QDLKLRGSGEILGVKQSGEIEFFFADLAEHYDLLLKANKFAEIGSKGNLDFIDFQIKLF
FT                   AKSQVSEFGLV"
FT   gene            complement(421027..421248)
FT                   /locus_tag="A1E_01895"
FT   CDS_pept        complement(421027..421248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01895"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01895"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73324"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY91"
FT                   /protein_id="ABV73324.1"
FT                   /translation="MLRIFYEKLGSIFFNHKAEKHFKIHMLLDPEHEQIAIDLLKQINI
FT                   NNSSLLAIQKSWDIIEALCTRIAEITQD"
FT   gene            complement(421668..422414)
FT                   /locus_tag="A1E_01900"
FT   CDS_pept        complement(421668..422414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01900"
FT                   /product="hypothetical protein"
FT                   /note="COG1135 ABC-type metal ion transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01900"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73325"
FT                   /db_xref="GOA:A8EY92"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY92"
FT                   /protein_id="ABV73325.1"
FT                   /translation="MIITRNKHQSNYQDLLKTLAIIAMIIDHMGLYLYPELTIMRVIGR
FT                   TVMPVFCFFTGYNFHDKPKTKIIIAGILLQIYTTVLFKQFITTNILIPIYLGQCYIYYF
FT                   RKSLIHFFYSGYCHVIIMAILFHISWYLVDYGTIVIAIMILGFIAQHEQANLKLSCFIA
FT                   IFITCMHSTLFTLAIPMSDFNFSNTDLILNLTILTVTYILMIISDYSQKIAINLKWISR
FT                   NILYIYCIHSMILQFIYKYTYSFKNW"
FT   gene            complement(422411..423916)
FT                   /locus_tag="A1E_01905"
FT   CDS_pept        complement(422411..423916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01905"
FT                   /product="virulence factor mviN"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01905"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73326"
FT                   /db_xref="GOA:A8EY93"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY93"
FT                   /protein_id="ABV73326.1"
FT                   /translation="MTLFRSGVVVAFCTLISRIFGLVREQFIASLFGSTPMGDSINVAF
FT                   KLPNLFRRIFAEGALSSIFIPIYNEKMLISKRAANNFSGTVFTLLLLTLIIIIALMQIF
FT                   MPQLMLFIAPGFHGKKEKFELTIFLCRITIPYLIFVSLTALLGGILNSIKKFTAFAFSP
FT                   VILSVCVIICTLMLDDYIESTISISLSLIIAGILQVSFMFVCVKRADLNFPIIFNPSDP
FT                   DVKKLLINMGPAIISSGVQQLNLFISQSIASFIEGAISILAYADRIYQFPLSIIGTSFS
FT                   TILLPTLSKIYKSNDLVSAKKIQNNAIRMGLLLSLPATFGIIILSHPIINIIYERGVFT
FT                   SQDTTNTAEAISAFALGLPAFILAKILTPIFYANGDTKTPLKITLFSIIINTGINLLLM
FT                   DSLKHIGIAVGTSIAAWYNLGLLYSYTTKQNKLHIEANIKLFCGKILLCCIIMSVIIAL
FT                   IKHYCLEYFYSEYLLIKVCMLGSTIAVGIGSFFGTAYLLKVVL"
FT   gene            423983..424096
FT                   /locus_tag="A1E_01910"
FT   CDS_pept        423983..424096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01910"
FT                   /product="hypothetical protein"
FT                   /note="COG0728 Uncharacterized membrane protein, putative
FT                   virulence factor"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01910"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73327"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY94"
FT                   /protein_id="ABV73327.1"
FT                   /translation="MDTTLSLQATVESMAKPEESNKNMLYKLAFFTGLLRE"
FT   gene            complement(424195..424722)
FT                   /locus_tag="A1E_01915"
FT   CDS_pept        complement(424195..424722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01915"
FT                   /product="inorganic pyrophosphatase"
FT                   /note="COG0221 Inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01915"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73328"
FT                   /db_xref="GOA:A8EY95"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY95"
FT                   /protein_id="ABV73328.1"
FT                   /translation="MFIDKIKAKANNDEINVIIEIPMNSGPIKYEFDKESGAVFVDRFM
FT                   QTTMSYPCNYGFIPHTLSNDGDPVDVLVVSHHAVVPGSVIKCRTIGVLMMEDESGLDEK
FT                   IIAVPTSRLDITFDHIKELDNLCEMLRKRIVHFFEHYKDLEKGKWVKVTGWGNKAKADT
FT                   LINEGIDRASQE"
FT   gene            complement(424973..425359)
FT                   /locus_tag="A1E_01920"
FT   CDS_pept        complement(424973..425359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01920"
FT                   /product="Cytochrome c-type biogenesis protein CcmE"
FT                   /note="COG2332 Cytochrome c-type biogenesis protein CcmE"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01920"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73329"
FT                   /db_xref="GOA:A8EY96"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EY96"
FT                   /protein_id="ABV73329.1"
FT                   /translation="MQKRVRNRLITIIICFCSAFLGIGIILYNLENNIVFFLPPSKINA
FT                   IEQDKELRVGGLVKTSSINKIAADKISFIITDNIKDLEILYQGILPALFREGQGIIAIG
FT                   QLSDGKFMARQLLTKHDENYRPTR"
FT   gene            complement(425461..426078)
FT                   /locus_tag="A1E_01925"
FT   CDS_pept        complement(425461..426078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01925"
FT                   /product="Sco2 protein precursor"
FT                   /note="COG1999 Uncharacterized protein SCO1/SenC/PrrC,
FT                   involved in biogenesis of respiratory and photosynthetic
FT                   systems"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01925"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73330"
FT                   /db_xref="GOA:A8EY97"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY97"
FT                   /protein_id="ABV73330.1"
FT                   /translation="MKMQSNVIKIIIIISLLIGVGALYLLLSLRTPAKPLAGQVNIYED
FT                   NVKIGGDFELIDQNGEIFNSDELKGNLSLIYFGFTRCPDICPTSLNKMTEIVEMLNKHN
FT                   IDIIPLFITIDSKRDTPIVLKEYLKHFHPKFIGLTGNEQQIKDITNKFKVFYARVNNDD
FT                   DDPNYMFDHSSFIYLMDTNGKYLKHFYLDSSPKEIIEFLRNE"
FT   gene            complement(426084..427646)
FT                   /locus_tag="A1E_01930"
FT   CDS_pept        complement(426084..427646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01930"
FT                   /product="protein export protein SecD"
FT                   /note="COG0342 Preprotein translocase subunit SecD"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01930"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73331"
FT                   /db_xref="GOA:A8EY98"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY98"
FT                   /protein_id="ABV73331.1"
FT                   /translation="MPNLPKWKIFLSIICTVFATICALPNFMQVNSKFLPHDSVNLGLD
FT                   LRGGAHLLLDVDFESYLNDSMENLADTLRKNFREDKIGYKNLLVNQNQNSIQLELRTSK
FT                   ELKQLKKIINKIDSEIIVEVNENKIKLRYSDSRLNDLLNKVVDQSIEIVRMRVDSTGTK
FT                   EPTLQKQGDKHILLQVPGEENPSYLKNILGKTAKLTFHLVDENANIEEAVKGHVPVGSM
FT                   LIKGDSESHGEYYVVIKKKVVLGGDQLTTASVSFDQNSQAVVTFSFNNLGSKIFGEITK
FT                   NNTGKRLAIVLDNKLLSAPMINGAIMGGSGIITGNFTVESAHELALLLRAGSLPAPLNI
FT                   IEERSIGPNLGADSIESGKKAGLIGFIAVCIFMIWSYGVLGLFANIALSLALLYILALL
FT                   SLFQATLTLPGIAGIILTIGMAVDANVLIYERIKEELHKGVSNLYAIRTGFASAFATIL
FT                   DSNLTTLIVASLLYIFGVGAIKGFAITLTIGIISSMFSAIIITKLLIDIWVKYFKSKKL
FT                   GLV"
FT   gene            complement(427630..428067)
FT                   /locus_tag="A1E_01935"
FT   CDS_pept        complement(427630..428067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01935"
FT                   /product="preprotein translocase subunit YajC"
FT                   /note="COG1862 Preprotein translocase subunit YajC"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01935"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73332"
FT                   /db_xref="GOA:A8EY99"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:A8EY99"
FT                   /protein_id="ABV73332.1"
FT                   /translation="MSAITQDNQANHNDTIEIQETEVVPVETNSLQSGLTSLIPMILIF
FT                   AIFYFLLLRPQEKRRKEREKLANKVKKGEEVLTNSGIYGIVSKVSANDPNIEIEIAKDV
FT                   HIKILKSTIIDITSHSKEVPVKKENNKNNKKDKKVSSAKSS"
FT   gene            complement(428567..428641)
FT                   /locus_tag="A1E_t05700"
FT   tRNA            complement(428567..428641)
FT                   /locus_tag="A1E_t05700"
FT                   /product="tRNA-Gly"
FT   gene            complement(430629..431999)
FT                   /locus_tag="A1E_01940"
FT   CDS_pept        complement(430629..431999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01940"
FT                   /product="Magnesium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01940"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73333"
FT                   /db_xref="GOA:A8EYA0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYA0"
FT                   /protein_id="ABV73333.1"
FT                   /translation="MPNFNIFKRILPDHHDQFAEIFDQINDLLEDHNYDAAANRLAELH
FT                   YADLADFLDNLNNKIYKIIIPLLQDKIKPETLVSLNAYSKPLIIETLGIKKSAELINKL
FT                   VIEDAIEVVIDLDDDIKDLILSNLTKEKKHQITVGCTYPENTVGRVIERDFINLQENWT
FT                   VEESLNFIKNVKNDFYAAIVTDNKLRPIGIISLSTLIKGKKNELIKDLMSKDFKLADAF
FT                   TDLNELSFIFRQYALTIVPVVNKSGKLVGSVSIDNIIYIIEEQAGKDILSLSGVHTQDT
FT                   FFNVLYTVKHRFPWLFVNLITACMTSLIINHFNDTIAKLVTLAATMPIVASMGGNAGTQ
FT                   VMTVTVRALANKDIHYNNVNKVILKEIAVSAFNGFVLAIIGAGLSFIMLLDLNLSVIFA
FT                   IAVILNFLVAGLFGSAIPIILHYFDIDPAAGSGVFLTTITDALGFLTFLSLAHIFLV"
FT   gene            complement(432412..432534)
FT                   /locus_tag="A1E_01945"
FT   CDS_pept        complement(432412..432534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01945"
FT                   /product="hypothetical protein"
FT                   /note="COG2239 Mg/Co/Ni transporter MgtE (contains CBS
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01945"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73334"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYA1"
FT                   /protein_id="ABV73334.1"
FT                   /translation="MVREYFSATSGNVTDDMINEYINRHTDAHEPAMTTNIRLE"
FT   gene            complement(432564..432743)
FT                   /locus_tag="A1E_01950"
FT   CDS_pept        complement(432564..432743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01950"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73335"
FT                   /db_xref="GOA:A8EYA2"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYA2"
FT                   /protein_id="ABV73335.1"
FT                   /translation="MREIIAVVVEELNVKIENGVISSDHIHIFANIPPHIKVSEFVQKA
FT                   KGRSSKKYKKNFQY"
FT   gene            432878..433147
FT                   /locus_tag="A1E_01955"
FT   CDS_pept        432878..433147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01955"
FT                   /product="hypothetical protein"
FT                   /note="COG1943 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01955"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73336"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYA3"
FT                   /protein_id="ABV73336.1"
FT                   /translation="MAQHGKLKLSHLEDGGFNHQRDYKNLDIVIVTTLLECGSEQNKCI
FT                   GRRVICYNCRIVGQTFGNKRKLEVKIKSKVPKQKKFRVMVSEQR"
FT   gene            complement(433200..433286)
FT                   /locus_tag="A1E_t05702"
FT   tRNA            complement(433200..433286)
FT                   /locus_tag="A1E_t05702"
FT                   /product="tRNA-Leu"
FT   gene            complement(433475..434335)
FT                   /locus_tag="A1E_01960"
FT   CDS_pept        complement(433475..434335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01960"
FT                   /product="HAD-superfamily subfamily IIA hydrolase"
FT                   /note="COG0647 Predicted sugar phosphatases of the HAD
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01960"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73337"
FT                   /db_xref="GOA:A8EYA4"
FT                   /db_xref="InterPro:IPR006356"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYA4"
FT                   /protein_id="ABV73337.1"
FT                   /translation="MNILKLKNIFDIIDNYDVFLFDLWGVIIEGGHTYQNVVQNINKII
FT                   ERKKVYFVTNAPQNIFSLHQTIKSWGLNAEPEMIISSGEIAVQMILESKERFGIEKPVI
FT                   YHLGHLENDIINGIQYSTTDDIKKANIFLMTIYRDENENLDLNEFDELFKIVVERKMVN
FT                   ICANPDLGINQHGVYRYCSGYYAEKIKQLGGEIIYSGKPYEEIYSKIFKECHNTPKNRI
FT                   LMIGDTFYTDILAANRLGIDSALVLTGNSRAYHINFDNIDEKLDSLTKSAIKQSIMPNF
FT                   MLSLS"
FT   gene            434443..436869
FT                   /locus_tag="A1E_01965"
FT   CDS_pept        434443..436869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01965"
FT                   /product="DNA gyrase subunit B"
FT                   /note="COG0187 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01965"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73338"
FT                   /db_xref="GOA:A8EYA5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYA5"
FT                   /protein_id="ABV73338.1"
FT                   /translation="MSEIEENFNKSSYGADSIKVLKGLEAVRKRPGMYIGDVGNGSGLH
FT                   HMIYEVVDNAIDESLAGYCDLVQVILNKNGSVTVSDNGRGIPVEIHEEEGISAAEVIMT
FT                   QLHAGGKFDQNSYKVSGGLHGVGVSVVNALSEWLELRIWRNNKEYLIRFNNGITEAPLA
FT                   VVKENIDKKGTEVTFFPSVETFTNIEFDFGTIEHRLRELAFLNSGIKILLVDNRFEEAK
FT                   EAEFYYTGGIEAYVKYIDRAKHAIHPCIIVNVDNAESGINLELAMHWNDSYYENILCFT
FT                   NNIRQRDGGTHLSAFKSAITRVITSYLDTTGLNKKVKNDFSGEDTREGLCCVLSVKVPD
FT                   PKFSSQTKDKLVSSEVRPVVENIVYTKVLEWFEEHPAEARAIISKIMEAANAREAARKA
FT                   REFTRRKSALEISNLPGKLADCHAKDPAISELFIVEGDSAGGTAKQGRDSKIQAILPLR
FT                   GKILNVERARFDKMLGSDQIGTLITALGTGVDNQEFSLEKLRYHKVIIMTDADVDGSHI
FT                   RTLLLTFFYRNMPELINKGYLYIAQPPLYKVKKGAAEFYLKNEQALQDYLIKSTINDAT
FT                   LILDGKEQLVDGNLEELINTVVKFNGCLDHASKKFNRSITEILAINDLLNNKIFEAESD
FT                   LRCKKALDVLNSLEESPDKTNWEVLKHENKIEFFRFNRGLKESKILLKEQLESFEFVQI
FT                   SKLALTIFDIFCKQLKLIVKSQECDILTPSQLLNTIIACGKKGINIQRFKGLGEMNSNQ
FT                   LWETTLDPEKRTLLQVRVAEVDEAEGIFSTLMGDVVEPRRLFIQANALNVVNLDV"
FT   gene            437074..438333
FT                   /locus_tag="A1E_01970"
FT   CDS_pept        437074..438333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01970"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="COG0766 UDP-N-acetylglucosamine enolpyruvyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01970"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73339"
FT                   /db_xref="GOA:A8EYA6"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYA6"
FT                   /protein_id="ABV73339.1"
FT                   /translation="MQKLIIYGGKPLRGSINISGAKNAVLPIMAASILTDKLHITNVPK
FT                   LTDVSTMKGLLRSHGADIETIEHQDEFELIINTRNINNFTADYDIVRKMRASIWVLGPL
FT                   LTKYGKAKVSLPGGCAIGARQVDLHIAVLKAMGAMIEIEGGYINASSKGRLKGTHFIFD
FT                   KVSVGATINAILAAVLAEGETLLFNCGREPEIVDLCNCLIKMGADIIGVGTSEITIKGK
FT                   DALNKVSYKVLSDRIEAGTYMLAAAITKGDVKICGIDYHIIENLALKLIETGIKVVPID
FT                   NGVQVIYEGKLNAVNLETNPYPGFATDLQAQFMSLMTLSSGVSMITENIFENRFMHVPE
FT                   LCRMGADILVRGNKAIVRGVEMLKGAEVMASDLRASVSLILAGLSTNSKTVLHRIYHLD
FT                   RGFQDLEKKLSNCGADIKRV"
FT   gene            438501..438884
FT                   /locus_tag="A1E_01975"
FT   CDS_pept        438501..438884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01975"
FT                   /product="DNA-directed RNA polymerase omega subunit"
FT                   /note="COG1758 DNA-directed RNA polymerase, subunit
FT                   K/omega"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01975"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73340"
FT                   /db_xref="GOA:A8EYA7"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYA7"
FT                   /protein_id="ABV73340.1"
FT                   /translation="MARVTAEDCNKIIPDRFRLVVLATRYAKLLNYKVETSYSKKEKRD
FT                   KPPVIALRRIAAGKVSVAQLEQDLINSLCTRNIIEPLANQDDLEDVEEKFDYLPEVYVG
FT                   EDYSDLDDQIFIDENGEYDERDK"
FT   gene            438885..439280
FT                   /locus_tag="A1E_01980"
FT   CDS_pept        438885..439280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01980"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /note="COG0736 Phosphopantetheinyl transferase (holo-ACP
FT                   synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01980"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73341"
FT                   /db_xref="GOA:A8EYA8"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYA8"
FT                   /protein_id="ABV73341.1"
FT                   /translation="MLVGIGTDIVQIPRIEKILHLYPQLFAKKILTLKELKQFALLDKT
FT                   NRATFVAKHFAAKEAVSKAFGVGIGQGINFKDITILNDDLGKPIAEVSSNYTKKYSFLN
FT                   IHLSLSDDYPVCVAFAVVEGGYNVIPV"
FT   gene            complement(439525..440373)
FT                   /locus_tag="A1E_01985"
FT   CDS_pept        complement(439525..440373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01985"
FT                   /product="Protein export protein PrsA precursor"
FT                   /note="COG0760 Parvulin-like peptidyl-prolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01985"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73342"
FT                   /db_xref="GOA:A8EYA9"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYA9"
FT                   /protein_id="ABV73342.1"
FT                   /translation="MKKLSVIFLSVSMLSSIAFADKDKVVATYKGGEVKESQIMKEFKP
FT                   QLNIQSGETIKSFDDFSLQDQEKLIKIYVNNLLLKEEVAKSHITASKEFQEKLENAKNQ
FT                   LAQQELLANYIKSNITDKMFDDEYNKYVGNLKGKEQIKVAHILVKSQKEANEIKTKLSK
FT                   GGNFTKLAEELSLDKASASNGGVIGDIILNQPGQLVPEFEKKAFALKVNEVSTPVKTDF
FT                   GWHIIKVLEKKPVPIPTKEDAKVTIDNILAAAILKQYISDLEAKADLKIMLPKAGSKDG
FT                   E"
FT   gene            440584..443304
FT                   /locus_tag="A1E_01990"
FT   CDS_pept        440584..443304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01990"
FT                   /product="translocase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01990"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73343"
FT                   /db_xref="GOA:A8EYB0"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYB0"
FT                   /protein_id="ABV73343.1"
FT                   /translation="MLSILKKLFGTANDRTVKKLFSEITKINSLEPVIQKLSDEELKNK
FT                   TVEFKEKLKNGATLDDILYEAFAVVRESARRVCGMRHFDVQLIGGLILHQGMITEMRTG
FT                   EGKTLVATLPAYLNALTGKGVHVVTVNDYLASRDSASMGKIYNFLGLSVGCIVAGMSDE
FT                   AKRAAYNADITHATNNELGFDYLRDNMKYSIQERVLRPFNFAIIDEVDSILIDEARTPL
FT                   VISGPVNDNSELYTKIDKIVRQLKAGDFEKDEKLKTIHLTELGITHIESLLSNENIIKP
FT                   DSGLYDFENLTLVHYINQALRAHNMFNVDVDYLVRDGQVMIIDEFTGRVMEGRRYSEGL
FT                   HQALEAKENVKIQNENQTLASITFQNYFRNYPKLSGMTGTAMTEAPELKDIYNLDVVAV
FT                   PTHNKVTRVDLDDEIYGSKKEKYDAILKLIKDCYNRGQPILVGTISIEKSEELSSVLNK
FT                   EKIPHKILNAKFHEQEAFIIAQAGRFRAVTIATNMAGRGTDIMLGGNPEMLIEQLAKDH
FT                   SYEAKIAEIKAQIAEEKKKVIEAGGLFVIGTERHESRRIDNQLRGRSGRQGDPGKTQFF
FT                   LSLDDDLMRIFASERISGVLRTLGLKDGEAIHHPMISRSLEKAQQKVEGHNYEIRKNLL
FT                   RFDDVMNDQRKIIYEQRTEIIKSKDSYDFLNSTTAELAKKIVLTFMPAGSYREDWDIEN
FT                   LSVELHRIFSIKFDHNLVSKNDVTEEEITKSVIQMAHDIYKSKEESYSSELMHNAVKYI
FT                   LLTTLDQVWKDHLYSLDHLRQGISLRAYAQQDPLSEYKREAFNLFEQMLDNLKELFIQT
FT                   VYHFHIDLKHVQKEDVSLEHKKFQKNMQESREDPAFSKYNAGSSLEIDLKPVVSRIDPK
FT                   DRNPEDPTSWGRVSRNELCPCRSGKKYKYCHGANA"
FT   gene            443305..443454
FT                   /locus_tag="A1E_01995"
FT   CDS_pept        443305..443454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_01995"
FT                   /product="NT (nucleotidyltransferase) domain and HEPN
FT                   (higher eukarytoes and prokaryotes nucleotide-binding)
FT                   domain"
FT                   /note="COG0653 Preprotein translocase subunit SecA (ATPase,
FT                   RNA helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_01995"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73344"
FT                   /db_xref="GOA:A8EYB1"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYB1"
FT                   /protein_id="ABV73344.1"
FT                   /translation="MKTTLPERSLKISAILNFIVQQILDIASDKITMIILYGSFTKFEL
FT                   MVNR"
FT   gene            444232..444456
FT                   /locus_tag="A1E_02000"
FT   CDS_pept        444232..444456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02000"
FT                   /product="Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02000"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73345"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYB2"
FT                   /protein_id="ABV73345.1"
FT                   /translation="MDVVNGLNKLRAVSTTELFLASANNVIKVAKWLVEEKTGVNMYSD
FT                   MFRCTPLNSVARSGYYKVVKYLISKQELQ"
FT   gene            444609..444818
FT                   /locus_tag="A1E_02005"
FT   CDS_pept        444609..444818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02005"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73346"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYB3"
FT                   /protein_id="ABV73346.1"
FT                   /translation="MVAKNIRCISENIQDDEIYKLLLSCGTDISAKVEFRGVWFSIYEY
FT                   DGKMVSKIAEFKIALVSGESKIIT"
FT   gene            444931..445146
FT                   /locus_tag="A1E_02010"
FT   CDS_pept        444931..445146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02010"
FT                   /product="hypothetical protein"
FT                   /note="COG0666 FOG: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02010"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73347"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYB4"
FT                   /protein_id="ABV73347.1"
FT                   /translation="MSKAKAKTASKNNPTSREQAKEYFHNGQKIKPVKLIAAQNSFLAA
FT                   EYESSGDLVVGINGQPLPWGLVKSLS"
FT   gene            445181..445255
FT                   /locus_tag="A1E_t05704"
FT   tRNA            445181..445255
FT                   /locus_tag="A1E_t05704"
FT                   /product="tRNA-Ala"
FT   gene            445734..445877
FT                   /locus_tag="A1E_02015"
FT   CDS_pept        445734..445877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02015"
FT                   /product="Type I restriction-modification system, M
FT                   subunit"
FT                   /note="COG0286 Type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02015"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73348"
FT                   /db_xref="GOA:A8EYB5"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYB5"
FT                   /protein_id="ABV73348.1"
FT                   /translation="MRAAKEVEDHNYALYGQEMINTICALAQINMFLHVEGQAHIHWGV
FT                   IH"
FT   gene            445802..446044
FT                   /locus_tag="A1E_02020"
FT   CDS_pept        445802..446044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02020"
FT                   /product="Type I restriction-modification system, M
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02020"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73349"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYB6"
FT                   /protein_id="ABV73349.1"
FT                   /translation="MCISTDKYVFACGRPGTYSLGGDPLNHPVLLENDTLMDFDIVVAS
FT                   PLLSLEKLGLGMKNAANDEYNRFKCGTHPKAIFLI"
FT   gene            complement(446915..447103)
FT                   /locus_tag="A1E_02025"
FT   CDS_pept        complement(446915..447103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02025"
FT                   /product="hypothetical protein"
FT                   /note="COG0286 Type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02025"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73350"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYB7"
FT                   /protein_id="ABV73350.1"
FT                   /translation="MVKFLKLASKLALIIQSSVVLKSIKVGIFESFIIFPITSYSVPKI
FT                   ETVLFVLKYFKTIIKLE"
FT   gene            447424..448818
FT                   /locus_tag="A1E_02030"
FT   CDS_pept        447424..448818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02030"
FT                   /product="Sodium/pantothenate symporter"
FT                   /note="COG0591 Na+/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02030"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73351"
FT                   /db_xref="GOA:A8EYB8"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYB8"
FT                   /protein_id="ABV73351.1"
FT                   /translation="MLKIPVNNIIVFIYLISILLIGIYYRAKDSSFKNYANVESKVRNS
FT                   KLLLIATIFASSVGGATTFGIMEKVFLGYAYYAYALILTIPIDILIAIYIVPLITKHYG
FT                   AESIGDILSTYYGTIGRFIGGVSSVIVSVGFLAAQISVSGYIFQYILDINYVSGVILSY
FT                   SIVLIYTTIGGLQSIVSTNLVQFLAMIIAIPTITFISLNKIGFIDFINNFHTENANFDQ
FT                   SNLLSYTITAALSFSVMNLYPTFIQRALINKNPTQTTKAIYAKSAIYLFFLICITLNGL
FT                   IAYKLYPTQPSNLVLPYLINKIIPPLMQGIVMSGLLAAVMSTADSDLNVTSIALVKDII
FT                   NLILKVKNQQKLLLIARIINIIIGSLAIIVALKFSNVIDLVVFFTGFWGPVILVPLITT
FT                   LFGIRVSEKIMVLSSLGGAATFLIWEYYSLYLKYFNLKGVFVGTMTSLIIFILGRYYSN
FT                   VVVRKD"
FT   gene            complement(449353..451269)
FT                   /locus_tag="A1E_02035"
FT   CDS_pept        complement(449353..451269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02035"
FT                   /product="excinuclease ABC subunit C"
FT                   /note="COG0322 Nuclease subunit of the excinuclease
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02035"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73352"
FT                   /db_xref="GOA:A8EYB9"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYB9"
FT                   /protein_id="ABV73352.1"
FT                   /translation="MTSDATGSELIKSKLVDAPECAGVYQMFDVNKQVIYVGKAKNLKK
FT                   RLTNYIKLDLDNKTLRMIANTCFLEYSVTSSEVEALLLEAQLIKKFQPKFNILLKDDKS
FT                   FPFIKLRLDHDFPQLLKYRGRTRTLSDGKFFGPFASATAVNTTLTELQKIFKLRSCTDN
FT                   YFNSRNRPCLQYEIKRCYAPCISKINKKDYAELVIQVTAFLQGHTKELQENLSKKMEEL
FT                   SSHMYFEEAAEIRDRIKALSYVQLKAGISDIVKDADIMAIVEKNGHYCVEVCLYRAGQA
FT                   CGTIPYFPTAMGNNTKEAILKYFLLQFYQKQQLPSEIIINNEVEDKEDVIEAIKKINNI
FT                   TKLNIILPISGGKAKLVQNATTNALFSLEQYLKKFAKNQEIMLEIKELFDLSEIPERIE
FT                   IYDNSHIQGKFAVGVMVVAGKSGFDKKEYRVFSLSSHDSITGFSTLTNNLDPVVKQQYD
FT                   TNGTYNTTVGDDYDMFRQVLTRRLTRLKQEPYKLPSLMIIDGGRGHVGIVKEVMDKFKM
FT                   NIPFVCMSKGPDRNAGLEQFHMVGKEVFTLDKNLPVMKYLQILRDAAHSFAIKNHRLGR
FT                   SRTIKLSSLDNIKGIGKTRKKSLLHYFGSYKAVCDATIDELVKVHGISKSLAEMIFRTL
FT                   HQS"
FT   gene            complement(451351..451884)
FT                   /locus_tag="A1E_02040"
FT   CDS_pept        complement(451351..451884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02040"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73353"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYC0"
FT                   /protein_id="ABV73353.1"
FT                   /translation="MLKTLLISLITLICAVSYAENQTAQNHYSTNASSDESNNLLPAAL
FT                   AVHFVQPWARPTTDVQGKVSNSAMYFTLVNSRSSSYNLVNISSDIANKIELHQTITDES
FT                   GVSKMVKVDYPFLIADNIKVDFKPGGMHIMLYDLKGPLNVGSSFKITFFFDDNTRKTVD
FT                   VKVANDNPYNTAGN"
FT   gene            complement(452001..452111)
FT                   /locus_tag="A1E_02045"
FT   CDS_pept        complement(452001..452111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02045"
FT                   /product="hypothetical protein"
FT                   /note="COG2847 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02045"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73354"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYC1"
FT                   /protein_id="ABV73354.1"
FT                   /translation="MHQAVGWMLREAGKKDKKHINRSFRSLYSTNAKNHS"
FT   gene            complement(452588..453118)
FT                   /locus_tag="A1E_02050"
FT   CDS_pept        complement(452588..453118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02050"
FT                   /product="Methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /note="COG0350 Methylated DNA-protein cysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02050"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73355"
FT                   /db_xref="GOA:A8EYC2"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYC2"
FT                   /protein_id="ABV73355.1"
FT                   /translation="MDIKINNVLKSAWLDTPIGSMLTISDEERLYLLDFAESKGLEYKI
FT                   KRLKIKTKSAITEDRTKPILSIKEELKSYFTGTLKKFDTPIYLLGSEFQKLVWQELMNV
FT                   PYGETRSYFDQAKIIGRERSYRAVANANGANKCAIIIPCHRIINNNGELGCYSSGLDRK
FT                   KWLIEHERTFTTN"
FT   gene            complement(454363..454545)
FT                   /locus_tag="A1E_02055"
FT   CDS_pept        complement(454363..454545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02055"
FT                   /product="Type I site-specific restriction-modification
FT                   system, R (restriction) subunit"
FT                   /note="COG0610 Type I site-specific
FT                   restriction-modification system, R (restriction) subunit
FT                   and related helicases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02055"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73356"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYC3"
FT                   /protein_id="ABV73356.1"
FT                   /translation="MRTILPNAYIAFTGTPILKDQKHTFRNFGKSIHKYTIKAILKDNM
FT                   IVPLFYEGRIIQQYL"
FT   gene            456406..456855
FT                   /locus_tag="A1E_02060"
FT   CDS_pept        456406..456855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02060"
FT                   /product="hypothetical protein"
FT                   /note="COG2001 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02060"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73357"
FT                   /db_xref="GOA:A8EYC4"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYC4"
FT                   /protein_id="ABV73357.1"
FT                   /translation="MNVFLSKYVNGVDKKSRVSVPANYRAVLGQELFNGVIAYPSIRNK
FT                   CIEACGISHIEKLRQMIETLDPYSEERDAFETIIFGEALQLSFDSEGRVMLPQSLMQHA
FT                   GIEEQACFVGKGVIFEIWQPQNFEKYLNSAQKIAYEKRLTLRNAN"
FT   gene            456855..457781
FT                   /locus_tag="A1E_02065"
FT   CDS_pept        456855..457781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02065"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="COG0275 Predicted S-adenosylmethionine-dependent
FT                   methyltransferase involved in cell envelope biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02065"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73358"
FT                   /db_xref="GOA:A8EYC5"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYC5"
FT                   /protein_id="ABV73358.1"
FT                   /translation="MQQSHIPVMLNEMLANLAPQDGKSYLDCTFGAGGYSKAILESCNC
FT                   YVTALDRDPNVIKRAERIKQNYSTRFDFIETNFADSFAKLKEKKFDGIVLDLGVSSMQL
FT                   DIADRGFSFLHDSPLDMRMSGQGLSAEEFINTVEEKELADIIYKYGDESFSRRIAKRIV
FT                   EYRKTARINSTGKLAEIVRNSIGFRKGKIDPATKTFQAIRIYINDELRELERFLANVQN
FT                   ILNKDGRLVIVSFHSLEDRIVKHFFKENSEKPVARSKYSKDNPVIDPNKWLKIITNKAE
FT                   APSDKEVELNVRARSAKLRAAKAIYEY"
FT   gene            457784..458173
FT                   /locus_tag="A1E_02070"
FT   CDS_pept        457784..458173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02070"
FT                   /product="Cell division protein FtsL"
FT                   /note="COG5462 Predicted secreted (periplasmic) protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02070"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73359"
FT                   /db_xref="GOA:A8EYC6"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYC6"
FT                   /protein_id="ABV73359.1"
FT                   /translation="MSIRKFHYLTLLITIIAVCSLFSIKERVSTLDYQLNSVIKQINSE
FT                   NNNIHILKAEQAYLLSPGRLKKLVAAYLTLETVKSYQMIKDPLLPTTNQNIKFAYNISI
FT                   PKDSKWRYRRITNNKYIQTVSSKVK"
FT   gene            458264..459949
FT                   /locus_tag="A1E_02075"
FT   CDS_pept        458264..459949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02075"
FT                   /product="Penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02075"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73360"
FT                   /db_xref="GOA:A8EYC7"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYC7"
FT                   /protein_id="ABV73360.1"
FT                   /translation="MKHILEKWKPAIKSLIIWNVCSKNIKIRLLIVICGFSFLFCTLSY
FT                   RLIIVATNVYDKNLNAVKKNNQFRKEIVDRNGNLLAVNLPSASLFANPQIVLDPETSVK
FT                   KLAEILPDINKAKLLAELKSNKSFIWVKRDLLPSQQEKITSLGLLGFDFEEEQKRIYIF
FT                   SNLLSHVIGYVGRDLVGLSGLELAYDKYLTNSDHALNEPGNWKEPLKLSIDIRLQSILS
FT                   EEIDKTLKQFNAIGAVGIIADPNNGEILALVNKPDFDPHHPNLARPEELFNIASLGLYE
FT                   MGSVFKALTMAVGFDTGAINMNDAYDISYMKVGGFQLKDYTPRQGWHSVPEIFLYSSNI
FT                   GTSQIMLEIGKSNFKKYLKKLGLLDQLQIELPERGTPLFPSEKRWNELTSVTMSYGYGI
FT                   SISPLHFVRAMLPVVNGGTLYDLTLLKRKDEKVIGRRVFSEHTSTQMKKLFRSVVKEGN
FT                   GKRAEVKGYLVGGKTGTAEKLSQGAGGKKKYLKNSRASSFLGVLPVSNPQYVIFIRFDE
FT                   PKPTKESFGFATASWTAAPTAGRVFERMISLYGLEPIEHNEEES"
FT   gene            460379..460900
FT                   /locus_tag="A1E_02080"
FT   CDS_pept        460379..460900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02080"
FT                   /product="hypothetical protein"
FT                   /note="COG0768 Cell division protein
FT                   FtsI/penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02080"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73361"
FT                   /db_xref="GOA:A8EYC8"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYC8"
FT                   /protein_id="ABV73361.1"
FT                   /translation="MLKIKQEIYKNSLQIILKLLFALLCLLIILFPLVSYKINIQSRIF
FT                   PAIEIIFIYYFMSLYSLNVFRIFLLGLLIDQISGIPIGTNSLVFLLAYVIYKVSSKYFV
FT                   TKNYFIHFIIFCVYCLFILNFKYLLVIIKRLEADGYLILFLQFCTTIFSYNLVYLILDS
FT                   PMNYFKKYAK"
FT   gene            460890..462671
FT                   /locus_tag="A1E_02085"
FT   CDS_pept        460890..462671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02085"
FT                   /product="Penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02085"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73362"
FT                   /db_xref="GOA:A8EYC9"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYC9"
FT                   /protein_id="ABV73362.1"
FT                   /translation="MLNKKILHGELISRRAFIIGVGKLGFLSLLGIRMFYLQLIKSEEY
FT                   KTLSDKNRINFVVLPPSRGRIYDLDGNILATNKPCYQLVIDRSINNNYRDELEIISNIL
FT                   NLSPEKFNYIKQKIEKSSRHVPLVIFDQLDWQQVSVIEEQKHKLASIFIDVGYLRFYPF
FT                   SSVTSHLIGYLGQINEQEKQELNIYSVSNFNIGKSGIEKYYDNKLRGEFGYKKVEVNAY
FT                   GKQVREIAGTPTKSGEDMHLNIDASLQQKIRQYLNPKGSSAIVMDTRTGNVLICVSTPG
FT                   FESNNFSKLSENYWQSLTGDPYKPLINKVIQNSYPPGSVFKIITVLAALEVGINPNKTV
FT                   FCDGSSVLNTNSFRCWNHSGHGTLDMMSALKYSCNIYMYELARIIGPDKILAVAREFGF
FT                   GSKTGIDLAHENMGFVPSKEWKKRKLKLPWSIGDSFNLAIGQGFLGVTPMQLARFITAI
FT                   ASNGKLYTPRVLKNDPEFYNVNIKPENIKIIQESLYNTVNVVGGTAYYNRILGKNRQLA
FT                   GKTGTSQVQGKLNAKDDLSRDSIAWERRNHALFLGFSPYHDPRYSVTVFIDHGGGGSKA
FT                   AAPIARKIMSDVLDKYL"
FT   gene            462710..462850
FT                   /locus_tag="A1E_02090"
FT   CDS_pept        462710..462850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02090"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73363"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYD0"
FT                   /protein_id="ABV73363.1"
FT                   /translation="MIEELLKFQYGYNDEKVAAIVERVIDYDLLYCIKYFINNGGIVIE
FT                   N"
FT   gene            463165..463344
FT                   /locus_tag="A1E_02095"
FT   CDS_pept        463165..463344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02095"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73364"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYD1"
FT                   /protein_id="ABV73364.1"
FT                   /translation="MPDTDLLDLCNVLKMRSFLLSIKELDNLYLYPTGQDSDFINVYKI
FT                   SSPEVQEMWDVRVS"
FT   gene            463781..464758
FT                   /locus_tag="A1E_02100"
FT   CDS_pept        463781..464758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02100"
FT                   /product="hypothetical protein"
FT                   /note="COG0768 Cell division protein
FT                   FtsI/penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02100"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73365"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYD2"
FT                   /protein_id="ABV73365.1"
FT                   /translation="MSKKKQDDQIIKELEARLAKLKGTPPTLEELEERFAKLQDRPYVP
FT                   TKKSGNKVDDLIEQIRSEVKLEQKSRNLSNQKDQEICDRLDKLREDIPIMQHKTSTALS
FT                   FNDTKSIITDTIDAQADIASLYASRSTELEEKKALLHLANNLTEASDIIRDKSPISKEY
FT                   ETKILDVIASGLNTIYEGIKKIVSPTVNILKEIGSSFVNSIQSLHQKSSKQQIKESKIK
FT                   LKKLYKTYIYLKGVKPKIKEDFLKKHYERIDQLQTPQEIFIETAKITKSIKIAGKQKIN
FT                   NLKQQQIINRMKEQSPTAFINNNLFVPSNTLTTKVRSLKKSNQR"
FT   gene            complement(465108..466859)
FT                   /locus_tag="A1E_02105"
FT   CDS_pept        complement(465108..466859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02105"
FT                   /product="hypothetical protein"
FT                   /note="COG1357 Uncharacterized low-complexity proteins"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02105"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73366"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYD3"
FT                   /protein_id="ABV73366.1"
FT                   /translation="MPILKVISIITIYLLLSSCSESTRDAHGLLTDSQSTVIQHYIVSQ
FT                   NSKNLKVNLKEKFGSNLKGVKLIGVQLINEDLSGIDLTSCEILRTDFAGSNLEKAILTN
FT                   AIIQESNFADSVIKNISGYNSDFRGSIFNNITLQNTNLVQSNFSDTAFNKTTIKHVNFE
FT                   KSKFSHVLWNNNTIDGVNFQKANLKNNSFKNTNITNSIFYGTDLAKSVINNTNFTNNYF
FT                   ESSDLSQTRLTAVIIKDSNFTQSIFNEVSFNNVQSNNSYFSYASFQGSTLQNISLTKCD
FT                   LQNSTISGAVLNQFKIDNSILNNMSLNDNKFNNLSIKNSNANFVRINKTKGSNITLDNI
FT                   SIANIIFSNNDFKQFIAINTDLTGSEIINSNITNGQFNNVNFSKTLIQNINFSDVKINL
FT                   GNLNQVALINSNLINTAVINSAISNSQINNINYQAYSSFINTNVSNNIILNSDNSSKNL
FT                   PNNIIINSVKDLQKITNLANMNLTNFDLSNLIFDRVDFSNSIFKNANLTNTVIKNSSLQ
FT                   NVDFSATTISKTDFSNSILTDSIFKSAKIDQANFNNSDLTNVDFSDAAIKNTLFDKAKT
FT                   GRMKGVE"
FT   gene            complement(466846..468273)
FT                   /locus_tag="A1E_02110"
FT   CDS_pept        complement(466846..468273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02110"
FT                   /product="nitrogen assimilation regulatory protein NtrX"
FT                   /note="COG2204 Response regulator containing CheY-like
FT                   receiver, AAA-type ATPase, and DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02110"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73367"
FT                   /db_xref="GOA:A8EYD4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYD4"
FT                   /protein_id="ABV73367.1"
FT                   /translation="MSSIDVLIVDDEEDIRNIIAAILKDEGFNSKVAANSTQALKILAE
FT                   KPVSAVILDIWLQGSEIDGLGILEIIKKRYPLMPVIIISGHGTIETAVNAIKMGAYDYI
FT                   EKPFNNDKLVILLKRACEVTKLKRENIDLKSKVIDKTELVGGCSVTLKYKMEIEKAASS
FT                   SSRIMIQGKVGSGKELAARLIHKQSKRVNNPFIIFSPTCMTTEKIDQELFGESEKQENN
FT                   NKRPTILEFANNGTLYIDEVSNIPIPIQVKLLKFLKNQTITKPCGDSIKVDIKIITGTS
FT                   KNIQDEVNNGKFLEELYYRLNVFSLKVPSLYERKEDIPLLIKYFVKQLSKFSGLKERPF
FT                   ADDTIAALQSYEWPGNIRQLRNVVEWTLIMNPLTTGNNEIIKPYMIPAEILANSANLTK
FT                   LEDSVDMLSMPLREAREVFERQYLSAQMSRFNNNISKTSSFVGMERSALHRKLKLLSLH
FT                   IPPANKINEEEYEDANT"
FT   gene            468487..468753
FT                   /locus_tag="A1E_02115"
FT   CDS_pept        468487..468753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02115"
FT                   /product="Multisubunit Na+/H+ antiporter, MnhF subunit"
FT                   /note="COG2212 Multisubunit Na+/H+ antiporter, MnhF
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02115"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73368"
FT                   /db_xref="GOA:A8EYD5"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYD5"
FT                   /protein_id="ABV73368.1"
FT                   /translation="MLNIFLIIISLFICLITYLFIKKTDIFTKLLVLNSFTTIVSLFIC
FT                   CLSLYSGNSSYLDIAIIYFLLSFIATNGYLKYFINESNENKTD"
FT   gene            468896..470023
FT                   /locus_tag="A1E_02120"
FT   CDS_pept        468896..470023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02120"
FT                   /product="2-octaprenyl-6-methoxyphenyl hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02120"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73369"
FT                   /db_xref="GOA:A8EYD6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR011295"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYD6"
FT                   /protein_id="ABV73369.1"
FT                   /translation="MTNIVILGCGLSGMLTALSFAKKGIETTIFESKSVKSPEFFKDIR
FT                   TTALTPHAKNFLSSIDIWEELEECTVGMQDVYVVDNKASEILDLRNDNNNLLGYVVKNS
FT                   DFKKILLSKITNHPLVTLIDNYKYQEVISHHNYSVIKFDNEQIKCNLLIICDGANSKAR
FT                   SHYFANKIEKPYQTALTFNIKHEKPHENSAMEHFLPLGPFALLPLKDQYASSVIWSTSS
FT                   DQAALIMNLPVEEVRFLTQRNAGNALGKITIDSEMSSFPLKARMVNRYFHNKIVLIADT
FT                   AHIIHPLAGQGLNQGIKDIETLSMVISNNNGSLERYQKLRQDDNFIMYKLTDELNNIFS
FT                   HYSKNLRFIRQIGFKAINNFKPIKNLIMNYAMGER"
FT   gene            470237..470419
FT                   /locus_tag="A1E_02125"
FT   CDS_pept        470237..470419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02125"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73370"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYD7"
FT                   /protein_id="ABV73370.1"
FT                   /translation="MLKKVMLLCLNINENSNISQPQTQQSGQKKNRVLTETKAMCGLRA
FT                   VTAAASAVLVSAKIV"
FT   gene            470412..470531
FT                   /locus_tag="A1E_02130"
FT   CDS_pept        470412..470531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02130"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73371"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYD8"
FT                   /protein_id="ABV73371.1"
FT                   /translation="MFSAAAKVCANFDIVCVADDLKSESDIAKGCDKIKTLPG"
FT   gene            470997..471071
FT                   /locus_tag="A1E_02135"
FT   CDS_pept        470997..471071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02135"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73372"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYD9"
FT                   /protein_id="ABV73372.1"
FT                   /translation="MVIAVAAAKGLVNTGSTADIDIIL"
FT   gene            471696..471911
FT                   /locus_tag="A1E_02140"
FT   CDS_pept        471696..471911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02140"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73373"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYE0"
FT                   /protein_id="ABV73373.1"
FT                   /translation="MYYFSHNFILLKYTFAIPLNSALNVKGFIFPRGHMSSSIVFYGWF
FT                   FANIRHYLIKNNNSSDFNWYWIFVDL"
FT   gene            471901..472050
FT                   /locus_tag="A1E_02145"
FT   CDS_pept        471901..472050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02145"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73374"
FT                   /db_xref="GOA:A8EYE1"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYE1"
FT                   /protein_id="ABV73374.1"
FT                   /translation="MIYKGYHYLFDIIASITIGIMVIAFVYSVTKEDIVHKYPFMLGAF
FT                   VWAF"
FT   gene            472038..472241
FT                   /locus_tag="A1E_02150"
FT   CDS_pept        472038..472241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02150"
FT                   /product="hypothetical protein"
FT                   /note="COG0654 2-polyprenyl-6-methoxyphenol hydroxylase and
FT                   related FAD-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02150"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73375"
FT                   /db_xref="GOA:A8EYE2"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYE2"
FT                   /protein_id="ABV73375.1"
FT                   /translation="MGVLTVPMVAYLKIIDLNCLVSVWTVFWGLLGLTISWPVILSIFG
FT                   TLSIKIKLFLQLSYNCRFNSVA"
FT   gene            472492..473823
FT                   /locus_tag="A1E_02155"
FT   CDS_pept        472492..473823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02155"
FT                   /product="Proline/betaine transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02155"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73376"
FT                   /db_xref="GOA:A8EYE3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYE3"
FT                   /protein_id="ABV73376.1"
FT                   /translation="MLGYEKAQTSLNREQKETIRLLSIGTFLEYFDLMIYVHMAVLLNE
FT                   LLFPKADTQTAAIYSAAAFCSTFVFRTFVALLFGWIGDKYGRKSTVIITTLFMACFCAF
FT                   MAGLPTYVQIGVTATWIVTICRIIQGMSSLCEIIGAELYLTETINPPKQYPVVSLMFSC
FT                   AVLGGVAALGLESIIVHYGFSWRITFFIGTFIAITGSYARTHLRETRDFIDAKQQVKNI
FT                   FNKASINIKILENNPIWKEKVHWKTSLYYFLIHCTWPVTFYITYIYCSNILKSSFNYTS
FT                   EEIITHNFIVSLMQFFGSLIFRAYLSGIINPLKILKGFLAIFSLFILIFPYLLNNLHTP
FT                   RELLIIQSIMVIIGLGDAPAVPIFFKHFPIFKRFTYSSFLYALSRALIYVVTSFGIIYL
FT                   VSYFGHWGILVISIPLSISYGFGIQHFEKLEKNRENYLKKKQLA"
FT   gene            complement(473820..474467)
FT                   /locus_tag="A1E_02160"
FT   CDS_pept        complement(473820..474467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02160"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73377"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYE4"
FT                   /protein_id="ABV73377.1"
FT                   /translation="MTFMEDISSWQEKFEVCVYAKKLLDKLKYLNAKVKNPVDIEEVKK
FT                   GIYYARKYHGSQMRQSGEPYYSHPVEVAIMLAEFVTDEAPKLFTTNMINAALLHDTIED
FT                   TELTEEMITEIFEIEVARHVEGLTRIKSYGKISVEESLNLLVKQKRYDTALIKFFDRIH
FT                   NVQTLGVKSPEKIRKIIEETLKVFLILSMYLGISQVKNKLIELCLNIAYSDS"
FT   gene            complement(474576..474647)
FT                   /locus_tag="A1E_02165"
FT   CDS_pept        complement(474576..474647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02165"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73378"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYE5"
FT                   /protein_id="ABV73378.1"
FT                   /translation="MEEKATEYKLQQGEDAKASNKIE"
FT   gene            complement(475101..475177)
FT                   /locus_tag="A1E_t05706"
FT   tRNA            complement(475101..475177)
FT                   /locus_tag="A1E_t05706"
FT                   /product="tRNA-Arg"
FT   gene            complement(476156..476395)
FT                   /locus_tag="A1E_02170"
FT   CDS_pept        complement(476156..476395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02170"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73379"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYE6"
FT                   /protein_id="ABV73379.1"
FT                   /translation="MLKDQLAENIIGLEIKTFDKPLITLKTEYDTPYKVITLDKIKLEN
FT                   PANVKIFNEAINNKINEFNNRNFISFTYAVQLNS"
FT   gene            complement(476698..476994)
FT                   /locus_tag="A1E_02175"
FT   CDS_pept        complement(476698..476994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02175"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73380"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYE7"
FT                   /protein_id="ABV73380.1"
FT                   /translation="MSKDNEPANSLTTEKQIKEIISGARNDIRDIEGYVLGQLKNQIIA
FT                   DKEPIDINSKDFKEIFEADHNETSTIEINEKQEVIKNNIINVRATILAINERI"
FT   gene            477733..477912
FT                   /locus_tag="A1E_02180"
FT   CDS_pept        477733..477912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02180"
FT                   /product="hypothetical protein"
FT                   /note="COG0317 Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02180"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73381"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYE8"
FT                   /protein_id="ABV73381.1"
FT                   /translation="MGDKLDLYEQDIENNFKKQQKFNNQSEITLLHKSAQIYMSKMSIL
FT                   NVTNRKTKKEFLKG"
FT   gene            477924..479159
FT                   /locus_tag="A1E_02185"
FT   CDS_pept        477924..479159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02185"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02185"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73382"
FT                   /db_xref="GOA:A8EYE9"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYE9"
FT                   /protein_id="ABV73382.1"
FT                   /translation="MTFIKEFRNKGYFHQCTNLDRLTSITKETKIAAYIGFDCTATSLH
FT                   IGSLMQIMILRLLQQHGHKPIVIIGGGTSKIGDPTWKDEARKILSKEEIAKNAEGIKKS
FT                   LSKFIKFGEESSDAIMLDNSEWLDSLNYLDFLRDFGSYFSVNRMLTMDSVRLRLEREQH
FT                   LSFLEFNYMLLQAYDFYYLSKYYNCSLQLGGSDQWGNIVIGVDLIRKISSKEVFGMTTP
FT                   LLTTSSGAKMGKTAAGAVWLNEDLLSPYDYYQYWRNCEDADVIRFAKLFSELNTKEFTK
FT                   FENLVAEDINAAKKQLAYELTKLCHSEQAAKSALETAVKIFEQGEIDENLHTVVLELEI
FT                   LQAGINAYELFHEAGLATSKSEARKLIRGKGAKINDKLIEDENMIINTNFLLDKSVIKL
FT                   SAGKKRHILVRI"
FT   gene            479982..480158
FT                   /locus_tag="A1E_02190"
FT   CDS_pept        479982..480158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02190"
FT                   /product="hypothetical protein"
FT                   /note="COG0162 Tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02190"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73383"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYF0"
FT                   /protein_id="ABV73383.1"
FT                   /translation="MQFVSTCTQDKPLESHYLKGVKYLVILELLKGRLNLGLPTNCYFW
FT                   RDKTGYEIDCISE"
FT   gene            480266..481120
FT                   /locus_tag="A1E_02195"
FT   CDS_pept        480266..481120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02195"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="COG1189 Predicted rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02195"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73384"
FT                   /db_xref="GOA:A8EYF1"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYF1"
FT                   /protein_id="ABV73384.1"
FT                   /translation="MYNAEQNGSIFKYTNLILLGQINQVNIKMIKAMKIRLDEYLLQKG
FT                   FVTDITIAQSLIIQGKVHNKYEQLIKPGIQVNINDTNIKVKLPKHNYVSRGALKLIAAL
FT                   DYFKITTENLVCIDIGSSTGGFTQVLLERKAKLIFAVDVGYGELHPKLRNNLQIKVLEK
FT                   TNARYLTDKQITMKPDLIVCDASFISLTTILPTSLNLAKEDCMLIALIKPQFEVKKHEV
FT                   EKGGIIKNSILHRKVCNKIKDWLVKEHNFKIFGIIDSPILGAKGNKEFLICGKRKWLFS
FT                   YNL"
FT   gene            481400..481777
FT                   /locus_tag="A1E_02200"
FT   CDS_pept        481400..481777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02200"
FT                   /product="hypothetical protein"
FT                   /note="COG0779 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02200"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73385"
FT                   /db_xref="GOA:A8EYF2"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYF2"
FT                   /protein_id="ABV73385.1"
FT                   /translation="MQTIEQQITNVIEESLIDMGFELVLVKFKGVNSKVVEILIDSLNS
FT                   EKVSVEDCTKVSRTIPAILDVENLIEDASSLEVASSGLERPLVKFENYNRFLGREVKIT
FT                   LKELLNDKTSYQGKIIKAENK"
FT   gene            481900..483411
FT                   /gene="nusA"
FT                   /locus_tag="A1E_02205"
FT   CDS_pept        481900..483411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="A1E_02205"
FT                   /product="transcription elongation factor NusA"
FT                   /note="COG0195 Transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02205"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73386"
FT                   /db_xref="GOA:A8EYF3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYF3"
FT                   /protein_id="ABV73386.1"
FT                   /translation="MSNIGNVEILQIINSVAREKGISKEILISTVEQAVQVAGRKKYGN
FT                   EYNIKAQINRKTGEINLLRILKIVENVEDYLTQISFEEALIKNPAAKIGDEIYEYLPPI
FT                   DHARVSAQAAKQVITQRVIEAERAKQYHDFKDRKGEIINGIVKRIEYGDIIVDLSRAEA
FT                   IIKKDQLIKGENFKPNDRIKAYVQDVRQETKGPQIFLSRVDNQMLVNLFKLEVPEIFED
FT                   IIQIKSVARDPGSKAKIAVFASDSSIDPVGSCVGIRGNRVKAVTNELNGEKIDIVLWSN
FT                   DLAQFIVNALAPLAAAAITKILIDEDSHKVEVVVSQENQSIAIGRRGQNVRLASKLTGW
FT                   NIDIMTEEQESKRRNEEFLTSTGLFMEALDVEEVIGQLLSVTGFNSVEQIANSEISTLT
FT                   RIEGFEEELAVEIKNRAINYVNLKNEKIIKKLEELGVEQEVIDILELPLELILKFAEYG
FT                   IKTIEDLGEMSVNEFKNLAPSANITDENIKLLIKTARQHSELKSN"
FT   gene            483625..486126
FT                   /locus_tag="A1E_02210"
FT   CDS_pept        483625..486126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02210"
FT                   /product="translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02210"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73387"
FT                   /db_xref="GOA:A8EYF4"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYF4"
FT                   /protein_id="ABV73387.1"
FT                   /translation="MTDNQEIKPKKLTLGNSKLSLNKSFDSLTGAQSFVNAKSKTLVEV
FT                   RKSSIGSTTTISLNKERNNLDQTVIDANKEEFNRRLSILKKAAEQSKLNDPSQISTLSK
FT                   LASINQSTNLKIETLETDKEVAQKRQNITENKVEVSAKIVQGDEDILSQIYKKKAETFV
FT                   KSPLVGMRTRYSIESEKESDKTAESKVVVQKIKLEEPKKFKKVDLFNMLSDDESGSGRT
FT                   RTRSLASIKRAREKEKRKLVLQAPEKVYREVTIPEVIGVGDLANAMSERVADVIKELMN
FT                   LGILANASQVIDADTAELVATNLGHKVKRVQESDVENVLISDDKVEDLRTRAPVVTVMG
FT                   HVDHGKTSLLDALKSTDIAAGEIGGITQHIGAYRVTLADGRAITFIDTPGHEAFSEMRS
FT                   RGTKVTDIAIIVVAADDGIKTQTVEAINHAKVAGVPIIIAINKIDKPNIDIERVKNELY
FT                   IHEIIGEEAGGDVMVIPISALKKINLDKLEEAILLIAEMQDLKASPFGSAAGVVIESKI
FT                   EKGRGTLTTILVQRGTLKNGDIIIAGTSYGKVKKMTNDKGLEIAEATPSVPVEIQGLNE
FT                   VPFAGVKFNVVQNEKQAKDIAEYRMRLAKEKKISIAPRSSLEDLFLKASGNSKIKELPL
FT                   IIKGDVHGSVEAILGSLLKLPSDEIKLRILHSGVGPITESDISLAHASSAIIVGFNVRA
FT                   GVNALTAAEKAKIDIRYYSIIYNLIDDVKAIMSGMLDPIVREQYIGSVEIRRVFNVTKV
FT                   GKIAGSYVTKGIIKKGADVRLLRDNIVIHEGKLKTLKRFKDEVKEVREGYECGIAFENY
FT                   EDIRENDVVEVFELIQEQRQL"
FT   gene            486434..488014
FT                   /locus_tag="A1E_02215"
FT   CDS_pept        486434..488014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02215"
FT                   /product="hypothetical protein"
FT                   /note="COG0532 Translation initiation factor 2 (IF-2;
FT                   GTPase)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02215"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73388"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYF5"
FT                   /protein_id="ABV73388.1"
FT                   /translation="MVIMSIFNKLQNLITPNIASKPASYPANSEFYFITFPKKTTDKEQ
FT                   NAENTEFLVVLDNTIKQYDKESVRCNKKIIEAQAKYPVLSSKIDSQEAVKIVYDFGVNS
FT                   FSEVKKTIDTKYKTIKESIKPTVNKVYDFGVNSFSEVKKTIDTKYKTIKESIKPTVNKV
FT                   YDFGVNSFSEVKKTIDTKYKTIKESIKPTVNKVYDFGVNSFSEVKKTIDTKYKTIKESI
FT                   KPTVNKVYDFGVNSFSEVKKTIDTKYKTIKESIKPTVDKVYDFGVNSFSEVKKTVDTKY
FT                   KTIKESIKPTVDKVYDFWFKFKFNLSFQKVSNNDQVEEILNTPENELDEIFEKMTYEKL
FT                   AELINNIANEQAQKLVNYIMPCHFEKLMQFIPLDTLNMYIDQTLSLDELVEQKLKKLSN
FT                   DDITDEQLENIIILVGEEKLVEKLDIIPNENLVRIMSNISNNKLATIIYHASDESLVRI
FT                   IDIINSDNHHLSESLVGEIITLIHDKTCVKQEVEPYNVNYNMKLSGALSDSNNNYGFSF
FT                   NLEDEIIEL"
FT   gene            complement(488043..488723)
FT                   /gene="infB"
FT                   /locus_tag="A1E_02220"
FT   CDS_pept        complement(488043..488723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="A1E_02220"
FT                   /product="translation initiation factor IF-2"
FT                   /note="COG1214 Inactive homolog of metal-dependent
FT                   proteases, putative molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02220"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73389"
FT                   /db_xref="GOA:A8EYF6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYF6"
FT                   /protein_id="ABV73389.1"
FT                   /translation="MKILAFDTANNTASVAISENENILAYIEELNHSMQAENLMPMIED
FT                   VMKAAKCSYDDLDYLAVTTGPGSFTGIRIGLASAKGILFAKENIKAVAVNNFEYAYFRA
FT                   ITQVKKYDKIYVFLNAYRSQLYMQVFHKSGKIEEPLLIDFKYAIKLLTNDKGSIVCCGS
FT                   GLEFIYNQIMHLPSIITLPRFARVKAWVICRYIASKGRCVIKLNSSIEPLYIRPPDAKI
FT                   AKKG"
FT   gene            complement(488806..489531)
FT                   /locus_tag="A1E_02225"
FT   CDS_pept        complement(488806..489531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02225"
FT                   /product="DNA repair protein RecO"
FT                   /note="COG1381 Recombinational DNA repair protein (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02225"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73390"
FT                   /db_xref="GOA:A8EYF7"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYF7"
FT                   /protein_id="ABV73390.1"
FT                   /translation="MNIKDIGVIVAKKPLKENTFIITVFTKNYGLYSGVVKASSKKSKF
FT                   IYQEGNIVDFLWMARLHEHIGIAKCELIKSYTGYFITNKTKLYAFNSIISLIKELLHER
FT                   EEYSNFFSFLINYLDNLSKKFFFRDYINFELALLDIAGYKLDLSKCAVSNVKQDLYYVS
FT                   PKSGRALSYEVGKPYKDKLLILPKFLLSDNSKITLEEKRQALTLTNYFFNRYLFHNNRH
FT                   AEARQAFMEYILHRCHPAT"
FT   gene            complement(489730..490062)
FT                   /gene="recO"
FT                   /locus_tag="A1E_02230"
FT   CDS_pept        complement(489730..490062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="A1E_02230"
FT                   /product="DNA repair protein RecO"
FT                   /note="COG0191 Fructose/tagatose bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02230"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73391"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYF8"
FT                   /protein_id="ABV73391.1"
FT                   /translation="MIIVYEIRNLEEARDFLSSVEQKLMLTNHVSSVKYYGMLAIDYMF
FT                   KTLSKEFPEKVLDLTVDVRDDHAALFTAIKLGYKNIIYTGNSNEVRALLRRIGKAPTIS
FT                   YRSLTK"
FT   gene            complement(490059..491399)
FT                   /locus_tag="A1E_02235"
FT   CDS_pept        complement(490059..491399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02235"
FT                   /product="DNA repair protein RadA"
FT                   /note="COG1066 Predicted ATP-dependent serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02235"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73392"
FT                   /db_xref="GOA:A8EYF9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYF9"
FT                   /protein_id="ABV73392.1"
FT                   /translation="MTKDKKHYTCSNCGNINPKWSGQCFDCGVWGSIVEETVSSHKTII
FT                   KTGSKQDFDKLSGNVAEQVRIPTPIGEFNRVLGGGLVLGAAILIGGDPGIGKSTLLLQL
FT                   AASNFASKVHCLYITGEESLNQIKLRAIRLNLTNYNTKILAATNLEDIITSIEANKNNI
FT                   DLVVIDSIQTITTKELSSPPGTVSQIRTCANELVNYAKQNNIIILLSCHVTKDGQLAGP
FT                   KILEHLVDTVLYFEGEHNNHFRILRSYKNRFGGVGEIGVFEMSSSGLIEVTNPSELFLM
FT                   KREQNVIGTSIFAGIEGSRPLLMEVQALIVPSNMVTPRHSAVGWDANRLSMILAVLISK
FT                   IGLNFANYEVYLSIAGGLKITDPASDLAVAASLISAATGKPVPEQSIFFGEISLSGEIR
FT                   KTAKAEMRVKEAVKLGFNKIICSKLENLTYKFISSVSHLKDLKEIIK"
FT   gene            complement(491538..492110)
FT                   /locus_tag="A1E_02240"
FT   CDS_pept        complement(491538..492110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02240"
FT                   /product="N6-adenine-specific methylase"
FT                   /note="COG0742 N6-adenine-specific methylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02240"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73393"
FT                   /db_xref="GOA:A8EYG0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYG0"
FT                   /protein_id="ABV73393.1"
FT                   /translation="MLKIISGKYRNQIIHTAKNIKYRPSTGKIKEAIFSILTSGEFTDN
FT                   KLFNDNTHILDLFAGSGNFAFESLSRGAGLATLIDIDPSSLKIAEGFAKSLNIENKINF
FT                   VNLNSLNLPKANKTFDLVFIDPPYHKDIVPKVMKLLVKNNWLKDGSIIVIEMAKLDDYF
FT                   LDENIEIIRKKLYSKSKLLILRYALAK"
FT   gene            complement(492119..494989)
FT                   /locus_tag="A1E_02245"
FT   CDS_pept        complement(492119..494989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02245"
FT                   /product="Uncharacterized low-complexity protein"
FT                   /note="COG1357 Uncharacterized low-complexity proteins"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02245"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73394"
FT                   /db_xref="GOA:A8EYG1"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYG1"
FT                   /protein_id="ABV73394.1"
FT                   /translation="MTNLNIYKCEEKDLNDYLDYIKDNPNVSLNDFIKKTYFSNDKDKI
FT                   VIASLADQEINDKDLMNANFQGTILIDTVFNNCDFTNTILCDSDLTNVKFNDCKFIGTD
FT                   FRGANLHYTDFNYKDYDYDNYKIPNLKDKIRDIKLSFSDLERLNKYIDKDLEKERIKEI
FT                   VIDEVTNRKKYILAGEDEKTLWEVKSKELKTKQAELEDLKQNLDNPGIVTNFLNAFWNS
FT                   AETIAQNQQNKLAKINLLQQQVNKLETEVHVLDNLRMFCGKGLDSILEQLKDEKIQITL
FT                   DPSYIIGSTAKERDISKKYIKLTSQEFDLYLAEAAKQSDTKLSLTAFVRKHKKLSEDIH
FT                   IIPDLSEIDLSGKTLTNLNLKNTLFAAANLENIKILNCNLDFTNFEGANLQNAVFQNVT
FT                   ARNAGFLFADLKNSKIKNSDMSRSYMPKIDLSEAEVTNSKFNAVMMVNADAEKLVIKDS
FT                   EWKNSNLTGISLAYADMQRVQMQGVVLNNALLDQANIISTNLENAFMHNAHALEAKFKK
FT                   QCNMKSITARNAYFSDAEFENILSLEEADLRNAIMERVNLVNANMNKALLDKANLEYAN
FT                   LTGAILTDASAQFAKLSNATLEKAEAEGLNIADAIAKNMNAKEANFKNAIMKRADLTKA
FT                   NLEKAILENADMQAAEALDAIFKEANLKQANLKAANLARINKAGADFDQAKVDDATKMH
FT                   YTKGDAKGHLEHHDKDDKITSVNVNNEHDKLQDKIHAREKSGWFLKTEVGQFCTKLAKS
FT                   TTSSMSSITNFLASKKFLVGVAIVAGLALAAVPFVAMPMLLVTGTALTTKAIILGASIL
FT                   AGVAVAAGTYKFIQKPLRNIQKSFQNLTSSIDKYISPPPENIDELVTEKQQARQKAEAE
FT                   KSKTREENFNNVNNNIDKAKEQDILKRVQNVTPKVEIKEKKDKTVEKQQTKSSTFAAKV
FT                   QPNTKNKGFAATIKDEQKNQGHKRNI"
FT   gene            complement(495040..495729)
FT                   /locus_tag="A1E_02250"
FT   CDS_pept        complement(495040..495729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02250"
FT                   /product="predicted repair protein"
FT                   /note="COG1187 16S rRNA uridine-516 pseudouridylate
FT                   synthase and related pseudouridylate synthases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02250"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73395"
FT                   /db_xref="GOA:A8EYG2"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYG2"
FT                   /protein_id="ABV73395.1"
FT                   /translation="MQRLAKVISNSGVCSRRDAEKLIAEGQVKVDGITILAPATNVDIS
FT                   NQIEVSGILINQSQKPRLWIYYKPVGLITTHKDPLSRKTVFEDLTSLPRVISIGRLDLN
FT                   SEGLLLLTNSGDLARQFELPSNKLKRVYHVRAYGNPDILLKSEYKNLEIDGILYNPYSI
FT                   KLLRGNNTNAWFEIVLFEGKNREIRRIFEYFGLKVNKLIRVQYGSFTIGNLKPGDYKEI
FT                   NNKILEK"
FT   gene            495922..496068
FT                   /locus_tag="A1E_02255"
FT   CDS_pept        495922..496068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02255"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73396"
FT                   /db_xref="GOA:A8EYG3"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYG3"
FT                   /protein_id="ABV73396.1"
FT                   /translation="MMQKLIGSNLLILGTCIGSSMIALPMVLAKLGIVYNLVYNIIILL
FT                   ELI"
FT   gene            496497..496643
FT                   /locus_tag="A1E_02260"
FT   CDS_pept        496497..496643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02260"
FT                   /product="hypothetical protein"
FT                   /note="COG0814 Amino acid permeases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02260"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73397"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYG4"
FT                   /protein_id="ABV73397.1"
FT                   /translation="MIVEYNIKTMKQVGNNEQIFLVKKYVGKQIKILTLNDGTSNKAWQ
FT                   ICS"
FT   gene            complement(496743..498227)
FT                   /locus_tag="A1E_02265"
FT   CDS_pept        complement(496743..498227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02265"
FT                   /product="replicative DNA helicase"
FT                   /note="COG0305 Replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02265"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73398"
FT                   /db_xref="GOA:A8EYG5"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYG5"
FT                   /protein_id="ABV73398.1"
FT                   /translation="MACNKINNDKNIDTKEEADIPIPRVLPSNIQAEQMLLGAILTNNE
FT                   LLNYVSEFLRLEHFFEPIHQKIYNAIEAITEKGLIATPITLRSMLTQDELFQKIEGSEY
FT                   LAKLITMSMMVINPIDYGKIIYDLAIKRNLINIGEEVVNNAYNSSLEVEAKEQIEYAEA
FT                   KLYNLASKGLNEKSFTKIGISISESLANINRAMKNNDHVIGISTGLIDLDNKLFGFHNS
FT                   DLIILAGRPSMGKTAFAINLALNACNNMRLKNIRDNQEIQSVGFFSLEMSSEQLTTRLL
FT                   SMCAEIDSTSLRTGVLGEEKYNRLRKEANTLSELQFFIDDTPALSITTIRTRARRMKRQ
FT                   HNLGILFIDYLQLIRGVSKAENRVSEIAEITQGLKAIAKELNIPVIALSQLSRAVELRE
FT                   DKKPMLSDLRESGTIEQDADIVMFIYREEYYLTRKEPAADDAKHAEWLNKLNKVYNIAD
FT                   IIVAKHRNGPIGNVSLYYDSQYSKFSNLEHRTFNAV"
FT   gene            complement(498715..499350)
FT                   /locus_tag="A1E_02270"
FT   CDS_pept        complement(498715..499350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02270"
FT                   /product="aromatic acid decarboxylase"
FT                   /note="COG0163 3-polyprenyl-4-hydroxybenzoate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02270"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73399"
FT                   /db_xref="GOA:A8EYG6"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYG6"
FT                   /protein_id="ABV73399.1"
FT                   /translation="MHINVFYKFFLLYTKLINYRTEMNKEKKIIIAISGASGAIYGIRL
FT                   LEILKQQNIETHLVISDGAALTIKAETTYSIEAIKNLANYYYDDKDLGATISSGSFKTS
FT                   GIIIAPCSMKTLASIAHSIEDTLISRAAGVVLKDRRKLILMTRETPLHIGHLENMLKVA
FT                   SYGGIIAPPVPAFYNNPASIDDIVNHSVTRILDCFDIETNLIKRWGSV"
FT   gene            499345..501291
FT                   /locus_tag="A1E_02275"
FT   CDS_pept        499345..501291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02275"
FT                   /product="primosome assembly protein PriA"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02275"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73400"
FT                   /db_xref="GOA:A8EYG7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYG7"
FT                   /protein_id="ABV73400.1"
FT                   /translation="MQIAKILLPVAKLFPLDYLIPKDLSVNIGDLVIVSFRNKELTGIV
FT                   WELVSDSEIQKLKTIHRKVSLNLNITPEVLELIKWMSVYYMSELGSIAKLVLPIDIAAK
FT                   PIKIKEQKVNNDFILPDLSEEQKQAVTVLNESNKPVIIKGVTGSGKTEIYFHLIADYLV
FT                   KGKQVLIMLPEIALSTQIINRFIERFGFEPIIWNSSVTKAQKQMILRGILIDKVKVVIG
FT                   ARSSLFLPFKNLGLIVIDEEHDESYKQDDGILYNARDTAIVRGTFDKAQIVLCSATPSI
FT                   ETMYNVDLGKYRLINLINRYKNAHLPNIEVIDMTKEKLPKNSYLSKILIEAIKANLANK
FT                   KQTLLFLNRRGYAPLMLCKACGYRLTCKYCSSWMVVHKANKKLECHHCGYQSKIFSVCP
FT                   ECLEDATLTICGPGIERIEEEAKALFPERKIAVISKDHAKNTEKIAQILHQIENLEIDI
FT                   LIGTQMITKGYHFPNLTLVGVIDADLGSNNADLRASERTFQLLHQVGGRAGRGDSKGLV
FT                   YLQSYCPNNIIFSYVKVSYEDSFFAHELEIRKSAYMPPFSKMASVILSGASEHKILAIA
FT                   KNMVRIAPKANVKILGPASSLMSKLAGKYRYRILIIADKKFNLQKYLKFWLSLIKIPSF
FT                   CQIKIDIDPKSFY"
FT   gene            complement(501787..501903)
FT                   /locus_tag="A1E_02280"
FT   CDS_pept        complement(501787..501903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02280"
FT                   /product="hypothetical protein"
FT                   /note="COG1198 Primosomal protein N' (replication factor Y)
FT                   - superfamily II helicase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02280"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73401"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYG8"
FT                   /protein_id="ABV73401.1"
FT                   /translation="MAQENIKPVVPTKPTSEQIKAWDEAYKKHTDLTAAQGI"
FT   gene            502061..503053
FT                   /locus_tag="A1E_02285"
FT   CDS_pept        502061..503053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02285"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02285"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73402"
FT                   /db_xref="GOA:A8EYG9"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYG9"
FT                   /protein_id="ABV73402.1"
FT                   /translation="MYPLVRLRRNRKAFWLRELIAESNLSINDLVLPLFVVDGHNERQE
FT                   IKTMPGIYRLPINQIVETAKRAAELGINAIALFPSIDQSLKSKNANEAYNLDNLICRTI
FT                   RSIKNANVDIGIICDVALDPYTTHGHDGIVYHGEVDNDKSVRALSNQALVLAKAGVDIV
FT                   APSDMMDGRIGAIRKYLDKEGFINVGILAYAAKYASSFYGPFRDAIRSNKRNYLDKSSY
FT                   QMDVRNIKEAMLEIEHDISEGADMVMVKPGMPFLDVIREAANNFNAKIFAYQVSGEYAM
FT                   LKFAAEAGAIDWESTIIESLTSFKRAGATAILTYAALEVAEILKNNKIK"
FT   gene            503168..504733
FT                   /locus_tag="A1E_02290"
FT   CDS_pept        503168..504733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02290"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /note="COG0113 Delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02290"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73403"
FT                   /db_xref="GOA:A8EYH0"
FT                   /db_xref="InterPro:IPR040519"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYH0"
FT                   /protein_id="ABV73403.1"
FT                   /translation="MRQNKKSVFKGWNFLRPKVGGANDVGEHGGVYQSSDGKITAMIKK
FT                   ETSISKNIAEFLGSQIFETISPGNGAKVNLISPDHFNKSKVFDSQIYVKSEFFENYISD
FT                   MYVDMDKHMSATTKPSSWFRKDGGRPLFMGTRNKLFRTLENAFKEIKYQNFENIMPASL
FT                   LIGDFDIHVGNIGVIRDQKNPKTLPKLVRIDFAGSFNNLTNNIYPNSRAKHLPWFGPTN
FT                   HFREFPSSFRKKNPKFADSLLAVSKIDLSKTIDKSFDELTKYYSNEAIAEFAKQAIPKK
FT                   FNNTKSKEITPEEIKTSLIDVMQKRQESLKEYGLEIKINSLISKKYSFPYYEVKEQELK
FT                   TLMREYPDYFEKILNYKASKKGGQKIKLRNKVTTNVTRILEILGVRDSAKKHLIKTIKR
FT                   LNEDIKYERNLTDSSDKVKIKKEPEQKLVKTNVDANREYVDALEKFKKEVETDYIVSVT
FT                   PSQLGLTKKAKTKDQDLLKLDEEDLKHIKNLKEKIMKPTKTTLVDVDNKKPFKSKASKA
FT                   EIRK"
FT   gene            complement(504723..506093)
FT                   /locus_tag="A1E_02295"
FT   CDS_pept        complement(504723..506093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02295"
FT                   /product="NADH dehydrogenase subunit N"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02295"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73404"
FT                   /db_xref="GOA:A8EYH1"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYH1"
FT                   /protein_id="ABV73404.1"
FT                   /translation="MLLLLPEITLIIIALLGQFFAVMIPNKNRIISNIIILLCILSIFL
FT                   TFHYSSYEGVWHSFATGINIGISQSIVLLFTIISIIIYRGYSILANEKLKCEFITLMLL
FT                   STVGIFVAISSQNFLLLFCGMELTALTSYTLAGFKLNDIKSSEGALKYFILGSLVSCLS
FT                   LFGISFIYGFGGSVQFEDILYKLNNSSSTNIGLIIGIVLFLSSIFFKLSSVPLHFWAPD
FT                   VYEGSPIASVTYFTAASKIGMVAVLLNISKFIIGDYHPINYNLIKIIAILSMLFGSFGA
FT                   IRQTSLKRLMAYSTILNIGYVLIGVLLHNQDGYKTALLYILIYAVGSIGFFTCLIMLLG
FT                   KDADKASFKTIQGIAENHKTIAAVISIVMFSMIGIPPLTGFFGKYYLFYQAINQGEFAL
FT                   AYCGIFTSIVAAFYYLKVVKAMYFSKKIELMNLPIQYGLLLINYLVVGFLLLGSFIF"
FT   gene            506111..506275
FT                   /locus_tag="A1E_02300"
FT   CDS_pept        506111..506275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02300"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73405"
FT                   /db_xref="GOA:A8EYH2"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYH2"
FT                   /protein_id="ABV73405.1"
FT                   /translation="MEIWILVNKSFFINKLIYNYCTLKLHLIKIIFFYTLIVEKFNTKN
FT                   YFMQKKKKL"
FT   gene            506505..506684
FT                   /locus_tag="A1E_02305"
FT   CDS_pept        506505..506684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02305"
FT                   /product="Transposase"
FT                   /note="COG1007 NADH:ubiquinone oxidoreductase subunit 2
FT                   (chain N)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02305"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73406"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYH3"
FT                   /protein_id="ABV73406.1"
FT                   /translation="MLNIAEYHMKVLKNKKFPFIYPLVFYNGIQKYNVPLNLWALFEKS
FT                   ELVQATWINDCQLN"
FT   gene            507004..507237
FT                   /locus_tag="A1E_02310"
FT   CDS_pept        507004..507237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02310"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73407"
FT                   /db_xref="GOA:A8EYH4"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYH4"
FT                   /protein_id="ABV73407.1"
FT                   /translation="MWITKYRYKVLTYDIKKRVREIIAVVVEELNVKIENGVISSDHIH
FT                   IFANIPPHIKVSEFVQKAKGRSSKKYKKNFQY"
FT   gene            507267..507389
FT                   /locus_tag="A1E_02315"
FT   CDS_pept        507267..507389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02315"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73408"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYA1"
FT                   /protein_id="ABV73408.1"
FT                   /translation="MVREYFSATSGNVTDDMINEYINRHTDAHEPAMTTNIRLE"
FT   gene            507737..508609
FT                   /locus_tag="A1E_02320"
FT   CDS_pept        507737..508609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02320"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73409"
FT                   /db_xref="GOA:A8EYH6"
FT                   /db_xref="InterPro:IPR009574"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYH6"
FT                   /protein_id="ABV73409.1"
FT                   /translation="MYLLSFILKGVTTLFRQLWLSVSSIEFYTDVYRNYQGYGIRYLFT
FT                   VSFIPSIIYCIFILNYIITLKDYFNGIQSSKVTDNIEYIINQLPEIKYNNSKILVEEVE
FT                   PIYLYSKNNNKIVVIDTKNQVSNKEKSKIPFVLEENKLRINLIVANTKKNFPSTVNYSE
FT                   IFKQNEVILTPEIIKKYFANNLLYVANLFIYFGMPVIILFWFVTFLLERSIIVLLVYSL
FT                   ANLLTTKTSIQTSIRLVMFSSGVPIILQPVIIILIPELSILLQLLQMLTTCLVFIAIWQ
FT                   INKSLSSYI"
FT   gene            508865..508969
FT                   /locus_tag="A1E_02325"
FT   CDS_pept        508865..508969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02325"
FT                   /product="hypothetical protein"
FT                   /note="COG1943 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02325"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73410"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYH7"
FT                   /protein_id="ABV73410.1"
FT                   /translation="MLKAAYLKPDQLVIHERKATGVRKIEVKRNLNFF"
FT   gene            509686..510792
FT                   /locus_tag="A1E_02330"
FT   CDS_pept        509686..510792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02330"
FT                   /product="hypothetical protein"
FT                   /note="COG1104 Cysteine sulfinate desulfinase/cysteine
FT                   desulfurase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02330"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73411"
FT                   /db_xref="GOA:A8EYH8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYH8"
FT                   /protein_id="ABV73411.1"
FT                   /translation="MIYLDHNATTVIDFRVKEFIISLMDMELNPSSAHSSGRFAKNIIE
FT                   IARSQIATALGITLSSREYDIAFTSSGTESNNLIMKNFYDGDIFISAIEHLSIYSHIKY
FT                   APNIKIIKVDNQGLVDLKHLEELLSQSSTAKKLVSVMMANNESGVIQDIAEISKITKKY
FT                   EAKFHSDLIQSLGRIPINIKDLGLDFATISGHKIGAGQGSSTLISNSNFQVTPMIIGGG
FT                   QEKGIRSGTENVLAIAGLGLAAELITKDISEKYIKIKSLQATLEKKLKEYPKVNIISEN
FT                   VSRLPNTSLFTVPGTDAQIKLIGFDLRNICVSSGSACSSGKISKSHVLTNMGVEEEEAK
FT                   SSIRVSLSHNNTIEDIEAFIKAFEEVYD"
FT   gene            510902..512134
FT                   /locus_tag="A1E_02335"
FT   CDS_pept        510902..512134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02335"
FT                   /product="NADH dehydrogenase subunit N"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG1104 Cysteine sulfinate desulfinase/cysteine
FT                   desulfurase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02335"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73412"
FT                   /db_xref="GOA:A8EYH9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYH9"
FT                   /protein_id="ABV73412.1"
FT                   /translation="MNPQLHNIILPIYMDYQATTPLDPRVMEAMLPYFTTKFGNPHSRS
FT                   HSFGWEAENAVEEARSRVAKLIGADAKEIIFTSGATESNNLAIKGIAKFYGNKKNHIIT
FT                   VVSEHKCVLDACRHLEQEGIKITYLPINPNGIIDLEILKESITNQTMLVSVMAVNNEIG
FT                   VIQPLKEIGKICRERGVFLHSDIAQGFGKIPINVNEFNIDLASISGHKIYGPKGVGALY
FT                   VRKKPRIRVTPLINGGGQERGMRSGTLPTPLIVGLGMAAEIAYNEMEKDNKHVSYLFDR
FT                   FLNNIKQKISEVYLNGDKDQRYKGNLNLSFAGVEGESIILAIKDLAVSSGSACTSASLE
FT                   PSYVLRSMGIGEELAHTSIRFGIGKFTTEQEIDYAVDLICSKIDKLRELSPLWEMMQQG
FT                   IDLKKIKWASH"
FT   gene            512223..512624
FT                   /locus_tag="A1E_02340"
FT   CDS_pept        512223..512624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02340"
FT                   /product="FeS cluster assembly scaffold IscU"
FT                   /note="COG0822 NifU homolog involved in Fe-S cluster
FT                   formation"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02340"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73413"
FT                   /db_xref="GOA:A8EYI0"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYI0"
FT                   /protein_id="ABV73413.1"
FT                   /translation="MAYSKKVIDHYENPRNVGSLNKESQNVGTGLVGAPACGDVMKLQI
FT                   EVDDNGIITDAKFKTFGCGSAIASSSLVTEWVKGRSINDAETIKNTEIAKELSLPPVKL
FT                   HCSLLAEDAIKAAIADYKQKKQAKNTLKT"
FT   gene            512621..512953
FT                   /locus_tag="A1E_02345"
FT   CDS_pept        512621..512953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02345"
FT                   /product="Iron-sulfur cluster assembly accessory protein"
FT                   /note="COG0316 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02345"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73414"
FT                   /db_xref="GOA:A8EYI1"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYI1"
FT                   /protein_id="ABV73414.1"
FT                   /translation="MKNVISLTDSAAKQIKLLIAKRDKPTFGIRVGVKSGGCAGQTYYV
FT                   EYADSKNQFDEIVEAKGVRILIDPKALMYILGSKMDYVETKFKSQFTFTNPNEKGNCGC
FT                   GKSFSV"
FT   gene            513083..514399
FT                   /locus_tag="A1E_02350"
FT   CDS_pept        513083..514399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02350"
FT                   /product="putrescine-ornithine antiporter"
FT                   /note="COG0531 Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02350"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73415"
FT                   /db_xref="GOA:A8EYI2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYI2"
FT                   /protein_id="ABV73415.1"
FT                   /translation="MSQKLGFWAVFALVTGSQIGTSVFILPLSLAPFGVYSIWGWVLSL
FT                   FGAMSIALVFSCLCAKFPKTGGPHVYVWASFGDKIAFFTGWTYWVISFVSTSIVVISAI
FT                   GYLTPFFKSQAVLDLILQIILLSAILVLNLKGPEVAGKVEFYLTLLKFVPLLVVGLAAL
FT                   SHFNIDNIAIAEEVENLSIPTIMGRVALLTFWGFIGVECATTTAGAVTDPAKTIPRAIM
FT                   LGTLCVAALYIINSIGIMGLIPAAKLIGSKAPYADAATLLFGGKWSSVIAVIASIICIG
FT                   TLNAWVLTSGQIALGLAEDGLLPKFFAKKNSNNAPTYGIIVSCLGIVPLLVFTANDNLA
FT                   AQITQIIDFSVIAFLFVYLICSLAFLKVILSSKEKCSYYYVLIAIISIIFCSWVIYTTP
FT                   VKTIIIATSFTILGIPLYYMWYRSSKQYVAKSSVSPPVT"
FT   gene            514480..516357
FT                   /locus_tag="A1E_02355"
FT   CDS_pept        514480..516357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02355"
FT                   /product="hypothetical protein"
FT                   /note="COG0006 Xaa-Pro aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02355"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73416"
FT                   /db_xref="GOA:A8EYI3"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYI3"
FT                   /protein_id="ABV73416.1"
FT                   /translation="MIKERITLLRSLFTEYNIDGYIIPSNDKYMSEYVPDYAKRLEYIT
FT                   GFTGSNGMVIICKDVALFFTDGRYLEQANKELDLELFKIFDLKDISTLNKDNSERFRQD
FT                   LQNSLVSSFLNYVVGYDSELFTYPAISNLKFKFQKINGNLVDKIWHNQLLEPNSKVYLH
FT                   DIEFAGSSHLEKIKQCRKTLDSLCRVNDNKQGWHHTTVSALVILDSSSICWLLNLRSSD
FT                   VAYTPLMFAKVILTSTKLYLFIAPSRIDADIINARPEITILPEKEFEKILRDSENIFID
FT                   ANIASVYIMDLISDKKVHKITDPCLIQKACKNEIEIKYAIDFHIKDAVALCEFFADFFQ
FT                   CHPCESVDPGKDSMDYRLCGNDIGENWNDSITEYTIGLKLTEYRARQEGYVSDSFPTIC
FT                   GFQENSAIIHYRADPKTAKKIIEQGILLIDSGGQYRGATTDITRTIVIGTPTDEQKKRY
FT                   TQVLKGHIALARAKFPKNIVVGANLDILARQYLWQEMLDYPHSTGHGVGSFLSVHEGPQ
FT                   SINLRNKTVLKAGMILSNEPGFYIPGKYGIRIENLMYVKENSGWLEFETLSLVPYASKL
FT                   IDVKLLNIDEINYIKEYYNKIRDKIYDLLSTQARNWLNNEINLFLQSLL"
FT   gene            516449..516523
FT                   /locus_tag="A1E_t05708"
FT   tRNA            516449..516523
FT                   /locus_tag="A1E_t05708"
FT                   /product="tRNA-Gln"
FT   gene            complement(516641..516717)
FT                   /locus_tag="A1E_t05710"
FT   tRNA            complement(516641..516717)
FT                   /locus_tag="A1E_t05710"
FT                   /product="tRNA-Arg"
FT   gene            complement(516744..517727)
FT                   /locus_tag="A1E_02360"
FT   CDS_pept        complement(516744..517727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02360"
FT                   /product="Octaprenyl-diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02360"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73417"
FT                   /db_xref="GOA:A8EYI4"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYI4"
FT                   /protein_id="ABV73417.1"
FT                   /translation="MNIIVKIQQDLKEEVTKLNNLIISCLKSDEGLIEIVGKYLLEAGG
FT                   KRIRPLLTIITAKMFDYKGDNHIKLASAVEFIHTATLLHDDVVDDSTLRRFKPTANVIW
FT                   GSKTSILVGDFLFSQSFKLMVAAGSIKAMNILAKASAIISEGEVVQLVKLNERRIITID
FT                   EYQQIVKSKTAELFGASCKVGAIIAEQVDHVSKDMQDFGKLLGTIFQVIDDLLDYLGDD
FT                   KQVGKNIGDDFLEGKVTLPLIFLYNTLEQDKQLWLQNVIKCDKRTNEEFIKVRNLMIEH
FT                   EIYNETVNYLSNLENETNKLLNKIPVQNIYKDYLFSIMRFILDRSY"
FT   gene            complement(517839..519500)
FT                   /locus_tag="A1E_02365"
FT   CDS_pept        complement(517839..519500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02365"
FT                   /product="hypothetical protein"
FT                   /note="COG0142 Geranylgeranyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02365"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73418"
FT                   /db_xref="GOA:A8EYI5"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYI5"
FT                   /protein_id="ABV73418.1"
FT                   /translation="MKKTFKIILFISIFIILAYSGLWFAIMLSVSHSINQKYAGTDLNI
FT                   EEADNNPNQQYLIKFSKVQPYGFPFKWGISVINWQEESINRAIEFTSPINIGYNLLKQN
FT                   LFIHFSGEAFGRFKPVQRGFGVRFYNDNCILSAKIPLNFKLFKIVWSKKNLFEIINFIK
FT                   KITFNSGKTEIFDLVDNQKLYEEGHTIFTMLFDKSKYYTNKQDFLENIPQKLEIYYETE
FT                   IIQSNLEDRIIPAGLLLYRLAWNNNFKFSGNFLISTSSLHFKDIAKDLIIEVTNAKINS
FT                   NGFENNINLLYKGKLNDFGNNNIDLLLDTKFKLKHGFIIGLLEVIKKYYDKQDYLFKIS
FT                   DNKIYQGLHNELSYILNNNKQYNFSILEDRQYNFHLNINLVTELNKLTRAQINSLSLYS
FT                   NASGFNITNETIINALKDSYSKGVIIINNYAKIIDVISPYIYGVGNFKNFSEESKKVYG
FT                   DTLKSFLKTISDHPNSSNLIDASIEYVFDLSDLNKAKIGTIDDINKLIPLYYLSLYQAA
FT                   AKKVKPGENIKDKIMELIPNANQKILEQCILDELEL"
FT   gene            complement(519660..521171)
FT                   /locus_tag="A1E_02370"
FT   CDS_pept        complement(519660..521171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02370"
FT                   /product="ADP,ATP carrier protein"
FT                   /note="COG3202 ATP/ADP translocase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02370"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73419"
FT                   /db_xref="GOA:A8EYI6"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYI6"
FT                   /protein_id="ABV73419.1"
FT                   /translation="MLSPKIFFEKVKEIIWPIERNELKLFIPMALMMLCILFNFGALRS
FT                   IKDSLVVPSMGAEIISFLKLWLVLPSCVIFTILYVKLSNKLNFEYIFYVIVGSFLLFFL
FT                   LFAYIIYPNQDIYHPNDEMINNLIASYPNFKWFIKIGSKWSYALMYIFSELWSAVVINL
FT                   MFWQFANHIFDTSKAKRFYPVLGMVGNIGLIIAGSVLVFFSSGHGIIDSELLPDSFNSS
FT                   YQNAIMLQPIMSIIVTAGIIAILLFRIINRLILTDSINVLDVKKVTAKTKTKLSVIESI
FT                   KLVIQSKYIGRIALLIICYGLLINIVEGPWKAKIKALYPNTVDYVNFMGRFNIWMGISC
FT                   VTFMVIGSNILRRLGWLISALLTPIMLSITGLIFFIFIIFIEEIPSYFGVGDFNLLYAA
FT                   IIVGAIQNILSKSSKYSLFDSTKEIAYIPLSLELRTKGKAAVEVIGTKFGKSLGAFIQS
FT                   LIFIIIPNATFDSIIIYLLVIFIVMMSLWIWNVIKLNKEYIELCT"
FT   gene            complement(521420..521797)
FT                   /locus_tag="A1E_02375"
FT   CDS_pept        complement(521420..521797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02375"
FT                   /product="transposase IS200-family protein"
FT                   /note="COG1943 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02375"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73420"
FT                   /db_xref="GOA:A8EYI7"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYI7"
FT                   /protein_id="ABV73420.1"
FT                   /translation="MREIIAVVVEELNVKIENRVISSDHIHIFANIPPHIKVSEFVQKA
FT                   KGRSSKKIQEEFPILRKKYWGRHLWVVREYFSATSGNVTDDMINEYINRHTDAHEPVMT
FT                   TNINFLTCKCLVRKKASVNLG"
FT   gene            522057..523307
FT                   /locus_tag="A1E_02380"
FT   CDS_pept        522057..523307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02380"
FT                   /product="ampG protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02380"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73421"
FT                   /db_xref="GOA:A8EYI8"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYI8"
FT                   /protein_id="ABV73421.1"
FT                   /translation="MLNNSCLCIIWLFGFISGFNLMITGNTLNYWLARENIALQTIGIL
FT                   SFITLPYSINFLLAPVFDALQIKYLNKIFGHRLSWICLTSSALVFLVYIFSFLDPRTNL
FT                   LLFAFTALIISFFSAVQDTILSALRTEIVPKESLVFTSGIYICGYRVGMLLAGSGAIYL
FT                   SIYLTFNAIYKIFAGLVFIYLILLIVGIKYCYLNENNIQIIKNDIKNNQNKKNIINFIY
FT                   NALQPIGSVYFIILILIFLVLYRLPDNLINVMINPFLLHLGYDAFEIASVGKFWGVVGA
FT                   IIGGLVGGVIMKHKNILNSILLFGIIHALGHIVFIFLEINGKSSLLLFITIGIESITGG
FT                   MTMTTYIAFISSLCQGKFRATQYSFLSSMMGISRSIFPIISGYIVVNFGWQNFFLFTTI
FT                   ITIPSLLILLKLKTKLQ"
FT   gene            523773..524414
FT                   /locus_tag="A1E_02385"
FT   CDS_pept        523773..524414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02385"
FT                   /product="Lysine efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02385"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73422"
FT                   /db_xref="GOA:A8EYI9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYI9"
FT                   /protein_id="ABV73422.1"
FT                   /translation="MNNDILSAFLHGIVLALGLIVPLGVQNIFIFNQGAKQPKFSKVLP
FT                   SIIAASICDTILICMAVLGISLLILEISWLKLFIFIVGFIFLIYIGYNTWNQLPIDLTT
FT                   NSQAFSTKKQILFAISVSILNPHAIMDTIVIIGTSALKYNGSAKIIFTLTCILISWIWF
FT                   FSLAVAGYNITKLNKSSTILIMINKIAAIIIWVVAVYIGVQLLHEIGFIN"
FT   gene            524392..525072
FT                   /locus_tag="A1E_02390"
FT   CDS_pept        524392..525072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02390"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73423"
FT                   /db_xref="GOA:A8EYJ0"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYJ0"
FT                   /protein_id="ABV73423.1"
FT                   /translation="MKSVLLTRSLEENRKIIKEMSKSNLDLHYIHCPLIKYKILDFNVN
FT                   ILANYSNIIITSKYAAIIITKHYINQNIWVVGNTSKKLLENKGLKVTYTAKNLEDLIEH
FT                   FPPKLYEQTIYLSSNEITKDLPNEIARHIIYSVEYLNELPVSIIKEFEKNIDFILCYSQ
FT                   NSAKTLVKLLLQNNLLQYVQESLVVAISLKVANIVRPFTKNVVYCDDQNPNDIIKLLSD
FT                   NAKI"
FT   gene            525059..525841
FT                   /locus_tag="A1E_02395"
FT   CDS_pept        525059..525841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02395"
FT                   /product="hypothetical protein"
FT                   /note="COG1279 Lysine efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02395"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73424"
FT                   /db_xref="GOA:A8EYJ1"
FT                   /db_xref="InterPro:IPR022436"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYJ1"
FT                   /protein_id="ABV73424.1"
FT                   /translation="MQKFNSLFKSKNIFFTAIVIFVLSFSTFYHNRADILKLFKSDAKD
FT                   LSQTFYTVEESKLNISEEKNEAPLLSTQSLLNYVSSLKFPEALLPKQKIETIVNAALSG
FT                   YKEQGAKPITNRKVTNGTIGMLKSIDYTADTSKIYTIGYIHYLLNVNLLVYNFMQDKDY
FT                   SKELRIVKSHLLPQDIRNILNNLEAYNNNYLFSKSSSTQVIFPTHHKWLEKFIKIEKKS
FT                   SVMIIKEQDKNLILEKLNYLIDFLYSEKFMQEFINQDV"
FT   gene            525834..526847
FT                   /locus_tag="A1E_02400"
FT   CDS_pept        525834..526847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02400"
FT                   /product="hypothetical protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02400"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73425"
FT                   /db_xref="GOA:A8EYJ2"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYJ2"
FT                   /protein_id="ABV73425.1"
FT                   /translation="MFRLLLICATFLLFYFGFTLIESFDSKVFISLYDYNIETTLFFNL
FT                   ILGLVLLISCFIVIRFLILIIELPSKIHNIFHKRKVNHDRYALILAFAEYIMSNKAKSA
FT                   SIARTNLSSEDLKDSQEFHNLILAVTEEDIDTKISYFQKLMKSKEFAFYGSKNLAKLYY
FT                   DKSLYEEAQNYAIKAYNLNELDSDNLITLMHCYGKLSLWTKFTFITNKLTKFHKYDSIK
FT                   QMHAIVEYYLLAAKQEVESNNIAHAIDYLETAIDLNFYNGELLEFYFTLNNKLNVNKKT
FT                   KILKDAFRIVPSLKLVQLFKKFTSLSDRQIYKELTQELDAKKDEILILAIEAYLEL"
FT   gene            complement(527021..527740)
FT                   /locus_tag="A1E_02405"
FT   CDS_pept        complement(527021..527740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02405"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73426"
FT                   /db_xref="GOA:A8EYJ3"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYJ3"
FT                   /protein_id="ABV73426.1"
FT                   /translation="MPQVYFNGPEGRIEGRYAKATSPNAPIALVLHPHPLYEGNMNNKV
FT                   VYNAYKILADNGYTVLRINFRGVGGSQGKFDNGVGEVVDAGAALDWLQQNNPNAQSSLI
FT                   LGFSFGAWIAMQLVMRRPEINHFIAISPPVNTIHKYDFSFLSPCPIPGFILQGDNDSIV
FT                   SADDVKNLANRLSKQQSHIKVDYKIITGADHFFRYKTEEFAKAIKDYLITIQSNYHHHN
FT                   NNINEETSKNQKKLFLY"
FT   gene            527861..528004
FT                   /locus_tag="A1E_02410"
FT   CDS_pept        527861..528004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02410"
FT                   /product="hypothetical protein"
FT                   /note="COG2945 Predicted hydrolase of the alpha/beta
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02410"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73427"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYJ4"
FT                   /protein_id="ABV73427.1"
FT                   /translation="MYTKINSFDIKIVITRGQGFKKLIELLSTKSPFVKYRDHNLIGNF
FT                   WV"
FT   gene            complement(528159..528599)
FT                   /locus_tag="A1E_02415"
FT   CDS_pept        complement(528159..528599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02415"
FT                   /product="hypothetical protein"
FT                   /note="COG5622 Protein required for attachment to host
FT                   cells"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02415"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73428"
FT                   /db_xref="InterPro:IPR019291"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYJ5"
FT                   /protein_id="ABV73428.1"
FT                   /translation="MVITAPLKLIAVIDSKHMMLYDAQGVKITTNKPLKLSLYLEEHHH
FT                   HRKKRQSFYQNKSTPGSLFEPHTSLREIEHKEAAKSVIKHLEKIARNNQAKYKELIIVA
FT                   EPQILGCIRQELKNGLKKMITKEIAKGLVQHSVDAVERAVFA"
FT   gene            complement(528641..529228)
FT                   /locus_tag="A1E_02420"
FT   CDS_pept        complement(528641..529228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02420"
FT                   /product="scaffold protein"
FT                   /note="COG0204 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02420"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73429"
FT                   /db_xref="GOA:A8EYJ6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYJ6"
FT                   /protein_id="ABV73429.1"
FT                   /translation="MWLAKICCGLKYEVEGLEKLPTTISIVVSNHQSFWDQMFMQLIIP
FT                   KHSWVLKRELFNIPLLGWGLRMVKPIAVDRGTNSSVAQILREGQEKIKEGLWLIIFPES
FT                   TKVPPDRIVKFKPSAVKLASITKVPIVMMAHNAGLFWPRGFWFKQPGTIKVKIIGVIAK
FT                   EEVEQTDVRILNDKVEQIINSEKQKLLGFKNN"
FT   gene            529456..530448
FT                   /locus_tag="A1E_02425"
FT   CDS_pept        529456..530448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02425"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02425"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73430"
FT                   /db_xref="GOA:A8EYJ7"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYJ7"
FT                   /protein_id="ABV73430.1"
FT                   /translation="MKKTVLSGVQATGSLHLGNYLGSIRNWVKMQEEYNCFFFLADLHS
FT                   ITVDIKPSELNNSIMEVIALYIAAGLEADKVTIFAQSMVKEHSELAWLLSCVTSLGWLK
FT                   RMIQFKDKAGSDQEKACLGLFSYPVLMAADILIYKADIVPVGEDQKQHLELTRDIAGMI
FT                   NRKFNKEILKVPEPLINGSGTRIMSLRDGLKKMSKSDISDFSRINLKDDNDLIHQKIKK
FT                   AKTDHLSFVSYDKETRPEISNLLDIYRSLSKESLEKIIANYQNQGFAKFKEDLAEIIIT
FT                   NLQPIRDKYLELMNNKEYLLKILHKGAEKARIRASETVNEVKEQFGFII"
FT   gene            530508..530597
FT                   /locus_tag="A1E_t05712"
FT   tRNA            530508..530597
FT                   /locus_tag="A1E_t05712"
FT                   /product="tRNA-Ser"
FT   gene            complement(531967..532101)
FT                   /locus_tag="A1E_02430"
FT   CDS_pept        complement(531967..532101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02430"
FT                   /product="hypothetical protein"
FT                   /note="COG0180 Tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02430"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73431"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYJ8"
FT                   /protein_id="ABV73431.1"
FT                   /translation="MGIRVALQKDYEKEGLKVENADINIEELSHSQINTNQIQKQVIL"
FT   gene            complement(532198..533103)
FT                   /locus_tag="A1E_02435"
FT   CDS_pept        complement(532198..533103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02435"
FT                   /product="porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02435"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73432"
FT                   /db_xref="GOA:A8EYJ9"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYJ9"
FT                   /protein_id="ABV73432.1"
FT                   /translation="MTHSIRIGTRKSPLALIQTNLVIQQIKQFVPDINYKIVPITTSGD
FT                   LIQNKPLYDIGGKALFLKEIEQALLDKKIDLAVHSLKDVPGRIPEDLIIAAVLEREDPR
FT                   DVFVCLKYKSIEELPQNAIIGSSAVRRKTFIEKIRSDLKVTVFRGNVDSRIKKLMNGEV
FT                   DATILAYAGLKRLNAFNPQYCHLIEYSQMLPCIGQGVIAVEIRKDDNAMLETCNQINHL
FT                   TTFELIKPERAFLEYLDANCRTPIAAYSKYLDKDNIETDFMLGNLESSKITFHTETTNI
FT                   KTSKEAGIKAAKIMLSELER"
FT   gene            complement(533100..533324)
FT                   /locus_tag="A1E_02440"
FT   CDS_pept        complement(533100..533324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02440"
FT                   /product="Microcin C7 resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02440"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73433"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYK0"
FT                   /protein_id="ABV73433.1"
FT                   /translation="MVNISKVSGGNITGKIIGLIIKDFCLKHIQNIEAYTAEGIGHSEI
FT                   NHPIIMNHDVTISDSVLSFTSPFEIIENK"
FT   gene            complement(533531..533659)
FT                   /locus_tag="A1E_02445"
FT   CDS_pept        complement(533531..533659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02445"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73434"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYK1"
FT                   /protein_id="ABV73434.1"
FT                   /translation="MLPLQRFKTLVDVFQVIALAFFVDTKAERESIFKESLGKGTG"
FT   gene            complement(533637..533792)
FT                   /locus_tag="A1E_02450"
FT   CDS_pept        complement(533637..533792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02450"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73435"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYK2"
FT                   /protein_id="ABV73435.1"
FT                   /translation="MNAIDYAIRHDNRQMLNGELTEADNNSYGQGYPDDAQDKLKEAIN
FT                   VTFTKI"
FT   gene            533819..533959
FT                   /locus_tag="A1E_02455"
FT   CDS_pept        533819..533959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02455"
FT                   /product="hypothetical protein"
FT                   /note="COG0181 Porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02455"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73436"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYK3"
FT                   /protein_id="ABV73436.1"
FT                   /translation="MLKIIIFIDKDANLWFDFTSLQGKIVNFDEARKNKNANLALFDFF
FT                   R"
FT   gene            complement(534261..534542)
FT                   /locus_tag="A1E_02460"
FT   CDS_pept        complement(534261..534542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02460"
FT                   /product="alkaline phosphatase synthesis sensor protein
FT                   phor (phor)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02460"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73437"
FT                   /db_xref="GOA:A8EYK4"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYK4"
FT                   /protein_id="ABV73437.1"
FT                   /translation="MIRFNEDQRCNTLEIIATSSIRLNSLINNILDFSKLSSLNYKENI
FT                   NLSKLLYKRIQISKKLYLNSKTLNFTPNIEENIIFNCNPHYIKHTFNN"
FT   gene            complement(536315..536452)
FT                   /locus_tag="A1E_02465"
FT   CDS_pept        complement(536315..536452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02465"
FT                   /product="hypothetical protein"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02465"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73438"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYK5"
FT                   /protein_id="ABV73438.1"
FT                   /translation="MFHGNFIVKYNINFGAFFMYTPFQLLNSGNIQNIQQIPAGYIKRK
FT                   "
FT   gene            complement(536514..537344)
FT                   /locus_tag="A1E_02470"
FT   CDS_pept        complement(536514..537344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02470"
FT                   /product="Glycine cleavage T-protein"
FT                   /note="COG0354 Predicted aminomethyltransferase related to
FT                   GcvT"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02470"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73439"
FT                   /db_xref="GOA:A8EYK6"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYK6"
FT                   /protein_id="ABV73439.1"
FT                   /translation="MYEILSDREVIKIIGLDSVKFLQNLVTNDIKKSKYCYTYLLNNKG
FT                   KYLFDFFVYIHNFEELYLDIDKSNKATLIDHLNFYKFRSKIQIIDCHDKYKVIYSHQKL
FT                   DIDTLVTSRDPRYTKLGFRSIVNRTLKDTLDPLCHSREDKNPIYLEDKYNFAIIDGVED
FT                   LSFNKSIPILYGGEELNGISYYKGCYVGQEVISRAKYQGIIRRKIYKVIADEDLSSLVK
FT                   DEEILADNDTIGIICSSYHNKAIALIRVEKYLAVKESSISVKGISIELSLAPWY"
FT   gene            537460..538251
FT                   /locus_tag="A1E_02475"
FT   CDS_pept        537460..538251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02475"
FT                   /product="hypothetical protein"
FT                   /note="COG1723 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02475"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73440"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYK7"
FT                   /protein_id="ABV73440.1"
FT                   /translation="MIDLVTNLKKIGLEPQHFDDVLYIRKEINKDSDFIEIFFFPFGCV
FT                   TIWGDDEIQEKIILSDTDLVTVNKLKEPVSDYIYCEYNTEVEKTFIDEEKNKIILADKS
FT                   IFVKLSISYALAQSVKLSVLEQSVSNLIIQTTPIQQELARTGSVSLSKKEILQQIGILF
FT                   NERYSISLHSDIFDTPEFFWRRPSYEPLYLMTAEFQDIEIRQNIMNHRLNMIHELLNIL
FT                   SNDLNYKHSTKLEWIIIILIGLEVVLSLSHTNLFLKIIGAL"
FT   gene            538262..539116
FT                   /locus_tag="A1E_02480"
FT   CDS_pept        538262..539116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02480"
FT                   /product="Ribonuclease D"
FT                   /note="COG0349 Ribonuclease D"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02480"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73441"
FT                   /db_xref="GOA:A8EYK8"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYK8"
FT                   /protein_id="ABV73441.1"
FT                   /translation="MQMIDNQKTLEEVCKQLASKTCLSIDTEFERRYTYYAQLSIIQVK
FT                   AENYCGIIDALSNVDLNIFNKLLADNNITKIFHAPREDLEIFYNLFKTLPSNVFDIQIA
FT                   ANICGFGKQLSYDDLCYKLFGIAIDKTHQKSNWLKRPITSDMLNYAMLDVEYLYKIYKE
FT                   LNNIIIRSNLVNKYQTTLGSLLDVRNYKVEPKDAWKKIKYRSDDKSFNRRIQILAAYRE
FT                   KNAQTIDIPRKHFILDEDLIKLCKYSPVTNKDFKNLNLKSKYLYKQKYKDEIISLCNNF
FT                   FML"
FT   gene            complement(539212..539751)
FT                   /gene="hemC"
FT                   /locus_tag="A1E_02485"
FT   CDS_pept        complement(539212..539751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="A1E_02485"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="COG0212 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02485"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73442"
FT                   /db_xref="GOA:A8EYK9"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYK9"
FT                   /protein_id="ABV73442.1"
FT                   /translation="MGMTVIMNKQELRIYFKDLLIKTQEKITSGLVRHSLISKISHLLK
FT                   KLEIQTVGLYYPLKYEINLLEITNLHPEIKFFLPKIIKNEIQYCPYHYKDSLALGNFKT
FT                   FEPINNDLFIPELVIIPGLAFSSDGYRLGYGKGHFDQYLNNNPNILTAGVCLKEQLINN
FT                   FPVESHDIKLKFVISV"
FT   gene            complement(539784..541163)
FT                   /locus_tag="A1E_02490"
FT   CDS_pept        complement(539784..541163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02490"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide dehydrogenase (E3) component, and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02490"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73443"
FT                   /db_xref="GOA:A8EYL0"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYL0"
FT                   /protein_id="ABV73443.1"
FT                   /translation="MQEFDLVVIGSGPAGYTGSIRAAQLNMKVACIEKNDALGGTCLNI
FT                   GCIPSKALLHSSKKYEEALKHFESIGITAEIKLDLQKMLVNKDKLVLNLTKGIESLFAK
FT                   NKVTRIKGEAKIISNNIVEVNNEQIKAKNILITTGSSIIEIPNIKIDEEFIVSSTGALK
FT                   LSKVPENLIVVGGGYIGLELGSVWRRLGAKVIVVEYAASIVPMLDKEIAMQFMKLQQKQ
FT                   GIQFKLNTKVLSAEVKSGKVNLTIEEGGKNVVITSDVVLIAVGRKAYTQNLGLESVGII
FT                   TDKQGRIEINNHFQTTVSNIYAVGDVVKGAMLAHKAEEEAVAAVEIIAGHTGHVNYNLI
FT                   PSVIYTYPEVASVGETEEQLKEKGINYTVGKFPFLANSRARVIGSTEGMVKILADSKTD
FT                   KVLGAHIIGADAGTLIAELTAYMEFGAAAEDIARTCHAHPTLSEAIKEAALSVDKRTIN
FT                   M"
FT   gene            complement(541323..541895)
FT                   /locus_tag="A1E_02495"
FT   CDS_pept        complement(541323..541895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02495"
FT                   /product="biotin synthesis protein BioC"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02495"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73444"
FT                   /db_xref="GOA:A8EYL1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYL1"
FT                   /protein_id="ABV73444.1"
FT                   /translation="MSPLLLDSFNHDRKLLIDDEDLEFPSNSFDLIVYSLGLHWINDVQ
FT                   RFLSNIRTFLKPEGIFIGNFVGGDSLKNLRKVLIEAEIMSNFAHSPHISPFIHFDHVPI
FT                   LFSQTGFAEVIVDYENISLEFDNPLALMREIKNIGESNSLNLRHNYTISKKMFFLLQNY
FT                   TNFFKDNINLISFIASPNKNSIRLKLL"
FT   gene            complement(542226..542864)
FT                   /locus_tag="A1E_02500"
FT   CDS_pept        complement(542226..542864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02500"
FT                   /product="hypothetical protein"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02500"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73445"
FT                   /db_xref="InterPro:IPR024386"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYL2"
FT                   /protein_id="ABV73445.1"
FT                   /translation="MNKNFNIYILRYCYAKINKVFTGRVISISKKSYNLQLKRAKIDYL
FT                   KFLFIEPKLIVCFLILVSTVANADFNNIQENFECQEAQVIIKLPWSDCTKIHKLLEEKL
FT                   SFSEQQIKKEKKIHEKYKQFYLKHNNRANFSMQFLEKKSETNAVETLISGFLKFCKDNF
FT                   QTSNSKSNSLNYHIKKQQEQWFNDMQNENYKIYYRKKYKNDIIRNNFNA"
FT   gene            complement(542885..543652)
FT                   /locus_tag="A1E_02505"
FT   CDS_pept        complement(542885..543652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02505"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73446"
FT                   /db_xref="GOA:A8EYL3"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYL3"
FT                   /protein_id="ABV73446.1"
FT                   /translation="MDSGLRGDDIREVRNNVRKWVHDTIIILILLFSFIFFSKPAIADP
FT                   EIAESFKCSKLFPYFEKKFNIPSNTLHSIALKESGKQHTTHKIRVVWPWTVNVRGKGYY
FT                   FNNKREAVRFVRIELIKGNESIDVGCMQINLRHHLEAFNSLEQAFDPNHNIRYGAKFLR
FT                   SKYDQLGSWHKAIAHYHSANYSLGFQYKQDVVKIASNMALYKASLHSYLKNNEVVVENK
FT                   ISVNNNKVQKKSLFSSNQRYRSSIMIPIPAKIN"
FT   gene            complement(545051..545287)
FT                   /locus_tag="A1E_02510"
FT   CDS_pept        complement(545051..545287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02510"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02510"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73447"
FT                   /db_xref="GOA:A8EYL4"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYL4"
FT                   /protein_id="ABV73447.1"
FT                   /translation="MNKYSLYNFSQDTINEIKQNASEWNLEKPYYDEFFVALPKLVQKF
FT                   DLSEIMIKVDYLGKHVSIFNAVGDLEPYTQLAK"
FT   gene            545454..545579
FT                   /locus_tag="A1E_02515"
FT   CDS_pept        545454..545579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02515"
FT                   /product="hypothetical protein"
FT                   /note="COG0741 Soluble lytic murein transglycosylase and
FT                   related regulatory proteins (some contain LysM/invasin
FT                   domains)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02515"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73448"
FT                   /db_xref="GOA:A8EYL5"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYL5"
FT                   /protein_id="ABV73448.1"
FT                   /translation="MKVVSSLKSLKKRDKDCQIVKRRGKIFVINKKKKRFKAKQG"
FT   gene            545695..546453
FT                   /locus_tag="A1E_02520"
FT   CDS_pept        545695..546453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02520"
FT                   /product="hypothetical protein"
FT                   /note="COG0217 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02520"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73449"
FT                   /db_xref="GOA:A8EYL6"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYL6"
FT                   /protein_id="ABV73449.1"
FT                   /translation="MAGHSKFKNIQYRKGAQDKKRAKIFTKLIREIVTAAKTGSSNNPE
FT                   NNPRLRNALTAARSQNLPKERIDKAINSANDASNTENYMEIRYEGYAPSGIAIIVEALT
FT                   DNKNRTAAEVRSSFTKYGGSLGETGSVNYLFKHCGVIQYLSNIVSSENILEAVMEVDVD
FT                   DITSDDTIHTIYTDIENFSKVLEFLTGKYGIPEDSYIGWIPLNTIIIDDKEKAEKLLKL
FT                   VEVLEESDDVQRVFSNYELSDDVYAIIQGA"
FT   gene            546453..547199
FT                   /locus_tag="A1E_02525"
FT   CDS_pept        546453..547199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02525"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02525"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73450"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYL7"
FT                   /protein_id="ABV73450.1"
FT                   /translation="MTYNNANYQIIILAAGKGTRMESSLPKVMHKVGGVPMLETVLQNS
FT                   LEVTNNVVIVYSEELKKYLTPYENMCRFVLQKEPKGTAHATYAAIDLIDENKIILVLYG
FT                   DHPLITPKLMHELIAYLNLTNSALVTLSFESKNPTWYGRIVTDKNGDFLEIIEYKNANE
FT                   EEKKIKLCNSGIMAFSRGILNQYLPLFATNTTGNKEVYLTEIVKVCKNHGEKVSYLLST
FT                   DHDLIVGVNNKNELEKANNIFSKNNC"
FT   gene            547405..547492
FT                   /locus_tag="A1E_t05714"
FT   tRNA            547405..547492
FT                   /locus_tag="A1E_t05714"
FT                   /product="tRNA-Ser"
FT   gene            complement(547555..547800)
FT                   /locus_tag="A1E_02535"
FT   CDS_pept        complement(547555..547800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02535"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73451"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYL8"
FT                   /protein_id="ABV73451.1"
FT                   /translation="MDNNTTIFIIKTELKDRQYELNQLMSSYDVINDKLSKKLLDFIHV
FT                   TTNVMKPLQVGQWTMDKKRECLNFIFYEPKFERRTP"
FT   gene            548279..548389
FT                   /locus_tag="A1E_02540"
FT   CDS_pept        548279..548389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02540"
FT                   /product="hypothetical protein"
FT                   /note="COG1207 N-acetylglucosamine-1-phosphate
FT                   uridyltransferase (contains nucleotidyltransferase and
FT                   I-patch acetyltransferase domains)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02540"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73452"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYL9"
FT                   /protein_id="ABV73452.1"
FT                   /translation="MWQPIASYNRNDYISAKRINYSHERNMFIGSILKKS"
FT   gene            complement(548565..548828)
FT                   /locus_tag="A1E_02545"
FT   CDS_pept        complement(548565..548828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02545"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73453"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYM0"
FT                   /protein_id="ABV73453.1"
FT                   /translation="MGLHGFDWSDYDIILKLEQVINECKEIKEPNHWKEYRKKIGDVPY
FT                   DNFTMYFSGFDVEETLKLTNEKFSKRMKAIKMLTEKHHLPNL"
FT   gene            549276..549383
FT                   /locus_tag="A1E_02550"
FT   CDS_pept        549276..549383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02550"
FT                   /product="hypothetical protein"
FT                   /note="COG1694 Predicted pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02550"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73454"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYM1"
FT                   /protein_id="ABV73454.1"
FT                   /translation="MQQDGLYEADNYREEVKLVQVSDYKAERIIFEFST"
FT   gene            complement(549394..550422)
FT                   /locus_tag="A1E_02555"
FT   CDS_pept        complement(549394..550422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02555"
FT                   /product="isopentenyl pyrophosphate isomerase"
FT                   /EC_number="5.3.3.2"
FT                   /note="COG1304 L-lactate dehydrogenase (FMN-dependent) and
FT                   related alpha-hydroxy acid dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02555"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73455"
FT                   /db_xref="GOA:A8EYM2"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYM2"
FT                   /protein_id="ABV73455.1"
FT                   /translation="MLKNQDLDIERKQEHIEINLTKNIESTLKSGFESIQFIHNALPEI
FT                   NYDNIDTTTTFLGKALQAPILISSMTGGTARARDINYRLAEAAQKAGIAMGLGSMRVLL
FT                   AAADTIKTFAVRHIAPDILLLANIGAVQLNYGVTPKECQYLVDATKADALILHLNVLQE
FT                   LTQPEGNRNWANLLPKIREVINYLSVPVIVKEVGYGLSKQVAKSLIDVGVKTLDIAGSG
FT                   GTSWSQVEAYRAKNSLQNRIASSFINWGIPTLDSLKMVREISKNVSIIASGGLKSGIDG
FT                   AKAIRMGANIFGLAGQLLKAVDNSEYLVSEEIQLIIKQLKITMLCTGSRTLKDLTKAEI
FT                   KL"
FT   gene            complement(550696..550860)
FT                   /locus_tag="A1E_02560"
FT   CDS_pept        complement(550696..550860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02560"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73456"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYM3"
FT                   /protein_id="ABV73456.1"
FT                   /translation="MIQYRCKAKLQNTTDKLSQVEYINNNLIQNIVYNLKIPFNTICAL
FT                   VAVLHKLRG"
FT   gene            complement(551825..552034)
FT                   /locus_tag="A1E_02565"
FT   CDS_pept        complement(551825..552034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02565"
FT                   /product="hypothetical protein"
FT                   /note="COG0474 Cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02565"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73457"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYM4"
FT                   /protein_id="ABV73457.1"
FT                   /translation="MIKIFLAPRKFRVKPKEIWCQPQKNLDDKIYIIYIDDKGISNKSR
FT                   SSEIFNKIDQDELPSSTEAISNLL"
FT   gene            complement(552374..552449)
FT                   /locus_tag="A1E_t05716"
FT   tRNA            complement(552374..552449)
FT                   /locus_tag="A1E_t05716"
FT                   /product="tRNA-Ala"
FT   gene            complement(552624..553229)
FT                   /gene="clpP"
FT                   /locus_tag="A1E_02570"
FT   CDS_pept        complement(552624..553229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="A1E_02570"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /EC_number="3.4.21.92"
FT                   /note="COG0740 Protease subunit of ATP-dependent Clp
FT                   proteases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02570"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73458"
FT                   /db_xref="GOA:A8EYM5"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYM5"
FT                   /protein_id="ABV73458.1"
FT                   /translation="MSYVPIVIEQTSRGERAYDIYSRLLKERIIFVCSTVEDHMANLIV
FT                   AQLLFLEAENPKKDIYMYINSPGGVVTAGLAIYDTMQYIKPKVATLCIGQACSMGSFLL
FT                   CGGEKGMRYSLPHSRIMIHQPSGGYQGQATDIEIHAQETLKIKRLLNELYSKHTGQDVK
FT                   HIEKSMERDNFMSPEEAKKFGIVDNIISSRNATGLLTK"
FT   gene            complement(553367..555073)
FT                   /gene="rpsA"
FT                   /locus_tag="A1E_02575"
FT   CDS_pept        complement(553367..555073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="A1E_02575"
FT                   /product="30S ribosomal protein S1"
FT                   /note="COG0539 Ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02575"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73459"
FT                   /db_xref="GOA:A8EYM6"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYM6"
FT                   /protein_id="ABV73459.1"
FT                   /translation="MSIKLKQRFVPQLAAINYEFAEDLSKMLETVDTSHIKEKTVVKGQ
FT                   VIEIKNDMVIVDVGLKNEGRILKSEFLSLPEVGDVVEVYIEKIEGRNGKTILSREKAVK
FT                   EELWGQLEIMCSKGEFVDGTIFGRVKGGFTVDLSGVVAFLPGSQVDVRPIKDPTSIMHI
FT                   KQPFKILSMDKKLGNIVVSRRAILEESRAEARDEMLSKIKEGMILEGTVKNITDYGAFI
FT                   DLGSVDGLLHLTDISWGRVNHPSEVLEFNQKVKVMVIKFDEKTKRISLGIKQLDSNPWE
FT                   VIKEEFPVGKKMTGKVTNFADYGVFIELKDGLEGLVHSSEISWLKCNQNPRKTLTIGQE
FT                   VEFVVLEVDTEKHRVSLSIKQCQENPLIKFAENNPVGTVIKAPIRNITDFGIFVALGNN
FT                   MDGMIHEGDISWDNKGMDLLKSYKKGDEIECKVLAINIEKEQVSLGIKQLSQNPYQEIS
FT                   DKYKKGTIVKGLITAIKDDGLEVLLNNEVAGFIKSTELSDEKDEQKPEMFKVDEEIEAK
FT                   VISIEKSTDRILLSVKAHKIAERQTVLKEYGSSDNTTNMGDILANVLEDKK"
FT   gene            complement(555226..555882)
FT                   /locus_tag="A1E_02580"
FT   CDS_pept        complement(555226..555882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02580"
FT                   /product="cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02580"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73460"
FT                   /db_xref="GOA:A8EYM7"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYM7"
FT                   /protein_id="ABV73460.1"
FT                   /translation="MMDLKTKAFDISQNFTISLDGPAASGKGTIGLMLAKKFSLKYFQS
FT                   SIVYRQLTFDCISQKIDITDIDAVIALSKRLKLDNNLDLENENIGDIASQIAVISEVRN
FT                   NLNKYLINLVKTTPRIIMEGRDIGTVVAPDADLKIFITANPDIRAERRYKQLQAKGKAC
FT                   ILDEILQQIILRDKRDKERKVAPLLPASDALIIDTSKLSAIEVVEEITHYMQIIK"
FT   gene            556129..556205
FT                   /locus_tag="A1E_t05718"
FT   tRNA            556129..556205
FT                   /locus_tag="A1E_t05718"
FT                   /product="tRNA-Val"
FT   gene            556444..556833
FT                   /locus_tag="A1E_02585"
FT   CDS_pept        556444..556833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02585"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73461"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYM8"
FT                   /protein_id="ABV73461.1"
FT                   /translation="MQIYHNNSIDELKETYHFFQEEHLGVCQERVRQYIFELQKSGFIQ
FT                   VYNATVVKYGIKCRNNPCIKLARNFQPASNKIPSKNEKILTQPQKSLDHSLYIDNNKNI
FT                   SNKSRYTESTILQNEKDKCSQNAEN"
FT   gene            557416..557580
FT                   /locus_tag="A1E_02590"
FT   CDS_pept        557416..557580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02590"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73462"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYM9"
FT                   /protein_id="ABV73462.1"
FT                   /translation="MIYGNSIGKLHIIAFTELEAKQNNTEDETQNYLSQLSKQFNPDTI
FT                   WYRVRYSVL"
FT   gene            557495..557692
FT                   /locus_tag="A1E_02595"
FT   CDS_pept        557495..557692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02595"
FT                   /product="hypothetical protein"
FT                   /note="COG0283 Cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02595"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73463"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYN0"
FT                   /protein_id="ABV73463.1"
FT                   /translation="MKRKIIYHSSVNNLILIQYGTGCGIQCYNKHIDSSVFSKLVVTEE
FT                   DIDNKKLILKFPHQLSMITM"
FT   gene            557898..558209
FT                   /locus_tag="A1E_02600"
FT   CDS_pept        557898..558209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02600"
FT                   /product="Integrase, catalytic region"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02600"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73464"
FT                   /db_xref="GOA:A8EYN1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYN1"
FT                   /protein_id="ABV73464.1"
FT                   /translation="MAIENIDHTKTKARSPQTNGICERLHRTLKDEFYDIAFCKKIYNS
FT                   LEDLQIDLDQYLNKYNNTRPHSGKFCYGKTPMQTFKDSIKIAKDKSINSYLSDSSFAA"
FT   gene            558971..559678
FT                   /locus_tag="A1E_02605"
FT   CDS_pept        558971..559678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02605"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73465"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYN2"
FT                   /protein_id="ABV73465.1"
FT                   /translation="MKDLKNWQDEFEVCIYAKKLLDKVIYLNSIVKVPPVDVLEVKKAI
FT                   YYARKYHGGQMRQSGELFYSHPIEVAYMVSDYLFRTDILVTSILHDTIEDTELTKEKIL
FT                   QEFGKNIANQVMDLTRIKENGIKISSAEMVEMLYKEKKHDVLLIKLFDRLHNIQTIGAK
FT                   SPEKAKKIVNETLISFIVLMPYLGIPSLEKHFYRLCLHATHKNRLKENTLFTNNLRKFW
FT                   SYFKHNTESINII"
FT   gene            complement(559707..560798)
FT                   /locus_tag="A1E_02610"
FT   CDS_pept        complement(559707..560798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02610"
FT                   /product="hypothetical protein"
FT                   /note="COG0317 Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02610"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73466"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYN3"
FT                   /protein_id="ABV73466.1"
FT                   /translation="MFILETKIEEFILNNSDLKDVHAATIFAFDDQKLIISFFGKTQSE
FT                   SGKSEENNSIWISLGFKKKNHYQWTTPERIISPQYFRDHHIPLKQDNGIISCGNPVITF
FT                   FNNQLLIFSKIGPYPRTWSGILSRSYDRGLTWQKPELLHGILGPARNKPLIYENNILSP
FT                   CSRESCIDDFSYIEYSSDLHTWNLSNPILPFNPQIFQKGYRGFIQPTLVSSNLPNKIIM
FT                   LVRPRKTDSLISTYIHRSISINKGIYWSNLEPVNLLNPDSAIDTINLSSDVLLLAYNRV
FT                   INNHKSRNILSVATSYDEGLNWRPITIRNSIYPEGDIEYSNILSEEYSYPAIIMSPDNN
FT                   EIHVIYTFNRINLKHKVFQLLPK"
FT   gene            complement(560805..562115)
FT                   /locus_tag="A1E_02615"
FT   CDS_pept        complement(560805..562115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02615"
FT                   /product="Proline/betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02615"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73467"
FT                   /db_xref="GOA:A8EYN4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYN4"
FT                   /protein_id="ABV73467.1"
FT                   /translation="MIEYTKHNEGTFTSLTTEQKKAVGLLSIGTFLEYFDLMLYVHMTV
FT                   LLNELFFPKADPHTQAIYSAFAFCSTYVMRPVGAIIFGLVGDIIGRKATVIITTFLMSS
FT                   SCLAMALVPTYAEKGLIATVIVITCRIIQGLSSMGEIVGAQLYLLEITKPPIQYPIVLM
FT                   TSVFANLGGMIALAVASLVTSFGFNWRIAFWLGTIIAIVGAVARTALRETPEFADAKRR
FT                   VKKNITLIQKTTDNPLKDNLIYNERVNLKTFFFLLLISCGWPICFYFTYIYCGEILKNS
FT                   FNFTAEAVIHNNFIVAIVNFCAYLILTYLSYIIYPLRILKIKLVIFFIFALICPYLLNN
FT                   ITTSVHLFLIQSFVMLFFLSANPAMPIFLKHFPVFKRFRTASIIFALSTVSMNIIISFG
FT                   LVYLTKYFSHWGMQIILFPIIIGFTLGLNYFNNLEKK"
FT   gene            complement(562214..562435)
FT                   /locus_tag="A1E_02620"
FT   CDS_pept        complement(562214..562435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02620"
FT                   /product="Conjugal transfer protein TraD"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02620"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73468"
FT                   /db_xref="GOA:A8EYN5"
FT                   /db_xref="InterPro:IPR009444"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYN5"
FT                   /protein_id="ABV73468.1"
FT                   /translation="MEEAKLKIQERKTRTRHLIEMGGLVVKVKLDCLPTSSLLGALVSL
FT                   QSELTENPSIQDQWTQIGKNIFDNHELR"
FT   gene            563083..563202
FT                   /locus_tag="A1E_02625"
FT   CDS_pept        563083..563202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02625"
FT                   /product="Conjugal transfer protein TraA"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02625"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73469"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYN6"
FT                   /protein_id="ABV73469.1"
FT                   /translation="MPAHVDQKFKAQRVLMNKVERLETRKNSQLLKDVVYSTT"
FT   gene            563202..563384
FT                   /locus_tag="A1E_02630"
FT   CDS_pept        563202..563384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02630"
FT                   /product="Conjugal transfer protein TraA"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02630"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73470"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYN7"
FT                   /protein_id="ABV73470.1"
FT                   /translation="MIKLDLDDRIAITHEIIEEMGWVKNGLGVQIDIHQLHDGEKNWHA
FT                   HVLVTTRRFTKDVRQ"
FT   gene            563521..563775
FT                   /locus_tag="A1E_02635"
FT   CDS_pept        563521..563775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02635"
FT                   /product="Conjugal transfer protein TraA"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02635"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73471"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYN8"
FT                   /protein_id="ABV73471.1"
FT                   /translation="MPQQHVGPTRIRSIINAISEQNKICRLAHLEIIKGTDGVLDCIIH
FT                   HQAIFTKLDIEKAVKEMLAEAEKSKLIREVLNSDRLIKL"
FT   gene            564150..564296
FT                   /locus_tag="A1E_02640"
FT   CDS_pept        564150..564296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02640"
FT                   /product="Conjugal transfer protein TraA"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02640"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73472"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYN9"
FT                   /protein_id="ABV73472.1"
FT                   /translation="MYNGKAELPRNTTLVVDEAGMVGNSDYLELLKVARSNNCNVILAG
FT                   GER"
FT   gene            564286..564438
FT                   /locus_tag="A1E_02645"
FT   CDS_pept        564286..564438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02645"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73473"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYP0"
FT                   /protein_id="ABV73473.1"
FT                   /translation="MRDNSLQLSEEEYLQYLQVGLAQVTLEDKARYEQKKWLHALQNQI
FT                   LLGGL"
FT   gene            564556..564789
FT                   /locus_tag="A1E_02650"
FT   CDS_pept        564556..564789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02650"
FT                   /product="Conjugal transfer protein TraA"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02650"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73474"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYP1"
FT                   /protein_id="ABV73474.1"
FT                   /translation="MHNIEVDSINQGIRKLLKAKALLTGQEYRRYVSPKKYEDYMAGDR
FT                   ILFNITNKDLQIENGEFATITSVSNDKFVAKR"
FT   gene            565561..566427
FT                   /locus_tag="A1E_02655"
FT   CDS_pept        565561..566427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02655"
FT                   /product="Conjugal transfer protein TraA"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02655"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73475"
FT                   /db_xref="GOA:A8EYP2"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYP2"
FT                   /protein_id="ABV73475.1"
FT                   /translation="MKINGNKAGIWHDFSTGNGGDLFTLVQRETNCDFVEAKKYLQDMV
FT                   GISSTNKSKDIAVNLAANKNQQIKTPAAQGDKIVKIKRAEILYEKSDALKYVMPSHVAK
FT                   RYLSEHCEIKEVLTRYQLSFDLSTNMMWDSHSKQYYPVLIAFARNKDGNITAGQSIYLN
FT                   KDTNNKADIDVNKRSFGRIRGSFVEINKNNEQQNVQISKDGSNSTNNVTIIAEGLETAL
FT                   SIVEAGIKGKILCSLGVSNIRNYKPLKGERIIIAADNDAKEAVSVYTIIKAQDELISKG
FT                   AAVAIIY"
FT   gene            complement(566393..566539)
FT                   /locus_tag="A1E_02660"
FT   CDS_pept        complement(566393..566539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02660"
FT                   /product="Putative conjugative transfer protein TraD"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02660"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73476"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYP3"
FT                   /protein_id="ABV73476.1"
FT                   /translation="MVYKNNKASNICFSGLPLLKDSERTHILITGTTGSSKTNILLLPL
FT                   LLC"
FT   gene            complement(566600..566956)
FT                   /locus_tag="A1E_02665"
FT   CDS_pept        complement(566600..566956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02665"
FT                   /product="Putative conjugative transfer protein TraD"
FT                   /note="COG0358 DNA primase (bacterial type)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02665"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73477"
FT                   /db_xref="GOA:A8EYP4"
FT                   /db_xref="InterPro:IPR022585"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYP4"
FT                   /protein_id="ABV73477.1"
FT                   /translation="MIGVVSVLAWLMLRTFQKLSLLSLYYFIIERYVQLKLAIGQYFYP
FT                   LEQIGIKFYYIEQKAWGYRNAKEFIHKFWHVTLHSHNINEFEQFLLHPALQEAVVAFTI
FT                   GIFTVIIFFIYRVK"
FT   gene            complement(567115..567324)
FT                   /locus_tag="A1E_02670"
FT   CDS_pept        complement(567115..567324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02670"
FT                   /product="Tetratricopeptide repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02670"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73478"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYP5"
FT                   /protein_id="ABV73478.1"
FT                   /translation="MPNSYLEKAITVVNLNKHKEAKENFNLALKYKPNLIVEYEAIINA
FT                   LRKLGNNLRANEFEEKLKILKNYL"
FT   gene            complement(567420..567593)
FT                   /locus_tag="A1E_02675"
FT   CDS_pept        complement(567420..567593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02675"
FT                   /product="Tetratricopeptide repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02675"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73479"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYP6"
FT                   /protein_id="ABV73479.1"
FT                   /translation="MKIIEKQFMQNIKKSAVLFILPLMFFNIASAANSTNSVNKQPQID
FT                   PQSKIQDPNIFS"
FT   gene            complement(567678..567809)
FT                   /locus_tag="A1E_02680"
FT   CDS_pept        complement(567678..567809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02680"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73480"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYP7"
FT                   /protein_id="ABV73480.1"
FT                   /translation="MLIQRVDNNEVEKVKLLDQLSATVKDKKRKLKMNLIIFLNQQL"
FT   gene            complement(568354..568881)
FT                   /locus_tag="A1E_02685"
FT   CDS_pept        complement(568354..568881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02685"
FT                   /product="Conjugative transfer protein TraG"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02685"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73481"
FT                   /db_xref="GOA:A8EYP8"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYP8"
FT                   /protein_id="ABV73481.1"
FT                   /translation="MNEYINNHIEKLIRQLLLLILASIKGLCAYATTTLANQFSLVPVA
FT                   SNIGASITDNNLAMDNYSIGNRSIAQQNLAPTLQMVGGIIDAGGMSGRQVLTQAANSLI
FT                   NNYRSSKLLQDNSYQSQFMSLQSYLDSLNNRYSDLTTTGNSIATEIKKNTGTSANIGLK
FT                   IPSIGEVNSTSR"
FT   gene            complement(569712..569855)
FT                   /locus_tag="A1E_02690"
FT   CDS_pept        complement(569712..569855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02690"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73482"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYP9"
FT                   /protein_id="ABV73482.1"
FT                   /translation="MPEDYLAAIGKEKQVMQYYKPKLRNRQSYKSKINKCSEMKINQEI
FT                   RV"
FT   gene            complement(570724..570942)
FT                   /locus_tag="A1E_02695"
FT   CDS_pept        complement(570724..570942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02695"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02695"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73483"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYQ0"
FT                   /protein_id="ABV73483.1"
FT                   /translation="MIYKKIYYSLVGNTTIKLKEEAMNDQNKIYSKQDITALKKKLSYK
FT                   ATEIGTALLGRPNDSLSNNYYLHWGRR"
FT   gene            571020..571616
FT                   /locus_tag="A1E_02700"
FT   CDS_pept        571020..571616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02700"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73484"
FT                   /db_xref="GOA:A8EYQ1"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYQ1"
FT                   /protein_id="ABV73484.1"
FT                   /translation="MSKILNNDRLYLLLTFVLFVLTLLLNFYSKISYCSLIFTFLAFTV
FT                   NIISESQGYKKAIKSVILCTSASFAFAILYNMKYYIYGEPLTGLIFASLLSVFISSYIS
FT                   LIFFLKRKLQHSFLTRNFKSLLSHAFIDGLVMSIFFTSKFPMHRVLSIFYKETAYKLVY
FT                   SCLLHLFILTTFYLLKQVKVSREYLSGLNITQLNN"
FT   gene            complement(571895..572290)
FT                   /locus_tag="A1E_02705"
FT   CDS_pept        complement(571895..572290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02705"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02705"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73485"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYQ2"
FT                   /protein_id="ABV73485.1"
FT                   /translation="MQIVLIKSRGTLDNLCKHIDHEKSIKQTLEKDFINDIKDKETTII
FT                   ADDPRGYGQITSLTKLCTLQYDLWSEVKSMFQSYWVISADLKDHISTIGRTNSSNIKID
FT                   DIINLWLESDSDTTCLMQPLLFIALTL"
FT   gene            complement(573827..574039)
FT                   /locus_tag="A1E_02710"
FT   CDS_pept        complement(573827..574039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02710"
FT                   /product="Putative conjugative transfer protein TraD"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02710"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73486"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYQ3"
FT                   /protein_id="ABV73486.1"
FT                   /translation="MLGKQEIIETQEKSSHTELTSMRDGVNMNHLERRKLLVMPSEIMN
FT                   LPDLTCYVNLAGNVPITKLQINLQT"
FT   gene            complement(574374..574595)
FT                   /locus_tag="A1E_02715"
FT   CDS_pept        complement(574374..574595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02715"
FT                   /product="F pilus assembly protein TraB"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02715"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73487"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYQ4"
FT                   /protein_id="ABV73487.1"
FT                   /translation="MIRLVDTANFSKRYKTKQIKEVILIGSCSGDISSERAKCYLETVS
FT                   FINNKGEIIKKNVEGWLIGRRYGKGHSS"
FT   gene            complement(574965..575180)
FT                   /locus_tag="A1E_02720"
FT   CDS_pept        complement(574965..575180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02720"
FT                   /product="hypothetical protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02720"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73488"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYQ5"
FT                   /protein_id="ABV73488.1"
FT                   /translation="MIRYLIVLFVSIALIGCNGQKTTQSKEVVELDGDPNYLIMKTIDN
FT                   TNRNIYNTTSQIPSTPVSIGRLFIIS"
FT   gene            complement(575746..575892)
FT                   /locus_tag="A1E_02725"
FT   CDS_pept        complement(575746..575892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02725"
FT                   /product="hypothetical protein"
FT                   /note="COG0776 Bacterial nucleoid DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02725"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73489"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYQ6"
FT                   /protein_id="ABV73489.1"
FT                   /translation="MVTKEDVKKSVDLILDYLSFQDQKRIAIRNFSNVSICKIYYQMPK
FT                   NLK"
FT   gene            complement(575892..576809)
FT                   /gene="cmk"
FT                   /locus_tag="A1E_02730"
FT   CDS_pept        complement(575892..576809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="A1E_02730"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="COG0616 Periplasmic serine proteases (ClpP class)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02730"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73490"
FT                   /db_xref="GOA:A8EYQ7"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYQ7"
FT                   /protein_id="ABV73490.1"
FT                   /translation="MNISSDYLIERRQIKSRLLIWKLAAIILIAIIFLLVGKDFAPKEI
FT                   FPITGNEDYIASILIDEIIFEDEKRDKKLKKIIDDSHIKALIVNVNSPGGTVVGSEKIY
FT                   NILRKISEKKPVVIVMGTMATSGGYLISLGGDYIISHNGTITGSIGVILQTAEITELAQ
FT                   KLGIKFNNFKSGELKAAPNPTEKLTQAVRIAIMENIEDTYDFFLELVSERRNLPIEEVK
FT                   KLADGRVYSGRQALKLKLVDSIGSEDTALKWLQEVKKINTNLLVKDYPLKAKPKLVEMI
FT                   FEDFGSITPNFFKNNLNGIKAIFQ"
FT   gene            complement(577054..578430)
FT                   /locus_tag="A1E_02735"
FT   CDS_pept        complement(577054..578430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02735"
FT                   /product="transcription termination factor Rho"
FT                   /note="COG1158 Transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02735"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73491"
FT                   /db_xref="GOA:A8EYQ8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYQ8"
FT                   /protein_id="ABV73491.1"
FT                   /translation="MNTTNKKSTEELNNSESNNNHNNFAENGNIINLKQLKRKLPEELQ
FT                   VQAEELKIENINSLLKQELVFAILKKSVEQGGLIVGEGVLEVLPDGFGFLRSPEVNYLA
FT                   GPDDIYISPSQIRRFGLRTGDTVEGQIRAPKAGERYFALLKVNRVNFEDPSKAYHRVHF
FT                   DNLTPLYPDKKLGLELENNSKDTKDFSTRVIELVAPMGKGQRALIVAPPRTGKTVLLQN
FT                   IAHAITTNNPEVFLIVLLIDERPEEVTDMQRSVRGEVVSSTFDEPASRHVQLAEMVIEK
FT                   AKRLVEHKKDVVILVDAITRLARAYNTVVPSSGKVLTGGVDANALQRPKRFFGAARNIE
FT                   NGGSLTIIGTALIETGSRMDEVIFEEFKGTGNSEIVLDRKIADKRIYPAIDITRSGTRK
FT                   EDLLVDKIILNKMWVLRRIIDPMGSSEAIEFLLKKLENTKTNGEFFEMMKSPERPKNGL
FT                   "
FT   gene            complement(578946..580268)
FT                   /locus_tag="A1E_02740"
FT   CDS_pept        complement(578946..580268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02740"
FT                   /product="Putative methyltransferase"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02740"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73492"
FT                   /db_xref="GOA:A8EYQ9"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYQ9"
FT                   /protein_id="ABV73492.1"
FT                   /translation="MHNTKKTKNTTISKDLAEVQEHYQDYPYPFRDPNQEKERLLVICG
FT                   EFLGELNHFLYKGKENFNNNFRCLIAGGGTGDSTIYLAEQLKDKNAEIIYLDFSKPSME
FT                   VAQKRAEVRGLKNIQWINDSILNIPNLKLGKFDYINCTGVLHHLVNPDAGLKNLKDSLK
FT                   PTGGMGLMVYAKYGRTGVYQIQDLMKMINKDTKSRVEEVMNGKLILDNLPATNWYKRGC
FT                   ELFSDYQNFGDVGVYDMFLHKQDRAYSVPELYEFVEKAGLNFVDYLDPLEKILLRPENY
FT                   IKDFSLLQKVKKMDKVTREAISEILTGNIIKHSFYVSNQKDSVASLDDLDNTPYFYNIA
FT                   NFAKQIYEHLEANPSTINGAINFTINNGVLNNVNISMSIFRSTKYIFKYIAEEKSLREI
FT                   FDAVRSELNQEISNEALLNEVKNVFTPLLNTNLLLLKSKDL"
FT   gene            complement(580278..582035)
FT                   /gene="rho"
FT                   /locus_tag="A1E_02745"
FT   CDS_pept        complement(580278..582035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="A1E_02745"
FT                   /product="transcription termination factor Rho"
FT                   /note="COG0608 Single-stranded DNA-specific exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02745"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73493"
FT                   /db_xref="GOA:A8EYR0"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYR0"
FT                   /protein_id="ABV73493.1"
FT                   /translation="MKPRASINGKIWQQKVINEDIVMELCRSFKISDLLARIVSLRVNN
FT                   LAEVENFLIPKIKNLLPDPFHLLDMAKAVDRTVKAILNNQKICIFADYDVDGATSAALL
FT                   KNIFRDLNIICDIYVPDRIAEGYGPTPFAIQKIKDNSTELLITVDCGTMAHEALKYAKD
FT                   ISLDVIVIDHHIATEILPDAVAIINPNRIDEKSEYKHLAAVGVAFLFATAILSNLKQQN
FT                   YFTKSPQPNLINYLDLVALGTVCDMVKLTGINRAFVASGLKVMQQRQNIGIKTLYDIVG
FT                   LNEIPKCYHLGFILGPRINAGGRVGKSSLGANLLSTSCSNEASKLAEELEKHNNERKLI
FT                   ELLMIEEAMEIAWTQQDSSLLFIVKEGWHPGVIGIVAGRLKEKFDKPVAVVALNDGIGK
FT                   ASCRSITGIDFGAEIINAKNHGLLIAGGGHTMAAGFTVTAEKLQELQEFLNNAFRTSIN
FT                   KLENYKQVEYDLDLSLNSINLHLMEELSSIEPFGQGNHEPIFKFDNLFVLKAYIVGSKH
FT                   IKALLVHNTQGSGSKALSAIAFNSVGTAFEEVLLSPKAKNIAAIGTLRTSNWQDNYTIQ
FT                   LIIKDIITT"
FT   gene            complement(582212..583279)
FT                   /gene="prfA"
FT                   /locus_tag="A1E_02750"
FT   CDS_pept        complement(582212..583279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="A1E_02750"
FT                   /product="peptide chain release factor 1"
FT                   /note="COG0216 Protein chain release factor A"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02750"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73494"
FT                   /db_xref="GOA:A8EYR1"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYR1"
FT                   /protein_id="ABV73494.1"
FT                   /translation="MSFSDNLAKIVDKYENLGKKLSSGIMGDEFVKASKEYAELEEVVE
FT                   KIKEYNKAKSELEEANNFKLEVGLDNATLEMIEDEIHTLENSLPKLERAVKIALLPKDE
FT                   ADSKSAIIEVRAGSGGEEAALFAAILFNMYQRYAELKGWHFEILAIVDTGIGGYKEASA
FT                   SIKGKDVFSKLKCESGVHRVQRIPETESHGRIHTSAATVAVLPEVEDVDIKLEDKDLRI
FT                   DTYRSSGAGGQHVNTTNSAVRITHIPTGITVALQDEKSQHKNKAKALKILRARIYEEER
FT                   RKKEQKRANNRRGQVGSGDRSERIRTYNFPQGRVSDHRINLTLYKIDEVVKNGQLDEFV
FT                   DALIADDEAKKLAEI"
FT   gene            complement(583562..584818)
FT                   /locus_tag="A1E_02755"
FT   CDS_pept        complement(583562..584818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02755"
FT                   /product="branched-chain alpha-keto acid dehydrogenase
FT                   subunit E2"
FT                   /note="COG0508 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide acyltransferase (E2) component,
FT                   and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02755"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73495"
FT                   /db_xref="GOA:A8EYR2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006257"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYR2"
FT                   /protein_id="ABV73495.1"
FT                   /translation="MPIKILMPALSPTMTEGNLSRWLKNEGDKVNPGEVIAEIETDKAT
FT                   MEVEAVDEGILAKIVIPQNSQNVPVNSLIAVLSEEGEDIDDINGFIAKNSSVLPSLKAD
FT                   ADANLLKSTEDIAVQYSNVEEQVAVTNHNKSKIFASPLAKRLAKIQNIRLESVKGSGPH
FT                   GRIIKQDILSYTPSTVPNKIVIRNPEEYHLVPNNNIRKIIAKRVLESKQAVPHFYLSIE
FT                   CNVDKLLEIREDINKSFSEDNSTRISVNDFIILAIAKALQEVPNANASWGKDAIRYYNN
FT                   VDIAVAVAIENGLVTPIVKNADQKNIIELSHEMKELIKKAKDNKLTPEEFQGGGFTISN
FT                   LGMYGIKNFNAIINPPQSCIMGVGSSSKRAIVKNDQINIATIMDVTLSADHRVIDGVVG
FT                   AEFLAAFKKFIERPALMLL"
FT   gene            complement(585057..585500)
FT                   /locus_tag="A1E_02760"
FT   CDS_pept        complement(585057..585500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02760"
FT                   /product="translation initiation factor IF-3"
FT                   /note="COG0290 Translation initiation factor 3 (IF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02760"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73496"
FT                   /db_xref="GOA:A8EYR3"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYR3"
FT                   /protein_id="ABV73496.1"
FT                   /translation="MHGIVNIREALDMADKVGLDLVEISPNAEPPVCKILDFGKFKYES
FT                   KKRLHEARKKHKIVVLKEMKFKPNISIGDFETKLRKIKEFLKDGNKVKISLWFKGREIL
FT                   HKEVGQELFKRIEIGLEGLVKIDQHAKMEGKQMIMIISPDIKV"
FT   gene            complement(585675..586010)
FT                   /locus_tag="A1E_02765"
FT   CDS_pept        complement(585675..586010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02765"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02765"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73497"
FT                   /db_xref="GOA:A8EYR4"
FT                   /db_xref="InterPro:IPR019284"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYR4"
FT                   /protein_id="ABV73497.1"
FT                   /translation="MKETKRFFNKNNRLNKGYAKTFSVNEPDNNFYHKKFAHILPPIDL
FT                   ISEYENIYPGTLQELIHMAQKEQAHKHAIDLKNLKMQERVVKLTRICLLIFGICLVVSI
FT                   FFLKLST"
FT   gene            complement(585997..586170)
FT                   /locus_tag="A1E_02770"
FT   CDS_pept        complement(585997..586170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02770"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73498"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYR5"
FT                   /protein_id="ABV73498.1"
FT                   /translation="MKKNFIKLVYAELKNIINIKSSKQQQKKETQLIDYFKVVESNILY
FT                   TFQKIKKEYERD"
FT   gene            complement(586361..586615)
FT                   /locus_tag="A1E_02775"
FT   CDS_pept        complement(586361..586615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02775"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02775"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73499"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYR6"
FT                   /protein_id="ABV73499.1"
FT                   /translation="MYIQNYDLSLKIHLKPETVKYNYSKTCRAIFRDNKCNIDKVYIGL
FT                   YKVKEILKKSLRILALVKKTAIITAVKSYSARIVLVLEF"
FT   gene            complement(586909..587097)
FT                   /locus_tag="A1E_02780"
FT   CDS_pept        complement(586909..587097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02780"
FT                   /product="hypothetical protein"
FT                   /note="COG5346 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02780"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73500"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYR7"
FT                   /protein_id="ABV73500.1"
FT                   /translation="MSQENNNPSYMSQAFLKNAYEQLNEFKKLSYENNIRTLMEDRNNK
FT                   VDKTFKCALFTVNNLKV"
FT   gene            complement(587181..587960)
FT                   /locus_tag="A1E_02785"
FT   CDS_pept        complement(587181..587960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02785"
FT                   /product="biotin--protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02785"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73501"
FT                   /db_xref="GOA:A8EYR8"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYR8"
FT                   /protein_id="ABV73501.1"
FT                   /translation="MNIGKFKLIVFDEIDSTNSEAIRIAKSNKVDSNYALLAKSQTKGR
FT                   GRSSKNWQSRSGNLHVSLLIKPDKELELLSQLSFVTALAVYDSMSSSRDRVAGSSNYMD
FT                   ILVKPWYDSLKLKWPNDVLVNGRKIAGILLESVKVGDNYYIIIGIGINITYHPIDIDQP
FT                   TTSLISENLPLIEPQALLKILIENFEKYYQIWDNNSFSFIREKWLEHAYKLHENISIKQ
FT                   KNDIVTGLFKDIDNTGRIILQLPSKKIMSFSTAELSF"
FT   gene            589016..589189
FT                   /locus_tag="A1E_02805"
FT   CDS_pept        589016..589189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02805"
FT                   /product="hypothetical protein"
FT                   /note="COG0340 Biotin-(acetyl-CoA carboxylase) ligase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02805"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73502"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYR9"
FT                   /protein_id="ABV73502.1"
FT                   /translation="MTSFVLNSGSLSLKYFVGILSKYPPSIYCLPLISTGSKTRGIETE
FT                   ARHAKAISTLGV"
FT   gene            complement(589885..590514)
FT                   /locus_tag="A1E_02815"
FT   CDS_pept        complement(589885..590514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02815"
FT                   /product="Superoxide dismutase"
FT                   /note="COG0605 Superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02815"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73503"
FT                   /db_xref="GOA:A8EYS0"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYS0"
FT                   /protein_id="ABV73503.1"
FT                   /translation="MVYCNKSNQTSYPFILPDLPYDKESFKPHFTHETFDYHHGKHHNA
FT                   YVQNLNNLLKDKEELQKKDLEEIIEWSSQNSNTAIFNNAAQIWNHTFFWYSIKPQGGGK
FT                   PSGKILEQINKDFSSFEEFCQQFKQDAVGQFGSGWTWLVYHNNGLQIIKTANAGTPIAN
FT                   GMKPLLACDVWEHAYYIDYHNKRSDYVDIFIKHMINWQFVEDNLIK"
FT   gene            complement(590605..591909)
FT                   /locus_tag="A1E_02820"
FT   CDS_pept        complement(590605..591909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02820"
FT                   /product="folylpolyglutamate synthase"
FT                   /EC_number="6.3.2.17"
FT                   /note="COG0285 Folylpolyglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02820"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73504"
FT                   /db_xref="GOA:A8EYS1"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYS1"
FT                   /protein_id="ABV73504.1"
FT                   /translation="MLMPHFPVPTWKNNIKYDLENIARLLKALGDPHLRLPPIIHIAGT
FT                   NGKGSSAAMLKSIFTLNDYKVHCYTSPHLLEFNERIVVAGEKISDNELWQVCEQVRIAS
FT                   EKFNIEPSFFEGTTAAAFLAFAGTKADILILEAGLGGRLDATNIVERPLITLITPISYD
FT                   HMNVLGNTLSLIAVEKAGIMKRFVPCVISIQALEVYETLFIKAEELEVPSFCYEYDFGI
FT                   KKTDNGFIYSSQNVTYEFPIPSLLGDHQLINAASVIALISLINKKFNISNTIIAKGLQN
FT                   TVWSARIEKIEPKKYSKLIGDNVQIWVDGAHNNSGAQVLASWIRYNLKPPIYLILGMTK
FT                   NRNVEEFCSYFRGLKIKGYGIKVLSEPLSHSAEIINSEGKKSGIDFSASDSIEEAISDI
FT                   KKINGDNKANIIITGSLLLASDFYKLLRGVCHTAA"
FT   gene            complement(591911..592471)
FT                   /locus_tag="A1E_02825"
FT   CDS_pept        complement(591911..592471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02825"
FT                   /product="BioY family protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02825"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73505"
FT                   /db_xref="GOA:A8EYS2"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYS2"
FT                   /protein_id="ABV73505.1"
FT                   /translation="MQLNLISLPFIQRQAIEIVLGVALLAICSQIIIPIKPIFISLQTV
FT                   AVMFIGLTYNKTTAPLTILSFITLGVIGIPVFGNFSSGLQTLFGPTGGYLVGFLLAVYV
FT                   MARLKDKIFTSNKCLNQISLCLIGNIIIMSFGWVWLSKFLGASAAFYGGVLPFIIPGII
FT                   KSVLLIGLINVVKSNKLGSNRNK"
FT   gene            592724..593053
FT                   /locus_tag="A1E_02830"
FT   CDS_pept        592724..593053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02830"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73506"
FT                   /db_xref="InterPro:IPR015834"
FT                   /db_xref="InterPro:IPR019197"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYS3"
FT                   /protein_id="ABV73506.1"
FT                   /translation="MYYVQKLQGKGNARIQSYLKNGGDFLGICAGSYYSGNYLEFAKGT
FT                   NIEVICERELKIFNRAVRGLLLAPYYYNSHKGARAAYLKINSKLKLNIKIKDGYIFYNG
FT                   GGYFC"
FT   gene            593121..593249
FT                   /locus_tag="A1E_02835"
FT   CDS_pept        593121..593249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02835"
FT                   /product="hypothetical protein"
FT                   /note="COG4285 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02835"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73507"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYS4"
FT                   /protein_id="ABV73507.1"
FT                   /translation="MCNMDNGTDIISVVHLEYDPALIKNQSLNKICKILKAIIRKE"
FT   gene            complement(593268..593936)
FT                   /gene="infC"
FT                   /locus_tag="A1E_02840"
FT   CDS_pept        complement(593268..593936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="A1E_02840"
FT                   /product="translation initiation factor IF-3"
FT                   /note="COG0625 Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02840"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73508"
FT                   /db_xref="GOA:A8EYS5"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYS5"
FT                   /protein_id="ABV73508.1"
FT                   /translation="MRKLYHYPICPLSRQARVFLKELEIEFTTIKEDYWQFNKDFLQIN
FT                   PSGTLPVLEESYGLFVIGIYPFVEYLNSKYPNFNFLDENIDICTEIRRLFFWFNDKFYR
FT                   EVTKIIIDEKVIRSIAKISSPRTEFLRAAKNNLNYHLEYITSLLEKRSYIVSDSLTIAD
FT                   IAASCHLSVLDYFGEIFWDKWTLIKHWYSLIKSRPSFRLLLQDRIPGFTPPSYYIDLDF
FT                   "
FT   gene            594669..597305
FT                   /locus_tag="A1E_02845"
FT   CDS_pept        594669..597305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02845"
FT                   /product="pyruvate phosphate dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02845"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73509"
FT                   /db_xref="GOA:A8EYS6"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYS6"
FT                   /protein_id="ABV73509.1"
FT                   /translation="MKKLIYYFGSNGSDGNASMKNILGNKGAGLAEMSNLKLPIPDGFT
FT                   ITTELCNYFYTHNNNFPKNFQSDLKKAITELEITTGKIFGSTSNPLLLSVRSGAMVSMP
FT                   GMMDTILNLGMNNEVCNALANSCGNKRFALDSYKRFLEMYGSTVLSIPSDLFEQIYEKH
FT                   KIQADIYKNSDITIELLEKIIDDFKRLHIKYNKQLINDPYEQLESAIKAVLHSWMSNRA
FT                   VIYRKINNISEDCGTAINIQAMVFGNLGKNSATGVAFTRSPSTGEKKLFGEFLINAQGE
FT                   DIVSGTRTPMPIIAADANSMQTMMPKVFKELSQIAKKLEEHYLDMQDIEFTIENNKLYI
FT                   LQTRTAKRTAIAAINIAVQMVEEKLISKEQALMRIDPESLNQLLHTRIDYSKGITSIAE
FT                   GLPASPGAATGIVVFSPYDAEKLSHHHKVILVRHNTSPEDINGMYVSSGILTIRGGMTS
FT                   HAAVVARGIGKPCVCGTSNLSIDEKKQILTAGNIVIKQGDIITIDGGSGKVFLGEMPLI
FT                   QPTFSEESKLILDWADEISSLKVRANAETVNDALVSIKFGAQGIGLCRSEHMFFDKNKI
FT                   PLVREMIIAPDIERRKLAVQKLLPLQTEDFKALFRVMNGKPVNIRLLDPPLHEFLPTTE
FT                   EEKKNLANSLNLPLFMINQRLHAMHEVNPMLGHRGCRLGICSPEIYQMQIEAIFTAIFE
FT                   LHTQEHIKCNLELMIPFISNVGEIKKLKMDIYEVIEELEQRYSYKFAFTLGTMIELPRA
FT                   ALSSKKIAEEVDYFSFGTNDLTQTTYGISRDDITSFLPYYLQEKIFDSDPFTNLDEEGV
FT                   GELIEIAIKRGKSSNANLKLGACGEHAGNPVSIEFFHRVNLNYVSCSPYRIPIARIAAA
FT                   QAKIKHG"
FT   gene            complement(597692..597814)
FT                   /locus_tag="A1E_02850"
FT   CDS_pept        complement(597692..597814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02850"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73510"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYS7"
FT                   /protein_id="ABV73510.1"
FT                   /translation="MQKYCAYQKEALQKQQIQKLLGVKKAISLHIGDEENCITA"
FT   gene            complement(597879..597959)
FT                   /locus_tag="A1E_02855"
FT   CDS_pept        complement(597879..597959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02855"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02855"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73511"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYS8"
FT                   /protein_id="ABV73511.1"
FT                   /translation="MASSNKMIYEPLVRSGSEAAKDKDSV"
FT   gene            complement(598360..598626)
FT                   /locus_tag="A1E_02860"
FT   CDS_pept        complement(598360..598626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02860"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73512"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYS9"
FT                   /protein_id="ABV73512.1"
FT                   /translation="MSSEIKTHYAKFLEKLNTIAVINYKLVLGKEYDLLPTVIENQKQF
FT                   IDSKISSISKYTGEISKDIIIYLMQLYQPLVFIKFLNLMKRQN"
FT   gene            599182..600789
FT                   /locus_tag="A1E_02865"
FT   CDS_pept        599182..600789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02865"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02865"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73513"
FT                   /db_xref="GOA:A8EYT0"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYT0"
FT                   /protein_id="ABV73513.1"
FT                   /translation="MIIIPILSIFGFSSFFAKYFKTKLTFAIPPTISTLVTILYCFAML
FT                   KLLSTTTYISYFIGIFLALRNLHILSKEFIVLTLLIFIFFLYTRDASLHAYDDFSHWGI
FT                   FTKELLYFGFFENQSSLTSIITTHAHYPRGAAVYHYFMLLLSGYSDGNVLFAHFLLHLA
FT                   FLAPLAANKKFWQTGVLFSLLLCSVVLYTTGIRSIYNDSTISLMFGAIFTIYIFEEDKQ
FT                   KALLLILPITILLALFREIGTWLASFASIILIVHYTIFDKKPKKTSDYIIYLILLTLPI
FT                   LYNFIWMSYFKNTHDFFDRGEHSFSNLVYIAENFNERHKLLLLNYSKFFLLFLVKEGSL
FT                   VVYTICIAAWYGIRKYKPDLLKEYRFFLISTFICFVIFALWRLYLYFFNFSAEEAIRGA
FT                   SLLRYLGCYVIGIGMMAASYVKSSIFLGKQNNNELFIFLLLFAVSTCSIVKNILKITHL
FT                   NLEQKAFIQQTTEVKKLLEQGNKIEFNFSGKKDNLQCYILNYNLAPYLDKKYLQECIKT
FT                   PKDMMIEIKKEAVHMPFK"
FT   gene            601306..601401
FT                   /locus_tag="A1E_02870"
FT   CDS_pept        601306..601401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02870"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73514"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYT1"
FT                   /protein_id="ABV73514.1"
FT                   /translation="MLDADKQSTRLVNELKQNYVMLLCNRSAITL"
FT   gene            complement(601920..602000)
FT                   /locus_tag="A1E_02875"
FT   CDS_pept        complement(601920..602000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02875"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02875"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73515"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYT2"
FT                   /protein_id="ABV73515.1"
FT                   /translation="MKYLDYNNGTKQKLEVEGLSSKRDSA"
FT   gene            complement(602073..602174)
FT                   /locus_tag="A1E_02880"
FT   CDS_pept        complement(602073..602174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02880"
FT                   /product="hypothetical protein"
FT                   /note="COG0574 Phosphoenolpyruvate synthase/pyruvate
FT                   phosphate dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02880"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73516"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYT3"
FT                   /protein_id="ABV73516.1"
FT                   /translation="MVGLLKRIAVVELHANNKSSPINLEITYCSKET"
FT   gene            complement(602289..603011)
FT                   /locus_tag="A1E_02885"
FT   CDS_pept        complement(602289..603011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02885"
FT                   /product="hypothetical protein"
FT                   /note="COG1496 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02885"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73517"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYT4"
FT                   /protein_id="ABV73517.1"
FT                   /translation="MEGLINGSVYYKIFDKTFNNSSHRYIKKNNSINETEIVENKKSIT
FT                   TYFKAQDILILNQVHGNQIVNADDFIIAVPEADGSITTKKNLVLAVQSADCVPVLLASG
FT                   DGKIIGAAHAGWKGSINNIISNIVTQMTEKGANNLIAVIGPAIAQSSYEVDNEYYKTFL
FT                   SKDINNKQFFINSKRENNYMFDLPAFVQLKLKEVGVKNIKNIGEDTYTNPLKYPSRRRA
FT                   FHLQEPYNENILSAIVIK"
FT   gene            603010..603843
FT                   /locus_tag="A1E_02890"
FT   CDS_pept        603010..603843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02890"
FT                   /product="Glutamine synthetase"
FT                   /note="COG0174 Glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02890"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73518"
FT                   /db_xref="GOA:A8EYT5"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYT5"
FT                   /protein_id="ABV73518.1"
FT                   /translation="MKIPYINYNSFINSLSGHLQKNKQLEKIISQFYQDYNLIPIIGVE
FT                   IEFYLSHNIDIAKFEILLSKYLARFKIPKMKKEKGNNQFEIDLPPSANLIQYIKNILEV
FT                   KTILKKMAQQLNGYIDFSPKPFLDDYGNSMHFHINFNSKFNDYYIILAAQGLCHYMLDT
FT                   LLAFMPSTIDYSRINKNFMAPTHISYGGNNRSVAVRIPNSFPQRVEHRLSSPETDPYIA
FT                   IFIILKSILLALKSPNSLQKIEKIYGNAFDPQYNLTPLPTSSHESFMLFNPEFFK"
FT   gene            complement(603991..604818)
FT                   /locus_tag="A1E_02895"
FT   CDS_pept        complement(603991..604818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02895"
FT                   /product="hypothetical protein"
FT                   /note="COG1295 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02895"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73519"
FT                   /db_xref="GOA:A8EYT6"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYT6"
FT                   /protein_id="ABV73519.1"
FT                   /translation="MRKIFHCLYVALFRTIEDDGVEHSGYMSFMILLSIFPFLVFLLAL
FT                   TSFLGASELGQNFIQIFLESLPEQATESIKKRIQELLSAPPQSLMNLAIVGSVWTASSF
FT                   VECLRTILNRVYQIKSPPPYIRRRLLSIIQFLIISAVITFTMFLLVVIPIIFMKIPIIL
FT                   ETIEKYKIILNVIRYSLILILLFLGSSSLYYILPNVKLNFVDVFPGALLTVILWIISGY
FT                   LLSTYIVYYNQLNLMYGSLGSIIVTLIFFYIINMIFIYGAEFNYLMKNYENIE"
FT   gene            605440..605832
FT                   /locus_tag="A1E_02900"
FT   CDS_pept        605440..605832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02900"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02900"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73520"
FT                   /db_xref="GOA:A8EYT7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYT7"
FT                   /protein_id="ABV73520.1"
FT                   /translation="MGRKNDIIQKIDSFIGKKIYSLRLAKGLSRQQLAEVIDVTHQQLQ
FT                   KYEKAINRISVGRLVLIAEALDRNIDYFFEGLEEANKPQPVHTQHQRMCIEVSRNFMKI
FT                   NSTEEQQAINNLVKCLAGKEKLKAKS"
FT   gene            complement(606064..608943)
FT                   /locus_tag="A1E_02905"
FT   CDS_pept        complement(606064..608943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02905"
FT                   /product="Cell surface antigen"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02905"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73521"
FT                   /db_xref="InterPro:IPR020954"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYT8"
FT                   /protein_id="ABV73521.1"
FT                   /translation="MSKDGNPDTSEFDPLANREFTEEEKQQQAKQEQEFFSQTTLDVAD
FT                   DGLIITAASSTQSTSSISALSGSILADGQTLDPITEAIRKDILEKQRDILREYFINTNP
FT                   ELAAQIAKEEEDKRLRAFLSNPDHRGLIDKAFEDSETKKKLEAAEIQGYRNVFSIYSAE
FT                   NYKGGFKPIQWKNQVSASSLRTTVVENDAGDVLCTLNETTHNTKPFIVAKQDGTQVQVS
FT                   SYREIDFPIKLDKADGSMHLSMVALKADGTKPSKNKAVYFTAHYEEGPNGKPLLKEISS
FT                   PQPLKFAGDGPDAVAYIEHGGEIYTLAVTRGKYNEMMKEVELNKGQAIDLSQTIAEDLT
FT                   KVQGRAQEIPQPIITPNQGLKSSIAKPTATQTTQMLQPQQEESSGIPNLVLNAVTVLSG
FT                   SMHDLLNYVNAGLTKEIEGNKQIDLIKEACAAILNNEKSDLVAKQAHVITLAENMVNNK
FT                   DLVPDVKVAGVCSILEIIKSDNALSNPEKSKMLEAIVAIALNSENLESKYKLHIVEKAG
FT                   DLGLGLNDANARANTIDGITNAVIKSNLSTEDKETMLMAVGDKVNTAQLSNTEKQKLLG
FT                   SVLKIGVEAAVLSEEQQQLMRQNLDKITVEQEKESKVAAVLSVLVDPAFNTIAKTKEIQ
FT                   DITTKVLDAPVKAEVKGHIIEGITKTIAESSLDAKDKTDIVQGVGETITSHSNTFLTYK
FT                   VTIMDFAEQGIAEGKTDLPVRELMTKGLVEGVYESKADPEITSAITKAVSNGIDNSTSV
FT                   LEDKPALKDAALEAVLDRETQNLNKDLSQTVEQTKPRDDIYNKYAVSEEEVVQKTSSIL
FT                   SDISKLAVEKVNNFRAMLSPNGNLNTLEAKRAKSEQEISKIVNAYKAIDEKYKVQYEQQ
FT                   QGSYNNTKELEEKKLFIENLKLEDKVKIKLISTLIQNEAQNKKKGTVNNITMLTENRTK
FT                   LEAKVAIQDKSKLGYDAQLKPRKNTGRVH"
FT   gene            complement(609255..610790)
FT                   /locus_tag="A1E_02910"
FT   CDS_pept        complement(609255..610790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02910"
FT                   /product="pyruvate phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /note="COG3202 ATP/ADP translocase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02910"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73522"
FT                   /db_xref="GOA:A8EYT9"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYT9"
FT                   /protein_id="ABV73522.1"
FT                   /translation="MTINLNNIENSSSKINIHLSKLIDYIWPIKRREVSKFLFITLLMF
FT                   CILFIQNLIRALKDSIVTTMIGAETISFLKFWGVMPSAFLMTAIYVKLVNRIKAENIFY
FT                   LIISIFLAFFALFAYIIFPNHEILHLSPVTIHNLTVSVPNLKWFILLLSKWSFSLFYII
FT                   AELWPNVVFALLFWQFVNNITTVEESKRFYPLFGLFSQTGIYFAGQFLENLSNINEYIT
FT                   NKFALHSSFHTLSIQIILSIVLILGIIAIKTFWLLNHKVLDKEHMVLLKFKVKKKSMTI
FT                   AESVQMILSSRHIRLIATLLICYGVAINLVEGPWKAAATKIYKTPTEYAAFIGSYLSYT
FT                   GVFTILFVVLGSNIVRRLGWFTAAVITPLIVFITGILFFTVNNFEGFAALMIANFILTD
FT                   PALIAITIGAIQNVLSKSSKYTLFDSTKEMAYVPLDLEIKIKGKAAADVIGTKLGKSGS
FT                   AFLQSLVFIMLPYTSYQSISICLMIIFIMTCLTWLWATKELNKEYKNSIKISQ"
FT   gene            610876..611757
FT                   /gene="truB"
FT                   /locus_tag="A1E_02915"
FT   CDS_pept        610876..611757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="A1E_02915"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="COG0130 Pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02915"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73523"
FT                   /db_xref="GOA:A8EYU0"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYU0"
FT                   /protein_id="ABV73523.1"
FT                   /translation="MSNYWLNIYKPRGISSAKLVSIVKTILGKVKIGHAGTLDVEAEGV
FT                   LPLAVGEATKLVQILIDAKKSYIFTVQFGKQTDSGDYAGKVIATKDYIPYKEEAYAVCS
FT                   KFIGNITQIPPVFSALKVNGVRTYKLARVGTAVELKPRNITIYDLKCLNFDEKNATATY
FT                   YTECSKGTYIRTLAEDLALSLQSLGFVIELRRTQVGIFKEKNAIRIKSSDAIIKNSLEE
FT                   KSIKIEAILDDILVLDATDQQAQQIKYGQKCLFNYEKDINLLWVRYKGVVLAIGSLNKS
FT                   CFNSLRVLNLTQ"
FT   gene            611922..612197
FT                   /gene="rpsO"
FT                   /locus_tag="A1E_02920"
FT   CDS_pept        611922..612197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="A1E_02920"
FT                   /product="30S ribosomal protein S15"
FT                   /note="COG0184 Ribosomal protein S15P/S13E"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02920"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73524"
FT                   /db_xref="GOA:A8EYU1"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYU1"
FT                   /protein_id="ABV73524.1"
FT                   /translation="MSITTERKQQLIKEYAITENDTGSSAVQCAILTERINNLTEHFKS
FT                   NHKDHASRRGLLILVGRRRRLLNYIKKNNISEYLELISKLGIRKVK"
FT   gene            612464..614707
FT                   /locus_tag="A1E_02925"
FT   CDS_pept        612464..614707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02925"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="COG1185 Polyribonucleotide nucleotidyltransferase
FT                   (polynucleotide phosphorylase)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02925"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73525"
FT                   /db_xref="GOA:A8EYU2"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYU2"
FT                   /protein_id="ABV73525.1"
FT                   /translation="MFNEITKSVTWNGKVLELSTGKIARQADGSVTVKMGNSVLLCTAV
FT                   VANTAKEGIGFFPLTINYREMAYAVGKIPGGFFKREGKASEREVLVSRLIDRPIRPLFH
FT                   PAFVNETHVTCTVLSYDPETPVDILAIIGASAALALSPAPYLEIVAASKVGLINGEFVL
FT                   NPTLELLKTSQLDLVVAGTTESVMMVESEAHLLSEAQMLEAVKFGFESFQPVVKIIKEL
FT                   AEEAKRPKLEMQDLYPSVLKNEIEQLFAKEIEQAFAIKSKQERSTSLDLISEKVITHFI
FT                   SNIENKKYNNYQIESALKSVESDILRKEILEKNKRIDGRSTMDIRQIACEVGLLPSAHG
FT                   SALFTRGETQSLVSSTLGTSLDEQIVDNLEGEYKERFMLNYIFPPYSVNEAMPMKAPSR
FT                   REVGHGKLAWRAINPILPNKVQFPYSIRVVAETTESNGSSSMATVCGSSLALMQTGIPI
FT                   KAPVAGIAMGLVKEGKKFAVLSDILGDEDYFGDMDFKVAGTSEGITALQMDIKISGVDF
FT                   KIMKVALEQARLGRLHILEQMNKVISKPNSELSKNAPSTTTIKIDKDKIRDIIGPGGKI
FT                   IKEICETSGAKIDISDDGTVSVYAADRDKLKIASDKIKAIAIEPEIGEIFNGTVTKILD
FT                   SGAFINYLGNKDGFVHISEISEERIDTVSSVIKQGDIVKVKLIGFDNKGKAKLTIKNAD
FT                   KDKSLNNPKPQNSINNAKENSEHVRCDSIKKRAWNEDNNAETAEFITERKYFN"
FT   gene            614847..615806
FT                   /locus_tag="A1E_02930"
FT   CDS_pept        614847..615806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02930"
FT                   /product="KpsF protein"
FT                   /note="COG0794 Predicted sugar phosphate isomerase involved
FT                   in capsule formation"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02930"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73526"
FT                   /db_xref="GOA:A8EYU3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYU3"
FT                   /protein_id="ABV73526.1"
FT                   /translation="MTNTNNYRTIAKRVISSEASALEKLSENIPEDFNTIIEFLLSFTG
FT                   RVIFTGIGKSGYIARKIAASFSSTGMPAFYLHPAEASHGDLGMVTRDDLVIMISNSGET
FT                   KELFNIIEYCNNSSIKIAAMTMNKNSTLAKRSDFLLIVPEYSEASVIGVPTISSLIMLS
FT                   LGDALMTVIHEKRGFTKDDFKVYHPGGTIGANLTKIKNLMRSGDEIPLVYEDTSFAETI
FT                   IVMNKKRLGCTLVTDKNQNLVGIITDGDLRRHINAQIHLKTASNIMTKNPIHISSEILA
FT                   KEALNLMKAKNITNVPIIDANIITGIIHIHDLLRIGVN"
FT   gene            615845..616411
FT                   /locus_tag="A1E_02935"
FT   CDS_pept        615845..616411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02935"
FT                   /product="hypothetical protein"
FT                   /note="COG5375 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02935"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73527"
FT                   /db_xref="GOA:A8EYU4"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYU4"
FT                   /protein_id="ABV73527.1"
FT                   /translation="MKSIYLLIILGILYIGYILIKSGYINEENDINVTKKSLKYNKNFD
FT                   LKYNIILKDSIFEGVNKNLNAYTIKTERATKESDNKYKLDIINAIYNVNKDQHLIIHAQ
FT                   EGFLDEESNILDLKNDVKFFFDKIIFNTNNARIDLVNQNITGNSSATLFYNNSSITSDS
FT                   FNTRDKNNIIIFKGNVSTIINLSDY"
FT   gene            616377..616814
FT                   /locus_tag="A1E_02940"
FT   CDS_pept        616377..616814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02940"
FT                   /product="hypothetical protein"
FT                   /note="COG1934 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02940"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73528"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYU5"
FT                   /protein_id="ABV73528.1"
FT                   /translation="MSLQSSIYRIIKLLVFLTISISIYASDKDISNLHITSDTLIIDKT
FT                   KQKAEYLGNVVVYFDNAILRTEELYIFYKTIDEKQTIDHIIVPTKLNVERKINNELLLA
FT                   DSAKYFFDNKQLILIGNVILQRDDNVLKTNKLIYYVDHVNK"
FT   gene            616962..617684
FT                   /locus_tag="A1E_02945"
FT   CDS_pept        616962..617684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02945"
FT                   /product="abc transporter atp-binding protein (abct2)"
FT                   /note="COG1137 ABC-type (unclassified) transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02945"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73529"
FT                   /db_xref="GOA:A8EYU6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYU6"
FT                   /protein_id="ABV73529.1"
FT                   /translation="MDILQVNNISKSYIKKNILSDVSLNIKQGEIVGLFGPNGAGKTTC
FT                   FNIIIGLIKPDSGQLLLNDINITNLPIYLRARLGIGYLLQEPSIFRGLSVEDNIKAIIE
FT                   ISKNDKEVIEQKTHDLLEKFSIMHLKDLSAASLSGGERRRLEIARSLAIEPKFIILDEP
FT                   LAGIDPLAISDIKNLITYLREFNIGILITDHNVRDTLDIVDRAYVVFEGKVLLEGNAKE
FT                   IANSKKVKEVYLGESFSF"
FT   gene            617885..619432
FT                   /locus_tag="A1E_02950"
FT   CDS_pept        617885..619432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02950"
FT                   /product="polynucleotide phosphorylase/polyadenylase"
FT                   /note="COG1109 Phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02950"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73530"
FT                   /db_xref="GOA:A8EYU7"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR022436"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYU7"
FT                   /protein_id="ABV73530.1"
FT                   /translation="MQINKEIFRAYDIRGNSLKDLTEEVAYKIGFCFTKMSISNDNNKI
FT                   CVGLDGRLSSPTICKALELGLTDAGAKVINIGIVPTPVLYFADKEFTPSGSIMITGSHN
FT                   PRDDNGFKMLQNGKSFFGTQIQDLLAKILDDHFILDSHHVIATKVRNQEIIRSNLDSCL
FT                   HGHNIEYKNTIASKYLKNILEGININPKLKVAWDCGNGATGNIIEELKSYLAIVNSVGF
FT                   GYKERETKPITNRRATSNIVGESKSIDYNKNIIINSIIDGNFPNHHPDPTNPANLQELI
FT                   KTVKEQNCDLGIAFDGDGDRIGIVSSSGKILFGDQILCIFAEDIVKENPNATIIVDIKA
FT                   SQLIIDKIKSYGGNPIIWRTGHPFIKSKMLETKALLAGEMSGHIFFADKYFGFDDGIYA
FT                   ALRFLDLLSRSNKTLDEIIDELPKSYSTPEIKIFVPSELKIKIIEEIKQKLFDDKIAFN
FT                   DIDGVRVNTEHGWWLLRSSNTESIIVARAESTSHEGLIKLKVIINDLLSKYGLTIDR"
FT   gene            619429..620406
FT                   /locus_tag="A1E_02955"
FT   CDS_pept        619429..620406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02955"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /note="COG0324 tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02955"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73531"
FT                   /db_xref="GOA:A8EYU8"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYU8"
FT                   /protein_id="ABV73531.1"
FT                   /translation="MKKKEIIILCGPTASGKSYLGHEFAKAYNGEIINIDSMQVYKETP
FT                   IITASPSQIYKTEIPYHLYNFLSITEDFSVIKYLKLAAKKIKEIISRGKLPILIGGTGL
FT                   YINSLVFGYNNIPDITEDLQKQARELHSKIGNIELWNKLEKLDPLAASKINQNDTQRLI
FT                   RAYEVFKQSGKSIFCFHTLPKEQILSEFNFKIIFLNPERKFLYKTCEQRLQKIFKEGSI
FT                   DEIALIKKQLIPQDYLNLKAVGVKEILAYLDGNLTLDDALSATQIRTRRYAKRQVTWFK
FT                   NQIKDKITLKYSNQEECTKILEIFPHLLIERNLKETQNTAPQCI"
FT   gene            complement(621037..623904)
FT                   /gene="miaA"
FT                   /locus_tag="A1E_02960"
FT   CDS_pept        complement(621037..623904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="A1E_02960"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="COG0593 ATPase involved in DNA replication
FT                   initiation"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02960"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73532"
FT                   /db_xref="GOA:A8EYU9"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYU9"
FT                   /protein_id="ABV73532.1"
FT                   /translation="MAVINNKNYQKVVENILSSSKLNTLLKSAIKDLSSAKNISLRTML
FT                   LGARFVLTNPINAYNLIKLARSSNIYLDPEFQRSLLENSPIWEFLKKHVGDLPKIGQIL
FT                   AKAGFREFQDKSVLDQKGLAILKECFKTEKVLKKLQEIAVEVKQELPDWNKVTSSSLDM
FT                   LVTDKNFRKFFNEKSEDITNYIRIGATEILPSDYIKTFDDILQKPQSKDIYAQVIKIFN
FT                   EYPNFKQALAENINNINSLKRFNTLSPEKQIIIKNFLAEVQEQAKPFLKEYFESYKIDL
FT                   NILDIIPTLLNKIPETKEIFDTLNALDQGVMVALEKSLKMVAGDDKLKSFFAHNKKILP
FT                   NIALGIIDNTPSVQSITQQYNFDKQMLNIAGEVMSKPEIAYAIIVDLNKGDYMSLTVNI
FT                   ISALNDPAFKLKDILVEQSKKGLFDNLITGILEHDEKGNQNIKQQLINYGLEARDITQL
FT                   TSIMPILLDKPEALQKVFRDFIKGNYTGMAKELITLTKDSPEIKKYLNNKREIFASILE
FT                   KTLVDIPGINDLDKKELYNILPSMLNHPDELVKVIEEVEKSNYRGATSALYNLAQKTNY
FT                   FEGQLLNIIKVGFSYATEKVKDVLSASQDFKDTTIDAMTLRNNLNKIQNGKFNLEGAIL
FT                   VGDLSNIDFSGVSLKNADLTKVTSLKDCNFKNTNLAGAKLPDNLMLLTDTYNLDKTIPA
FT                   LAPELIKEQQAQLIDKAIDKVFLQVQAEGTRNLLSKQEFVQQVKILYEENQTIKDYIIE
FT                   KLNSLPMNMVTNLATPKTNQYQHITNYINSPLQVLNPLYENIANKQDIKSNLLANILSE
FT                   QISQKLFDNGDNRGEDFYLINQMLKLSLSEYLTENPDIINSFLEPKNLKKLASNIASTL
FT                   NLKSKYTWVGNITGGIYLPKEIFNEQLKDNFKNEFEKINKLNVLTQARNIASNLDSELY
FT                   IKDTQDKSYTYKSLPIPIKSKTMHK"
FT   gene            complement(624006..624980)
FT                   /gene="nrdF"
FT                   /locus_tag="A1E_02965"
FT   CDS_pept        complement(624006..624980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdF"
FT                   /locus_tag="A1E_02965"
FT                   /product="ribonucleotide-diphosphate reductase subunit
FT                   beta"
FT                   /EC_number="1.17.4.1"
FT                   /note="COG0208 Ribonucleotide reductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02965"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73533"
FT                   /db_xref="GOA:A8EYV0"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYV0"
FT                   /protein_id="ABV73533.1"
FT                   /translation="MSLLDASPIYKPFSYPWAYDAWHTQQKIHWLPEEVPLADDVKDWK
FT                   YNLTPGEKHLLTQIFRFFTQADIEVNNCYMKHYSRVFKPTEILMMLSAFSNMETIHIAA
FT                   YSHLLDTVGMPEVEYSAFLKYKEMKDKYDYMQQFGVDTKEDIATTLAVFGAFTEGLQLF
FT                   ASFAIMLNFPRFNKMKGMGQVIAWSVRDETLHTNSIITLFKTFVRENPEVWTETLRKRI
FT                   YGACTTIVHFEDAFIELAFEVGGIEGLTAYEVRQYIRYIADRRLMQLGLKDVYLVNHNP
FT                   LPWLDEMLNGVEHTNFFENRATEYSKAATTGSWEEVFAEIDNK"
FT   gene            complement(625226..627049)
FT                   /locus_tag="A1E_02970"
FT   CDS_pept        complement(625226..627049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02970"
FT                   /product="ribonucleotide-diphosphate reductase alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02970"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73534"
FT                   /db_xref="GOA:A8EYV1"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYV1"
FT                   /protein_id="ABV73534.1"
FT                   /translation="MNMLKKNKFQININNSHNNLLTPFGKAILRDRYLMKGEDFQDLFA
FT                   RVSSYYAENKQHAQKLYEYMSKMWFMPATPILSNGGTDRGLPISCFLNETNDSLDDIVN
FT                   LWTENVWLASRGGGIGSYWGNVRSINEEIHNKGHSSGIIPFIKVMDSMTLAISQGSIRR
FT                   GSSAVYLPINHPEIEEFIDIRRPIGGDVNRKSLNIHHGIAITDEFMNAVENNTDFNLVS
FT                   PATKKVTNKVRARDLWIKLLTTRIETGEPYLLFIDSVNKSIPEHHKKLGLQVKMSNLCS
FT                   EITLPTGIDHLGNSRTAVCCLSSLNLEYFEEWKDDKAFIHSIMLFLDNVLEDFINKAPD
FT                   TMARAKYSALRERSVGLGVMGFHSFLQMKKVPIESVMAKVWNKKIFEYISAEADKASIE
FT                   IGKEKGACPDALDAGSNERFSNKTAIAPTASISVIAGNASPGIEPFAANSFVQKTLTGS
FT                   FNVRNKHLEKLLEEKGFNNDQVWSSIATHEGSVQHLTFLSAEEKQVFKTAYEIDQNWLI
FT                   ELASDRTPYITQAQSLNIFLPGNVSKKYLNNIHFKAWKKGVKSLYYCRSTSIQRADKVS
FT                   HDVLKADFKDLEKQNNKIAEAGNYEECLACQ"
FT   gene            complement(627244..627342)
FT                   /locus_tag="A1E_02975"
FT   CDS_pept        complement(627244..627342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02975"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02975"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73535"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYV2"
FT                   /protein_id="ABV73535.1"
FT                   /translation="MTNWRKVGDIITKASSWSNSTRFADIQFIQAI"
FT   gene            complement(627951..628109)
FT                   /locus_tag="A1E_02980"
FT   CDS_pept        complement(627951..628109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02980"
FT                   /product="hypothetical protein"
FT                   /note="COG0209 Ribonucleotide reductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02980"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73536"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYV3"
FT                   /protein_id="ABV73536.1"
FT                   /translation="MYEDSIEEYKETKDLVTTHITFSLEGGKMQLIRIALKNTQNFLLE
FT                   KKTIESW"
FT   gene            629165..630178
FT                   /locus_tag="A1E_02985"
FT   CDS_pept        629165..630178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02985"
FT                   /product="Thioredoxin reductase"
FT                   /note="COG0492 Thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02985"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73537"
FT                   /db_xref="GOA:A8EYV4"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYV4"
FT                   /protein_id="ABV73537.1"
FT                   /translation="MYNTDVVIIGAGPVGLFAVFQAGMFGMKCHVIDAQETIGGQCITL
FT                   YPEKPIYDIPAYPKIVAEELIKQLELQAAPFKPVYHLNQQAIELNKQGDFFEIKTSKNT
FT                   LIKSKIIIIAAGAGSFGPNKPPLANIEDFEGKSVFYFINDKNKFTGKNIVIAGGGDSAV
FT                   DWAISLSEIANKIYLVHRRDKFTASPESVRQLRNLAETGKIELVIGYQLNALDGNNGEL
FT                   QSVIVRDLQNNTHKLEANILLPFFGLKQNLGSLANWGLNVKLQHIEVDNSYYQTNIEGI
FT                   YAIGDIAHYTGKLKLILIGFAEAASSLHHAYSRVFDGKALHFEYSTTKYGKNGKKK"
FT   gene            630312..631193
FT                   /locus_tag="A1E_02990"
FT   CDS_pept        630312..631193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02990"
FT                   /product="Methylenetetrahydrofolate dehydrogenase"
FT                   /note="COG0190 5,10-methylene-tetrahydrofolate
FT                   dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02990"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73538"
FT                   /db_xref="GOA:A8EYV5"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYV5"
FT                   /protein_id="ABV73538.1"
FT                   /translation="MDKNIVNNIIDGKALANEILADLKLEIQELKDKTNTSPKLAIVLV
FT                   GNNPASIIYVKHKIKNAHNIGIDTLLVNLSTNIHTDDLILKINELNLNNEISGIIVQLP
FT                   LPRSIDTNKILSAVLPLKDIDGFHPLNVGYLHSGISQGFIPCTALGCLAVIKKYETNLS
FT                   GKNVVIIGRSNIVGKPLSALLLKEHCSVTICHSKSQNLSKISSKADIVIAAIGSPVKLT
FT                   AEYFNPESIVIDVGINRINGNKIIGDVDFENVKSKVKYITPVPGGIGPMTIAFLLNNTV
FT                   KAFKDSYSTVCH"
FT   gene            complement(631337..631915)
FT                   /locus_tag="A1E_02995"
FT   CDS_pept        complement(631337..631915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_02995"
FT                   /product="Probable sigma(54) modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_02995"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73539"
FT                   /db_xref="GOA:A8EYV6"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYV6"
FT                   /protein_id="ABV73539.1"
FT                   /translation="MIISVSAQHISIGNSLQEYSKDRATQVVKKYFNDIINIDIHFSKE
FT                   GINFKCDIIVKYGPGKHNIVKSNDSCSDIYVAFDKAMSKLEKQLRKYKSKFKNHHTGKV
FT                   KISEIAYEGTKYVISSQPDSETSNSEDNDNPAIIAEKPVEILKLSVKEAVMKMDLEDLP
FT                   AVVFKNINNDRINIVYYRKDGNISWVDYN"
FT   gene            632465..632541
FT                   /locus_tag="A1E_t05720"
FT   tRNA            632465..632541
FT                   /locus_tag="A1E_t05720"
FT                   /product="tRNA-Asp"
FT   gene            complement(633581..633769)
FT                   /locus_tag="A1E_03000"
FT   CDS_pept        complement(633581..633769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03000"
FT                   /product="hypothetical protein"
FT                   /note="COG1544 Ribosome-associated protein Y (PSrp-1)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03000"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73540"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYV7"
FT                   /protein_id="ABV73540.1"
FT                   /translation="MNLLLISIDNKVVHLVILADRQNPKFLNGINLSEIGELYNGFRNF
FT                   YFEKVSFIKATLNFNNF"
FT   gene            634191..634358
FT                   /locus_tag="A1E_03005"
FT   CDS_pept        634191..634358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03005"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73541"
FT                   /db_xref="InterPro:IPR008866"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYV8"
FT                   /protein_id="ABV73541.1"
FT                   /translation="MDALNNLKIEIIVVISSAQVGKTKIINNIVGYHIHQDPTPILVVQ
FT                   LIILPTLLLV"
FT   gene            634436..634642
FT                   /locus_tag="A1E_03010"
FT   CDS_pept        634436..634642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03010"
FT                   /product="hypothetical protein"
FT                   /note="COG5525 Bacteriophage tail assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03010"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73542"
FT                   /db_xref="GOA:A8EYV9"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYV9"
FT                   /protein_id="ABV73542.1"
FT                   /translation="MKENILVQAGGMWWTTLAIYLVAAVGVWAVSQEQAAFYQGLVLHL
FT                   VDSLQKAVRLNKAHIVGDCGKPE"
FT   gene            complement(634997..637333)
FT                   /locus_tag="A1E_03015"
FT   CDS_pept        complement(634997..637333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03015"
FT                   /product="ribonucleotide-diphosphate reductase subunit
FT                   alpha"
FT                   /EC_number="1.17.4.1"
FT                   /note="COG0466 ATP-dependent Lon protease, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03015"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73543"
FT                   /db_xref="GOA:A8EYW0"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYW0"
FT                   /protein_id="ABV73543.1"
FT                   /translation="MNKKSLPLMVLRDMVVFPGVIAPIFVGREKSLQALSRTTISEEDN
FT                   SKYILITLQKKFDQENPNKYDLYNTGILAKIIQIVKLPNNTAKILIEAVARVKLSNIKG
FT                   EAAFEANYLIIPDEEIFDVNNMRSLVDNAVQLFSKYAVNDKKVNAEIIETINKEISNRT
FT                   NFINIINILAAHLITSLEAKQHLLEETSPFKRITTVISTLTSNIVNSETEQVLQQRVRK
FT                   QIEKTQRDYYLHEQMKAIQKELDEDKSELADIEKKIKSLRLSKEAKEKAESELKKLRTM
FT                   NQMSAESGVTRNYLETLLSLPWGKYDNSKIDINQAEQILNRDHFGLEKVKERIIEYLAV
FT                   LQRSSKIRGPILCLIGPPGVGKTSLVKSIAEGMGRKYTKFALGGVRDEAEIRGHRKTYL
FT                   GSMPGKILGQLKKVKTSNPVMLLDEIDKMSSDFRGDPASALLEVLDPEQNSHFVDHYLE
FT                   VEYDLSNVIFIATANSHDLPRALSDRMEKIYISGYVEEEKLQIAKNYLVPKQFKMHKIK
FT                   KGEITISETAILDLIRYYTKESGVRALEREIGALTRKALKQILANKTVKHIAIDSNNLE
FT                   EFLGVKKYNFGFAEKEDQIGSTTGLAYTEVDGDLLTIEALAFPGKGEIKTTGKLGDVMK
FT                   ESVMAAYSCFRSRATNFGLKYENYKDFDIHIHVPAGAIPKDGPSAGCALFTTIVSLMTK
FT                   IPVHRTVAMTGEITLRGNVLPIGGLKEKLLAASRGGIKTVLIPEENVKDLKDIPPNIKE
FT                   SLEIISVSNIDQVLKHALVETPINK"
FT   gene            637417..638418
FT                   /locus_tag="A1E_03020"
FT   CDS_pept        637417..638418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03020"
FT                   /product="threonine dehydratase"
FT                   /note="COG1171 Threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03020"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73544"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYW1"
FT                   /protein_id="ABV73544.1"
FT                   /translation="MNSLLQSSQNVAAAHNRIKQYLHLTPIVHSESLNEMLGHKIFFKV
FT                   ESLQKTGAFKVRGVLNHLLELKEQGKLPDKIVGYSTGNHGIGLAYARKLFGIKTRIYLP
FT                   FNTAKVKQQAALYYGGEVIYTNTRQEAEERAKEDMEQGFYYIHPSDSDSTIAGAGTLCY
FT                   EALQQLGFSPDAIFTSCGGGGLIAGSYLAKELISPTSLLIGSEPLMANDAYLSIKNNKI
FT                   YRFNNAPNTIADGLKTLSVSTRTFEYLKKLDHFYLAEEHEIYYWTAWLTHLLKVICEPS
FT                   SSINMVSVINFLKMQSQPQKLLVLISGGNIDPILYNELWKEEYLTVLPNIKI"
FT   gene            complement(638415..639782)
FT                   /locus_tag="A1E_03025"
FT   CDS_pept        complement(638415..639782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03025"
FT                   /product="hypothetical protein"
FT                   /note="COG1137 ABC-type (unclassified) transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03025"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73545"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYW2"
FT                   /protein_id="ABV73545.1"
FT                   /translation="MTGVVTNRGYHTETIKKNDEVTEISDVVKTKIVDIAKIDSRLDTL
FT                   HKNIITLDPIQQYLQSEEYITSTLEVLASKIISEVVENKEVQKLVDNLHINLGQDIKLI
FT                   PSVADRRKFDVARAEAALKGFVLPLNPGGPFDKLSFMGIEDAQEIFANPIRATKEALIA
FT                   VSGKAIPKEQYAQAIKDKAIEILKQDPKNTSEKLEKYEKFIIQGDQNQKFDKDSKQFIP
FT                   RVNQLSQVEFKALQKAATNTVQQINNRLEKNNEISKQLEQTIILTKSSGIKNPEVIIKK
FT                   LSKLHSTYLAENSTKIATELKYINDRGTSLWEKFKQIFTGKNYLAERLGKVVDKYITLN
FT                   DEYVVKTINDKIFSNALTNPEIAECLTKFLNQNKEKAITNPEFKNLIPDMSSGPIVVQP
FT                   QQVNNFNLAELRKINPIAFDKTMFEDLIKLRSANITPTQNDPNALTKNRGVVRSKG"
FT   gene            complement(640132..640416)
FT                   /locus_tag="A1E_03030"
FT   CDS_pept        complement(640132..640416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03030"
FT                   /product="hypothetical protein"
FT                   /note="COG1038 Pyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03030"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73546"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYW3"
FT                   /protein_id="ABV73546.1"
FT                   /translation="MKIIFQTNERETKTLSCIYEQRIKEPEIIKPLLPAISKLSPEKMI
FT                   EQGQGSKIVKDFAPLLESSNPGLVNGTKKALTELDPEYLAEYAKNQEKL"
FT   gene            complement(640424..642409)
FT                   /locus_tag="A1E_03035"
FT   CDS_pept        complement(640424..642409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03035"
FT                   /product="DNA helicase II"
FT                   /note="COG0210 Superfamily I DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03035"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73547"
FT                   /db_xref="GOA:A8EYW4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYW4"
FT                   /protein_id="ABV73547.1"
FT                   /translation="MDTVEGMTGIVQKQDFLNTLNPQQQKAVLHTEGPLLLLAGAGTGK
FT                   TKVLTSRIANIIYQNLASPHNILAVTFTNKAAKEMVERVHSLINCDGLNIGTFHSMAAR
FT                   ILREHIEHLNLGLNNRFTIISQDEQLKLVKDIVKLKDIDTKKYAPKLIHIIISRWKDQG
FT                   LLPSKLSVSDTNLPVQRVAKLVYQEYQQNLLISNALDFGDFLLYNNELFIKNPDILKYY
FT                   QDKYRYILIDEYQDTNIVQYLWARMLASLYKNICCVGDDDQSIYGWRGAEVGNILRFEK
FT                   DFSGATIIKLEQNYRSTLPILAAASNVINNNKNRHGKTLWTDRENGEKIKIVSCWSDKE
FT                   EARYIAGEIERLVREDRYNAGNIAILVRAGFQTRSFEEAFINSAMPYKIIGGLRFYERM
FT                   EIRDVIAYIRISLNQNDNFALERIVNVPKRAIGAATLSKIKAYAIEQNISHFAAIKKML
FT                   EKGKAKSYETLKDFVTKIDNWHERFNTDAPINVVKAILHDSGYLEMLKEEQTEEAFGRI
FT                   ENINEMLRAIAEFNDIHDFIEHSSLVMENESLETHYGGSVTIMTLHAAKGLEFDVVFLP
FT                   GWEEGVFPSQKSLDEDGEKGLEEERRIAYVGITRAKKDLYITYAESRKIFYEIVRSYPS
FT                   RFITEIPDEITIRTSSVKKYNAFYKF"
FT   gene            complement(642510..643355)
FT                   /locus_tag="A1E_03040"
FT   CDS_pept        complement(642510..643355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03040"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03040"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73548"
FT                   /db_xref="GOA:A8EYW5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYW5"
FT                   /protein_id="ABV73548.1"
FT                   /translation="MHINLPKISIVLPVYNREKLLPFVIESCLNQSFKDFELIIIDDCS
FT                   KDNSVVVAKKYAEQDSRIKLIVNATNKTLPASLNIAFKDAKGRYFTWTSDDNLFHENAL
FT                   EKMVRTLDNSPEIGLVYTDYTLIDEQGRIGARLYQESPEFLPIRDCVGACFLYRADLAR
FT                   QVGGYNENMQLVDDYEYWLRLGLVTKFTHIPESLYFYRVHDQSLTIERKVEAKQAKRAL
FT                   KELFKDKYIIPTEIKPINDLYNWFIEDRNFNSYFRLFKIILCNPIITLSYIIKNLRRIR
FT                   "
FT   gene            complement(643345..643698)
FT                   /locus_tag="A1E_03045"
FT   CDS_pept        complement(643345..643698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03045"
FT                   /product="hypothetical protein"
FT                   /note="COG0463 Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03045"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73549"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYW6"
FT                   /protein_id="ABV73549.1"
FT                   /translation="MSVSIKNIERAIDRTNEVVSLIDNKNGVDPWLWAISDCLTRLLDQ
FT                   HKELLSIEYAYPLIQLIQRYEETKIIIYQSLNNALSNILLIFEDKCKFEESELIKNITY
FT                   SLNTLNILGVHAY"
FT   gene            644567..644728
FT                   /locus_tag="A1E_03065"
FT   CDS_pept        644567..644728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03065"
FT                   /product="hypothetical protein"
FT                   /note="COG1012 NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03065"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73550"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYW7"
FT                   /protein_id="ABV73550.1"
FT                   /translation="MQVLKLIEAVRRDGFNITLQPAAIAGTTLRVIIAFGKFQGVIAAE
FT                   GPIPVHIA"
FT   gene            complement(646151..646369)
FT                   /locus_tag="A1E_03080"
FT   CDS_pept        complement(646151..646369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03080"
FT                   /product="transposase IS200-family protein"
FT                   /note="COG1943 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03080"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73551"
FT                   /db_xref="GOA:A8EYW8"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYW8"
FT                   /protein_id="ABV73551.1"
FT                   /translation="MNLCKKPKGDHQKKIQEEFPILRKKYWGRHLWVVRGYFSATSGNV
FT                   TDDMINEYINRHTDAHEPVMTTNIRLE"
FT   gene            complement(646284..646484)
FT                   /locus_tag="A1E_03085"
FT   CDS_pept        complement(646284..646484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03085"
FT                   /product="transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03085"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73552"
FT                   /db_xref="GOA:A8EXX0"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A8EXX0"
FT                   /protein_id="ABV73552.1"
FT                   /translation="MREIIAVVVEELNVKIENGVISSDHIHIFANIPPHIKVSEFVQKA
FT                   KGRSSKKNTRRISNIKKKVLG"
FT   gene            complement(646636..646773)
FT                   /locus_tag="A1E_03090"
FT   CDS_pept        complement(646636..646773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03090"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73553"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYX0"
FT                   /protein_id="ABV73553.1"
FT                   /translation="MQAIQVYKVDGKPPIITYSLKDEFIIANFIVSLVVKTSIFQMRKL
FT                   "
FT   gene            complement(646973..647104)
FT                   /locus_tag="A1E_03095"
FT   CDS_pept        complement(646973..647104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03095"
FT                   /product="hypothetical protein"
FT                   /note="COG1943 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03095"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73554"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYX1"
FT                   /protein_id="ABV73554.1"
FT                   /translation="MSYFNKLVDGDLITEHGLSKILETIKLEAEFSKALLTAEIQLL"
FT   gene            complement(647384..648316)
FT                   /locus_tag="A1E_03100"
FT   CDS_pept        complement(647384..648316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03100"
FT                   /product="thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="COG0492 Thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03100"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73555"
FT                   /db_xref="GOA:A8EYX2"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYX2"
FT                   /protein_id="ABV73555.1"
FT                   /translation="MHITAKVLIIGSGPAGLSAAIYTARAALKPILINGMQPGGQLTIT
FT                   TDVENYPGFAETVQGPWLMEQMYMQAKNVGTEIVSDYVEKVDLSKRPFKVLTGAGHEYK
FT                   AESIIICTGAEAKWLGIASEQEFRGFGVSACATCDGFFFKNQEIVVVGGGNSAVEEALY
FT                   LTNHANKVTIVHRRDSFRAEKILQARLFKNPKISVIWDHVVDEIVGDNKPKSVTGVKIQ
FT                   NVHTKEISLVNCSGVFVAIGHAPNTSLFTGQIAMDYDNYIITKPGTTKTSVEGVFAAGD
FT                   VQDKIYRQAVTAAGSGCMAALEAEKFLNN"
FT   gene            complement(648332..649219)
FT                   /locus_tag="A1E_03105"
FT   CDS_pept        complement(648332..649219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03105"
FT                   /product="hypothetical protein"
FT                   /note="COG0596 Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03105"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73556"
FT                   /db_xref="GOA:A8EYX3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYX3"
FT                   /protein_id="ABV73556.1"
FT                   /translation="MKINSITIGPYINLLPLQYIPKHKISYVEFGDPKNKNIIVCAHGL
FT                   TRNAHDFDKIAKALSQNYRVISINYPGRSDSENFKKANHYNYTTYIKDTLFFFRRLNIK
FT                   KTIWLGTSMGGIIGMLLASKYKNFFKALILNDIGAFIDAAPLIKIRDYAKKTIILDDLA
FT                   GAKEHLKLIYAQSGIKDEEDWDYLTKYSVISTFGGKYKMNYDPAIIKGINNAGNQEDVK
FT                   LWSVWNKIKCKTLVIHGMKSQILTKSTVKKMKETKVFDLYEIKYAGHTPSLMNPEEINY
FT                   VKSWLEQLENKKEN"
FT   gene            complement(649277..650206)
FT                   /locus_tag="A1E_03110"
FT   CDS_pept        complement(649277..650206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03110"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03110"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73557"
FT                   /db_xref="GOA:A8EYX4"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYX4"
FT                   /protein_id="ABV73557.1"
FT                   /translation="MIIFSIVFLKTVSVLLSVVIGFLAGKYSNVERDSISSLLFYFISP
FT                   IVFFTIPASTTLTLSALSVTVVTFVIATLLSLFSYYFFGKFWQDHTRNIIALSAGTANG
FT                   GYFMLPIAAALFDDYTLSIYMMAVIGVNIYECSVGFYICMRSFADTTDSMLKVVKLPIL
FT                   NAFFLGCLFSFCGFTLPDFLDDFIYNMKGSFSILGMVMVGLALSSLQKFEVDIKFTLAT
FT                   FAAKFLFYPLGVGLFIMFDHFVTKWYNNDYYNALKLLSTAPLAANTIVIANLQKFYPEK
FT                   VAATVFLSLLFVVIYTPTMVSIFLSNLN"
FT   gene            650523..650654
FT                   /locus_tag="A1E_03115"
FT   CDS_pept        650523..650654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03115"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73558"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYX5"
FT                   /protein_id="ABV73558.1"
FT                   /translation="MLDSSELNPETELVYITHSFYKDFLNKLDKEEKLEQEQIKRLL"
FT   gene            651146..651343
FT                   /locus_tag="A1E_03120"
FT   CDS_pept        651146..651343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03120"
FT                   /product="hypothetical protein"
FT                   /note="COG0679 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03120"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73559"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYX6"
FT                   /protein_id="ABV73559.1"
FT                   /translation="MFLPPTCNVTISLVTLVVKIFEPRLLAILFATSISKLAMLAEAGK
FT                   FLASSFARLRLDRNAIAVIR"
FT   gene            complement(651711..653396)
FT                   /locus_tag="A1E_03125"
FT   CDS_pept        complement(651711..653396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03125"
FT                   /product="threonine dehydratase"
FT                   /EC_number="4.3.1.19"
FT                   /note="COG0595 Predicted hydrolase of the
FT                   metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03125"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73560"
FT                   /db_xref="GOA:A8EYX7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYX7"
FT                   /protein_id="ABV73560.1"
FT                   /translation="MSSFNMKNHKNDLLFVPLGGSNEIGMNLNFYHYKGKWLMIDCGSG
FT                   FADDYLPGVDMIIADSSFIEKYKKDIVGLILTHAHEDHLGGVQYLWNSLKCPIYTTTFT
FT                   ANFLKIRLNEYDFATNIKIHEVKPGSKINLDPFSLEMVPLTHSAPEMQAIMIRTKAGNI
FT                   LHTGDWKFDNDPILGKKADEKLLKSYGDEGVLALVCDSTNVFNKGSSGSEGDVRKSLVD
FT                   IIACCPQMVVVSTFASNLARLDTIIHAAGLAGRKVVLTGRSLYRMMRAAQESGYFKDIT
FT                   PLISEREISRFRREELLVIATGCQGETMAATAKLASNSHPSIKLAPKDTMIFSSKIIPG
FT                   NEKKIFRLFNIFVKAGVEVITERDHFVHVSGHPSIDELKKMYSLIRPNICIPVHGEPMH
FT                   IHEHVKLAKKNSIKQVVEVENGSVVLLEHNNAKVISKVESGYLAVDGNYLIPVESPIFK
FT                   ARRRMSESGIVIASVVINKKGLLAANPMVSMPGLLDPKEDVALVNLIKNDIKELVTIQN
FT                   KQAKKLLSDEQVIEAIKGTIRKTLKQEINKSPVIIVNIEKVISE"
FT   gene            653482..654249
FT                   /locus_tag="A1E_03130"
FT   CDS_pept        653482..654249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03130"
FT                   /product="inorganic polyphosphate/ATP-NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03130"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73561"
FT                   /db_xref="GOA:A8EYX8"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYX8"
FT                   /protein_id="ABV73561.1"
FT                   /translation="MNINKIALIYNKDYKSLAIIEEIKKLYNYCEVEEAEVIIVIGGDG
FT                   ALLHNIHCYMHLNIPFYGVNLGSLGFLMNTLDTKNLLQNIHDSTVTILNPLLMQAKDTS
FT                   GQIYTALAINEVSIFRKTNQAAKFRIDVNGIERMSELVADGALVATPAGSSAYNLSAGG
FT                   PILPLESNMLCLTPICAFRPRRWHGALLLSSATIKFEIFNTTKRPVNATADFQEFNNII
FT                   QVTVSSTKDKPIKLLFNKNHTLEDRIIKEQFGG"
FT   gene            654603..654791
FT                   /locus_tag="A1E_03135"
FT   CDS_pept        654603..654791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03135"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73562"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYX9"
FT                   /protein_id="ABV73562.1"
FT                   /translation="MNTNLALILLTPIAKIINKFIAKENIFSLAVVEKNIFLMEEVDKD
FT                   ILKSAPIVLNLLKTQGQ"
FT   gene            655103..655333
FT                   /locus_tag="A1E_03140"
FT   CDS_pept        655103..655333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03140"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73563"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYY0"
FT                   /protein_id="ABV73563.1"
FT                   /translation="MSFNLAEISESKLNLMNQDNLSKDSREQFGCFQYIAKYNKYSASE
FT                   KILNEENLKYELIEISDYIGGSIIITYNSII"
FT   gene            655891..656028
FT                   /locus_tag="A1E_03145"
FT   CDS_pept        655891..656028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03145"
FT                   /product="hypothetical protein"
FT                   /note="COG0061 Predicted sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03145"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73564"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYY1"
FT                   /protein_id="ABV73564.1"
FT                   /translation="MNTLKKGLIYRQQGDNGVKFIGKKAVEIKIDGNQRLFKNILHSNE
FT                   "
FT   gene            complement(656115..656714)
FT                   /locus_tag="A1E_03150"
FT   CDS_pept        complement(656115..656714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03150"
FT                   /product="recombination protein RecR"
FT                   /note="COG0353 Recombinational DNA repair protein (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03150"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73565"
FT                   /db_xref="GOA:A8EYY2"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYY2"
FT                   /protein_id="ABV73565.1"
FT                   /translation="MNETNDIDQLIYLFSKLPGLGSRSARRIVLYLLQDKDVRLKSLIN
FT                   NLINIDKKIVKCEICGNMDTENICRICSSEYRDKSVIAIVETVAELWAMERSGNFKGLY
FT                   HVLGYNLSAASRKNPSMLRLPELLTRCFAANIKEVIIATNSTLEGQTTAYFITEYLKEH
FT                   PAKISRLASGIPIGGELDYLDEGTLSAAINLRQPFE"
FT   gene            complement(656723..657241)
FT                   /locus_tag="A1E_03155"
FT   CDS_pept        complement(656723..657241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03155"
FT                   /product="hypothetical protein"
FT                   /note="COG1714 Predicted membrane protein/domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03155"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73566"
FT                   /db_xref="GOA:A8EYY3"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYY3"
FT                   /protein_id="ABV73566.1"
FT                   /translation="MKKQIIYPDFIARIFSTALDLSLFAFIAIPISQFCAFNLLWLFFN
FT                   DYFFSTNISLYPNEIFSSIMSQEFYEYLKAGNFNKYILFNISIFATNILVIGSYFITLW
FT                   YYTGATLSKMLLRMKIVDAVTLNRPTLKQLIKRFLGYMTFPIGIFFILFSSKKQALHDK
FT                   IAGTVVIKA"
FT   gene            657479..657907
FT                   /locus_tag="A1E_03160"
FT   CDS_pept        657479..657907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03160"
FT                   /product="Predicted membrane protein"
FT                   /note="COG1238 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03160"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73567"
FT                   /db_xref="GOA:A8EYY4"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYY4"
FT                   /protein_id="ABV73567.1"
FT                   /translation="MEQFEAYSLLFADSFVSNLVIGFQNELIFHSMKMFGGYNSLIMLL
FT                   VATCASLSSNAVNYIFGRIVLNIFYASKNEQNILRYKNLAKLYYTYEIFILFLMAFAFW
FT                   GSFISLFSGFFKTKFLKFLSICSLAKICYYVLTLYYIL"
FT   gene            657871..658305
FT                   /locus_tag="A1E_03165"
FT   CDS_pept        657871..658305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03165"
FT                   /product="ribosome-binding factor A"
FT                   /note="COG0858 Ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03165"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73568"
FT                   /db_xref="GOA:A8EYY5"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYY5"
FT                   /protein_id="ABV73568.1"
FT                   /translation="MLLCPNIILYSIIYDMKKLTKTNAHRQQKLASIINEVLIEILRRG
FT                   KMLDIRLFNCPLAITKVIVTADLKIANCYFLPFNTKLTIDDIMDALNNSKNAIRNFVTN
FT                   KINMKFSPEIRFHYDHGFDNAIKVEKLLKNISLKRRDKDK"
FT   gene            658634..659269
FT                   /locus_tag="A1E_03170"
FT   CDS_pept        658634..659269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03170"
FT                   /product="hypothetical protein"
FT                   /note="COG4395 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03170"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73569"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYY6"
FT                   /protein_id="ABV73569.1"
FT                   /translation="MSPQIIELLIFALIAFFIINKLITTLGSTAEEEQTKQKSYFGEPV
FT                   IKDVTYSAVKSNKAEKNLPTVEDIKAFQDIIVEQNITAVVDGMEQVHKRLYSFDPVKFI
FT                   NNAKTAFQMIIEAAYKKDTQELSELVDKRYLEEFEKITPSYGDFFDSSALSAKYSEIYL
FT                   FGNNIFIKLLFQGKNVVDKIEDLKEEWTFTRNANTKEVDWFLSNIEKV"
FT   gene            659445..661484
FT                   /locus_tag="A1E_03175"
FT   CDS_pept        659445..661484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03175"
FT                   /product="acylamino-acid-releasing enzyme"
FT                   /note="COG1506 Dipeptidyl
FT                   aminopeptidases/acylaminoacyl-peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03175"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73570"
FT                   /db_xref="GOA:A8EYY7"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYY7"
FT                   /protein_id="ABV73570.1"
FT                   /translation="MTKFSYIIAIILTIVVLFMFQNQTTVAGNNNQIIPRKVLFGNPDK
FT                   TRVSLTHDGKYILYIAPKDGILNIWLAPADNISKATAITHDKDRGIRDYIVAYNNKNII
FT                   YSKDHKGDENFRLYSYNIETKETKLITPAHDVRAGIVAVSYKNPNEILIDLNERNPKYF
FT                   DVYKLNLETLEKELVLKNEKFRGFIVDNNLHIKYAAAPDKDGGTEYYELKNNKWELFTK
FT                   ISMEDSVNTSILGFDTSDQILYMLDGRNRNTATLKALNLATGKDEILAEDSKVDISLFT
FT                   VHPIKQTPQAVSINYDRVSYKILDKDIEGDVKYLQALDRGDLIINSRTLDDNTWIVAYN
FT                   SDNAPVKYYKYDRQNKKAEFLFTNRKELEQYNLAKMIPVIIKSRDGLNLVSYITFPNYI
FT                   KLDANNIPDKKLPLIINVHGGPWVRDSWGYNPEHQWLANRGYAVLSINYRGSTGFGKDF
FT                   VNASNLEWGRKMHYDLLDGVNWAVKNNITDPDKVCIMGGSYGGYATLVGLTMTPDIFAC
FT                   GIDVVGPSNLLTLIKSVPPYWEPALNEFKKRIGSWDNEQDIEFLNKRSPLTFVDNIKKP
FT                   LFIAQGANDPRVKHTESDQIVNRMKAKHIPVVYALYNDEGHGFAKPSNRISYYALAEQF
FT                   LAKILKGRAENIGDDLKNANLILNDKDKITGEEAEKIIDTAVGN"
FT   gene            661660..662820
FT                   /locus_tag="A1E_03180"
FT   CDS_pept        661660..662820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03180"
FT                   /product="succinyl-CoA synthetase subunit beta"
FT                   /note="COG0045 Succinyl-CoA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03180"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73571"
FT                   /db_xref="GOA:A8EYY8"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYY8"
FT                   /protein_id="ABV73571.1"
FT                   /translation="MNIHEYQAKEILRKYGIPTSTGLVVTKTEQINETIDKLNTEVYVV
FT                   KAQIHAGGRGKAGGVKVVKSKEEAKKIAHDMFGINLVTHQTGPQGQKVKRLYIESGCDI
FT                   LKEYYFSIVFDRSASCITFIASTAGGVDIEEVAKKTPEKIVKFSVDPATGLQDFHMRGI
FT                   AYELGFKDNQVKQMKEIVKSVYNAFIETDATQIEINPLIVKTDGDLLALDAKITFDENA
FT                   LFKHPNVTAMRDYDEEDPLETRAANAGLSYVKMDGNIGCMVNGAGLAMATMDIIKLYGA
FT                   LPANFLDVGGGADCERIKEAFKIILSDKKVQGVLVNIFGGIMRCDIISEGIIAAAKEID
FT                   IKVPLVVRLAGTNVEKGKKILSNSGLEIITAHDLADAANKIVEAIS"
FT   gene            663016..663894
FT                   /locus_tag="A1E_03185"
FT   CDS_pept        663016..663894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03185"
FT                   /product="succinyl-CoA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03185"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73572"
FT                   /db_xref="GOA:A8EYY9"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYY9"
FT                   /protein_id="ABV73572.1"
FT                   /translation="MSILINKKTKVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGG
FT                   DTHLDLPVYNTVHEAKAKTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPVLD
FT                   MVKVKRALVGSKTRLIGPNCPGVITPGECKIGIMPGYIHQRGIVGIVSRSGTLTYEAVA
FT                   QTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEEDASDFI
FT                   KQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGITITRCPADI
FT                   GKTMLDLLNKG"
FT   gene            complement(664171..664239)
FT                   /locus_tag="A1E_03190"
FT   CDS_pept        complement(664171..664239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03190"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73573"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYZ0"
FT                   /protein_id="ABV73573.1"
FT                   /translation="MDKKIKALWFALEVINSIKLIN"
FT   gene            complement(664232..664342)
FT                   /locus_tag="A1E_03195"
FT   CDS_pept        complement(664232..664342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03195"
FT                   /product="hypothetical protein"
FT                   /note="COG0074 Succinyl-CoA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03195"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73574"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYZ1"
FT                   /protein_id="ABV73574.1"
FT                   /translation="MLKQITSEYKNNKISLNNFIAKVEALLDLLKEFDDG"
FT   gene            complement(664600..665400)
FT                   /locus_tag="A1E_03200"
FT   CDS_pept        complement(664600..665400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03200"
FT                   /product="Thiol:disulfide interchange protein DsbA"
FT                   /note="COG1651 Protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03200"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73575"
FT                   /db_xref="GOA:A8EYZ2"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041205"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYZ2"
FT                   /protein_id="ABV73575.1"
FT                   /translation="MQHIIGKVLAIFVIIIGVLFIFKTMKTYSTKWFSVEVQQSDNARK
FT                   YEEERIQEIIKDYLLKTPEIIIESIQGLQKRKVQENETKVNNYLKDNNLGIEDSQRFPI
FT                   IGNKDGDVTIIAFYDYNCSYCRKGNMSINELLQNDQKVKVVLRPLPILGDASEYLARIS
FT                   LAIYKINSSKFKVVHDELMKIRNISKESINELLTENGLNATEIDETADSTEIKDLITQN
FT                   IKIARNLRIQGVPAYIIDTTLIPGLIDFPQLLNIVKDIRDNKSF"
FT   gene            complement(665439..665897)
FT                   /locus_tag="A1E_03205"
FT   CDS_pept        complement(665439..665897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03205"
FT                   /product="SsrA-binding protein"
FT                   /note="COG0691 tmRNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03205"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73576"
FT                   /db_xref="GOA:A8EYZ3"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYZ3"
FT                   /protein_id="ABV73576.1"
FT                   /translation="MTRYKKVIAQNKKALFNYFIEERLEAGIVLKGSEVQSLRQGKASI
FT                   EESYAGDTGHELFLYNCHIAEYEKANKFNHATRRPRKLLLHTKEMKKIIGKIKIKGYTL
FT                   VALSMYFNKKNKVKVELGLAKGKKLYDKRESIKEKDWQRDQSRLIRQK"
FT   gene            complement(665894..666778)
FT                   /locus_tag="A1E_03210"
FT   CDS_pept        complement(665894..666778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03210"
FT                   /product="dihydrodipicolinate synthase"
FT                   /note="COG0329 Dihydrodipicolinate
FT                   synthase/N-acetylneuraminate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03210"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73577"
FT                   /db_xref="GOA:A8EYZ4"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EYZ4"
FT                   /protein_id="ABV73577.1"
FT                   /translation="MHNIFKGLITAAITPFKDNTLDLDALEKILEHQIKYEVDGVLIAG
FT                   STGECSNLSFEEYKLLLQTSLEIVNKRIPIISGCSSNNTAYARELAAESTKIGVDGFMA
FT                   SPPSYIKPTQEGIYKHFEALHEACNIPIMLYSAPTRSGVDFSDETILRLSKLSRILALK
FT                   DCGVDLERPMRIRTIVKEDFNLLTGNDEVVLAFNAQGGVGWVSVASNIVPNICKELLEK
FT                   WYKNDVKEALEIHQRLLPLYKALFVESNPIPIKYAAHYLGLCANKIRLPLTEASYKTKK
FT                   QIENIITSLSIKI"
FT   gene            complement(666900..667772)
FT                   /locus_tag="A1E_03215"
FT   CDS_pept        complement(666900..667772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03215"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="COG0115 Branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03215"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73578"
FT                   /db_xref="GOA:A8EYZ5"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYZ5"
FT                   /protein_id="ABV73578.1"
FT                   /translation="MTMIKLEQIFWHFWINGDLVPYQFARIHVLTHSLHYSGSVFEGER
FT                   AYNGKVFKLKEHTERLIKSAEALGLKVPYSVDEIMKAHELVIKQNNIKDAYIRPLIWCG
FT                   DESLNITNSDLSTNLLIAGIPSMPRAFEKGINLHISRWRKAMPDSTPLQSKSSAQYNMA
FT                   ITSKKEAKALGYDDALLLDYEGYIAECTTTNIFFVKDQTLYTPIADRFLNGITRQTIIE
FT                   IAKDFGLEVKEERLKLEQVESFTGCFVTGTAIEVQNINSIDLGKKKIIFNDHQIANTLK
FT                   KEYDYIVRE"
FT   gene            668028..668708
FT                   /locus_tag="A1E_03220"
FT   CDS_pept        668028..668708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03220"
FT                   /product="petR protein"
FT                   /note="COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03220"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73579"
FT                   /db_xref="GOA:A8EYZ6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYZ6"
FT                   /protein_id="ABV73579.1"
FT                   /translation="MHTYKAHILIVDDDSRILALLKQFLNKNEFLVSTANSVIEAKNLL
FT                   KTSSYDLIILDIMLPEITGLDFATTIRDAGNNIPIVMLTALSEADDRVKGLEAGASDYI
FT                   TKPFEPRELLLRINNLINNYNNFKKETNIIKFGNNFYNFDTKEFTKNNQIVSLSSTEQK
FT                   LLEILIKNSSKSISRFELSKIMGGLSMRSIDVQITRIRSKIEDNPKEPKYLKTVRNEGY
FT                   ALYI"
FT   gene            668740..670146
FT                   /locus_tag="A1E_03225"
FT   CDS_pept        668740..670146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03225"
FT                   /product="Osmolarity sensor protein EnvZ"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03225"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73580"
FT                   /db_xref="GOA:A8EYZ7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR022438"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYZ7"
FT                   /protein_id="ABV73580.1"
FT                   /translation="MCIIIIPILIGQIVAIFLFYDRHWYNVSYYTSTIIINEIESLIKE
FT                   HKNNTREITHLSEHYLNLSYQFQLSKKLPIKQPKLSEPLTIFKNILATKIHEKNIVKLN
FT                   KENKIEVFLELKDGILYITFPAKLLLNPTVYIFVLWIISLTVILLSISIIFSKNQIKSI
FT                   LALADSMDKFGQGVLKGKNFKPSGALEIRKAGLAFLKMKARIEKQITKRTTMLAMISHD
FT                   LRTPLTRMKLQLELMEENEEIKGLKQDILTMQQMINSYLDFAKGESTEKFEEILLLPWM
FT                   EHFLNKWSHVYSGKMSNGYTKINLEKSKESVNQGAERILICEHPRTYNDDVSNFSSSSN
FT                   INIEFIKSTNFNKLEVRIKPNSFARALSNLIGNAIKYSTKIKISLKDNSSTVAIIIEDN
FT                   GPGIDDAEKHFVFKPFYRSDKARQIDNASNVGLGLAITKEIINDHKGSIYLEDSKDLGG
FT                   LSVSIEIPKI"
FT   gene            670169..670849
FT                   /locus_tag="A1E_03230"
FT   CDS_pept        670169..670849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03230"
FT                   /product="undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /note="COG0020 Undecaprenyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03230"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73581"
FT                   /db_xref="GOA:A8EYZ8"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYZ8"
FT                   /protein_id="ABV73581.1"
FT                   /translation="MTNIKHLAIVMDGNARWADQNNLPKSTGHRTGADKIRELLPEFIN
FT                   FGIPYITLYTFSSENWQRSSTEVDFLIKLFSIYLKTELNNLHKNGIKIKVIGRLNLLNS
FT                   SLQKQINNAIELTKNNNKITLCIAFSYGSRQEIVDACTKIIASGKKEVTENDLQDALYD
FT                   PEMPDVDLLIRSGGVYRISNFLLWQAAYAELYFSSKYWPDFHKDDIQDAINDYSKRKRT
FT                   FGKR"
FT   gene            670809..671498
FT                   /locus_tag="A1E_03235"
FT   CDS_pept        670809..671498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03235"
FT                   /product="Phosphatidate cytidylyltransferase"
FT                   /note="COG0575 CDP-diglyceride synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03235"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73582"
FT                   /db_xref="GOA:A8EYZ9"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:A8EYZ9"
FT                   /protein_id="ABV73582.1"
FT                   /translation="MITQKGKEHLAKDKQNIYLRILSGIILVPLFVIAILWFKPLFYGL
FT                   MILVGMGMLSEWYNMTCSSTTYLLLGLIIIPIPISLLILLRTEDTNSWLIMLYFCIIWS
FT                   VDTFAMIGGQTFKGAILTTKISPKKTWSGLITGILSAGIVAVLVSFISGFHIENYYFSN
FT                   KVYLFIMSCILALIAQLSDLFISYFKRKFNIKDSGHIIPGHGGILDRFDSIILTVPVLF
FT                   CISNIIE"
FT   gene            671688..672023
FT                   /locus_tag="A1E_03240"
FT   CDS_pept        671688..672023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03240"
FT                   /product="hypothetical protein"
FT                   /note="COG2919 Septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03240"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73583"
FT                   /db_xref="GOA:A8EZ00"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ00"
FT                   /protein_id="ABV73583.1"
FT                   /translation="MMLMNLIHLNNNSKKIILNIFLALLLGYFVFHCIYGNKGIIAYLK
FT                   VNRQLEKAYDELKGLRAERVELEHNVKLLRTESLNKDMLEEQAKKVLGVAAPNEQVFTT
FT                   KDIPNQR"
FT   gene            672122..672733
FT                   /locus_tag="A1E_03245"
FT   CDS_pept        672122..672733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03245"
FT                   /product="ribonuclease D"
FT                   /EC_number="3.1.26.3"
FT                   /note="COG0349 Ribonuclease D"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03245"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73584"
FT                   /db_xref="GOA:A8EZ01"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ01"
FT                   /protein_id="ABV73584.1"
FT                   /translation="MTIKIYQNDLPNNFRLGGDLAIDTETMGLNLHRDKLCLLQFSNGN
FT                   GEAHLVHFENQNYTAPNLKALLSDKSRCKIFHFARFDLAAIKKYLEIELENIFCTKISS
FT                   KLVRTYTDSHGLKDLCRELLNINISKQQQSSYWRADNLSSEQKEYAAKDVLYLHQLKDI
FT                   LQKMLLKENRFELAQDIFRFVPTRANLDLLGWNEIDIFMH"
FT   gene            complement(673305..675809)
FT                   /locus_tag="A1E_03250"
FT   CDS_pept        complement(673305..675809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03250"
FT                   /product="leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03250"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73585"
FT                   /db_xref="GOA:A8EZ02"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EZ02"
FT                   /protein_id="ABV73585.1"
FT                   /translation="MNQIEQKWQQIWDDEKAFEVSNECNKPKYYVLEMLPYPSGKIHVG
FT                   HVRNYSIGDVIARFMNMQGFNVLHPMGWDAFGLPAENAAIKNNVHPKEWTYSNVDNMQQ
FT                   QLKSMGFAYDWSRVINSCDPQYYKYEQKFFLELYERNLAYQKEALVNWDPVDNTVLANE
FT                   QVVDGRGWRSGAIIEKRYLKQWFLKITDYAEELLNEIKNLKEWPEAVRSMQEKWIGKSI
FT                   GANFYFKVKDNEDAIIEVFSTKPETIFGASFIGIAFNHPIIEKLISKTPEISNFITKCL
FT                   HITGSSELEKAEKDGILTSLYVIHPFDPSIILPVIITNFVLMDYGTGAIFGCPAHDERD
FT                   HELAVKMNLPIKQVIEADIDVHKIAYTEDGILINSDFLNGLTNNEAKQKVIKEIEKLQI
FT                   GKRSINYRLKDWGISRQRFWGCPIPMIYCKVCDIVPVPYKDLPVTLPDNVKFNGHGNPL
FT                   DHHPTWKHVNCPKCDKPAIRETDTFDTFFESSWYFTRYCNSHATDMTDKKACDYWLPVD
FT                   KYIGGIEHAVMHLLYARFFTKVMNEQNYVSVREPFKGLFTQGMVLHATYKDEHNNWLYP
FT                   DEVVKKDNKFFHKKSGNLVVQGRIEKMSKSKKNLIDLETMQKQYGADAIRLFVLSDSPP
FT                   EKDLEWSVSGLEGCSRFINKLEHMFKVIASLKDDVTGINKELNRLVHLTIKYVAEDIKH
FT                   FALNRAIARMRELSNAISSEFSKEVMDVKTVKYGFNVLVQLLNPFIPHITEEIWQKLGN
FT                   KERLYKTAFPAFDESMLELDTYVMAVQVNGKLRDTYEFNNSASDYEIKQITINLPKVQK
FT                   FLEGTEPKKIIFVPRKIVNIIV"
FT   gene            complement(675990..676493)
FT                   /locus_tag="A1E_03255"
FT   CDS_pept        complement(675990..676493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03255"
FT                   /product="hypothetical protein"
FT                   /note="COG0495 Leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03255"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73586"
FT                   /db_xref="InterPro:IPR021959"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ03"
FT                   /protein_id="ABV73586.1"
FT                   /translation="MKKIIGLFIVIILSAISTSILADDYPKTEREQKWDEVGSIAGEEG
FT                   LVFRPGRVKNESTKAVVGLVNQYLWQAALETISFAPLASTDSNGGVIITEWYSPRANPN
FT                   FRFKINIFIKDNVISPDSIEVKVFEEMRKNKQWILNENTSNLAITLEEKILRKARDIYI
FT                   NSVR"
FT   gene            complement(676625..677764)
FT                   /locus_tag="A1E_03260"
FT   CDS_pept        complement(676625..677764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03260"
FT                   /product="DNA polymerase III subunit beta"
FT                   /note="COG0592 DNA polymerase sliding clamp subunit (PCNA
FT                   homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03260"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73587"
FT                   /db_xref="GOA:A8EZ04"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ04"
FT                   /protein_id="ABV73587.1"
FT                   /translation="MLKLIVETKMLVQSLGFASSVIEKRNVIPEYANIKLSAKDGNLEL
FT                   SSTNMDLYLSQKIAVQVVSEGELTVSTKTLNDVVRKLSDSELTLTDLGTTGLEIKGKNC
FT                   TFNLFTLPVSSFPAMDSINPEASFKISCTDFAKIIESTKFSISLDETRYNLNGVYLHIK
FT                   DKEFYSASTDGHRLSISWVTLEKQIKNFGVILPQKSAEEILKIVKDPKNINQDIEVLLS
FT                   SNKIKFICNENTIMLSKLIDGTFPDYSAFIPESSSSKLVINRKIFADSIDRIAIITVEK
FT                   FRAVKLLLSRETLEISAVGEARGNAQEVINSSQAKESFYEYNSDESLAIGFNPQYLDDV
FT                   LKAVKSDLVELYFSGVSAPVLIKFPENPEDIFVVMPVKV"
FT   gene            complement(677769..680282)
FT                   /locus_tag="A1E_03265"
FT   CDS_pept        complement(677769..680282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03265"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /note="COG0073 EMAP domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03265"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73588"
FT                   /db_xref="GOA:A8EZ05"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR022439"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ05"
FT                   /protein_id="ABV73588.1"
FT                   /translation="MKFTLSWLKQFLDTSASVAEIAEVLTAIGLEVEEVIDKAKELQKF
FT                   EVAHIINVKPHPSADKLKLCDVETKNGVLQIVCGASNARAGIKVVLANIGIEIPNGKFK
FT                   IKESTIRGEKSCGMLCSEEELLLASESEGIIELPEDAVLGENFTKYCGLDDPIFVINVT
FT                   PNRGDALGVYGVARDLAAKGLGTLKELEIPEIKSTFTSKIKLNVQDKEACPLFTFREIK
FT                   NLKNKPSPDWLRKLLKNVGVKTISSLVDVTNYISYSFGQPMHAYDADKIKDVIIVGRYY
FT                   EGKQVSSRDLTTGSNEITSAVSCAMDPAVKLRDDDTGQRYDKSDIVKFHALNGKEYLLT
FT                   ENDLVIKDECSIHGLAGVIGGVDSSCTDSTTNIILEAACFNAKIVAASGRRFQIDTDAR
FT                   YRNERNIDRNFTEKALDIATNLILSICGNGEISEIVKVGEKELKKPPLDFSACYLEKIT
FT                   GIRLNIKDIESILNKLGFITNIKDDVIKVIAPSWRHDITILEDIAEEIARIYGYDKIES
FT                   IKLPELVQDNNKLREYKIISIFKRILASKGYDEVVTNSFMNSEDAKLFAELKEELFLLN
FT                   PISVEDNYMRPTILPNLLSIVSKNLARSIKDMAFFEVGPSFVDLNTEASYLTAIITGAY
FT                   NNKNPHSSGRSYDIFDLKGNLEQVFDYAGLSIDKCIVANGAAAPQYYHPTRSANLALGK
FT                   NLLGHFGQIHPKILKHYDINQEIFAFELNITNLPVIKAKFGKREEFAVSDFQANFRDYA
FT                   FIVDQDHSVGEIISYINNFNKKLVKSVILFDIYNGDKLPQGKKSIAIKVELQADDRTLS
FT                   DTDLNSFSKDLVNATSQKFQGTLRE"
FT   gene            complement(680279..681328)
FT                   /locus_tag="A1E_03270"
FT   CDS_pept        complement(680279..681328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03270"
FT                   /product="phenylalanyl-tRNA synthetase alpha subunit"
FT                   /note="COG0016 Phenylalanyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03270"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73589"
FT                   /db_xref="GOA:A8EZ06"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EZ06"
FT                   /protein_id="ABV73589.1"
FT                   /translation="MENIAKILRLAEEKILLVQNLKDLQEYKVEFLGKNGIVTGELKKL
FT                   GSLNEQARKEFGLKINKLKDKIQNTIKVKEEILEEQELNLKLAADKIDLTIPARKYKQG
FT                   SIHPITQCSEELIQVFSKFGFTINNGPNIEDTFHNFTALNFEDDHPARQMHDTFYLKGQ
FT                   EDSKPMLLRTHTSTVQIRAMKNGNPPFRFIALGRTYRSDSDMTHTPMFHQIEGLVIDKN
FT                   INMGHLKYVITEFIRSFFENSHIELRFRPSFFPFTEPSAEVDIRMNKNDQWLEVLGCGM
FT                   VHPNVLKNVGIDSSEYQGFAFGLGVERFAMLKYNIKDLRQFFEGDMRWLKHYNFGGFDI
FT                   PNLAGGLTK"
FT   gene            complement(681364..682632)
FT                   /locus_tag="A1E_03275"
FT   CDS_pept        complement(681364..682632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03275"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /note="COG0621 2-methylthioadenine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03275"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73590"
FT                   /db_xref="GOA:A8EZ07"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ07"
FT                   /protein_id="ABV73590.1"
FT                   /translation="MNNSLKQDVVTFGCRLNIYESEIIRKNLELSGLDNVMVFNTCTVT
FT                   KAAEKQARQAIRGAKKDNPDLKIIVTGCSAQTSPQIYANMPEVDKVIGNEEKLLPNYYQ
FT                   ITDEKIAVNDIMSVKETAGHLVSSFNGKSRAFIQVQNGCDHFCTFCIIPYGRGKSRSVP
FT                   IGAITEQVKHLMLNGFKEVVFTGVDVTAYGSDLPGSPTFAQMIKRVLNLVPELRRLRLS
FT                   SIDVAEIDDELFELIAYSERIMPHFHISLQAGDDMILKRMKRRHKRTNVIEFCWKLRAI
FT                   RPEVSFGADIIAGFPTETPEMFENTRKLISEAELQYLHVFPYSEREGTPAARMPQVPKP
FT                   IRKERAEILRQEGQNQLTEFFKKHIGQKVELLVENNNIAHTENFIPVKLEKPLEIGQIF
FT                   KAKLVGIEERHMSCDVIPGVGRN"
FT   gene            complement(682625..683434)
FT                   /locus_tag="A1E_03280"
FT   CDS_pept        complement(682625..683434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03280"
FT                   /product="diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03280"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73591"
FT                   /db_xref="GOA:A8EZ08"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EZ08"
FT                   /protein_id="ABV73591.1"
FT                   /translation="MISKINFVKMHGLGNDCVIVNKRDLLNAHNLSQLAKNIADRHTGI
FT                   GCDQFIIYENHNNFYEMIIYNIDGSSAKLCGNATRCLAKLIYLDTGKKDITIVVGNKEL
FT                   LCRIEDENKISVNVGAVSFNETWMPSRDKIWAFAARYMIDLKETICVDVGNPHLVIFSK
FT                   LESQDQKIVGETLQAKELFANGVNVNFAEIKDNKINLSVWERGVGLTGACGSGACGSFA
FT                   AGLKRGFIHSPSTVVFKHGSLNMKEENGNIIMQGSATLIAEGVYCCE"
FT   gene            684072..684275
FT                   /locus_tag="A1E_03285"
FT   CDS_pept        684072..684275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03285"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73592"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ09"
FT                   /protein_id="ABV73592.1"
FT                   /translation="MAYFFKHANESTLEKMEHLIGHDFIIKKAFYVLDQAHWSEEDFNT
FT                   YEKIIKTEMANLAVEIAENYRC"
FT   gene            684351..684431
FT                   /locus_tag="A1E_03290"
FT   CDS_pept        684351..684431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03290"
FT                   /product="hypothetical protein"
FT                   /note="COG0253 Diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03290"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73593"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ10"
FT                   /protein_id="ABV73593.1"
FT                   /translation="MLTKNRPLDEIIDFTGLTAEKIKKLK"
FT   gene            684434..685597
FT                   /locus_tag="A1E_03295"
FT   CDS_pept        684434..685597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03295"
FT                   /product="capM protein"
FT                   /note="COG0438 Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03295"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73594"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ11"
FT                   /protein_id="ABV73594.1"
FT                   /translation="MKVLNIMLSRDLGGIQQAFLDYSTALEMQKIEVINTTSYKAKINS
FT                   FLPKKSLKLPNIVPFDLLSVLILKYIIYKTKPDIIIAHGNRAINFSKLAKIANIKLIGI
FT                   AHNYNLKGLRKCDFVIALTHHMQEYLLKNNFAESKIFILPNMINITKDFAPNKIDFLQN
FT                   EANKEKFEGDSFTRTAAYTSLLEASNTGSTYKLPLEGRYTRSLIYGKPIVICVLARLVA
FT                   KKGVDVFIKAIKILKEKKYDIQVVIGGEGEEKDNLITLVHTLNLQNQISFTGWINDKDK
FT                   FFEQSNIFCLPSLHEPFGIIVLEAMEASIPIVSTDTEGPTEILSNMQDGLICKAGSIED
FT                   LAEKIAYLIDNPQKAEEFSKNAYLKLQQNYDVKVVSKKLQHILESLI"
FT   gene            685668..685820
FT                   /locus_tag="A1E_03300"
FT   CDS_pept        685668..685820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03300"
FT                   /product="RND efflux system, outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03300"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73595"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ12"
FT                   /protein_id="ABV73595.1"
FT                   /translation="MFKIKESLANNSDIELVMSNVLVAKAQLNLVKAYRFAQINLSCRA
FT                   NQTKK"
FT   gene            complement(686575..687234)
FT                   /locus_tag="A1E_03305"
FT   CDS_pept        complement(686575..687234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03305"
FT                   /product="hypothetical protein"
FT                   /note="COG1538 Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03305"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73596"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ13"
FT                   /protein_id="ABV73596.1"
FT                   /translation="MFKKIIILFLGIFLLAGCTDNLRSYFQKSANNKLVDSKGAKGGKR
FT                   KPLYNNKYITLAKKNIVEGNLDYDNDDDYDDYDSDSALRGERIDPVKRNREMYLKMIKR
FT                   DIARQKAEAGEVESDDYMTLSRTNKKVRKDNSDKEKKMQEELKQIKAMLRETKRDILKH
FT                   TCPNATVNQNYTPPVTNYEPVNYPPVKNSKPYNNNSKVKQKFIREDDDNGSHACSI"
FT   gene            complement(687564..688628)
FT                   /locus_tag="A1E_03310"
FT   CDS_pept        complement(687564..688628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03310"
FT                   /product="N-acetylglucosaminyl transferase"
FT                   /note="COG0707 UDP-N-acetylglucosamine:LPS
FT                   N-acetylglucosamine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03310"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73597"
FT                   /db_xref="GOA:A8EZ14"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EZ14"
FT                   /protein_id="ABV73597.1"
FT                   /translation="MKKIILVAGGTGGHFFPAVALGEELIKRGYEVHFIIDLRCKKYIS
FT                   QDMKVIFHILDLKRSGNIFLFLPRLSIAVLKAIRLLYNIKPSVIVGFGGYPVISSMFAA
FT                   VFLRVPIIIHEQNSYLGKVNKFFTSFAKKIAISYKNIKNLPEFAKNKIVVTGGIVRKNI
FT                   RNLGSVAGPRNDKLFTIFIFGGSQGAKLFSELIPASIQILIQKKPQLKLHIIQQAALDD
FT                   QVKIKDIYLKLNITYELAEFFDNIALQYKDADLVISRAGASTIEELTYIGLPAIFIPLP
FT                   SAADNHQYYNAKWLEDTKAGWCLEQNNISAGKLADKILDLISNTKILEDASHNLLKRRK
FT                   EGHKLLSNLIEEVI"
FT   gene            complement(688625..689764)
FT                   /locus_tag="A1E_03315"
FT   CDS_pept        complement(688625..689764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03315"
FT                   /product="Cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03315"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73598"
FT                   /db_xref="GOA:A8EZ15"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ15"
FT                   /protein_id="ABV73598.1"
FT                   /translation="MFKNTEISNNFIKLWWRSTDRQIIISLIILFAFSLMLVTTSGSAV
FT                   ASRVGFEESYFASRQIFYLAAASGLILLFSCLNKKWLRRFAILGFVASVVLLIAVKFLG
FT                   YEIKGAVRWINILGLSIQPSEFTKPFFAVVTGWILSLKFNDDFPSITICVILYSIVAIL
FT                   VIIQPDFGMLVMITAVFGIQLFIAGMPIFWIVLAGFLVMLGITIAYFWLPHVTQRINSF
FT                   LDPDSSENYQVSKSLKAFEHGGLYGRGPGEGAVKQVLPDSHTDFIFAVAGEEFGAIICL
FT                   IVIGIFAFIVLRSLIKLLNEKDKFVQFAASGIIAQLGLQSIINMGVTLNLLPTKGMTLP
FT                   FISYGGSSTLAIAIATGMLLGFTRHRTPLNSYKIHNIEI"
FT   gene            689956..690534
FT                   /locus_tag="A1E_03320"
FT   CDS_pept        689956..690534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03320"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73599"
FT                   /db_xref="InterPro:IPR025311"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ16"
FT                   /protein_id="ABV73599.1"
FT                   /translation="MICKNLIEKLPIILQKHYNIKPYSNNKITLEGKMNITISKIFQCF
FT                   SPFCRAVWDLTSYPDNNLPVAVILTSDKTSPIILMHRIFYYKNRAAYHFYSKMILITDN
FT                   IILELIRFRIAIKLLYHLENNKIIMDYGRYVLYLGKSLIPIPLHLIIGKFFTYKETEND
FT                   KIFNMRVKMVHTLFSKIFEYTGKFKIEAL"
FT   gene            690832..691035
FT                   /locus_tag="A1E_03325"
FT   CDS_pept        690832..691035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03325"
FT                   /product="hypothetical protein"
FT                   /note="COG0772 Bacterial cell division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03325"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73600"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ17"
FT                   /protein_id="ABV73600.1"
FT                   /translation="MIADSRRFASKFATNLNNIVEQKKSLAITVGKYRTLCLSSAVLEY
FT                   YKIDYNTRDKKQKKVLQQLLAA"
FT   gene            complement(691042..692409)
FT                   /locus_tag="A1E_03330"
FT   CDS_pept        complement(691042..692409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03330"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03330"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73601"
FT                   /db_xref="GOA:A8EZ18"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ18"
FT                   /protein_id="ABV73601.1"
FT                   /translation="MHSHTKQKIGIFGLGKTGISVYEELQNKYDVIVYDDLKANRDIFE
FT                   ELFGKNLIAALSDSRWQNLDKIVLSPGVPLTHEIVRIAHHFNISITSDIDLLFEKSRNL
FT                   NFIAVIGTNGKSTTTALISHILNSNGLDYPVAGNIGVPALKAKNSKDGYVIELSSFQLD
FT                   LVKTFTAKIAVLLNITPDHLDRHKDMNGYIKAKSKIFNRMDKNSYAVINIDNDYCRKIF
FT                   MKLQQEQRIKLIPFSVTKILEKGISVVNNIINYSFFGNSNFKLPFNKNLQGIHNCENIA
FT                   ASYAVAKIMGLEESTKIIEAISSFQSLPHRMQYIGSINNISFYNDSKATNAISALQSIK
FT                   ALDNIYWLAGGIPKEGGIKEIMPYLNRIKKAYFYGQAKEMFADTVKNIVDFVICNDLKQ
FT                   VFDLAYKDAVGDTAAVKNILLAPSCSSYDQFKNFEERGELFIKLYLEKAKHKKNTI"
FT   gene            complement(692556..692801)
FT                   /locus_tag="A1E_03335"
FT   CDS_pept        complement(692556..692801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03335"
FT                   /product="hypothetical protein"
FT                   /note="COG0771 UDP-N-acetylmuramoylalanine-D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03335"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73602"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ19"
FT                   /protein_id="ABV73602.1"
FT                   /translation="MKKIFLLFTVLLITSACSKKLKETVGISTAGPNEYQVQRAKALEV
FT                   PPHYYLPDPNGQLIYNNIKGQGEFNEGEQALMQEIN"
FT   gene            complement(692822..693412)
FT                   /locus_tag="A1E_03340"
FT   CDS_pept        complement(692822..693412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03340"
FT                   /product="signal peptidase II"
FT                   /note="COG0597 Lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03340"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73603"
FT                   /db_xref="GOA:A8EZ20"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EZ20"
FT                   /protein_id="ABV73603.1"
FT                   /translation="MLLLLKKIYLTFARSSRIIITLVIIDQLSKWWFIDNLRWKPGLML
FT                   KVTAFLNMVYTWNYGISFGLMREYYQYSNAVFILTNSIIVCYLYYLMVCSKTIRGFAGY
FT                   SFVIGGAVGNLIDRLFRGAVFDFIHFYYKNYSFPVFNLADCFITIGVIILIEDYYSTKK
FT                   IIEEKAKEHYDNAQIKAMAEKIRNTDHNGDNKI"
FT   gene            complement(693708..695081)
FT                   /locus_tag="A1E_03345"
FT   CDS_pept        complement(693708..695081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03345"
FT                   /product="hypothetical protein"
FT                   /note="COG0739 Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03345"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73604"
FT                   /db_xref="GOA:A8EZ21"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ21"
FT                   /protein_id="ABV73604.1"
FT                   /translation="MNDTVLSCDFNDVLPSSFISARLRKILTSASLLLFIGLVFFISFA
FT                   VNNYVNNTLSITLVQPDSIEEETISFKEVVVKKGDTIKSILIEQNIPKNEIEKIINLVK
FT                   DGKLSSSLKIGQHITFEYETKINENEDEDLTSEVTFLNKIVIIIDKLKTIEVIRESDNF
FT                   KVEEIVVPLNKKVAKASVSIESNFMSALKKLGLSNNSIIELINAYAYQIDFQRQIKSGD
FT                   TVTVITEKYVTEDGKFSHHGKILYVSLNLSGKEYNIYRYSHNNNANNHAFFSEDGKSVK
FT                   RSLLKTPLKVIKVSSHYGNRKHPILGYTKMHKGVDFAAPVGTPIYSAGNGVITEIGWKS
FT                   GYGKFIQVKHSGTLSTAYAHASNFAKNLKVGSIVKQGQIIAYVGSTGRATGPHLHYEVK
FT                   IDGKHVNPMSVKTTPGIELNGKNLEKFQQFKQEIKTLNVKLDQELQADKTVEFLCDNR"
FT   gene            695834..696625
FT                   /locus_tag="A1E_03350"
FT   CDS_pept        695834..696625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03350"
FT                   /product="Cytochrome c oxidase polypeptide II"
FT                   /note="COG1622 Heme/copper-type cytochrome/quinol oxidases,
FT                   subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03350"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73605"
FT                   /db_xref="GOA:A8EZ22"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ22"
FT                   /protein_id="ABV73605.1"
FT                   /translation="MKNIITLSSLLIFSKMCFASEPLPWQVTFQPPASPIMEELHHFHN
FT                   FLLYISTAIVLFVAGLLGFVCIRFNAKNNPVPAKFAHNILIEIIWTVIPIIILVIIAVP
FT                   SFRILRHAEKIPEMDLTIKVVGYQWYWHYMYPDHNNLEFDSVMISDENLKPDQKRLLDV
FT                   DNRIVIPENANVRFLITAGDVIHSFAVPSLGFKIDAVPGRINETWTRVTKKGVYYGQCS
FT                   ELCGINHGFMPIAIEVVSKEDFDNWIASKNKVAMNAKLAAN"
FT   gene            696664..697047
FT                   /locus_tag="A1E_03355"
FT   CDS_pept        696664..697047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03355"
FT                   /product="Virginiamycin A acetyltransferase"
FT                   /note="COG0110 Acetyltransferase (isoleucine patch
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03355"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73606"
FT                   /db_xref="GOA:A8EZ23"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ23"
FT                   /protein_id="ABV73606.1"
FT                   /translation="MGTSFITDNINHPMDWFATAPFFIFKHRNNYTPSYDKRRDIIVGN
FT                   DVCFGTNSTIFCLELIFGDGAIIIMAKDLPPHSIVASNHAKIIRYRFFDKIIEQLLEIK
FT                   WWNWDYIIKSLKIFQFLEQILKN"
FT   gene            697067..698665
FT                   /locus_tag="A1E_03360"
FT   CDS_pept        697067..698665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03360"
FT                   /product="Cytochrome c oxidase polypeptide I"
FT                   /note="COG0843 Heme/copper-type cytochrome/quinol oxidases,
FT                   subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03360"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73607"
FT                   /db_xref="GOA:A8EZ24"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ24"
FT                   /protein_id="ABV73607.1"
FT                   /translation="MDITTSDINHDDYHTPHGWRRWLFSTNHKDIGIMYIIFAVFAGIV
FT                   GGLFSLLFRLELAMPGGTFLNHDFQLYNVLITAHAVIMVFFMIMPALFGGFGNYFVPLL
FT                   IGAPDMAFPRLNNISFWLLVPAFILLIGSAFVDGGPGTGWTLYPPLSNLSGHPGAAVDM
FT                   AIFSLHLTGLSSILGSINLIVTIFNMRAPGMGLFKMPLFVWSILVTAFLIILAMPVLGG
FT                   AITMLLTDRNFGTTFFKPEGGGDPVLFQHLFWFFGHPEVYIVILPGFGIVSQIISTFSR
FT                   KPIFGYQGMVGAMVIIGFVGFIVWAHHMFTVGLSYNALRYFTAGTMIIAVPTGIKIFSW
FT                   IATMWGGSITFLTPMLFSIGFIILFTIGGVTGIILSNSALDRVLHDTYYVVAHFHYTMS
FT                   LGALFTAFAGFYYWFGKMSGKQYPEVLGKIHFWITFIGVNLTFFPQHFLGLAGMPRRIP
FT                   DYPKAFTGWNMVSSIGAGISMLAALYFVFIVFYTLKYGKDCPTNPWGDGADTLEWTLTS
FT                   PPPFHTFETPPCIEE"
FT   gene            698892..699629
FT                   /locus_tag="A1E_03365"
FT   CDS_pept        698892..699629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03365"
FT                   /product="hypothetical protein"
FT                   /note="COG2071 Predicted glutamine amidotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03365"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73608"
FT                   /db_xref="GOA:A8EZ25"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ25"
FT                   /protein_id="ABV73608.1"
FT                   /translation="MHKKQIIGVTPDLVQNCEKYTYAAFPWYALRKNYTDAIIAAGGVP
FT                   LLLPYQSETIDQLINLVDGVLIPGGDEDIHPKFYELEYADDVVISNEERDNFEILVLKK
FT                   ALERDIPVLGICRGMQLLNVIFKGTLIKHIPDYIETIINHTQPPPKNIVSHAINIEANT
FT                   QLARIANNNLRTMVNSTHHQAVKQLGNDLIISAKAEDGIIEAIESTKHKFVIGVQWHPE
FT                   YFNDNRVDLELFKELVKASKCYQ"
FT   gene            700089..702875
FT                   /locus_tag="A1E_03370"
FT   CDS_pept        700089..702875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03370"
FT                   /product="hypothetical protein"
FT                   /note="COG2887 RecB family exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03370"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73609"
FT                   /db_xref="GOA:A8EZ26"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ26"
FT                   /protein_id="ABV73609.1"
FT                   /translation="MAANYSFLESFAKYIIDKLGKGKEVQIILPNNFSCLELKKILIDK
FT                   YKIKLPVIIPFISIISKKNLDADYISKIEELFILSEIITEYKELTFNIEESLKAAKILR
FT                   KLFNDLILNNIDIKLIEVYNNSSYWQKIYKFLEYCFLRWQEEISPIMNSDSFCDRCKER
FT                   SLYTNRRDDEQRSTKWRSIQYNQKQTKAVYKLKLLHEEIIKIKNGHKQIILAGIFKPDP
FT                   FLKKFKEELKDYIIHYNPSLSARDFLHNVDDKQEFVEDTERRTAAYTNVHEDSSTGSTH
FT                   KLPLDKNYARSLNNISYLEPHDIYEEAKQIAYICSRNKDKRIAIITDNNKLKRVYCNFL
FT                   DKYEDLLGHDLRLTNIGELLTSIIKILCNNFDLKTLFLLLKNPLINCPMVQKLELMLSN
FT                   KNRFISSPKYLLQLQFDNEDIREYCRNLIDILFTNTPYNIQDILVAAKEIAEKILPTIW
FT                   GKEGGTELLEFLTNLTAYCKYINPTDKKDFPKIFSFLLSNIRYYKNTEAANIIIGSPTD
FT                   LVLCEFDLIILPHFNNENWSPNKQVHPWLLNKKALQILNIDYDEIDSNLYSDYFNLFLQ
FT                   NKQVIILNAKKYDKKLTTTSNLFLKLQKDCVSSHDSIAGFSNYMDTVFKPQYNNESTAL
FT                   NTFFPTTLSVTDIETLIRNPYGFYAKKILGLRKKDNIWEEPKISDFGNFIHNVLEEYSK
FT                   NYDKQYMNLNLLDKQNALINIGNHILYSTILPIYTKKAWQIKLVAFSKAFILFDIERRK
FT                   NCKEIYFEIKGELRLNIAGQDIKIIGIADRIEISKSNNITILDYKTGTIPTKKEIELGL
FT                   SPQLIIESLMLLENGFTEFYSCKSGNPVINKEITIAYVKITSTDPYIQTTEIALNIKTL
FT                   NRHKAGLIKLLEHYITNKFFSYDLNLSKYNDYLHLSRCNTAIKSQYDKQDPLLQPNY"
FT   gene            complement(702858..703805)
FT                   /locus_tag="A1E_03375"
FT   CDS_pept        complement(702858..703805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03375"
FT                   /product="microcin C7 self-immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03375"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73610"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ27"
FT                   /protein_id="ABV73610.1"
FT                   /translation="MILKNLSLLIILLFSISAFSAANILKNIPITVVAPASGADNKTLS
FT                   DLKNINGLNLQIFSKCFTKIKLPFLASSDEVRFNCLQDALFDESDNAVWGLRGGYGSAR
FT                   LIPYLQKLSKPLKEKFFIGYSDITALHIFLSQEWGWHTIHGSNIADLLKPDKDQSNFTK
FT                   IAEILQGKVKQVTIDNLVPLNKIAKSSNLVNGKLTGGNLTMLQTSIGTNWQIKTRGKIL
FT                   FLEDVNVVAFRLDRDLLHLKQAGLLEDVKAIIFGSFDKDSEGTMLVLRNFADSLNIPVF
FT                   KTNRFGHDKINDPIIYNTDSKIIKNKGFKLVIGL"
FT   gene            complement(704098..704253)
FT                   /locus_tag="A1E_03380"
FT   CDS_pept        complement(704098..704253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03380"
FT                   /product="hypothetical protein"
FT                   /note="COG1619 Uncharacterized proteins, homologs of
FT                   microcin C7 resistance protein MccF"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03380"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73611"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ28"
FT                   /protein_id="ABV73611.1"
FT                   /translation="MEFYNDLLPTECKYPKRIRLVLVHMFCEKQVSFKVVQEIAQKANV
FT                   IIFGFK"
FT   gene            complement(705230..707185)
FT                   /locus_tag="A1E_03385"
FT   CDS_pept        complement(705230..707185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03385"
FT                   /product="Soluble lytic murein transglycosylase precursor"
FT                   /note="COG0741 Soluble lytic murein transglycosylase and
FT                   related regulatory proteins (some contain LysM/invasin
FT                   domains)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03385"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73612"
FT                   /db_xref="GOA:A8EZ29"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ29"
FT                   /protein_id="ABV73612.1"
FT                   /translation="MKIKLLIIIFLLAALNVNANSNPVDNIKQIFTYIDQKNWLQAEDL
FT                   ALEVNSKALTKIVLSQKFLDNKYSDNSFEQVIKFLCDNPDWPQSKLLQERAEEYLNNST
FT                   NKKVIFDWFSKHPPLTGKGYKFYAIAASSLIKDQKILLPIIKEVWVYANFTPEEENAYY
FT                   NKWHKYLTVNDHLERIEEHLWKNDIRSAEQSLKYVDQGYRNSFKAQIAIINKSPNAEQF
FT                   FRSVPEKYYTSGLLYRYLDSKKMQKPTKELMTLFKKAKNNRKHFAKWCRIQSYYARKFI
FT                   DYKDFAGSYKIATLPFATCPKTIREQAWLAGWLSLSFLKKTDQALVHFNKFIKVVKTPI
FT                   SLARGFYWLGRTYEAKGDKQMARKFYEQAAKYSFTFYGQVANIELNRTKLVLPHIPVIT
FT                   SEERKTIENKEIIQAIRLLVKYNKNYLAMIYSKAAIKNTKNPAEVQIIANIIKVNNNTN
FT                   YMVEVAKIAAQNNTFILDCAFPTPYNLAGLPIPPHLTYGIIRQESVFDHKAVSYANAMG
FT                   LMQLIKGTACDTARSINVKCNVEDLTRNPLYNIKLGSHYFKKLLDGHKGSYILSIASYN
FT                   AGIHNVVKWIDMFGDPRDIKDTRKVIDWIELIPYQETRDYVQRVLENVQIYRIILNKNN
FT                   NLYFKRDLHACSISKS"
FT   gene            complement(707337..707783)
FT                   /locus_tag="A1E_03390"
FT   CDS_pept        complement(707337..707783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03390"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /note="COG0756 dUTPase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03390"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73613"
FT                   /db_xref="GOA:A8EZ30"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EZ30"
FT                   /protein_id="ABV73613.1"
FT                   /translation="MTITQFKIQKLENFFGSLPKYATEHSAGMDLIAANKQPIIIKIGE
FT                   IQLIPTGIAIALPDLFEAQIRPRSGLAVKHGITVANSPGTIDSDYRGEIKVILINLGKE
FT                   DFIIEKGMRIAQMIISKYERILWKESNTLEETVRGSGGFGSTGV"
FT   gene            complement(707786..708700)
FT                   /locus_tag="A1E_03395"
FT   CDS_pept        complement(707786..708700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03395"
FT                   /product="possible protease sohB"
FT                   /note="COG0616 Periplasmic serine proteases (ClpP class)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03395"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73614"
FT                   /db_xref="GOA:A8EZ31"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ31"
FT                   /protein_id="ABV73614.1"
FT                   /translation="MNEVNKSTIAGAEFDQIITKRQISKLDQLVAAVFGDAKNVIAVLR
FT                   LSGVIGKVSTMQSGLTLESLNELIEKAFKIKKLKALCLIINSPGGSPVQSELIAKRIRD
FT                   LAKENKIKIYSFIEDMAASGGYWLACSGDRIYALSSSIIGSIGVVSSGFGFHEAINKLG
FT                   IERRVYTEGKNKSVLDPFQPINKDDLKIIKNLQKQVYEHFVDYIKTRRAGKLTQQDEIL
FT                   FNGEFWAGQTALDYGLIDGIGDMYSVMKQKFGDNIKFQYVCAKQPWLKKKLGMGSKIFT
FT                   DNLANSLINAVENKMINDKFDIK"
FT   gene            complement(708700..709368)
FT                   /locus_tag="A1E_03400"
FT   CDS_pept        complement(708700..709368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03400"
FT                   /product="Thiol:disulfide interchange protein TlpA"
FT                   /note="COG0526 Thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03400"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73615"
FT                   /db_xref="GOA:A8EZ32"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ32"
FT                   /protein_id="ABV73615.1"
FT                   /translation="MTLRNYNKYFLYIIVFLLSIILFIPKIYSKHQDKLEFLRGSSVPD
FT                   NVFFFDEEKNQYSLDQFEGKTILLVFWAIWSASCVNEIPALDMLQKDFRNLPFSVIPIS
FT                   DDYQDVKVIKEYFKSYQIRYLPIYYDYRNQLFEALSIVSRPTSILIDPNGKIVTSFVGN
FT                   TNWYDERTRETILSSIPGNYPEPKNSYNEQSLNKLAKPLQPIKNDTMKESNIQIKNEQN
FT                   "
FT   gene            complement(709630..710256)
FT                   /locus_tag="A1E_03405"
FT   CDS_pept        complement(709630..710256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03405"
FT                   /product="Protocatechuate-3,4-dioxygenase, beta subunit"
FT                   /note="COG3485 Protocatechuate 3,4-dioxygenase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03405"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73616"
FT                   /db_xref="GOA:A8EZ33"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ33"
FT                   /protein_id="ABV73616.1"
FT                   /translation="MQKFIFCFLCLCTLKMFAASKTYPNKLNHCKITRNIFNDYEPKVF
FT                   ETTNNLLRKTGRLSKFYGERILIKGKVLDQNCVPVADAKVYLWQAGSGGKYPYEPLKNR
FT                   VDKRRFTSESDSSFTGSGTATTNNKGEYYFISMLPYKSSRYLRNANIRVEHPSLTTLET
FT                   QLDLSNKNMCANECGEVNPILIEPQENIVSYCFDLVLQGTTLKRY"
FT   gene            710397..711392
FT                   /locus_tag="A1E_03410"
FT   CDS_pept        710397..711392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03410"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73617"
FT                   /db_xref="GOA:A8EZ34"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ34"
FT                   /protein_id="ABV73617.1"
FT                   /translation="MQKFLSLIIVILILYNIVKLKISPENNNPITLEHTASNNSSTDEK
FT                   QTSTNNELPIALNGNLFERTVSKIVINALKTEEGKAFFENILQPLNGPINPNDYTIEVR
FT                   KDLVKTLFKINTLGKGNIGPASCGHVVTVFYQISDINNNLISEDTKTFTLGSAPIMLGL
FT                   DNVIIGMMVGEAREAIIPAKYTINNSNNIIFDNAYNYKVNVMLKSILPQNFVKSNETKI
FT                   YDDEIAYRVPLLCGEKVSFNAKITRLSNGKILYDSKAKGQKIDMKIGDITYPFIFSYAL
FT                   QGKVPVGTRSVIAEGKTFKALGSNINKIISHELLPINEYLLLELNDFKQN"
FT   gene            complement(711440..711613)
FT                   /locus_tag="A1E_03415"
FT   CDS_pept        complement(711440..711613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03415"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73618"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ35"
FT                   /protein_id="ABV73618.1"
FT                   /translation="MLRSEEFRPIFSKIKYSFYAAIFMLQILNKHKIYPAIFMQAIRYT
FT                   IIIIMTRIDNKI"
FT   gene            711696..712073
FT                   /locus_tag="A1E_03420"
FT   CDS_pept        711696..712073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03420"
FT                   /product="hypothetical protein"
FT                   /note="COG1047 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerases 2"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03420"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73619"
FT                   /db_xref="GOA:A8EZ36"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ36"
FT                   /protein_id="ABV73619.1"
FT                   /translation="MAIIKKNQDIIIIVVGLIFLAAIIYISTNKSSNNKTNDNILEVKI
FT                   AIKDHKFVPNIVEVPKSTKIKLIVHNEDDTVEEFESHDLHREKIVMPHKSINIILAPLN
FT                   PGKYEFFGDFHQDRGFIIVND"
FT   gene            712082..712921
FT                   /locus_tag="A1E_03425"
FT   CDS_pept        712082..712921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03425"
FT                   /product="FTR1 family protein"
FT                   /note="COG0672 High-affinity Fe2+/Pb2+ permease"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03425"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73620"
FT                   /db_xref="GOA:A8EZ37"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ37"
FT                   /protein_id="ABV73620.1"
FT                   /translation="MFKIALVVFRECLEISLLLGVILAVTKQIEKSRLYIIAGAMLGVV
FT                   FASIFAFFTRKLSLSFGGIGDELFDSGIMILITILISWTIIWMQGYSIKVKQHINDLSV
FT                   KIHEGNASYFMLVFLVATTILREGAEIIILVYSISSVETLSSSIYLQGVIIGATSGFLL
FT                   GLVIYFGLIKIANQKYIFKISTVLLMLIAGGFAASAAGILTSSGLVMFLSDQLWDSSWL
FT                   VADRSMVGKILHIVTGYIARPNGLQVLAYFATILLINIFIQIKLRYSTNTLISVQNK"
FT   gene            712961..713503
FT                   /locus_tag="A1E_03430"
FT   CDS_pept        712961..713503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03430"
FT                   /product="putative intracellular septation protein"
FT                   /note="COG2917 Intracellular septation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03430"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73621"
FT                   /db_xref="GOA:A8EZ38"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EZ38"
FT                   /protein_id="ABV73621.1"
FT                   /translation="MLKLLSEIGPVIAFFAGFFYGGGIQNATLYMLITAIICVTICYFV
FT                   DKKVSKLSIISVSVLLVSGIITLISGNSIYIKIKPTILYVIFGIIFLMSGIRKNPFIKY
FT                   ALESIVRLKEESWITLSYRAAAFFFFMAVVNEIVWRNFSDETWVKFKVFGVIPITFIFI
FT                   LLQLPLLLKNKLPDSKI"
FT   gene            713500..714279
FT                   /locus_tag="A1E_03435"
FT   CDS_pept        713500..714279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03435"
FT                   /product="hypothetical protein"
FT                   /note="COG2823 Predicted periplasmic or secreted
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03435"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73622"
FT                   /db_xref="GOA:A8EZ39"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ39"
FT                   /protein_id="ABV73622.1"
FT                   /translation="MIYIKNILYFLHNLSYKEEFERNTSPCTLAYIDNHTDASTGLTYK
FT                   LPLKAGYPRSLLRILIFIALSFNLSACLPTIFTVATTTGIVASKDQPMSQTLNDSRISA
FT                   GIKTDLVKNNFRDLGAKIKVTVSQGRVLLTGNIQKELDALKAVNIAWNQKGVKEVINEL
FT                   KVNKNSNHFDLAQYTKDCMITTQIKAKNLVRKDIKFANYTIITIDNIVYLFGVARSEEE
FT                   LEKLASIASKIKGVEKVVCYAKIMDNFNKHEDYDTTP"
FT   gene            714263..714949
FT                   /locus_tag="A1E_03440"
FT   CDS_pept        714263..714949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03440"
FT                   /product="rare lipoprotein A precursor"
FT                   /note="COG0797 Lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03440"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73623"
FT                   /db_xref="GOA:A8EZ40"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ40"
FT                   /protein_id="ABV73623.1"
FT                   /translation="MIRHHKLSLLILLIFCFGLSGCNTSKQKQLLYSHKYSYKELSKDD
FT                   PHNLTYKGYYKVGKNYKIKGKTYKPHNPKSFTEIGYASWYGGRNGFHGRQTANGDRFNR
FT                   NILTAAHKTLPLPCLVKVTNKANNKSVILMVNDRGPFKKNRIIDVSQKAAEILAFKNQG
FT                   ITKVKIEYLPDETEQFLKKINLKKPQSKTLAKNSKKSSSTKVAKNGKCSINCHIKLVNL
FT                   KYKLWQ"
FT   gene            complement(715076..715996)
FT                   /locus_tag="A1E_03445"
FT   CDS_pept        complement(715076..715996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03445"
FT                   /product="Penicillin-binding protein DacF precursor"
FT                   /note="COG1686 D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03445"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73624"
FT                   /db_xref="GOA:A8EZ41"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ41"
FT                   /protein_id="ABV73624.1"
FT                   /translation="MFSKFLLPYIFIATFFFAPISEAKKNVQNTLKPPVQTSLVIDAKS
FT                   GKVLQSHNSQIPIYPASLTKLMTLYLMFESIEAGKLSLDKKLFVSAKASQMPPCKLGLK
FT                   AGETITVREAINGLIIKSANDAAVTVAENMKGSEKAFAHLMNVKAKQLGMKNTYFKNAS
FT                   GWHDPLQQTTARDIAKLAMALKRDYPKYYPLFSKTSFVFRGNIINGHNRVTKNYQGAEG
FT                   MKTGFHTPAGYNLVTTASRNGKSLIAVVTGSRSAVSRDQKMIGLLDHYFNIKPIAAKRS
FT                   IKLASNNKSTTKAKSKIMKKKNIRS"
FT   gene            complement(716153..717397)
FT                   /locus_tag="A1E_03450"
FT   CDS_pept        complement(716153..717397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03450"
FT                   /product="AmpG protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03450"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73625"
FT                   /db_xref="GOA:A8EZ42"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ42"
FT                   /protein_id="ABV73625.1"
FT                   /translation="MLITKIFKDYRLFEILILGIVSGMPLVIIFSTLSVWLKESDIDIA
FT                   VITTFAVARLSYSLKVFWSPLVDNFKIPFLSRWGHRKSWLILCSSLMALVLIAMSKQNP
FT                   EVSLTALYLLTIVLGFLSSTFDIAVDALRIDKFDQETQGIAGATAVLGYRIGMLITGAG
FT                   ALYLAEITGNNWQLTFFVIAIIFAVSVLFIITVNEKELVRENINITSITSWIYTVINPF
FT                   KDFFTREFAVTILLAVIFFKLGDAMLGAVASPFYIELGYTKGEIAIIAKLYGLIATLVG
FT                   GFAGGIVMYRVGNFKGLIITGIAQSLTHFAFIWLNQQPPTFEALLIAITIENFAAAMGA
FT                   TALVGYIGNLCNKKYSATQYALLSSASSLCNNTVTIYAGKLVNMLGWDGFFIFTIILAL
FT                   PALFILMYLNNKVKI"
FT   gene            complement(717572..719335)
FT                   /locus_tag="A1E_03455"
FT   CDS_pept        complement(717572..719335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03455"
FT                   /product="Multidrug resistance protein"
FT                   /note="COG1132 ABC-type multidrug transport system, ATPase
FT                   and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03455"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73626"
FT                   /db_xref="GOA:A8EZ43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ43"
FT                   /protein_id="ABV73626.1"
FT                   /translation="MSNNNLNDSYTAVYIITRLIKEHVKPYASKIYFAIFCMSIAAICT
FT                   AVIVHAVQPIIDKIFLTHDRKMLVMMPIVLTITFFIKGISEYYQNYLIKFVGQRVLNDL
FT                   QMKMYEHLLFADIAFIQNQSSGRLISRVTNDISLMRGAVSNLLVGCAKHFLTVVFLIGM
FT                   MFQLEPILSYVVFFVFPLAVYPVQKMGRIIRKISSQSQEELGHYTSRLDETFQSIKIIK
FT                   SFVGEKIESNRASLIVNNILEFYKKASKLDAMVSPIMEGLSGLAVGGMVWYGGNLVLNG
FT                   KSTPGALFAFLASFAAAYRPFKSLVSLNVNLQEGIAAAKRVFNILDSKPLIKDREDAKE
FT                   VDLYNPQITFEKLALSFESKIAIKYIDLKLEPHKMIAFVGRSGSGKTSLSNLLVRFYDP
FT                   NDGRVLINNHDIKDIKLTSLRGQISLVTQDTHLFDTTVAENIAYAQADTTREKIIRAAK
FT                   YADAHEFIMHLPNGYDTMIGVQGMTLSGGERQRLSLARAFLKDAPILILDEATSSLDQA
FT                   SEKKILESLKKLRQGKTTLIITHRLSSITDLDNIIVMKNGEICEQGTHTQLLKNKEEYY
FT                   RLYNKELRENS"
FT   gene            complement(719328..720356)
FT                   /locus_tag="A1E_03460"
FT   CDS_pept        complement(719328..720356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03460"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03460"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73627"
FT                   /db_xref="GOA:A8EZ44"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EZ44"
FT                   /protein_id="ABV73627.1"
FT                   /translation="MTNILSPEKSENDQELPIRPSYLQEFVGQQQIKENLLVFIKAAKS
FT                   RNEHLDHTLFYGPPGLGKTTLAKIVSNEIGVNFKSTSGPAILKAADLAAILTNLEKNDV
FT                   LFIDEIHRLNTSVEEVLYPAMEDFELDIIIGEGPAARSVKINLPHFTLIGATTRLGLLS
FT                   NPLRDRFGIPMRLNFYNNDELKKVLNRASKLLDIDLTESGSEEIAKRSRGTPRIALRLL
FT                   RRIRDFAVVDSKSVVDKEIADFGLNRLEVDHIGLDSNDYRYLKFIAANYNGGPVGIETI
FT                   AAALSEQRDALEETIEPYLIQIGLLQRTPRGRVITIAAFEHLKMPVPNKSHNQFNIFND
FT                   NE"
FT   gene            complement(720946..721146)
FT                   /locus_tag="A1E_03465"
FT   CDS_pept        complement(720946..721146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03465"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73628"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ45"
FT                   /protein_id="ABV73628.1"
FT                   /translation="MQGIYLDRVAAISYFLERHDYTISLSFYLAREISKWSIKQLLASI
FT                   RNSKIISCSIEQEYNGYSDKK"
FT   gene            complement(721433..721723)
FT                   /locus_tag="A1E_03470"
FT   CDS_pept        complement(721433..721723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03470"
FT                   /product="hypothetical protein"
FT                   /note="COG2255 Holliday junction resolvasome, helicase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03470"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73629"
FT                   /db_xref="GOA:A8EZ46"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ46"
FT                   /protein_id="ABV73629.1"
FT                   /translation="MKLYLADNLNKLFSILKDTDIKNLIFISLFAINKCSLLSLFLIDR
FT                   ECRITSIKIDSSLVDHEKLAIILGAFKNNTIQEVNLIGVILGSKLLNLRHF"
FT   gene            complement(721854..722468)
FT                   /locus_tag="A1E_03475"
FT   CDS_pept        complement(721854..722468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03475"
FT                   /product="Holliday junction DNA helicase motor protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03475"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73630"
FT                   /db_xref="GOA:A8EZ47"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EZ47"
FT                   /protein_id="ABV73630.1"
FT                   /translation="MIGKLSGKADSQGDDYVIIDVNGVGYLVYASGKTLDKLVEGEFYK
FT                   LFIETHVREEHIHLYGFLTLEEKNFFNLLQSVNGIGTRMALSILSNLTPDDIQIAVNNE
FT                   DKNIFKAISGVGAKLAERIVLELKDKVTKISSSSAIKDSLNIKNITPVTSNEVMKALIN
FT                   LGFSRFEAQNVVQGIITQNPKISIDELIKTALKNRNSKFFS"
FT   gene            complement(722470..722718)
FT                   /locus_tag="A1E_03480"
FT   CDS_pept        complement(722470..722718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03480"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73631"
FT                   /db_xref="GOA:A8EZ48"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ48"
FT                   /protein_id="ABV73631.1"
FT                   /translation="MDTVDSQEIKMKNFIKYLFFTVLYIVVTIIVAYMVLAKTIPNDGQ
FT                   CHMMDRPFVIHYILAAIITALPTLVLIYSKSKKKEKK"
FT   gene            complement(722957..723187)
FT                   /locus_tag="A1E_03485"
FT   CDS_pept        complement(722957..723187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03485"
FT                   /product="hypothetical protein"
FT                   /note="COG0632 Holliday junction resolvasome, DNA-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03485"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73632"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ49"
FT                   /protein_id="ABV73632.1"
FT                   /translation="MAQVFLKASSLHILALPVKRISLLMAGLFDLYSNNVTYEASNHLS
FT                   RIGFAKVNLIEKWFLEKIILMYIKIFLWPRG"
FT   gene            complement(723366..723554)
FT                   /locus_tag="A1E_03490"
FT   CDS_pept        complement(723366..723554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03490"
FT                   /product="hypothetical protein"
FT                   /note="COG3177 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03490"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73633"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ50"
FT                   /protein_id="ABV73633.1"
FT                   /translation="MSDKPPLQITNKILGLSQDISYELGILAGSKLYSQSIKLRKNNPI
FT                   KTIHSPLAIEGNTLSIE"
FT   gene            complement(723720..725036)
FT                   /locus_tag="A1E_03495"
FT   CDS_pept        complement(723720..725036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03495"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="COG0442 Prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03495"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73634"
FT                   /db_xref="GOA:A8EZ51"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR023716"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EZ51"
FT                   /protein_id="ABV73634.1"
FT                   /translation="MLLSKYFLPVLKEEPSEAQITSHKLMLRSGMIRQQAAGIYTWLPL
FT                   GLKILKNIENIVRSNMNKAGALEVLMPCIQPAHLWMESGRFENYGKEMLKFQDRHDNTL
FT                   LFGPTNEDMITDIFRHNIKSYKDLPKNLYHIQWKFRDEIRPRFGVMRGREFLMKDAYSF
FT                   DINEENAVKTYNQMFKTYINTFRDLGVFAIPVIADNGPIGGNLSNEFHIIAETGESTLY
FT                   YDKRFKIFKDNPDIDVEEIKSWYAASEEKHDVNKLPISEQEITSSKGIEVGHIFYIGSK
FT                   YSVNMNALINDEHGKLTPVEMSSYGIGISRLVAAIIEANCDEKGIIWPSSVAPFKVSLI
FT                   NLNIHDSKCTELAERAYKELSAQNIEVLYDDTDVRPGSKFATHDLIGSPYQIIIGPKKA
FT                   ANNIVEFKNRKSGVIEDIKIGNLKKLIMSCLRQQKSCNF"
FT   gene            complement(725127..725786)
FT                   /locus_tag="A1E_03500"
FT   CDS_pept        complement(725127..725786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03500"
FT                   /product="GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03500"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73635"
FT                   /db_xref="GOA:A8EZ52"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ52"
FT                   /protein_id="ABV73635.1"
FT                   /translation="MALIAIVGGLMFVYFYGKTMFLKTNKLMKLEKPSREEAKEAVRTL
FT                   LKFIGEDPNREGLLKTPDRVINSYMEIFSGYEKDVAEILSTKFYDTCNFQDFISLDGIR
FT                   FTSFCEHHMLPFNGTVHISYIPDNCIIGISKLARIVNVFARRLQIQEKMTVQIAESVQD
FT                   NLKPLGVAVRISALHSCMSIRGVIQDNSIMNTMHYTGIFAEQQKYRHEFLNLTATR"
FT   gene            complement(725919..726935)
FT                   /locus_tag="A1E_03505"
FT   CDS_pept        complement(725919..726935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03505"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73636"
FT                   /db_xref="GOA:A8EZ53"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ53"
FT                   /protein_id="ABV73636.1"
FT                   /translation="MNSITQLRNNSLTNSWLKLGVLSLGFASLYSIILVILHTPQLSSF
FT                   FPNPHIFKSALMIYVNVSVLIWLLSITASIWSLSFPRKRESRKNILDSRFRGNDIVVLN
FT                   PNIYPKLAFLSTILIAVSPIAGHNPVMHNYIPMLENIVFILGLSLFGVTLLLYAINILY
FT                   FFDWTNLSSLVNFTILSTIIMFILSCVCFCWSYNSLQNIIQIIPIEIEFYYELLFWSGG
FT                   YLLQFIYTQILIFILVILFKELIGRELKFQTFYLFLLYLNFIFGILIIFGHISYDIIDG
FT                   AFKKFYTNHMQYLGGIAYILCLVGMGFEWLLSMSYRGLTMVSRHRASTTSSRELHNK"
FT   gene            complement(727506..727622)
FT                   /locus_tag="A1E_03510"
FT   CDS_pept        complement(727506..727622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03510"
FT                   /product="hypothetical protein"
FT                   /note="COG0302 GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03510"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73637"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ54"
FT                   /protein_id="ABV73637.1"
FT                   /translation="MIEEEQEIQDSFVKKSTVAEVEKEKISLKLQLLIFLKI"
FT   gene            complement(727737..727813)
FT                   /locus_tag="A1E_t05722"
FT   tRNA            complement(727737..727813)
FT                   /locus_tag="A1E_t05722"
FT                   /product="tRNA-Ile"
FT   gene            complement(727837..727912)
FT                   /locus_tag="A1E_t05724"
FT   tRNA            complement(727837..727912)
FT                   /locus_tag="A1E_t05724"
FT                   /product="tRNA-Lys"
FT   gene            728159..728893
FT                   /locus_tag="A1E_03515"
FT   CDS_pept        728159..728893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03515"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03515"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73638"
FT                   /db_xref="GOA:A8EZ55"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EZ55"
FT                   /protein_id="ABV73638.1"
FT                   /translation="MKHSDVAVIIPSRLSSTRLKQKPLQLIGSITLIERVFKQVSQANL
FT                   EHTYVTTDSEEIAKIIKKVGGKVIFTNSNIPTGTDRTYEAFKLIPNNQNINYIVNVQGD
FT                   MPFIEPSSILKIIEYLKNSEYDIVTPVVKVDKESVEAASNVTVAVNSAGKALYFSRSLI
FT                   PNGAEEFLYHVGIYGFCKSALEKFISIKPTFLEKTERLEQLRILENNIAIGTCLVNNVP
FT                   ISVDTEEDLQKAIKFYENISKL"
FT   gene            728871..729038
FT                   /locus_tag="A1E_03520"
FT   CDS_pept        728871..729038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03520"
FT                   /product="hypothetical protein"
FT                   /note="COG1212 CMP-2-keto-3-deoxyoctulosonic acid
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03520"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73639"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ56"
FT                   /protein_id="ABV73639.1"
FT                   /translation="MKILVNYDTNSELIHHAINIEYKKQKPASTFNYINNILKSGFRTA
FT                   SNSNFYNLNQ"
FT   gene            730770..732293
FT                   /locus_tag="A1E_03535"
FT   CDS_pept        730770..732293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03535"
FT                   /product="ADP,ATP carrier protein"
FT                   /note="COG3202 ATP/ADP translocase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03535"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73640"
FT                   /db_xref="GOA:A8EZ57"
FT                   /db_xref="InterPro:IPR004667"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ57"
FT                   /protein_id="ABV73640.1"
FT                   /translation="MDALDSNFTIWNKARNSKYRHIVWPIRSYELTKFIPMALLMFFIL
FT                   LNQNLVRSIKDSFVVTLISSEVLSFIKLWGEMPMGVLFVILYSKLCNLMTTEHVFRIIT
FT                   GTFLFFFTIFGFILFPHRDFFHPDPELVKHYIIILPHLKWFLIMWGQWSLVLFYIMGEL
FT                   WPVIVFTLLYWQLANKITKVEEAPRFYSFFTLFGQTNLLISGTVIIYFAKSNHFLLPLF
FT                   SHLNDTNEILLKSFITVILISGLICLALHKFIDKSVVEADKNVKFKNQRTDILKLSLVE
FT                   SAKVIFTSRYLGFIYLIVMSYSISISLIEGLWMSKVKQLYPATKDFISYHGEVLFWTGV
FT                   ITLVSAFLGSSLIRICGWFWGAIITPIMMFGAGVMFFSFTVFENHLVNVANTLGYSSPL
FT                   VIIVFIGGLWHVLSKSVKYSLFDATKEMVYIPLDSEIKTKGKAAVDVMGTKIGKSIGAI
FT                   IQFISFSIFPHAVHNDITGLLMFSFIIVCLLWLYSVKVLSKHYNNLIKR"
FT   gene            732388..733332
FT                   /locus_tag="A1E_03540"
FT   CDS_pept        732388..733332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03540"
FT                   /product="malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03540"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73641"
FT                   /db_xref="GOA:A8EZ58"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EZ58"
FT                   /protein_id="ABV73641.1"
FT                   /translation="MKKNPKISLIGSGNIGGTLAHLISIKELGDIVLFDVAEGVPQGKA
FT                   LDLMQAGTMLGSDIKIKGSNNYKDIEGSDAIIITAGLPRKPGMSRDDLISVNTKIMKDV
FT                   AQNIKKYAPSAFVIVITNPLDVMVYVILKESGLPHNKVIGMAGVLDSSRFNLFLAEEFK
FT                   VSVNSVNSIVLGGHGEAMVPLARYSTVSGIPIPDLIKMGLSSNENIEKIIDRTRNGGGE
FT                   IVALLKTGSAYYAPATSAIEMLESYLKDKRQILTCAAYLQGEYGIHDLYVGVPIIIGTE
FT                   GVLNVIELQLTKEEKALFDKSVEGVRKLIEMVK"
FT   gene            734040..734252
FT                   /locus_tag="A1E_03545"
FT   CDS_pept        734040..734252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03545"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73642"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ59"
FT                   /protein_id="ABV73642.1"
FT                   /translation="MQETIKNPTKNEEFNKTSKEILDLINNINSNQPSRLQATRNKILS
FT                   AGGSPNTKNTKINEFFLEQHEWDKF"
FT   gene            734623..734865
FT                   /locus_tag="A1E_03550"
FT   CDS_pept        734623..734865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03550"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73643"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ60"
FT                   /protein_id="ABV73643.1"
FT                   /translation="MLLIDHADNISQNIKETLVLYAGSNNNNKIDILSEELAKKFKNIS
FT                   NLIKQNESVLQRGTGKYSPALKTILEAAIPSCHQQ"
FT   gene            735025..735234
FT                   /locus_tag="A1E_03555"
FT   CDS_pept        735025..735234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03555"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73644"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ61"
FT                   /protein_id="ABV73644.1"
FT                   /translation="MEISSAIQGELSTTFGKSSSTNLIEALDLAQPQILSNSNTAKDKL
FT                   TATKELQKLIQQKEVKNEKLTHYL"
FT   gene            735322..735426
FT                   /locus_tag="A1E_03560"
FT   CDS_pept        735322..735426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03560"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73645"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ62"
FT                   /protein_id="ABV73645.1"
FT                   /translation="MLNKNYYKLTDLHEEHRTHTLRDDTSLDIRDITI"
FT   gene            735444..735584
FT                   /locus_tag="A1E_03565"
FT   CDS_pept        735444..735584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03565"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73646"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ63"
FT                   /protein_id="ABV73646.1"
FT                   /translation="MPFPIQKSYGAGNVLGRLKEAVDDYISELQNEKLSKEKKRLRNRL
FT                   I"
FT   gene            735933..736106
FT                   /locus_tag="A1E_03570"
FT   CDS_pept        735933..736106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03570"
FT                   /product="hypothetical protein"
FT                   /note="COG0039 Malate/lactate dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03570"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73647"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ64"
FT                   /protein_id="ABV73647.1"
FT                   /translation="MSEDINIKENNTKNLKDKFEKSAKEAKQIGTQAQQRSKFLSNSSI
FT                   KPTVQNKNGRII"
FT   gene            complement(736140..737468)
FT                   /locus_tag="A1E_03575"
FT   CDS_pept        complement(736140..737468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03575"
FT                   /product="Proline/betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03575"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73648"
FT                   /db_xref="GOA:A8EZ65"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ65"
FT                   /protein_id="ABV73648.1"
FT                   /translation="MSNSAFLVAFFTTIIRYYDYALFSLSASILAQNFLPSIEHDKQLL
FT                   GFFAVLSAAVIVRPLGSLIFGFIGDKYGRTKSIKISMFISSISTGLIAITPSFEMIGIF
FT                   ATVILTLCRMVFLVSLAGEIDGIKVYVAEKTGYNRKNLNIGIVSCCGQIGALLASIAYY
FT                   YASNSSIEYLWRFNFFIGAIFGLFAILMKNFFKESIEFLYYKNSVSFKKFDTSAFCGTP
FT                   RYSRTNAHCVDSSLNSSCLKLFEFSCMQQIKIIKDNLFSFIIALLINGAIGGMYHFLVI
FT                   FLGVFLAKITFINHPEIRFMNIALTTTYGISALFAGLLADKINPLKQIIWALFASIIVA
FT                   LWMQIMLYKKIFNLLCPVILIGLAAFYAVPLQIIIQSLFKTNVKMRLYSLSHSLGGIIL
FT                   SSSTPFFSMLLWKNFKSLPLTLSFIIFLLMILISTVLVLCKRK"
FT   gene            complement(737776..737868)
FT                   /locus_tag="A1E_03580"
FT   CDS_pept        complement(737776..737868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03580"
FT                   /product="hypothetical protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03580"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73649"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ66"
FT                   /protein_id="ABV73649.1"
FT                   /translation="MHSRWDKHREELAKALKGTKKKIESISRGV"
FT   gene            complement(738097..740397)
FT                   /locus_tag="A1E_03585"
FT   CDS_pept        complement(738097..740397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03585"
FT                   /product="phosphate acetyltransferase"
FT                   /note="COG0281 Malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03585"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73650"
FT                   /db_xref="GOA:A8EZ67"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ67"
FT                   /protein_id="ABV73650.1"
FT                   /translation="MDEMNKINYAEALEYHKKDKPGKIAISTTKSLVTQQDLSLAYSPG
FT                   VAAPCLEIAKNLEEVYKYTARGNLVAVISNGTAVLGLGNLGAAASKPVMEGKAVLFKKF
FT                   ADIDAIDLEINTEEPEEFINAVKYLGYSFGGINLEDIKAPECFIIEERLKSLMDIPVLH
FT                   DDQHGTAIITAAGLINAAYLTNRKLEDLKIIVNGAGAAAIACIDLLIALGADKSKIILC
FT                   DTKGVIYKGRTQGMNKWKELYASDTKFRTLEESLNNSDVFIGLSVKGAVTKEMVSKMAN
FT                   NPIIFAMANPDPEITPEEIKFVRDDAIIATGRSDYNNQINNVMGFPYIFRGALDVRAKT
FT                   INTEMKIAAAKAIAELARKPVPEEVYKAYSGKMVFGKEYIIPVPFDPRLMTVVAAAVAV
FT                   AAIESGVARIKDFNIGKYKKELGSRFNPTAHYINFLSEKIHNAPLKRIVFAEGEEEEVI
FT                   SAALMMRDEKYGHPVIIGRAERIEATLKKLGQDISLDGIQIMNAALSDSLEKYTDYLYK
FT                   RLQRRGYLYHDCAKLVKTNKNIFAGCMVACGDGDALLTGVTKSYIDSLEDIMQVISPKP
FT                   NRRILGYSIMIAKDNNIIIADNCITEYPSSWELAQITTQMAEIAKNMGITPRVALLSFS
FT                   TFGNSSKEKTDRIREAINILDNFSEEKKELNGMKIDFEYDGEMSVKVALDSELRKLYKF
FT                   CRLSGTANVLIMPSLNSAAISTELLQEFSSNSFIGPITNGFEKPVQILQATATANEILK
FT                   IATFACVEAIKEV"
FT   gene            complement(740506..741447)
FT                   /locus_tag="A1E_03590"
FT   CDS_pept        complement(740506..741447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03590"
FT                   /product="Predicted permease"
FT                   /note="COG0679 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03590"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73651"
FT                   /db_xref="GOA:A8EZ68"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A8EZ68"
FT                   /protein_id="ABV73651.1"
FT                   /translation="MNEIFCSTLPIFLIILLGSIIKNKWLTSEEFWRGIEKLSYFVLFP
FT                   AMLFNYVSTADLSVASIIKLVVALIISTILVSLGLIIYQKKYNIDKVQFTSIFQGSIRY
FT                   NSYIFFGVSSPLLGFSGLSVVAVISSYMIIFTNILSVMIFAYYIPNKSVTNTIRTSFVL
FT                   MMKLIVRNPLIIASLVGFIFNYSNLELHLGLKKTLDSLSNAALAIGMLNVGAGLNFTIR
FT                   QELLHNVLFTSFIKLVAFPLVSVIVLWLMSIDGLDRSVGILYSCLPCASTAYVLSRQLD
FT                   GDPDSMAAIITFTTFFSVITISIIMYIIGSRM"
FT   gene            complement(741514..743082)
FT                   /locus_tag="A1E_03595"
FT   CDS_pept        complement(741514..743082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03595"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="COG1384 Lysyl-tRNA synthetase (class I)"
FT                   /db_xref="EnsemblGenomes-Gn:A1E_03595"
FT                   /db_xref="EnsemblGenomes-Tr:ABV73652"
FT                   /db_xref="GOA:A8EZ69"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8EZ69"
FT                   /protein_id="ABV73652.1"
FT                   /translation="MLEIWEDAIQSNAWPFVEAKKILDSLNGKTPEKGYILFETGYGPS
FT                   GLPHIGTFGENARMVMVQKAFEQLSSIPTKLICFSDDMDGLRKVPSNIPNSEMLAQYMD
FT                   MPLTSILDPFGEYESYGAYMNAKLRSFLDKFGFEYEFYSSTKCYKAGMFDEMLLKVLEK
FT                   YDEIMELMLPTFREERKATYSPFMPICPKTGKVLQVPIEKWDAKRGTVTYKDEDNNYIE
FT                   VPVTGGHCKLQWKPDFGMRWAALKVDYEMYGKDHLANARLYSEICRILGGKPPVQLCYE
FT                   LFLDENGEKISKSKGNSISVDDWLKYAPVESMALFMYQNPTRAKRLFFDVIPQNVDAYI
FT                   TFNQKYHLEEDRAKRFANPVYHIHHGHVPKIETFGITYSLLLNLTSVCNPSDKSVLWGF
FT                   ISKYAPKATPNTTTYLDRLAEFAIRYYDDFIKAHKSYYTPSEKHKVILRDILDMLSSIS
FT                   EETEGEVIQKSIYDIGMKAGYENLRDYFKDLYQILLGQNEGPRLGTFIKLYGIKEMKKL
FT                   IERKL"
FT   gene            743307..743825
FT                   /locus_tag="A1E_03600"
FT   CDS_pept        743307..743825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1E_03600"
FT                   /product=