(data stored in ACNUC7421 zone)

EMBL: CP000413

ID   CP000413; SV 1; circular; genomic DNA; STD; PRO; 1894360 BP.
XX
AC   CP000413; AAAO02000000-AAAO02000046;
XX
PR   Project:PRJNA84;
XX
DT   15-OCT-2006 (Rel. 89, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 10)
XX
DE   Lactobacillus gasseri ATCC 33323, complete genome.
XX
KW   .
XX
OS   Lactobacillus gasseri ATCC 33323 = JCM 1131
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae;
OC   Lactobacillus.
XX
RN   [1]
RP   1-1894360
RX   DOI; 10.1073/pnas.0607117103.
RX   PUBMED; 17030793.
RA   Makarova K., Slesarev A., Wolf Y., Sorokin A., Mirkin B., Koonin E.,
RA   Pavlov A., Pavlova N., Karamychev V., Polouchine N., Shakhova V.,
RA   Grigoriev I., Lou Y., Rohksar D., Lucas S., Huang K., Goodstein D.M.,
RA   Hawkins T., Plengvidhya V., Welker D., Hughes J., Goh Y., Benson A.,
RA   Baldwin K., Lee J.H., Diaz-Muniz I., Dosti B., Smeianov V., Wechter W.,
RA   Barabote R., Lorca G., Altermann E., Barrangou R., Ganesan B., Xie Y.,
RA   Rawsthorne H., Tamir D., Parker C., Breidt F., Broadbent J., Hutkins R.,
RA   O'Sullivan D., Steele J., Unlu G., Saier M., Klaenhammer T., Richardson P.,
RA   Kozyavkin S., Weimer B., Mills D.;
RT   "Comparative genomics of the lactic acid bacteria";
RL   Proc. Natl. Acad. Sci. U.S.A. 103(42):15611-15616(2006).
XX
RN   [2]
RP   1-1894360
RG   US DOE Joint Genome Institute (JGI), The Lactic Acid Bacteria Genome
RG   Consortium and Fidelity Systems Inc.
RA   Lucas S., Copeland A., Detter J.C., Glavina del Rio T., Pitluck S.,
RA   Grigoriev I., Rokhsar D., Slesarev A., Pavlov A., Pavlova N.,
RA   Karamychev V., Polouchine N., Shakhova V., Kozyavkin S., Makarova K.,
RA   Koonin E., Mills D.A., Richardson P.;
RT   ;
RL   Submitted (22-MAY-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 2ac582064c5f44f5439efbc43abbf5ce.
DR   BioSample; SAMN02598542.
DR   EnsemblGenomes-Gn; EBG00000995868.
DR   EnsemblGenomes-Gn; EBG00000995869.
DR   EnsemblGenomes-Gn; EBG00000995870.
DR   EnsemblGenomes-Gn; EBG00000995871.
DR   EnsemblGenomes-Gn; EBG00000995872.
DR   EnsemblGenomes-Gn; EBG00000995873.
DR   EnsemblGenomes-Gn; EBG00000995874.
DR   EnsemblGenomes-Gn; EBG00000995875.
DR   EnsemblGenomes-Gn; EBG00000995876.
DR   EnsemblGenomes-Gn; EBG00000995877.
DR   EnsemblGenomes-Gn; EBG00000995878.
DR   EnsemblGenomes-Gn; EBG00000995879.
DR   EnsemblGenomes-Gn; EBG00000995880.
DR   EnsemblGenomes-Gn; EBG00000995881.
DR   EnsemblGenomes-Gn; EBG00000995882.
DR   EnsemblGenomes-Gn; EBG00000995883.
DR   EnsemblGenomes-Gn; EBG00000995884.
DR   EnsemblGenomes-Gn; EBG00000995885.
DR   EnsemblGenomes-Gn; EBG00000995886.
DR   EnsemblGenomes-Gn; EBG00000995887.
DR   EnsemblGenomes-Gn; EBG00000995888.
DR   EnsemblGenomes-Gn; EBG00000995889.
DR   EnsemblGenomes-Gn; EBG00000995890.
DR   EnsemblGenomes-Gn; EBG00000995891.
DR   EnsemblGenomes-Gn; EBG00000995892.
DR   EnsemblGenomes-Gn; EBG00000995893.
DR   EnsemblGenomes-Gn; EBG00000995894.
DR   EnsemblGenomes-Gn; EBG00000995895.
DR   EnsemblGenomes-Gn; EBG00000995896.
DR   EnsemblGenomes-Gn; EBG00000995897.
DR   EnsemblGenomes-Gn; EBG00000995898.
DR   EnsemblGenomes-Gn; EBG00000995899.
DR   EnsemblGenomes-Gn; EBG00000995900.
DR   EnsemblGenomes-Gn; EBG00000995901.
DR   EnsemblGenomes-Gn; EBG00000995902.
DR   EnsemblGenomes-Gn; EBG00000995903.
DR   EnsemblGenomes-Gn; EBG00000995904.
DR   EnsemblGenomes-Gn; EBG00000995905.
DR   EnsemblGenomes-Gn; EBG00000995906.
DR   EnsemblGenomes-Gn; EBG00000995907.
DR   EnsemblGenomes-Gn; EBG00000995908.
DR   EnsemblGenomes-Gn; EBG00000995909.
DR   EnsemblGenomes-Gn; EBG00000995910.
DR   EnsemblGenomes-Gn; EBG00000995911.
DR   EnsemblGenomes-Gn; EBG00000995912.
DR   EnsemblGenomes-Gn; EBG00000995913.
DR   EnsemblGenomes-Gn; EBG00000995914.
DR   EnsemblGenomes-Gn; EBG00000995915.
DR   EnsemblGenomes-Gn; EBG00000995916.
DR   EnsemblGenomes-Gn; EBG00000995917.
DR   EnsemblGenomes-Gn; EBG00000995918.
DR   EnsemblGenomes-Gn; EBG00000995919.
DR   EnsemblGenomes-Gn; EBG00000995920.
DR   EnsemblGenomes-Gn; EBG00000995921.
DR   EnsemblGenomes-Gn; EBG00000995922.
DR   EnsemblGenomes-Gn; EBG00000995923.
DR   EnsemblGenomes-Gn; EBG00000995924.
DR   EnsemblGenomes-Gn; EBG00000995925.
DR   EnsemblGenomes-Gn; EBG00000995926.
DR   EnsemblGenomes-Gn; EBG00000995927.
DR   EnsemblGenomes-Gn; EBG00000995928.
DR   EnsemblGenomes-Gn; EBG00000995929.
DR   EnsemblGenomes-Gn; EBG00000995930.
DR   EnsemblGenomes-Gn; EBG00000995931.
DR   EnsemblGenomes-Gn; EBG00000995932.
DR   EnsemblGenomes-Gn; EBG00000995933.
DR   EnsemblGenomes-Gn; EBG00000995934.
DR   EnsemblGenomes-Gn; EBG00000995935.
DR   EnsemblGenomes-Gn; EBG00000995936.
DR   EnsemblGenomes-Gn; EBG00000995937.
DR   EnsemblGenomes-Gn; EBG00000995938.
DR   EnsemblGenomes-Gn; EBG00000995939.
DR   EnsemblGenomes-Gn; EBG00000995940.
DR   EnsemblGenomes-Gn; EBG00000995941.
DR   EnsemblGenomes-Gn; EBG00000995942.
DR   EnsemblGenomes-Gn; EBG00000995943.
DR   EnsemblGenomes-Gn; EBG00000995944.
DR   EnsemblGenomes-Gn; EBG00000995945.
DR   EnsemblGenomes-Gn; EBG00000995946.
DR   EnsemblGenomes-Gn; EBG00000995947.
DR   EnsemblGenomes-Gn; EBG00000995948.
DR   EnsemblGenomes-Gn; EBG00000995949.
DR   EnsemblGenomes-Gn; EBG00000995950.
DR   EnsemblGenomes-Gn; EBG00000995951.
DR   EnsemblGenomes-Gn; EBG00000995952.
DR   EnsemblGenomes-Gn; EBG00000995953.
DR   EnsemblGenomes-Gn; EBG00000995954.
DR   EnsemblGenomes-Gn; EBG00000995955.
DR   EnsemblGenomes-Gn; EBG00000995956.
DR   EnsemblGenomes-Gn; EBG00000995957.
DR   EnsemblGenomes-Gn; EBG00000995958.
DR   EnsemblGenomes-Gn; EBG00000995959.
DR   EnsemblGenomes-Gn; EBG00000995960.
DR   EnsemblGenomes-Gn; EBG00000995961.
DR   EnsemblGenomes-Gn; EBG00000995962.
DR   EnsemblGenomes-Gn; EBG00000995963.
DR   EnsemblGenomes-Gn; EBG00000995964.
DR   EnsemblGenomes-Gn; EBG00000995965.
DR   EnsemblGenomes-Gn; EBG00000995966.
DR   EnsemblGenomes-Gn; EBG00000995967.
DR   EnsemblGenomes-Gn; EBG00000995968.
DR   EnsemblGenomes-Gn; EBG00000995969.
DR   EnsemblGenomes-Gn; EBG00000995970.
DR   EnsemblGenomes-Gn; EBG00000995971.
DR   EnsemblGenomes-Gn; EBG00000995972.
DR   EnsemblGenomes-Gn; LGAS_r0449.
DR   EnsemblGenomes-Gn; LGAS_r0450.
DR   EnsemblGenomes-Gn; LGAS_r0451.
DR   EnsemblGenomes-Gn; LGAS_r1021.
DR   EnsemblGenomes-Gn; LGAS_r1564.
DR   EnsemblGenomes-Gn; LGAS_r1565.
DR   EnsemblGenomes-Gn; LGAS_r1566.
DR   EnsemblGenomes-Gn; LGAS_r1583.
DR   EnsemblGenomes-Gn; LGAS_r1584.
DR   EnsemblGenomes-Gn; LGAS_r1585.
DR   EnsemblGenomes-Gn; LGAS_r1618.
DR   EnsemblGenomes-Gn; LGAS_r1619.
DR   EnsemblGenomes-Gn; LGAS_r1620.
DR   EnsemblGenomes-Gn; LGAS_r1797.
DR   EnsemblGenomes-Gn; LGAS_r1798.
DR   EnsemblGenomes-Gn; LGAS_r1801.
DR   EnsemblGenomes-Gn; LGAS_r1803.
DR   EnsemblGenomes-Gn; LGAS_r1804.
DR   EnsemblGenomes-Gn; LGAS_r1807.
DR   EnsemblGenomes-Gn; LGAS_s1268.
DR   EnsemblGenomes-Gn; LGAS_t0018.
DR   EnsemblGenomes-Gn; LGAS_t0023.
DR   EnsemblGenomes-Gn; LGAS_t0062.
DR   EnsemblGenomes-Gn; LGAS_t0063.
DR   EnsemblGenomes-Gn; LGAS_t0178.
DR   EnsemblGenomes-Gn; LGAS_t0199.
DR   EnsemblGenomes-Gn; LGAS_t0281.
DR   EnsemblGenomes-Gn; LGAS_t0282.
DR   EnsemblGenomes-Gn; LGAS_t0452.
DR   EnsemblGenomes-Gn; LGAS_t0453.
DR   EnsemblGenomes-Gn; LGAS_t0454.
DR   EnsemblGenomes-Gn; LGAS_t0455.
DR   EnsemblGenomes-Gn; LGAS_t0571.
DR   EnsemblGenomes-Gn; LGAS_t0598.
DR   EnsemblGenomes-Gn; LGAS_t0600.
DR   EnsemblGenomes-Gn; LGAS_t0660.
DR   EnsemblGenomes-Gn; LGAS_t0662.
DR   EnsemblGenomes-Gn; LGAS_t0718.
DR   EnsemblGenomes-Gn; LGAS_t0836.
DR   EnsemblGenomes-Gn; LGAS_t1252.
DR   EnsemblGenomes-Gn; LGAS_t1253.
DR   EnsemblGenomes-Gn; LGAS_t1310.
DR   EnsemblGenomes-Gn; LGAS_t1454.
DR   EnsemblGenomes-Gn; LGAS_t1519.
DR   EnsemblGenomes-Gn; LGAS_t1538.
DR   EnsemblGenomes-Gn; LGAS_t1539.
DR   EnsemblGenomes-Gn; LGAS_t1545.
DR   EnsemblGenomes-Gn; LGAS_t1552.
DR   EnsemblGenomes-Gn; LGAS_t1563.
DR   EnsemblGenomes-Gn; LGAS_t1567.
DR   EnsemblGenomes-Gn; LGAS_t1568.
DR   EnsemblGenomes-Gn; LGAS_t1569.
DR   EnsemblGenomes-Gn; LGAS_t1570.
DR   EnsemblGenomes-Gn; LGAS_t1571.
DR   EnsemblGenomes-Gn; LGAS_t1572.
DR   EnsemblGenomes-Gn; LGAS_t1573.
DR   EnsemblGenomes-Gn; LGAS_t1574.
DR   EnsemblGenomes-Gn; LGAS_t1575.
DR   EnsemblGenomes-Gn; LGAS_t1576.
DR   EnsemblGenomes-Gn; LGAS_t1577.
DR   EnsemblGenomes-Gn; LGAS_t1578.
DR   EnsemblGenomes-Gn; LGAS_t1579.
DR   EnsemblGenomes-Gn; LGAS_t1580.
DR   EnsemblGenomes-Gn; LGAS_t1581.
DR   EnsemblGenomes-Gn; LGAS_t1582.
DR   EnsemblGenomes-Gn; LGAS_t1590.
DR   EnsemblGenomes-Gn; LGAS_t1591.
DR   EnsemblGenomes-Gn; LGAS_t1592.
DR   EnsemblGenomes-Gn; LGAS_t1593.
DR   EnsemblGenomes-Gn; LGAS_t1594.
DR   EnsemblGenomes-Gn; LGAS_t1595.
DR   EnsemblGenomes-Gn; LGAS_t1596.
DR   EnsemblGenomes-Gn; LGAS_t1597.
DR   EnsemblGenomes-Gn; LGAS_t1598.
DR   EnsemblGenomes-Gn; LGAS_t1599.
DR   EnsemblGenomes-Gn; LGAS_t1600.
DR   EnsemblGenomes-Gn; LGAS_t1602.
DR   EnsemblGenomes-Gn; LGAS_t1603.
DR   EnsemblGenomes-Gn; LGAS_t1604.
DR   EnsemblGenomes-Gn; LGAS_t1605.
DR   EnsemblGenomes-Gn; LGAS_t1606.
DR   EnsemblGenomes-Gn; LGAS_t1607.
DR   EnsemblGenomes-Gn; LGAS_t1608.
DR   EnsemblGenomes-Gn; LGAS_t1609.
DR   EnsemblGenomes-Gn; LGAS_t1610.
DR   EnsemblGenomes-Gn; LGAS_t1611.
DR   EnsemblGenomes-Gn; LGAS_t1612.
DR   EnsemblGenomes-Gn; LGAS_t1613.
DR   EnsemblGenomes-Gn; LGAS_t1614.
DR   EnsemblGenomes-Gn; LGAS_t1615.
DR   EnsemblGenomes-Gn; LGAS_t1616.
DR   EnsemblGenomes-Gn; LGAS_t1617.
DR   EnsemblGenomes-Gn; LGAS_t1796.
DR   EnsemblGenomes-Gn; LGAS_t1799.
DR   EnsemblGenomes-Gn; LGAS_t1800.
DR   EnsemblGenomes-Gn; LGAS_t1802.
DR   EnsemblGenomes-Gn; LGAS_t1805.
DR   EnsemblGenomes-Gn; LGAS_t1806.
DR   EnsemblGenomes-Tr; EBT00001521760.
DR   EnsemblGenomes-Tr; EBT00001521761.
DR   EnsemblGenomes-Tr; EBT00001521762.
DR   EnsemblGenomes-Tr; EBT00001521763.
DR   EnsemblGenomes-Tr; EBT00001521764.
DR   EnsemblGenomes-Tr; EBT00001521765.
DR   EnsemblGenomes-Tr; EBT00001521766.
DR   EnsemblGenomes-Tr; EBT00001521767.
DR   EnsemblGenomes-Tr; EBT00001521768.
DR   EnsemblGenomes-Tr; EBT00001521769.
DR   EnsemblGenomes-Tr; EBT00001521770.
DR   EnsemblGenomes-Tr; EBT00001521771.
DR   EnsemblGenomes-Tr; EBT00001521772.
DR   EnsemblGenomes-Tr; EBT00001521773.
DR   EnsemblGenomes-Tr; EBT00001521774.
DR   EnsemblGenomes-Tr; EBT00001521775.
DR   EnsemblGenomes-Tr; EBT00001521776.
DR   EnsemblGenomes-Tr; EBT00001521777.
DR   EnsemblGenomes-Tr; EBT00001521778.
DR   EnsemblGenomes-Tr; EBT00001521779.
DR   EnsemblGenomes-Tr; EBT00001521780.
DR   EnsemblGenomes-Tr; EBT00001521781.
DR   EnsemblGenomes-Tr; EBT00001521782.
DR   EnsemblGenomes-Tr; EBT00001521783.
DR   EnsemblGenomes-Tr; EBT00001521784.
DR   EnsemblGenomes-Tr; EBT00001521785.
DR   EnsemblGenomes-Tr; EBT00001521786.
DR   EnsemblGenomes-Tr; EBT00001521787.
DR   EnsemblGenomes-Tr; EBT00001521788.
DR   EnsemblGenomes-Tr; EBT00001521789.
DR   EnsemblGenomes-Tr; EBT00001521790.
DR   EnsemblGenomes-Tr; EBT00001521791.
DR   EnsemblGenomes-Tr; EBT00001521792.
DR   EnsemblGenomes-Tr; EBT00001521793.
DR   EnsemblGenomes-Tr; EBT00001521794.
DR   EnsemblGenomes-Tr; EBT00001521795.
DR   EnsemblGenomes-Tr; EBT00001521796.
DR   EnsemblGenomes-Tr; EBT00001521797.
DR   EnsemblGenomes-Tr; EBT00001521798.
DR   EnsemblGenomes-Tr; EBT00001521799.
DR   EnsemblGenomes-Tr; EBT00001521800.
DR   EnsemblGenomes-Tr; EBT00001521801.
DR   EnsemblGenomes-Tr; EBT00001521802.
DR   EnsemblGenomes-Tr; EBT00001521803.
DR   EnsemblGenomes-Tr; EBT00001521804.
DR   EnsemblGenomes-Tr; EBT00001521805.
DR   EnsemblGenomes-Tr; EBT00001521806.
DR   EnsemblGenomes-Tr; EBT00001521807.
DR   EnsemblGenomes-Tr; EBT00001521808.
DR   EnsemblGenomes-Tr; EBT00001521809.
DR   EnsemblGenomes-Tr; EBT00001521810.
DR   EnsemblGenomes-Tr; EBT00001521811.
DR   EnsemblGenomes-Tr; EBT00001521812.
DR   EnsemblGenomes-Tr; EBT00001521813.
DR   EnsemblGenomes-Tr; EBT00001521814.
DR   EnsemblGenomes-Tr; EBT00001521815.
DR   EnsemblGenomes-Tr; EBT00001521816.
DR   EnsemblGenomes-Tr; EBT00001521817.
DR   EnsemblGenomes-Tr; EBT00001521818.
DR   EnsemblGenomes-Tr; EBT00001521819.
DR   EnsemblGenomes-Tr; EBT00001521820.
DR   EnsemblGenomes-Tr; EBT00001521821.
DR   EnsemblGenomes-Tr; EBT00001521822.
DR   EnsemblGenomes-Tr; EBT00001521823.
DR   EnsemblGenomes-Tr; EBT00001521824.
DR   EnsemblGenomes-Tr; EBT00001521825.
DR   EnsemblGenomes-Tr; EBT00001521826.
DR   EnsemblGenomes-Tr; EBT00001521827.
DR   EnsemblGenomes-Tr; EBT00001521828.
DR   EnsemblGenomes-Tr; EBT00001521829.
DR   EnsemblGenomes-Tr; EBT00001521830.
DR   EnsemblGenomes-Tr; EBT00001521831.
DR   EnsemblGenomes-Tr; EBT00001521832.
DR   EnsemblGenomes-Tr; EBT00001521833.
DR   EnsemblGenomes-Tr; EBT00001521834.
DR   EnsemblGenomes-Tr; EBT00001521835.
DR   EnsemblGenomes-Tr; EBT00001521836.
DR   EnsemblGenomes-Tr; EBT00001521837.
DR   EnsemblGenomes-Tr; EBT00001521838.
DR   EnsemblGenomes-Tr; EBT00001521839.
DR   EnsemblGenomes-Tr; EBT00001521840.
DR   EnsemblGenomes-Tr; EBT00001521841.
DR   EnsemblGenomes-Tr; EBT00001521842.
DR   EnsemblGenomes-Tr; EBT00001521843.
DR   EnsemblGenomes-Tr; EBT00001521844.
DR   EnsemblGenomes-Tr; EBT00001521845.
DR   EnsemblGenomes-Tr; EBT00001521846.
DR   EnsemblGenomes-Tr; EBT00001521847.
DR   EnsemblGenomes-Tr; EBT00001521848.
DR   EnsemblGenomes-Tr; EBT00001521849.
DR   EnsemblGenomes-Tr; EBT00001521850.
DR   EnsemblGenomes-Tr; EBT00001521851.
DR   EnsemblGenomes-Tr; EBT00001521852.
DR   EnsemblGenomes-Tr; EBT00001521853.
DR   EnsemblGenomes-Tr; EBT00001521854.
DR   EnsemblGenomes-Tr; EBT00001521855.
DR   EnsemblGenomes-Tr; EBT00001521856.
DR   EnsemblGenomes-Tr; EBT00001521857.
DR   EnsemblGenomes-Tr; EBT00001521858.
DR   EnsemblGenomes-Tr; EBT00001521859.
DR   EnsemblGenomes-Tr; EBT00001521860.
DR   EnsemblGenomes-Tr; EBT00001521861.
DR   EnsemblGenomes-Tr; EBT00001521862.
DR   EnsemblGenomes-Tr; EBT00001521863.
DR   EnsemblGenomes-Tr; EBT00001521864.
DR   EnsemblGenomes-Tr; LGAS_r0449-1.
DR   EnsemblGenomes-Tr; LGAS_r0450-1.
DR   EnsemblGenomes-Tr; LGAS_r0451-1.
DR   EnsemblGenomes-Tr; LGAS_r1021-1.
DR   EnsemblGenomes-Tr; LGAS_r1564-1.
DR   EnsemblGenomes-Tr; LGAS_r1565-1.
DR   EnsemblGenomes-Tr; LGAS_r1566-1.
DR   EnsemblGenomes-Tr; LGAS_r1583-1.
DR   EnsemblGenomes-Tr; LGAS_r1584-1.
DR   EnsemblGenomes-Tr; LGAS_r1585-1.
DR   EnsemblGenomes-Tr; LGAS_r1618-1.
DR   EnsemblGenomes-Tr; LGAS_r1619-1.
DR   EnsemblGenomes-Tr; LGAS_r1620-1.
DR   EnsemblGenomes-Tr; LGAS_r1797-1.
DR   EnsemblGenomes-Tr; LGAS_r1798-1.
DR   EnsemblGenomes-Tr; LGAS_r1801-1.
DR   EnsemblGenomes-Tr; LGAS_r1803-1.
DR   EnsemblGenomes-Tr; LGAS_r1804-1.
DR   EnsemblGenomes-Tr; LGAS_r1807-1.
DR   EnsemblGenomes-Tr; LGAS_s1268-1.
DR   EnsemblGenomes-Tr; LGAS_t0018-1.
DR   EnsemblGenomes-Tr; LGAS_t0023-1.
DR   EnsemblGenomes-Tr; LGAS_t0062-1.
DR   EnsemblGenomes-Tr; LGAS_t0063-1.
DR   EnsemblGenomes-Tr; LGAS_t0178-1.
DR   EnsemblGenomes-Tr; LGAS_t0199-1.
DR   EnsemblGenomes-Tr; LGAS_t0281-1.
DR   EnsemblGenomes-Tr; LGAS_t0282-1.
DR   EnsemblGenomes-Tr; LGAS_t0452-1.
DR   EnsemblGenomes-Tr; LGAS_t0453-1.
DR   EnsemblGenomes-Tr; LGAS_t0454-1.
DR   EnsemblGenomes-Tr; LGAS_t0455-1.
DR   EnsemblGenomes-Tr; LGAS_t0571-1.
DR   EnsemblGenomes-Tr; LGAS_t0598-1.
DR   EnsemblGenomes-Tr; LGAS_t0600-1.
DR   EnsemblGenomes-Tr; LGAS_t0660-1.
DR   EnsemblGenomes-Tr; LGAS_t0662-1.
DR   EnsemblGenomes-Tr; LGAS_t0718-1.
DR   EnsemblGenomes-Tr; LGAS_t0836-1.
DR   EnsemblGenomes-Tr; LGAS_t1252-1.
DR   EnsemblGenomes-Tr; LGAS_t1253-1.
DR   EnsemblGenomes-Tr; LGAS_t1310-1.
DR   EnsemblGenomes-Tr; LGAS_t1454-1.
DR   EnsemblGenomes-Tr; LGAS_t1519-1.
DR   EnsemblGenomes-Tr; LGAS_t1538-1.
DR   EnsemblGenomes-Tr; LGAS_t1539-1.
DR   EnsemblGenomes-Tr; LGAS_t1545-1.
DR   EnsemblGenomes-Tr; LGAS_t1552-1.
DR   EnsemblGenomes-Tr; LGAS_t1563-1.
DR   EnsemblGenomes-Tr; LGAS_t1567-1.
DR   EnsemblGenomes-Tr; LGAS_t1568-1.
DR   EnsemblGenomes-Tr; LGAS_t1569-1.
DR   EnsemblGenomes-Tr; LGAS_t1570-1.
DR   EnsemblGenomes-Tr; LGAS_t1571-1.
DR   EnsemblGenomes-Tr; LGAS_t1572-1.
DR   EnsemblGenomes-Tr; LGAS_t1573-1.
DR   EnsemblGenomes-Tr; LGAS_t1574-1.
DR   EnsemblGenomes-Tr; LGAS_t1575-1.
DR   EnsemblGenomes-Tr; LGAS_t1576-1.
DR   EnsemblGenomes-Tr; LGAS_t1577-1.
DR   EnsemblGenomes-Tr; LGAS_t1578-1.
DR   EnsemblGenomes-Tr; LGAS_t1579-1.
DR   EnsemblGenomes-Tr; LGAS_t1580-1.
DR   EnsemblGenomes-Tr; LGAS_t1581-1.
DR   EnsemblGenomes-Tr; LGAS_t1582-1.
DR   EnsemblGenomes-Tr; LGAS_t1590-1.
DR   EnsemblGenomes-Tr; LGAS_t1591-1.
DR   EnsemblGenomes-Tr; LGAS_t1592-1.
DR   EnsemblGenomes-Tr; LGAS_t1593-1.
DR   EnsemblGenomes-Tr; LGAS_t1594-1.
DR   EnsemblGenomes-Tr; LGAS_t1595-1.
DR   EnsemblGenomes-Tr; LGAS_t1596-1.
DR   EnsemblGenomes-Tr; LGAS_t1597-1.
DR   EnsemblGenomes-Tr; LGAS_t1598-1.
DR   EnsemblGenomes-Tr; LGAS_t1599-1.
DR   EnsemblGenomes-Tr; LGAS_t1600-1.
DR   EnsemblGenomes-Tr; LGAS_t1602-1.
DR   EnsemblGenomes-Tr; LGAS_t1603-1.
DR   EnsemblGenomes-Tr; LGAS_t1604-1.
DR   EnsemblGenomes-Tr; LGAS_t1605-1.
DR   EnsemblGenomes-Tr; LGAS_t1606-1.
DR   EnsemblGenomes-Tr; LGAS_t1607-1.
DR   EnsemblGenomes-Tr; LGAS_t1608-1.
DR   EnsemblGenomes-Tr; LGAS_t1609-1.
DR   EnsemblGenomes-Tr; LGAS_t1610-1.
DR   EnsemblGenomes-Tr; LGAS_t1611-1.
DR   EnsemblGenomes-Tr; LGAS_t1612-1.
DR   EnsemblGenomes-Tr; LGAS_t1613-1.
DR   EnsemblGenomes-Tr; LGAS_t1614-1.
DR   EnsemblGenomes-Tr; LGAS_t1615-1.
DR   EnsemblGenomes-Tr; LGAS_t1616-1.
DR   EnsemblGenomes-Tr; LGAS_t1617-1.
DR   EnsemblGenomes-Tr; LGAS_t1796-1.
DR   EnsemblGenomes-Tr; LGAS_t1799-1.
DR   EnsemblGenomes-Tr; LGAS_t1800-1.
DR   EnsemblGenomes-Tr; LGAS_t1802-1.
DR   EnsemblGenomes-Tr; LGAS_t1805-1.
DR   EnsemblGenomes-Tr; LGAS_t1806-1.
DR   EuropePMC; PMC2519322; 18539810.
DR   EuropePMC; PMC2519355; 18539796.
DR   EuropePMC; PMC2565949; 18689509.
DR   EuropePMC; PMC2827410; 20078865.
DR   EuropePMC; PMC2918964; 20581187.
DR   EuropePMC; PMC3668253; 23506117.
DR   EuropePMC; PMC3957601; 24362432.
DR   EuropePMC; PMC4920774; 27407290.
DR   EuropePMC; PMC5286655; 28163828.
DR   EuropePMC; PMC5997789; 29928268.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01710; Lacto-usp.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01764; yjdF.
DR   RFAM; RF01767; SMK_box_riboswitch.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000413.
DR   SILVA-SSU; CP000413.
DR   StrainInfo; 13671; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2661979
CC   Source DNA and bacteria available from Todd Klaenhammer
CC   (trk@unity.ncsu.edu)
CC   Bacteria also available from ATCC: ATCC 33323
CC   Contacts: Todd Klaenhammer (trk@unity.ncsu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Annotation done by Kira Makarova and Eugene Koonin
CC   Finishing done by Fidelity Systems Inc. (Gaithersburg)
CC   http://www.fidelitysystems.com
CC   Project Information available at:
CC   http://genome.jgi-psf.org/mic_home.html
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1894360
FT                   /organism="Lactobacillus gasseri ATCC 33323 = JCM 1131"
FT                   /strain="ATCC 33323"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:324831"
FT   gene            102..1496
FT                   /locus_tag="LGAS_0001"
FT                   /note="LactoCOG number LaCOG00001"
FT   CDS_pept        102..1496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0001"
FT                   /product="DNA replication ATPase initiation"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59418"
FT                   /protein_id="ABJ59418.1"
FT                   /translation="MDNTVLGGIFLFDLDKFWQFFNAEMKKSYSTVAYNAWFKNTKPIS
FT                   FNKKTKEMIIAVESPVAKGYWEKNLASQLIQEAYAYADMEIQPKFEVAGKEGPERLVTP
FT                   KPRIKTNQEILEDRRDEFAQDLQLNSKYTFDTFVQGEGNKLAAGAALAVADNPGSFYNP
FT                   LFIFGGVGLGKTHLMQAIGHQMLAEKPHAKVVYIQSETFVNDFINSIKNKTQAEFRNKY
FT                   RNCDLLLVDDIQFFSKKEGIQEEFFHTFETLYNDQKQIVMTSDRLPTEIPELSERLVSR
FT                   FAWGLQVEITPPDLETRIAILRKKAETDGLAIDDSTLDYIASQVDTNIRELEGALVKVQ
FT                   AHATIEREDINVDLAKEALADLKLVQKNRGLQISKIQEVVANYFQTSTTELKGKKRVKQ
FT                   IVVPRQIAMYLSRELTDSSLPKIGQEFGGKDHTTVMHACDKISRALKTDAEIKAAVYDL
FT                   KAMLEH"
FT   gene            1681..2811
FT                   /locus_tag="LGAS_0002"
FT                   /note="LactoCOG number LaCOG00002"
FT   CDS_pept        1681..2811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59419"
FT                   /protein_id="ABJ59419.1"
FT                   /translation="MQFTINRNLFLENLNNVMRAISSRATIPILSGIKLNLTDEMLTLT
FT                   GSDTDISIEIQIPVNDDLVVQSTGSIVLPARFFSEIVKKLPGKDFSFEVRESFQTKIVS
FT                   ENTEFMINGLDANNYPHLPEISTDASFKISGKTFREIINETVFAVATQESRPTLTGVNF
FT                   IFNNSSIKAVATDSHRLSQRQISLENGPQTSTDLIIPGKSLVELARIIGENDPEITVNP
FT                   GENQVLFEVGNIAFYSRLLDGQYPDTDRLIPTESTTSVEFELPVLARSLERASLLTHES
FT                   RNNVVKMTLDVQNQLVKLQGDSPEIGNVEEEISFKKLEGEGLTISFNPDYLREALRASI
FT                   TDSIIMNFTQPLRPFTVVPAKQDVNFTQLITPVRTF"
FT   gene            3089..3238
FT                   /locus_tag="LGAS_0003"
FT                   /note="LactoCOG number LaCOG01316"
FT   CDS_pept        3089..3238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0003"
FT                   /product="S4-like RNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59420"
FT                   /protein_id="ABJ59420.1"
FT                   /translation="MISSGGQAKWYLKENPVKLNGELEDRRGKKIHAGDVLNLAGEEYE
FT                   FVSE"
FT   gene            3242..4366
FT                   /locus_tag="LGAS_0004"
FT                   /note="LactoCOG number LaCOG01317"
FT   CDS_pept        3242..4366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59421"
FT                   /db_xref="GOA:Q047F1"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q047F1"
FT                   /protein_id="ABJ59421.1"
FT                   /translation="MYLANFELKDFRNFKELKTDFDPHVNIFIGPNAQGKTNLLEAIYF
FT                   LALTRSHRTNSDKELIRFGSKFAGLQGRVHKSQLQVELKLRLTANGKKAWVNRLEQKKL
FT                   SAYVGQMNAILFSPEDLALVKGAPSVRRRFMDLEFGQINSEYLYFSSQYRQVLQQRNNY
FT                   LKQLSIKKANDQVFLDVLSDQLAGIAAEIISRRIKYIKKLNSYAKAAHSEISGQAEKLQ
FT                   IFYRPSVKEIIPEDNVETIYRKVITSYKKNRPNEIRKGTTLSGPHRDDLEFLINEKNAH
FT                   DFASQGQQRTISLSVKLAEIQLVHELTQEYPILLLDDVMSELDHRRQSRLLNYIHGKTQ
FT                   TFITTTDLEGISWEIVKEPKVYHISAGTISAKES"
FT   gene            4367..6334
FT                   /locus_tag="LGAS_0005"
FT                   /note="LactoCOG number LaCOG00631"
FT   CDS_pept        4367..6334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0005"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59422"
FT                   /protein_id="ABJ59422.1"
FT                   /translation="MAEDKSKAALNKAKDFEKRADTYNASQIQVLGGLEAVRKRPGMYI
FT                   GSTSSQGLHHLVWEIIDNSIDERLAGFATKIEITVNEDGSVTVQDDGRGIPVDIQAKTG
FT                   RPALETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTKLDVTVMRDGKKYAISFD
FT                   HGRVVGEMKQIGTVPLEEHGTIVHFYPDPDIFTETTTFDDKILKNRIRELAFLNKGLKL
FT                   TFTDKRKESAETDVYHFEGGIKEYVAFLNKGQEVLFDEPIYVEGNYEGIDVEVALQYTN
FT                   GYKTTLMTFANNIHTYEGGMHEAGFKTALTRVVNDYAHKAKILKDKDDNLSGEDIREGI
FT                   TAVVSVKHPNPQFEGQTKTKLGNSDARTAVDRAFSETFSRFLMENPSVGRKIVEKGQLA
FT                   ERARTAAKRAREVTRKKSGLEIANLPGKLADNTSNDPSISELFIVEGNSAGGSAKQGRS
FT                   RLTQAILPIRGKILNVEKASMDRILANQEIRSLFTALGTGFGADFDVSKARYHKLIIMT
FT                   DADVDGAHIRTLLLTLFYNYMRPMIEKGYVYIARPPLYQVRQGKIEKYLDTDEELHDYL
FT                   GTLQPSPKPVVQRYKGLGEMDPEQLWETTMNPENRRLDRVSPEYAEDADKVFDLLMGNE
FT                   VGPRREFIEKNAKYVENLDA"
FT   gene            6345..8834
FT                   /locus_tag="LGAS_0006"
FT                   /note="LactoCOG number LaCOG00747"
FT   CDS_pept        6345..8834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0006"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59423"
FT                   /protein_id="ABJ59423.1"
FT                   /translation="MANENQPQDHRIRNVDLTHTMRSSFLDYAMSVIVARALPDVRDGL
FT                   KPVQRRILYGMHELGVTPDKQYKKSARIVGEVMGKFHPHGDSSIYLAMAHMAQDFSYRY
FT                   MLVDGHGNFGSVDGDEPAAMRYTEAKMSKIAVEMLRDINKETIDWQRNYDDTENEPVVL
FT                   PARIPNLLVNGASGIAVGMTTNIPPHNLAEVISGIHMLMDNPDVTTKDLMKVIPGPDFP
FT                   TGGIVMGRGGIYRAYETGKGNIVVRAKTNIETEKNGRERIVVSELPYLVNKAELVKKIA
FT                   DLAREKIIDGITGVRDESDQTGMRITIDIRRDASASVVLNNLFKETQMQANFGMNMVAI
FT                   VNGAPHFLTLKQMLEYYLHHQEDVITRRTKFELKKAEARAHILAGLRIALDHIDEIIKI
FT                   IRGSQNSDIAKAQLIQNFGLDDRQSQAILDMRLVRLTGLERDKIEAEYQDLQAKIADYK
FT                   DILAKPERIDEIIYNELLDIQKRFGDDRRTKIAEGEAVSIEDEDLIEQKDVLLTLTHNG
FT                   YIKRMPADEFKVQNRGGRGIKGMGVQDDDFINHLIFSSTHDFLLFFTNLGKVYSKKAYE
FT                   IPEFGRNAKGLPIVNLLELDKGEKIQAVINVPEGADDNYLFFVTKMGTVKRTKVSEFQN
FT                   IRRSGLIALTLRDGDELNNVLTTDGKQNILIGTHLGYAVTFNENDVRSMGRTAAGVRGI
FT                   NLRDNDYVVGSDILEPDSEVLVISEKGYGKRTAASEYPVKGRGGKGIKTANITEKNGPL
FT                   AGVTVVNGDEDIMLITSAGVMIRFDVDDVSQTGRATLGVRLIKVDDGAQVASITAVPKA
FT                   NDEDEEATDEKEPVEEN"
FT   gene            9021..9317
FT                   /locus_tag="LGAS_0007"
FT                   /note="LactoCOG number LaCOG01479"
FT   CDS_pept        9021..9317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0007"
FT                   /product="SSU ribosomal protein S6P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59424"
FT                   /db_xref="GOA:Q047E8"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q047E8"
FT                   /protein_id="ABJ59424.1"
FT                   /translation="MAKTKYEVTYIIKPDIDEDSKKALIDRFDKVVTDNGAEELESKDW
FT                   GKRRFAYEIEKYREGTYHIMTFVAENSEPVDEFGRLSRIDNQVLRSMTVKLDK"
FT   gene            9351..9869
FT                   /locus_tag="LGAS_0008"
FT                   /note="LactoCOG number LaCOG02599"
FT   CDS_pept        9351..9869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0008"
FT                   /product="single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59425"
FT                   /protein_id="ABJ59425.1"
FT                   /translation="MINNVVLVGRLTRDPDLRTTGSGISVATFTLAVDRQYTNSQGERG
FT                   ADFVSCVIWRKAAENFANFTSKGSLVGIQGRIQTRTYDDKDGKRVYVTEVIVDNFSLLE
FT                   SRRDRENRQTNGGNFAPQGGNAPSTNNFGGSSAPSTNNAPAGGESNKPQDPFADSGSTI
FT                   DISDDDLPF"
FT   gene            9894..10127
FT                   /locus_tag="LGAS_0009"
FT                   /note="LactoCOG number LaCOG01477"
FT   CDS_pept        9894..10127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0009"
FT                   /product="SSU ribosomal protein S18P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59426"
FT                   /db_xref="GOA:Q047E6"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q047E6"
FT                   /protein_id="ABJ59426.1"
FT                   /translation="MAQQRRGGRRRKVDFIAANHIDYIDYKDVDLLKRFISERGKILPR
FT                   RVTGTSAKNQRKLTVAIKRARVMGLLPFVAED"
FT   gene            10222..10908
FT                   /locus_tag="LGAS_0010"
FT                   /note="LactoCOG number LaCOG00689"
FT   CDS_pept        10222..10908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0010"
FT                   /product="Mg2+ and Co2+ transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59427"
FT                   /protein_id="ABJ59427.1"
FT                   /translation="MIIKQKLAGNIDFDYKWYDIYNCDDHDIRLLKDDFDLTSEIISYI
FT                   TDLHERPHFDHDYITNSDLLVYDVPVWPTADADHFTTLPIKFLMVGHTLFTVHSPDTTY
FT                   MIEEFRQKPDEHIHSEKELIFAILFAVTKYFQRALSQLNSQRLVLDNHLSERIHNKDLQ
FT                   ELSQVEKSLVYLSSSIRTNLMMLESLKNKKSGLHMNASEEEMCDDIIIEVQQSSQMIKI
FT                   YSEVTE"
FT   gene            11245..13263
FT                   /locus_tag="LGAS_0011"
FT                   /note="LactoCOG number LaCOG00505"
FT   CDS_pept        11245..13263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0011"
FT                   /product="Signaling protein (consists of PAS, a modified
FT                   GGDEF and a DHH family phosphatase domains)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59428"
FT                   /protein_id="ABJ59428.1"
FT                   /translation="MKGFLRKLELPEFVKDTRLTASLIIVLVLSLLGAIIGMLISPLFG
FT                   LAMVLLFILTVIFAVYGIYVLAGNTNNYAANLSYRIKRGEQEAMIKMPLGIMLYDKDRQ
FT                   IQWINPYLQMYLHDKDIIGSSISSVDKELAKYIDDAIKSNSKQNKIIKWGDRKFEMVVQ
FT                   DDLGVVYLLDITRYANIEEKYKQERLAIGLIFIDNYDELSQAMGDQNLTNMSSYVQTTL
FT                   SKYAGQFNSYLKRIDEDHFILLTHMHDLAKMEDNKFSILDKVRTESSRKNMPLTLSIGI
FT                   AFGSESLNEIADQAQSNLDLALGRGGDQVVVKQSGHEARFYGGKSNPMEKRTRVRARMV
FT                   SQALVELFKGVDHVFVQGHRNPDLDAIGSAIGIVKIARIHGVKASVVVDVDHVNYDVGR
FT                   LIAKMQAAGIDKDVFISPKDALEAATDESLLVLTDHSKYSITYDPELYKRLKNRLIIID
FT                   HHRRGEEFPENPMLVYIEPYASSTCELVTEMIEYQPQGGEGVLTDLEASAMLAGITVDS
FT                   KEFSLRTGTRTFDAASYLRSIGADTQVVSELLKENIDNYLQRSHLVSTIDMIEPNMALL
FT                   MGEDNKIYDPIITAQAADTALSLEHVDASFALTRRSKDVIGISARSMGNVNVQVIMEKL
FT                   GGGGHLSNAATQIKGVTVEEAKDKLLAAINEYLKENE"
FT   gene            13266..13730
FT                   /locus_tag="LGAS_0012"
FT                   /note="LactoCOG number LaCOG00506"
FT   CDS_pept        13266..13730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0012"
FT                   /product="LSU ribosomal protein L9P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59429"
FT                   /protein_id="ABJ59429.1"
FT                   /translation="MKFMKVIFIKDMKGKGKRGEVKNVPDGYAQNFLIKNGYAKEATSS
FT                   NLNTLKRVQKAEKDAYEAEKAAAEDIKKKLEDDKTIVNFKSKAGTDSRLFGSISSKKIV
FT                   EGLEKQYGIKVDKRKLELPEPIKSLGYTNVPVKLFKGVEAVIRVHITEQD"
FT   gene            13733..15106
FT                   /locus_tag="LGAS_0013"
FT                   /note="LactoCOG number LaCOG00507"
FT   CDS_pept        13733..15106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0013"
FT                   /product="primary replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59430"
FT                   /protein_id="ABJ59430.1"
FT                   /translation="MDNVVSQQIPHDSEAEKAVLGAVFLDPEAIIDASDILQPDDFYEH
FT                   ANRIVFQAMLNISDREEVIDPVTLQDELKKNNQVDDIGGIAYVTELSMATPTAAHLTYY
FT                   AKIVKRKAILRNLISTSQRIIQNAIEGSDDVTDILDDAESQIMGVSQDNASGGFKSIHD
FT                   VLNTTMEEINSIPDDGNTVTGLPSGFSELDKMTTGFHDDELIILAARPGVGKTAFALNV
FT                   AQFVGLKTDKTVAMFSLEMGAEQLVQRMLASEGLIDSQHLRTGQLTDEEWRKLVVAAGS
FT                   LDNTSIYIDDTPGIKMSEIRAKARRLAKEKGNLGLIVIDYLQLIEGPRSESRQQEVSAI
FT                   SRQLKKLAKELHIPVIALSQLSRSVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRDDY
FT                   YRDERDEDDEGEVEAEEDNGEVEVIIEKNRSGTRGTVKLMFSKPYNRFSNLDYTHNEA"
FT   gene            15201..16085
FT                   /locus_tag="LGAS_0014"
FT                   /note="LactoCOG number LaCOG00968"
FT   CDS_pept        15201..16085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0014"
FT                   /product="fructokinase"
FT                   /EC_number="2.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59431"
FT                   /protein_id="ABJ59431.1"
FT                   /translation="MVEGKYVGSIEAGGTKFILAVQDTESGEVVAKKRIPTTDAKETLA
FT                   KSVEFFKEHPVSALGIGTFGPIDINSNSRTFGYILDTPKRGWSGTNVKGTFEKELGIPV
FT                   VMTTDVNASCYGEYIARGRDNSKTYFYVTIGTGIGAGAVQAGKFIGLNNHPEMGHMLVT
FT                   PYPGDNYTGKCPFHGNKCVEGMAAGPSLEGRTGIPGEKLPRDHKVFTYVSYYVAQLLFN
FT                   AYMTMRPDVMVVGGSVLNDQDLVQVRGFFKEFNNNYVATPDVDELIVRPAVADNGSATL
FT                   GDFELAKEALKNK"
FT   gene            complement(16159..17301)
FT                   /locus_tag="LGAS_0015"
FT                   /note="LactoCOG number LaCOG02241"
FT   CDS_pept        complement(16159..17301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59432"
FT                   /protein_id="ABJ59432.1"
FT                   /translation="MGKVLDYVRWRGDLTLDREPFNSLDAGLFAAFAYLPFDSSVKGHT
FT                   LEAATKRLIQRKTLIHSDKLEAELVNLSDRYKNMHFLDWSHLSQKKPPVQFTAMTIELD
FT                   SKTILVAYRGTDGSMVGLNEDVDMSYQPEIFGQSVAADYLDKMAKAYPDKKIYTVGHSK
FT                   GGNFAAYALYAASPRLQDRVIKAYSFDGPGFMKEMYNQIEFRRVIPKMMTYVPEGSIFG
FT                   MMLDHPERVIVVKSRMKHLMKQHNPLHWEVARNSFVMAPGLSNASRIIRSTFISWNTKI
FT                   PREKREAFWLAFFTALESQKITEASQLTTNKIRGAIQFSHAYLALDPDARLIANEIISD
FT                   ITATARQYINLPFLSHNEHLKPLGNDSSKGPIVDDSYDGS"
FT   gene            complement(17430..19448)
FT                   /locus_tag="LGAS_0016"
FT                   /note="LactoCOG number LaCOG02302"
FT   CDS_pept        complement(17430..19448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59433"
FT                   /protein_id="ABJ59433.1"
FT                   /translation="MSYIYTLRYVFDPRTNTPEKDRKLLDFVQKAKIDDVAFIINGEEL
FT                   NHSHLTKEETQVWLDAIIPLQKQLAKLDVTTSLNPWTTIMHSDRGFSVNPEIGFNTFVD
FT                   INGNQAKDMACPADPTWRKYLADRYAQYASIHPRRLWMEDDFRHYNHTPLKLMCFCDYH
FT                   MKLYQEKLGKAESRAEFVKNMLKPGEPTIERKIYLDQARKEMIENEHLIEQAVHKVSPN
FT                   TDLGQMTSFPDWHAIEGRDWASLFDAQAGPGHPRVARPHLPSYNEVAPLIYGRKFEEYS
FT                   RPTAAFLGPRAELYPELENSMWTPQVKSNTFIDFQIITTALLGAKGIMLNIFDMMGNGV
FT                   NEDWGYDKMLADIKPFASALADHRLNMQKLRGIKVLVDQDSAYTAHTTLGKEPEELLPH
FT                   EKNWASLLASFGFATTILPVQDDLAIENQTIAIAGQLLRNLSNEQITNLITKNTVLLDG
FT                   ESIQVLLDRKIGNLLHIQSAKWHPCKSGYQSFEQADGTTVQGVKNPRITMLQHTGNYLQ
FT                   LDYQADSNVKIWSSAYNSIDQKLGNFMAVIDDHIIVLPMDQDPKHGWESQFSSYKQGLM
FT                   QQILASVEPIDYLINMPHVKLNIQENVKIVWLANFNLDGYQKINWHLSKPLPSNTATLI
FT                   RRRDNSVEKEVVKIKVTDNVATIKAPLSPLETIQLIF"
FT   gene            complement(19556..20257)
FT                   /locus_tag="LGAS_0017"
FT                   /note="LactoCOG number LaCOG01061"
FT   CDS_pept        complement(19556..20257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0017"
FT                   /product="Putative Mg2+ Transporter-C (MgtC) Family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59434"
FT                   /protein_id="ABJ59434.1"
FT                   /translation="MVGLTSLSTELDWLLRILVAALCGTAIGYERATQRKSAGIRTHMV
FT                   VAVASALFMLVSKYGFFDLLSLHDISLDPSRIAAQIVTGISFIGAGTILVRREQISGLT
FT                   TAAGVWATAAIGMAVGAGMYVIGIVSTVFLFIIQIIFHDDTFINFIILHVRFNVQIEAN
FT                   NRPDVLNELKKELALNEVEQISIKIIDVTSEHIVVNVDGVIKNRKDENDIILALEKDQN
FT                   IRRINSTHGAK"
FT   gene            20396..20468
FT                   /locus_tag="LGAS_t0018"
FT                   /note="tRNA_Thr_AGT"
FT   tRNA            20396..20468
FT                   /locus_tag="LGAS_t0018"
FT                   /product="tRNA-Thr"
FT   gene            complement(20749..21375)
FT                   /locus_tag="LGAS_0019"
FT                   /note="LactoCOG number LaCOG02149"
FT   CDS_pept        complement(20749..21375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0019"
FT                   /product="Predicted phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59435"
FT                   /protein_id="ABJ59435.1"
FT                   /translation="MIKTILFDVDGTIVDIQKVVLSTFKEVIKEYLNTNVNINDLAFAL
FT                   GIPGRDAIKHFTKNKVLINKMAKSWSEKASNRVDEDTLFNNIPETIKSLSQKGITLGIV
FT                   TSKTKQEYINEVGHFGLDDYFDVIVTASDTKNHKPNPEPLNFAISKLGVDRTETLYVGD
FT                   TKYDMLTANAAKVKFALANWGAHEELPEADYQLNNPINLEEIVKR"
FT   gene            21739..21951
FT                   /locus_tag="LGAS_0020"
FT                   /note="LactoCOG number LaCOG00232"
FT   CDS_pept        21739..21951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0020"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59436"
FT                   /protein_id="ABJ59436.1"
FT                   /translation="MIERIAMNRVKEYRKQKGLSQMALAKRIDVARQTINLIENDKYNP
FT                   SLDLCLKLAHELDTDLNTLFWDGDV"
FT   gene            21954..22472
FT                   /locus_tag="LGAS_0021"
FT                   /note="LactoCOG number LaCOG03204"
FT   CDS_pept        21954..22472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59437"
FT                   /protein_id="ABJ59437.1"
FT                   /translation="MKAKETRFEKYMKFWYGISGPLDEQKRQVMNRIGNRAFFIFFLGM
FT                   DAAFLISLVLISFYGANVAYIFLSGSFFVMLMIVSFYVMFQSKKFKLTDNEIEKNEVSN
FT                   AKKSAWIRGMMSGLFFGIMMLILNFLTSYGDGSWTWIEIPSSIIGGLFFGIVMSLVWVH
FT                   RIKVVKDED"
FT   gene            22512..23558
FT                   /locus_tag="LGAS_0022"
FT                   /note="LactoCOG number LaCOG01993"
FT   CDS_pept        22512..23558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0022"
FT                   /product="Predicted oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59438"
FT                   /protein_id="ABJ59438.1"
FT                   /translation="MAFLLKELHVAHKYLYHLNVIVCMKIEKIKKMKTTKLGKTSLDIP
FT                   ALALGVMRMGTRTPEEGAAAINVAYEAGVNFIDSADIYGRGNSEKVFGKALKLSDVKRE
FT                   DLFIQSKTGIVVGPNGSHGSLVYGSRYEFTKEHILNAVDGILKRMDIDYLDCLVLHRPD
FT                   VLMDLEVIKQAFDVLQATGKVRFFGVSNFNPAQFKMLQNAVSQPLMFDQVQFGLMHTGM
FT                   IDFGLHTNMTDDASINHDGSLLEFLRMNHITLQAWSPFQYGTFEGTFINNPAFPELNKK
FT                   LQEIGDKYGVGKNAVAAAWILRWPGQVQVIMGTMTPAHIVDSAKGADIELTNQEWYDLY
FT                   FAAGHDLP"
FT   gene            23614..23689
FT                   /locus_tag="LGAS_t0023"
FT                   /note="tRNA_Thr_AGT"
FT   tRNA            23614..23689
FT                   /locus_tag="LGAS_t0023"
FT                   /product="tRNA-Thr"
FT   gene            23795..24955
FT                   /locus_tag="LGAS_0024"
FT                   /note="LactoCOG number LaCOG00111"
FT   CDS_pept        23795..24955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0024"
FT                   /product="Acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59439"
FT                   /protein_id="ABJ59439.1"
FT                   /translation="MKLNQDKETLDQIAPLVEYAFLKNNDIREDPNFLSRYNHSMSFGE
FT                   YKDGHLASYIMVNKFKSMIFAKKVKMGGVGYVASYPENRGQGDINRLMKEIMLELHDQN
FT                   YAISNLAPFSETFYRRYGYENAIYEKMYQIQPAYLRFFKAVQEGKVVRGRWSDSSLKNA
FT                   VIKLYQAKLNQDDQRNTVVRAEWWWDRLDTYYPGRSICVYFDKKQQPQGYMFYRIVERN
FT                   FRVEEMYYQTPQAAKALLSIIASHSSSDLKYYVKMPEESLLEEFFPEQEGITVKILPYM
FT                   MTRIINIKQVLEASPLVNNKKLTIEVTNDDIIAENNGVWLIDNANEPRVREVETDPDYT
FT                   ASLTNWTKVLLGHLTLKQAVQLGFVKENHPVNTDFVKGDVSFYDYF"
FT   gene            25106..25753
FT                   /locus_tag="LGAS_0025"
FT                   /note="LactoCOG number LaCOG00551"
FT   CDS_pept        25106..25753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0025"
FT                   /product="Putative NADH-flavin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59440"
FT                   /protein_id="ABJ59440.1"
FT                   /translation="MKVGIIGASGMAGSAIYKLASQNKDLEVTGIVRDEDKAKRVLGKD
FT                   AKLLIGDVLTMDDSLLQQFNVIVDAFGTKPEKARDQVKLATKLCGLAKNKDIRVIFILG
FT                   AGSLRTGIDNHLVVEDIKKLTGSENWINTPKEQLNELNYLKQVEDVDWLGISPALTFEA
FT                   GPEAAGYMLGNDTLLYNNNNESKVTSGTMARLVVNEIVHPEHHKERITLVDE"
FT   gene            complement(25806..26549)
FT                   /locus_tag="LGAS_0026"
FT                   /note="LactoCOG number LaCOG00094"
FT   CDS_pept        complement(25806..26549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0026"
FT                   /product="Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59441"
FT                   /protein_id="ABJ59441.1"
FT                   /translation="MVRLEWLEVNILLERSNTMTRAQMKQAAKDQLRGNWGWAICLTIF
FT                   AWLVNAVIMDLNRWIWTGKDFTYTVLRFNKDNLIQGYKPAYNLSEIIVGLITGLILWGV
FT                   AYTILDFVETGKMEPWYSGIFSAYSNGRFKNSLFTLFMTNLFVSLWTILFIIPGFIKGY
FT                   SYAMTPYILKDKFSAGQTDIGATEAITESRKLMDGHKMDLFVLDLSFIGWGLLGLITCG
FT                   IGFIWITPYYRQTKANFYRSLVANN"
FT   gene            26636..27343
FT                   /locus_tag="LGAS_0027"
FT                   /note="LactoCOG number LaCOG00988"
FT   CDS_pept        26636..27343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0027"
FT                   /product="Predicted hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59442"
FT                   /protein_id="ABJ59442.1"
FT                   /translation="MKYKQLIFDVDDTLIDFAATEDSSLHALFKSHKLPLSSDLQKQYH
FT                   TYNQGLWRRLELGEITYDELSEMTFHDFIKEHFNLEVDGNEWMNEYRSYFGEAHQLLPG
FT                   VEDTLRFAKKQGYKLTVLSNGEKFMQRHRLELAGIKDYFDLIVTSEEAHYSKPDPHAFD
FT                   YFFSRTEIGPNETLFFGDGLQSDILGAEKYGFDSIWYNHRHRKDTIGLHPLFEVETYPE
FT                   FVKIMQNDFQKAY"
FT   gene            complement(27379..28218)
FT                   /locus_tag="LGAS_0028"
FT                   /note="LactoCOG number LaCOG02236"
FT   CDS_pept        complement(27379..28218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59443"
FT                   /protein_id="ABJ59443.1"
FT                   /translation="MPIKIITDSTANITADQIDGIDHVTVPLSLHVDGKLWMDTPDIDL
FT                   DKFLHTLKHTKSKSTSACPNVNDWLKAFEGSDEIFVITLTSALSGSYNSATQAAKIYHE
FT                   KNPKAKILVFDSRSAGPQLRLLAEKIASLASAGKSFEEIVKATEEYQHKLDLMFALQDL
FT                   TNLGNNGRIPPAVAKIAGLLKLFVIGTANNKGEFELLGKARGAKKARRKLLDEMVKAGY
FT                   KGGRVQIDHVQNEGSALSMKEIILDNFPDAKVTLEECGALCSFYAENGGLMVGFEKE"
FT   gene            complement(28330..28515)
FT                   /locus_tag="LGAS_0029"
FT   CDS_pept        complement(28330..28515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59444"
FT                   /protein_id="ABJ59444.1"
FT                   /translation="MFSILLALLIIWLFWKLGIGMLKIVGFLIIVGLLFAFVSYLVLPL
FT                   LALIAIGGLLGLVFSR"
FT   gene            28890..30812
FT                   /locus_tag="LGAS_0030"
FT                   /note="LactoCOG number LaCOG01545"
FT   CDS_pept        28890..30812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0030"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59445"
FT                   /protein_id="ABJ59445.1"
FT                   /translation="MKKVTIGILAHVDAGKTTLSEGLLYQSGTLRKLGAVDKGTAYLDN
FT                   DNLEKKRGITIFSHMARIKTENSELLLLDTPGHIDFAQEMEETLSVLDYAILVVSASEG
FT                   VTAYTQTLWNLLKSHKIPTFIFVNKMDTLKADKEKVLHDLSTLDDSCVEFGDEDSDFYE
FT                   KIATADEAILEEYLESGQIKDKEIQDLISQRKVFPVYFGAALKLKGVAEFLQGLDKWTK
FT                   KIEYSEKFASRIFKISHDEKGERLTWLKVTGGELRAKSELMPDEKVNEIRLYNGNKYEV
FT                   VSSVQAGEIVAVSGLKTTYPGQGIGFEKDQMNFTMQPVLNYAVQTTPDKTHATLAALRQ
FT                   LEDENPQLHVKWDKQTEEISIDVMGKIQLEILQQILHDRFNLEVEFTQGKILYQESIRN
FT                   SVEGVGHFEPLRHYAEVHLLLKPGKLGSGLVFKNECSLEVLPKKWQDQVMESLANKEHL
FT                   GVLTGSPLTDVEITLIGGRGSNVHTVGGDFREATYRAVRQGLMELKAQNQVSLLEPWYQ
FT                   FTLRINQDQVGRAINDIEKMGGKFKIGESDHDIVTITGQAPVAQMQDYATEVRNYSHGS
FT                   GQLECLFAGYQECKSSAEVIADANYDPVSDINNTPNSVFCSHGAGHTVVWDEVPSYAQY
FT                   PYLKS"
FT   gene            complement(30847..31773)
FT                   /locus_tag="LGAS_0031"
FT                   /note="LactoCOG number LaCOG00442"
FT   CDS_pept        complement(30847..31773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0031"
FT                   /product="Mg2+ and Co2+ transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59446"
FT                   /protein_id="ABJ59446.1"
FT                   /translation="MLTVYDKNGSTTSDNLLSAKLAILVNPTSEELTNIEKTIGCDAHV
FT                   FTKQTSATEVSHFNILPKCKIKNARIFVSFNFDAGQTKVEDAIYPTIAIFNSQQLILVL
FT                   QKNPAPTLEDQKAIAKLSVEDLLIKQLLYQNHCFNEELNKIKQQLDQLDHAARTTTKTK
FT                   SLKEATDLTRTLVYFNHTMDDQVSSIEALTDFLKEQHSANSIFIIDLLLSQRRITKKIK
FT                   VYRDLLESINGLFSAMMDNHLNNLMKYLDSIALIISIPALISGIWGMNVGGLPGKDNEF
FT                   GFLWVILFGAALAIISALFLRKKNYLK"
FT   gene            32036..32227
FT                   /locus_tag="LGAS_0032"
FT                   /note="LactoCOG number LaCOG00538"
FT   CDS_pept        32036..32227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0032"
FT                   /product="General stress response protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59447"
FT                   /protein_id="ABJ59447.1"
FT                   /translation="MCFRKGYLIMMKDKHGIKDKVAGKLKEVEGKVTGDKARELEGKAQ
FT                   QAKGKVKSKATKVKEDLE"
FT   gene            32262..32528
FT                   /locus_tag="LGAS_0033"
FT                   /note="LactoCOG number LaCOG00840"
FT   CDS_pept        32262..32528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0033"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59448"
FT                   /protein_id="ABJ59448.1"
FT                   /translation="MLHWIWVLIVGGVIGLIAGAITHKGGSMNWIANIIAGLVGSSLGE
FT                   ALLGAWGPQVAGMAIVPSLLGAIILVILVSWIMTMLFGPRASE"
FT   gene            32664..33491
FT                   /locus_tag="LGAS_0034"
FT                   /note="LactoCOG number LaCOG00546"
FT   CDS_pept        32664..33491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0034"
FT                   /product="Exonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59449"
FT                   /protein_id="ABJ59449.1"
FT                   /translation="MRLISWNIDSLNAALTSDSARAKLTRGVLNTIKEKDPDIIAIQET
FT                   KLRSTGPTKKHQEILAEMFPDYDYVWRSSEEPARKGYAGTMFLYKNTLAPEVTKPVIGA
FT                   PEPMDHEGRILTLEFDNYYVTQVYTPNSGNELKRLDDRQVWDEKYTEYLQKLDQNKPVI
FT                   ASGDYNVAHTPIDLKHPESNHHNAGFTDEERQDFDKLLKLGFTDTFRKVHGNVEGVYSW
FT                   WAQRVRTSKANNSGWRIDYYIVSNRIADQVTKSEMLDTGERKDHCPIMLEINL"
FT   gene            33548..36397
FT                   /locus_tag="LGAS_0035"
FT                   /note="LactoCOG number LaCOG02239"
FT   CDS_pept        33548..36397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0035"
FT                   /product="DNA or RNA helicase of superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59450"
FT                   /protein_id="ABJ59450.1"
FT                   /translation="MEVKAVDNVLKDAILNGLYNKNENKGNEFISPQLVNNDDQSKIWF
FT                   TLRQELMSCTSFTWAVAFISENMLVPFKLVMSELAKKGVNGTLITGTYLGFNSPKVFKE
FT                   LVKIPNLEVRLSEEAGFHAKGYIFNHEDYQTILIGSANFTRSALLKNCEWGLKVTSHEN
FT                   GQLVAEVNDQIENNLSNSLILTSSWIKEYEQNWQPVKKAAYLPLGKAKKILPNQMQKAA
FT                   LANLNALVKEQAKKALVVSATGTGKTYLGAFAVKEYKPKKFLYLVHREQIAKKALESFY
FT                   RVIGGKKSDYGLLTGNKHDFDKKYLFGTVQTVSQEQILEQLDPEEFDYILIDEAHRVAA
FT                   PTYQKILNHFAPKFLLGMTATPERMDKQNIYEIFDYHLAYEIRLKDALNDQMLTPFHYV
FT                   GVEDYTVGNHVISETSKLKDLVARKRVEYVLKQLDYYGYCGEKAKGLVFCSRQEEAREL
FT                   AKLFSQTGHPSRALTNEDSQKQRIEVTHQLENGELEYIFTVDLFNEGIDIPSLNQIVML
FT                   RNTQSSIVFIQQLGRGLRKFPGKDYVTVIDFLGNYKNNYLIPIALNGDKSRDKDQAVRE
FT                   SKLPQVIDVSTINFTEIASQRILVSLEKIKLDSMRELRQSYKDLKEKIGRVPLLYDFYQ
FT                   YGTTAPTVFAKNHALAHYGDFLKKMGEEVNLGNYQNAALSFVTKELLFGKRPHELLLLE
FT                   SCLDKNISRADFTKLLKSKNCYISEDVLNSVEKILSLNFFDVKQGKTTKKEQYGSYPLI
FT                   EKENGEYRLSSQLLQALNDNHQFKMLFEDVLKTGLALAREYNSQAQFTLYKQYDRKDVC
FT                   RLLNWPKDVSAPMYGYRVGEKETPIFITYQKDSEKKRNARYQNTLENGHSLRWYTRTPR
FT                   HLDSDEVKRLLHNKNMKLHLFVKRSDAAGKEFYYLGTAEIQKDSVKEEKIGLKQKCAVG
FT                   MNLVLNHPLKQSIYNLLFS"
FT   gene            36492..37379
FT                   /locus_tag="LGAS_0036"
FT                   /note="LactoCOG number LaCOG01137"
FT   CDS_pept        36492..37379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0036"
FT                   /product="alpha/beta hydrolase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59451"
FT                   /protein_id="ABJ59451.1"
FT                   /translation="MKNKLVSLLAFLVIFLTGCTNQDKPNQADAAPKYYVERRQTPKTS
FT                   LNVIPTLFFHGGLSNYKSEENMVKAAQKAGVTNSVIRADVDANGKVKLIGAISKNAVNP
FT                   IVEVNYSNNVQLNFKEHGRYARNVVQTLQNEYGIKKINMVGHSLGNISIMYYLLQTAHD
FT                   PEMPKLNKQISIGGHFDGLDFKQLPIAIRQPANLHVNREGKPNKTNSTYREMMKLRTLY
FT                   PNKQTDILNIIGNIGGNSDGIVKNASSLSLEYLVAPMAKTYQVVKIVGKNAEHGQLTYN
FT                   KQVERSIINFLWLQ"
FT   gene            37367..37504
FT                   /locus_tag="LGAS_0037"
FT   CDS_pept        37367..37504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59452"
FT                   /protein_id="ABJ59452.1"
FT                   /translation="MAPVILSNQKEDVLMHLLFLDFIFMLITFIEIMKPHAPSGLKFNN
FT                   "
FT   gene            complement(37424..37675)
FT                   /locus_tag="LGAS_0038"
FT                   /note="LactoCOG number LaCOG02139"
FT   CDS_pept        complement(37424..37675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59453"
FT                   /protein_id="ABJ59453.1"
FT                   /translation="MKAVSAMKKLWWGANIYWVILLIYGGIKLFTYNFDTSELGETASY
FT                   ALIIMVLISASVLIIEFQAAWGMWLHNFDKSNQHENKV"
FT   gene            37786..38835
FT                   /locus_tag="LGAS_0039"
FT                   /note="LactoCOG number LaCOG01997"
FT   CDS_pept        37786..38835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0039"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59454"
FT                   /protein_id="ABJ59454.1"
FT                   /translation="MGQVWEKFKKNTNVHRLATLCLIILVLYAARSMMNTILLTFIFTY
FT                   LIVHLIRFTQKKLPNLPSQVIVVLAYLLVIAIIYFAITIYMPILIKQIVKMSHSLMEFY
FT                   QSDNMDWLTQYLNHYISDSEITTQAKHGVTILVHALTNVGTLTIAFFMSLIMSFFYTIE
FT                   LDSMNEFSHTFLNSRHLSWLFKDIAYFGNKFVNTFGVVLEAQFFIALCNTAMTMICLII
FT                   MKMPQIIALGLMVFILSLIPVAGVIISLIPLSFVAYSVGGIRYVIYIFIVIMIIHAIEA
FT                   YILNPKFMSSKTELPIFYTFVVLLAGEHFLGTWGLIVGVPIFTFLLDILGVKSVKKKKP
FT                   TILKIENKK"
FT   gene            39078..40409
FT                   /locus_tag="LGAS_0040"
FT                   /note="LactoCOG number LaCOG00586"
FT   CDS_pept        39078..40409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0040"
FT                   /product="Glutathione reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59455"
FT                   /protein_id="ABJ59455.1"
FT                   /translation="MKKYDYIILGTGPAAYQFIKLLATQRKSILVIESGLFGGTCPNVG
FT                   CEPKIYLDGAVQAALLSRQLESHGIEQAATINWSQLMKEKKERFASWPSETRKNISKIC
FT                   DVVSGSAHFIDQQTIAVNQRYFQGNKIIIATGRRPHELSIPGAKFLHDSSDVLSLNKVS
FT                   EHVTFIGAGYVAMELATFLAAAGSQVTILVRGKHVLRHFYQKYSAELVTRMVQRGIQFK
FT                   FATEATCITQLSDKYVVELNQGSSLVTDYVVNASGRTSNIEKLDLSAAQIDYSPKGINV
FT                   DQHLQTSVKNIYAIGDVTSQDVPNLTTVAEFQSHYLFNSLEKGLSQPINYPAIGTGVFA
FT                   FPQLAQAGINPDSVSEDKDNFEIVEYELSQSSLYAGQKEKGLLTVVYDKANYIVGVSEI
FT                   STSAVNDVNYFVPIIGLRIRKNEWHQNVLPIYPALADKIEGILR"
FT   gene            complement(40454..41608)
FT                   /locus_tag="LGAS_0041"
FT                   /note="LactoCOG number LaCOG00149"
FT   CDS_pept        complement(40454..41608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0041"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59456"
FT                   /protein_id="ABJ59456.1"
FT                   /translation="MSLWETKFAKKGLTFDDVLLIPAESHVLPNEVKLDTKLAPNLQLH
FT                   IPLISAGMDTVTEGDMAIAMAENGGLGVIHKNLSIEAQVEEVKKAKTKAVDPNLSHPAV
FT                   DTQGRLLAAAAVGVTSDTFERAEALLKAGADAIVIDTAHGHSAGVLRKIKEIRDHFPKA
FT                   TLIAGNVATGEGTAALFDAGVDVVKVGIGPGSICTTRIVAGVGVPQITAIYDAANVAQK
FT                   YGKKIIADGGIKYSGDVVKALAAGGNAVMLGSMFSGTTEAPGTIFTNEGKKFKSYRGMG
FT                   SVGAMSQQHGSSDRYFQGGVNEANKLVPEGVEALVPYKGDVSNIIYQIDGGLRAGMGYV
FT                   GAGTIEELIENSQFVQITNAGLRESHPHDVQMAKEAPNYGGSDL"
FT   gene            complement(41682..42257)
FT                   /locus_tag="LGAS_0042"
FT                   /note="LactoCOG number LaCOG00478"
FT   CDS_pept        complement(41682..42257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0042"
FT                   /product="Lysophospholipase L1 related esterase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59457"
FT                   /protein_id="ABJ59457.1"
FT                   /translation="MKLLLTGDSIIARPENHSIPELNFQLQKFLSCNIYNTAISGINSG
FT                   GLALSLPNLVFNQPKCNYLIILVGTNDLATHKQVPLRQFEKNLELIASSIIWLYYPEKV
FT                   IFITPPAVDENKQRVRNNRLVMEYGNIVKKVASEYKFSIIDLASKMQENKNFPEIFNGK
FT                   KNDGLHFGVNGYKLLANLIVKKINQISN"
FT   gene            complement(42332..43363)
FT                   /locus_tag="LGAS_0043"
FT                   /note="LactoCOG number LaCOG00403"
FT   CDS_pept        complement(42332..43363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0043"
FT                   /product="(R)-2-hydroxyisocaproate dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59458"
FT                   /protein_id="ABJ59458.1"
FT                   /translation="MTEVEFMTKIFAYAIRKDEEPFLNEWKDAHKDVEVEYTDKLLTPE
FT                   TAKLAKGADGVVVYQQLDYTPETLQALADAGVTKMSLRNVGVDNIDMDKAKELGFEITN
FT                   VPVYSPDAIAEHAAIQAARVLRQDKRMDEKMAKRDLRWAPTIGREVRDQVVGVVGTGHI
FT                   GQVFMRIMEGFGAKVIAYDIFKNPELEKKGYYVDSLDDLYKQADVISLHVPDVPANVHM
FT                   INDKSIAEMKDGVVIVNCSRGPLVDTDAVIRGLDSGKIFGFVMDTYEGEVGVFNKDWEG
FT                   KEFPDARLADLIDRPNVLVTPHTAFYTTHAVRNMVVKAFDNNLKLINGEKPDSPVALDK
FT                   NKF"
FT   gene            43603..46224
FT                   /locus_tag="LGAS_0044"
FT                   /note="LactoCOG number LaCOG03205"
FT   CDS_pept        43603..46224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0044"
FT                   /product="Adhesion exoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59459"
FT                   /protein_id="ABJ59459.1"
FT                   /translation="MSVVVKYIDLDNNSAELASSETLNGKVGERVNYHTAEEVQKLIAA
FT                   GYVLVNNPFDLNNEVHFFNETSQEYKLTFKHAQEEVTAKNLKYDCQLGDVQLKGKQVVH
FT                   YTGLEKNIADNIVEVTFNRKIIYDKVTKQKVSLSAWQPEKYYLPLIATPAVLDYTPDKT
FT                   VIGGEAVTVQKPKHEYVVTYLPNKKNARRQKAEIKFIDVDNNNQELASSGELKGKPGKE
FT                   ISYSTTETLKELSDKGYEVINNDFDSKDQKPVFGNSRDYIQTFIIALRHKKQAVNSDHP
FT                   SSEIDHRLYEKEVHRKITFSGLSGQKLDDIVQTAVLKRSLTMDMVTKKIIQGEYTSQWQ
FT                   STETYPSVAVPVVAGYHTKTKEVVACPVVEEDLSEDIKYYANGYLIPVDANHNKLSEID
FT                   KKQLITNSINPTKAIFPKLELENIVLKPIKGVEIKDPGRDYEVPYLLVHKYIAVDEKHP
FT                   REEVSPAYYRRIVTARVHYQGAGDQTPADAEQIVTWTRTVTYDEVSREVIDNGMYTTEW
FT                   LADKDIFEATPTPVIKGFCADIGLIGEHPVTETDLMATVTYMPVGRMIPVDEHGNEIKN
FT                   AMRSPYINDPYDPVRVLFTEEVPEVQGYALVNNTISVNDPFSDTKVTYTLKPRYIPVNS
FT                   EHPYRPIKPTMYSVPVKETVKYQGADEQTPIARLQAARWTRTLTVDENTSELIDNGKYT
FT                   TAWKVDKNRYAAVKTPIIDGYHADKNIIEAKEVKKADLDFTVIYKANGRIVPVDAKGNL
FT                   LASVDQPSYVTDPEDATKVLPKQGVPRIMNYVPEQEVITVGDASEDTLVRYYTFNEWGE
FT                   LKAKKAAEQKQKDLKTKKPIENKDEQEKMEKVEERQLKSAEEEKKSEKKDTGFKSMFSW
FT                   LK"
FT   misc_binding    46391..46500
FT                   /bound_moiety="S-adenosylmethionine"
FT                   /note="SAM riboswitch (S box leader)"
FT   gene            46590..57668
FT                   /locus_tag="LGAS_0045"
FT                   /note="LactoCOG number LaCOG02280"
FT   CDS_pept        46590..57668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0045"
FT                   /product="Adhesion exoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59460"
FT                   /protein_id="ABJ59460.1"
FT                   /translation="MIYYDSKWRETGMLSKNNYQERLRKMDDKQERFSIRKFSVGAASV
FT                   LVGTAILSMQNVQTVRADATTDTEKGTTDVTSKNDEQNKQKAYNQVVSEDQNKASKTTD
FT                   TTMVGQDSKVASFSASKNEGTFAEASSEDKTSSTTDATQNKASENTKATEDNKVDAVAD
FT                   KSTEDKTNTATTQESSDNKSTENKTTDAQKVESKVATAKATTDTANSVKTASTTSTDQT
FT                   TSVNTTTFNTNQSSTAALFSASALSESKALAATPRASSATTNAQAKNNNYKLVTSSSEL
FT                   QQAINSGVAGINIDRSIDASNVNLAITNTFAIVGINDAAVLNLGQKSLNNSGNLTLQDI
FT                   TINGAVSGNGTVNIKGNVTSNVNENNSLIKGATADAANAALKDQTSTGTIGTQGTSWAS
FT                   GSSNQNGWTVKGWNYANFSGSKVNVAADANLTINRSAIGDGIHLANNGTVNVADGGQLT
FT                   INMNTNNDLNTTARYHNAGIFAVGNGNFTTGYKSVVTLNTSIGQGIAMTGMRPYVTDTD
FT                   VFGGYSARDRGDGSGQINLGQYSTLNFTGRDGVILGNNSNFNVGDSANVHFENKGRGVA
FT                   LDLAANSNINIDDHAVTYFHSVGKTTTNALGNTVGASGSFSGYNYIGVNEGGNITVGKF
FT                   ATFRVILEGRGNNNYDDVVSLDSQNTNTNAAFTSKTGAIVDIRDDNTNFYAELISFPLG
FT                   ASNTRIDIHDPLMLNLQRYSSGGPTTGWMPIGGDMINTTSNQYTANLIYMSGSKGVFSV
FT                   DGTNYVVYQKIKSDGSKQIWLNVNGVNIPMSGFQTKDIWDNQANPDVSIKGNDLTSGIR
FT                   ANQVHNYDGTPLTGKDAPYYGISTQRASQQIWFPHKTQMEVVGSHTNTIKYVYEDGTPV
FT                   LDENGNQIVKTQNLNLTRKLTLDITDDKIEEIQKYALTHNADQTLEYIKNAQGVSEDSG
FT                   WVYTDAQGNTVTDPYATVVSPVEDGYTASIESSNVPGITEGADGTSVTAKLQYKEELVQ
FT                   NGELSNNYKQNGLSAILPDNYETVVVYKKAKEVTNTLKFYDDTTKSYISTVADQTATGK
FT                   ENDDVNFKDGASTVKSLEDQGYKFINVTDGTPDDTNATVLSGDTFSDVDFGKFGKDGKT
FT                   FVVHLTHKVVPVTPDTPNVPSNSKVSKDDLTKTATRTIHYVENDQNGAELKESTVQTVN
FT                   YTGTAYVDVVTGQMVNAKADGKDAQGNTTYVVDTDNKKQPSITWTTDNNGKFAQVTPDA
FT                   SIKKGDDTWTTGVKSVDEKNAPDVSTITGKTTNEDVYVPYTLSQKTYTGTKETKTVTRV
FT                   INYLDNETKQPVSDAVEQTTTLSRTQIKDEKGNVIGYGTVSEDGHSYTLNNDWTIDKNG
FT                   WVAQVSPDETAKGYKETPHFEDGKDASTVAADTPSVTDPQDVTVNVFYDHDTTPVTPDK
FT                   PGHGLTHDDLNKDVTRTINYVDTTGAAVNGAPDGKSTYTQTAHFTRTAIVDKVNDKLLG
FT                   YDINGDGSVDISPDAGDFAWKSTDANLPAVTSKAPSEVGYDSVDTPVVQATTVAYNSEP
FT                   INVTVTYSKNAQQGSFQIHYIDEDNNNAILHQDTVSDKIGDSVTYSTADQIQLWESKGY
FT                   VLDQDGYTTQTTVNEDNNGKTYIVSFKHGRKNGTTETLVPTETIHFQYADGTKAADDVH
FT                   GNAGDFKFTRTPIIDTVTGQIVDPGTWNKESYTFDDGQKNVKVINGYVADKATYGNKTA
FT                   TPTDLNVEDTVTYRKISNIIPVDENGNQIPGTTPVDYKNDPSDPTKVTPDEESPKVPSG
FT                   WTISPNQPEGVTPNTTTNTAKVTPVDPTKPTNVVYTKDNAPVDKATVIVRYHDDTTNLD
FT                   LPESFDSGNKEVGTDTGYTQADINKVVQEYEAKGYYYVTTDGTLPTTIPAGGATIVVHL
FT                   AHNQIPVGPDTPDKHGVDPDQVKKAYTSTLHYQDSEGKTLSPDQQQTSTWTRTVTVDTV
FT                   TNQIVNGGKYDTNWTLQDANDKYSNFTVPVVEGYVARKTTNNGATVTTVVAGQTKVQQN
FT                   LEDTVVYDKVGKLVPVGPDGKTPIPDAPTPSYPNDPTDPTKVIPNEPVPDVPGYTPVDP
FT                   TPITPEDPTKDTPVPYTKDPVKAGLTVQYIDQDNNNSVIKSDAVDGNIGDKIDYSTASS
FT                   ITDFENKGYILVTDGFTGQAGDEFTTENNGQVYKVVFKHGTRPVTPENPADPNEPVDPD
FT                   HPDTPTPSNPNLSKEDLQKTITRTIEYKYADGTQAHEPVKQELTFTGKGTIDLVTGNLV
FT                   TVDEDGNITSQNGKITWNHESQEFEAVPAIDHDGYYISSINQSNSTASVDGQTGAVGTE
FT                   TVTPNSQNGNIVITLTRNPDVPVAAQGSINYIDDTTGQTIESANFSGNVGQKINYTTAG
FT                   SIKNWEAKGYNLVSNNFKDGEEVFTDGKNAFEVHLVHATTPVTPENPGKPGEPVNPTNP
FT                   DDPHKYPDNYVPQELAKTVTRDVTYVYADGSQAEAPVHQEVKFTGNGYLDLVTGEYVTV
FT                   DNNGKITGKGQINWTPESANFDATKSIDTSKYQIVGIKENNTTANVDQTTGVVAGETVT
FT                   QNSNNSSVVITLANKPAPVVEKGSITVKVHDLTDNVDLPQYGKESGEQEVGTSFTYDKN
FT                   AVITELINKGYKLVDGGENVPSEVAKGAKTITILVEHDTVPVTPENPGKPGEPINPNDP
FT                   DGPKWPEGTDENSVKRTGTQTIHYEGAGDKTPSDDVQTFDFTKKMLVDKVTGKIIDSGE
FT                   WNVTSHTFGYKDTPVIDGYHADKRNAGGSVVTPNDLNKKVVVTYKPNGKIIPTDPSGNP
FT                   IPNVPTPTYPTDPTDPTKVVPDEPVPDIPGMTPSTPTVTPEDPGKDTPVPYNPVVPAKN
FT                   QVAQVIYRDVQDGANKQLATSGDLTGKSGSEISYSTADQIKKLINQGYVLKNDGFPAGA
FT                   VFDNDDSKNQVFYVDFIHGQAPVNPDNPHEGIDPSQYEKTVTEKVHYVGAGDKTPADNV
FT                   QNSKWTRTLTIDTVTGKVVENGQYTTDWSIAKGEKTVYDQVSTPVIDGYHADKREVPAT
FT                   AVTQDDIEVTVTYKPNGKIIPTDPSSNPIPNVPNPTYPTDPTDPTKVVPDEPVPNIPGM
FT                   TPSTPTVTPEDPGKDTPVPYNPVVPAKDQAAVVNYVDADNNNTIITSSGNLTGKAGSRI
FT                   DYSTKTTIADLENKGYVLVNDGFPADATFDNDDSTTQVFTVVLKHGTVPVTPENPGKPG
FT                   EPINSNDPDGPKWPEGTDENSVKRTGTQTIHYVGAGDKTPSDDVQTFDFTRKMVVDKVT
FT                   GKVVDGGSWNVTSHTFGYKNTPVIDGYHADKRNAGGSVVTPDDLNKTVTVTYKQNGKIV
FT                   PVDPSGNPIPNVPNPTYPTDPTDPTKVVPDQPVPEVPGMTPSTPTVTPEDPGKDTPVPY
FT                   NPVKNPDKVTTVEGKQIVHFVDGDNGNTPLRDPNTQTHEFKITNGVPDESSHTFTLVDV
FT                   PVIPGYVAEVKSAGGKTVTPDTPLAEVTVVYHKVGKIVPVDPNGNPIPNVPTPSYTNDP
FT                   TDPTKVVPNEPVPAITGKTPDKTSVTPVDPTKDTPVVYKNNEVPATPNSQKAVVNFIDV
FT                   NTGKLIKTSGILSGRPGEDINKLYSSAEVIKQLEEAGYEVVYNAFDGDGVTKYFDDDDN
FT                   TTQQFTVALKLKEKAKTPYPVVPAPETPAKEPEAPAEKVSRPEQPVKQNVSVPTPQKPV
FT                   EKKTNNKKEVLPQTGADNNEAASILGAVATAIGMTSLIGAKRRKKDDK"
FT   gene            57837..60794
FT                   /locus_tag="LGAS_0046"
FT                   /note="LactoCOG number LaCOG03206"
FT   CDS_pept        57837..60794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0046"
FT                   /product="Adhesion exoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59461"
FT                   /protein_id="ABJ59461.1"
FT                   /translation="MDNLSEKAASVVIKYTDLDNNLAELSNSGSLTGNIGEVINYSTAD
FT                   EIKKLAKQGYVLVNNPFDNKGKAPVFSGDQDSYMVTFKHGRERVTADNLKYGCKLEDLQ
FT                   VKGTQTVHYVGAGSRTPRNEVSTITFNQILVYDQVTGKKIGSKGWEKVEQSFPVVAAPS
FT                   ILGYIPDQVLVGGKAVTADAPNREYTITYKVNEHISNKEQKAEVKYLDIDSNNEEIVES
FT                   ELLTGKPNTKINYSTIDQLKKLGEKGYEVVSNGFDANGDVQFFDTSDEYVQTFIVTLKH
FT                   KQVLVNAENPLDGIDEAEYHKTSKRVVSYAGAEDETPEEVVQLVNWNRNLTVDAATKRV
FT                   IADGKYTTDWKPERESYSAISVPVVSGYHTRIKEVPEEKARLANITEKIRYVKNGYVIP
FT                   VDENGQKIDSLPKLRFASDKDDPTLVSLPENSLKDEKYEPEKVDLTEIDPAKDFEAKYL
FT                   LKHKYVTINKDNSHFDINPGSYRRTVTAIVRYEGAGDKNPKDSIQTVQWNRSITYDEVT
FT                   KEILEDGKYTTDWKPDKEYFEAVDTPVISGFTADIGVVAKHDVTQSDLFATVKYQKNGA
FT                   IIPVDEGGKEIAKAKPIPFLTDLTDPTRVLATEEIPEIKGYRRTEESVLIKDPLKDIKV
FT                   TYILKPNYVLVDSEHPYRTVKPHNYSIPVKETIHYVGADEKTPADRIQGARWRRSLTVN
FT                   DNNGKVIEDGKYTTDWSVDKKEYSAAVTPVVDGYHADQYQVKAHGVNKEDIDVEVKYQR
FT                   NGQIVPVNSKGEKIEHADCPVYITDPTDATKVLMEQPVPRLLNYMAQDSSIVVKDPSRD
FT                   TKVTYYTFAEIKELSSAKNLKTEIQSIDGKTATSNVVSLPVNGKRRKAVVTFVDLSNNA
FT                   TQIASSGVLSGNVGDKITDLYNTSKQVEELKKKGYEVVYNGFDPKGASKYFEEDQRKVA
FT                   TFTVAVKKVKQLKPKEEKQAEKTSKKVKEKSKAANSDEKKKKNHKVLKYIFPWMK"
FT   gene            60863..62347
FT                   /locus_tag="LGAS_0047"
FT                   /note="LactoCOG number LaCOG00880"
FT   CDS_pept        60863..62347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0047"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59462"
FT                   /protein_id="ABJ59462.1"
FT                   /translation="MKKCIINFRKNFFGGNIVSDKSESLTKLEEDEKYNRLTALKLFAM
FT                   TSSMVISVNELAPFGKTGPTAVFYLLLAGLIWFVPITQMAGEMASIDGWDKGGIFTWVK
FT                   GSLGDRAGWTAMFYQWIHITVGMNTMMYVIIGALSITFNTPWFNTTPSIRFLLMMVIIW
FT                   SITIVEMVGVKKIGHIAEWLFALGIALPVILLIVTFFIYLSQGRPLYMHLNWDNIIPHH
FT                   LTGTTLVAFVPFVLAFCGGEASAPHAKYLENPKKYSTVMLALAITAISFDLLGSTAIGM
FT                   SVPKDQIQNSTGFVYTFGKILDSIGLPGDLIKKFIGVLLAAGIIGELGNWLAGPSQGMF
FT                   EAAKEGYMPKFFAKSTNRDVPMRLIVLQTLIVTASAVLITFTSGKNSDFAFNVSLAATT
FT                   AQYLMVYILMLISYIILKIRHRNLKRSYYMTKNNALGITIAIIALVITVVAFFISFIPA
FT                   QGTPAYLREVYIWTMIGLCAIVTILPLVIYHYHHRF"
FT   gene            62531..63457
FT                   /locus_tag="LGAS_0048"
FT                   /note="LactoCOG number LaCOG01767"
FT   CDS_pept        62531..63457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0048"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59463"
FT                   /protein_id="ABJ59463.1"
FT                   /translation="MNNPEEIQHFIDVLIKEDSFVKAAKKLYISQPYLTQLIKRIESHL
FT                   GTPIINRDKKPYSLTQAGLLYYQYLENVSYDKQQLNKKIAKYTHPNKEIIKIGILESLG
FT                   TYLLPEILPDFLKQNPQVEIQLFENFPRENEKNLLSGNIDCYIGQTPEAIDSSLDIVSN
FT                   GGEKYYIVISPASPYYQAGKFILDPNELDLKELLQEPFVLSVPGSAIRHQVNGVFQRFH
FT                   LEPKVVLESKSIITATSLAIHGMGLTISTASIIKRIGETPINLFPISHDLINVVFFIAS
FT                   RRGKNKSKALKNLIREFKTKNLQAMIR"
FT   gene            63587..65437
FT                   /locus_tag="LGAS_0049"
FT                   /note="LactoCOG number LaCOG01768"
FT   CDS_pept        63587..65437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0049"
FT                   /product="Fumarate reductase flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59464"
FT                   /protein_id="ABJ59464.1"
FT                   /translation="MKSGKYEVRAKGHGASFMPMEVTLSEDEIEDIKVDAKGETKGVAD
FT                   EVFRRLPEEIVKNQTLNVDTVSGATISSHGVIDGVASAISKAGGDPDEWKKRAKPAEQR
FT                   EKDETYTTDVVIVGAGGAGLAAAARSIQHNKKVIVLEKFPQIGGNTSRAGGPMNAAEPD
FT                   WQKQFKALAGEKETLEELAATPIEKIDPEYRTDFKELQKQIKEYVASGANYLFDSKLLH
FT                   EIQTYLGGKRTDLKGNEIHGNYTLVKELVDNALDSVHWLADLGVVFDRSQVTMPVGALW
FT                   RRGHKPVEPMGYAFIHVLGDWVKEHGGTILTDTRAKHLIIENGKVCGVIAKKPDGSKIT
FT                   IHAKAVILTAGGFGANTPMVQKYNTYWKHIDDNIATTNSPAITGDGIGLGKEAGADLVG
FT                   MGFIQMMPVSDPKTGELFTGLQTPPENYIMVNQKGKRFVNEFAERDVLTKAAIDNGGLF
FT                   YLIADDKIKDTAYNTTQESIDAQVKAGTLFRADSLEELAEQIGMDPDTLVDTIKKYNSY
FT                   VDAGKDPDFEKSAFNLKCEVAPFYATPRKPAIHHTMGGLKIDTGAHVLDKDGKQISGLY
FT                   AAGEVAGGIHAGNRLGGNSLADIFTFGRIAANSAIDELEK"
FT   gene            65528..66892
FT                   /locus_tag="LGAS_0050"
FT                   /note="LactoCOG number LaCOG01877"
FT   CDS_pept        65528..66892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0050"
FT                   /product="Branched-chain amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59465"
FT                   /protein_id="ABJ59465.1"
FT                   /translation="MREAQEKKLTTKRYLIVASMIFALFFGAGNLIFPLHLGQLAGKNW
FT                   GPAAIGFSITGVVLPLLSLLAVAITRSNGVYQIGLPVGKVFALSFMTLMQLAIGPLFAA
FT                   PRNATVSYTVGIAPLLPKQFHGIGLIVFTIIFFAIVYVIAYNESDILSSLGKILNPIFL
FT                   ILLFVVFVIAFARPLGNPEMAAPTKEYMNGAIVKGFLEGYNTMDALAGLAFGVTVVTAI
FT                   KELVNNDEKKTAKMTAKSGLIAVIAIGVIYTLLIVIGAMSLGHFKIASDGGILFSELVK
FT                   YYAGIFGQALLAVLIFLACLTTAVGVLAAFALDFSAHYSKISYKGWLTIGCLGSLATAN
FT                   LGLEKIIHWSLPVLMFLYPLAIVLIILSVCSPLFKGDMVVYKITMLLTLVPAIFDLITN
FT                   LPAPISGTQFYKVVSQIRLQYLPLANIGLSWVVPTILGLVISVLIHFGRRKANKI"
FT   gene            66959..67672
FT                   /locus_tag="LGAS_0051"
FT                   /note="LactoCOG number LaCOG00798"
FT   CDS_pept        66959..67672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0051"
FT                   /product="demethylmenaquinone methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59466"
FT                   /protein_id="ABJ59466.1"
FT                   /translation="MSLTNKVPEKDVHDLFTRVAPHYDQMNNLISLGTQKSWRKRFLKE
FT                   LKVAPGDFALDLCCGTGDITIALAKQVGPSGNVIGLDFNQEMLDLAEQKIRQQNLQKEI
FT                   QLKQGDAMHLPYPDQSFDIVTIGFGLRNVPDANQVLKEIYRVLKPTGKVGVLETSQPTN
FT                   PLIKLGWKSYFRLFPSFAKLLGANVSDYQYLSHTTAEFVSAQHLKEMLVKNGFKNVQVN
FT                   KLNLGAGAIHVGIKK"
FT   gene            67716..68630
FT                   /locus_tag="LGAS_0052"
FT                   /note="LactoCOG number LaCOG01681"
FT   CDS_pept        67716..68630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0052"
FT                   /product="prolinase, Serine peptidase, MEROPS family S33"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59467"
FT                   /protein_id="ABJ59467.1"
FT                   /translation="MKTGTKIITLDNGYHLWTNTQGEGDIHLLALHGGPGGNHEYWEDA
FT                   AEQLKKQGLNVQVTMYDQLGSLYSDQPDYSDPEIAKKYLTYEYFLDEVDEVREKLGLDN
FT                   FYLIGQSWGGLLVQEYAVKYGKHLKGAIISSMVDEIDEYVDSVNRRRQEVLPQTEIDFM
FT                   HECEKNNDYDNQRYQDDVQILNINFVDRKQPSKLYHLKNLGGSAVYNVFQGDNEFVITG
FT                   KLKDWHFRDQLKNIKVPTLITFGENETMPISTAKIMQKEIPNSRLVTTPNGGHHHMVDN
FT                   PDVYYKHLADFIREVENGNFKGE"
FT   gene            68765..69367
FT                   /locus_tag="LGAS_0053"
FT                   /note="LactoCOG number LaCOG01780"
FT   CDS_pept        68765..69367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0053"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59468"
FT                   /protein_id="ABJ59468.1"
FT                   /translation="MKRKISKLLAATALMGALGISVVACGNNDSTSKTKQSSVKKTAKD
FT                   KASNTKNATRKSQIKLSQTEAINKFDKKYSDKKLKEIDLKLDGNKYLYEITGFDKDKEY
FT                   EMTINATSGKEVKSSSEKLDLDERLQKGLDLDKVISRDQASEIAEKEVKNSTAKEWTLK
FT                   MDQDKAIWDVTVESGSSKHEVEIDAISKKVIKSEKDD"
FT   gene            complement(69430..70380)
FT                   /locus_tag="LGAS_0054"
FT                   /note="LactoCOG number LaCOG01222"
FT   CDS_pept        complement(69430..70380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0054"
FT                   /product="Conjugated bile salt hydrolase related amidase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59469"
FT                   /protein_id="ABJ59469.1"
FT                   /translation="MCTGLRFTDDQGNLYFGRNLDVGQDYGEGVIITPRNYPLPYKFLD
FT                   NTTTKKAVIGMGIVVDGYPSYFDCFNEDGLGIAGLNFPHFAKFSDGPIDGKINLASYEI
FT                   MLWVTQNFTKVSDVKEALKNVNLVNEAINSSFAVAPLHWIISDKDEAIIVEVSKQYGMK
FT                   VFDDKLGVLTNSPDFNWHLTNLGNYTGLDPHDATAQSWNGQKVAPWGVGTGSLGLPGDS
FT                   IPADRFVKAAYLNVNYPTVKGEKANVAKFFNILKSVAMIKGSVVNKLGSDEYTVYTACY
FT                   SAATKTYYCNFENDFELKTYKLDDETMNADKLITY"
FT   gene            complement(70398..71753)
FT                   /locus_tag="LGAS_0055"
FT                   /note="LactoCOG number LaCOG01775"
FT   CDS_pept        complement(70398..71753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0055"
FT                   /product="Conjugated Bile Salt Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59470"
FT                   /protein_id="ABJ59470.1"
FT                   /translation="MSTDVATKDKVVSKGYKYFMVFLCMLTQAIPYGIAQNIQPLFIHP
FT                   LVNTFHFTLASYTLIFTFGAVFASVASPFIGKALEKVNFRLMYLIGIGLSVIAYVIFGI
FT                   STKLPGFYIAAIICMIGSTFYSGQGVPWVINHWFPAKGRGAALGIAFCGGSIGNIFLQP
FT                   ATQAILKHFMTGNTKTGHLTSMAPFFIFAVALLVIGIVIACFIRTPKKDEIVVSDAELA
FT                   ESKKEAELAKAKEFKGWTSKQVLQMKWFWIFSLGFLIIGLGLASLNEDYAAFLDTKLSL
FT                   TDVGLIGSMYGVGCLIGNVSGGFLFDKFGTAKSMTYAGCMYVLSILMMVLISFQPYGAH
FT                   VSKIAGVAYAIFCGLAVFSYMSGPAFMAKDLFGSRDQGVMLGYVGLAYAIGYAIGAPLF
FT                   GIIKGKASFTVAWYFMIAFVAIGFIILVFAVIQIKRSQKKYIIQQEAKTTAK"
FT   gene            complement(71778..73124)
FT                   /pseudo
FT                   /locus_tag="LGAS_0056"
FT   gene            complement(73311..74171)
FT                   /locus_tag="LGAS_0057"
FT                   /note="LactoCOG number LaCOG02232"
FT   CDS_pept        complement(73311..74171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0057"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59471"
FT                   /protein_id="ABJ59471.1"
FT                   /translation="MIIGENRAQVIENIKTAVKKGKMHAKVELGDPILTKSERIKLVND
FT                   YWKQQKKFSHKLKNIIAQGIINIDTLILMAHTQIKNKKRAQGPKYGAIITSNHFKQTDS
FT                   LPIKKLANKCHKKLYVVIEDSNLKLPGFFGFLMNNINAIPIVQSYQYLGREFPKHLQKV
FT                   FDKKGWVLIYPEQEMWYNYRKPRPLQKGAYYYAAKANVPIISCFVEIQDLPEMEKNSNE
FT                   FHKTRYILHVLPTIYPVDRLTVDQNAKRMRDIDYLQKKKAYEKAYGKKLTYDFDDDDIA
FT                   GYVKK"
FT   gene            complement(74168..75118)
FT                   /locus_tag="LGAS_0058"
FT                   /note="LactoCOG number LaCOG02089"
FT   CDS_pept        complement(74168..75118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0058"
FT                   /product="Lipopolysaccharide biosynthesis
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59472"
FT                   /protein_id="ABJ59472.1"
FT                   /translation="MTIPVFYSISDDFAKYAAVSLNSLVKNANPQKDYTATFLNQDLSE
FT                   KHQKQLAAFANDHVHVKFFHIDEKLVKPIQNRKENYLRADFFTMSIFYRLFIPDLFPQY
FT                   DKAIYIDSDTVVVDDIAKLYNNDLGNNLFAACTDSSIQYVDKMVKYIKEVLALDPKKYI
FT                   NSGMLVLNSKAFRDEHFIDHFMHLLEQYHFDCIAPDQDYLNEIGDGRILHLDPRWDAMP
FT                   NENTAPIPEPGLIHYNLFFKPWHFKDVQYNDYFWKYASSTPFYEELKSELDNYTNQERA
FT                   EDRAKLDHMLEKEASTALDPNNWAQIKRKGERVKL"
FT   gene            complement(75131..76084)
FT                   /locus_tag="LGAS_0059"
FT                   /note="LactoCOG number LaCOG02089"
FT   CDS_pept        complement(75131..76084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0059"
FT                   /product="Lipopolysaccharide biosynthesis
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59473"
FT                   /protein_id="ABJ59473.1"
FT                   /translation="MMTIPVFYTISDNYTPYAAVSIQSLIDHVDQNKDYTITLLVQNIS
FT                   DKHKKDLEDLSIKNVHVNIFHIDDEMVAPIHNSEENYLRAQFFTMSIFYRLFIPNLFPQ
FT                   YDKAVYLDADTIICTDIAELYNTEIGDNMFASVPDMSIRFIKPLQVYIKECQGIFPPEK
FT                   YINNGVILFNMKAFRDKKFVDKFYSLIEKYHFDNIDPDQAYMNEICEDKIYHLPLEWDA
FT                   MPNEHMDEIKNPKIVHYNLFFKPWHFADVQYGKYFWDVAKKSPYYGELKEQLANFTDED
FT                   RKKARADLDWMIKKVDEIKDEDVTWAKVKKTTSVKI"
FT   gene            complement(76114..76938)
FT                   /locus_tag="LGAS_0060"
FT                   /note="LactoCOG number LaCOG02231"
FT   CDS_pept        complement(76114..76938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0060"
FT                   /product="Lipopolysaccharide biosynthesis
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59474"
FT                   /protein_id="ABJ59474.1"
FT                   /translation="MNIMFCGDSHAEDGILITTLSLLKNTSTPLHFYILTMHAEGYTAF
FT                   NQQAFNLIKKLLKEKDPNNTAELIDCTELFKKEPPRANMETRFTPYAMLRLFADQLPQI
FT                   PDRILYLDDDIIVRKDISDFYNQDLANIELVGVLDFWGRFFFHNIHTHKTFDYLNSGVL
FT                   LLNMAEIKKTQLFAKVREKMSDKKMLLPDQSALNKLATEKKIAPRCYNEQYRLRPDTKI
FT                   QHFTTSFRFKPYFHTLTVKPWDIERVHSVLKLHEYDDLLKQYVELRSQLKRA"
FT   gene            complement(76935..77717)
FT                   /locus_tag="LGAS_0061"
FT                   /note="LactoCOG number LaCOG02230"
FT   CDS_pept        complement(76935..77717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0061"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59475"
FT                   /protein_id="ABJ59475.1"
FT                   /translation="MNTKPSQHNVIYYNSLTDDIVKSKQQDFTLPSDYQIIKRTPLNYL
FT                   MRFLATGFAYLFTYGGMHVKVIGRDKLFKYKHQGYFVYANHTQMVNDVFMPLTLFGWKD
FT                   YYAIANQANWGIPIIGKILLPYGGLPVGKNIKQAIHLLKAVNTLIKENAHIIIYPEAHV
FT                   WPYYTDIRPFPATSFNFPVQTTKPSFVMTTTYQKRKFSKRPRITVYIDGPFFPDTSLPK
FT                   KLQQKKLHDQIFTQLKNRSKLSNCEYYRYQQRKIGGQK"
FT   gene            complement(77784..77856)
FT                   /locus_tag="LGAS_t0062"
FT                   /note="tRNA_Lys_CTT"
FT   tRNA            complement(77784..77856)
FT                   /locus_tag="LGAS_t0062"
FT                   /product="tRNA-Lys"
FT   gene            complement(77982..78054)
FT                   /locus_tag="LGAS_t0063"
FT                   /note="tRNA_Lys_CTT"
FT   tRNA            complement(77982..78054)
FT                   /locus_tag="LGAS_t0063"
FT                   /product="tRNA-Lys"
FT   gene            78181..78888
FT                   /locus_tag="LGAS_0064"
FT                   /note="LactoCOG number LaCOG00290"
FT   CDS_pept        78181..78888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0064"
FT                   /product="DNA-binding response regulator, OmpR family
FT                   (Rec-wHTH domains)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59476"
FT                   /protein_id="ABJ59476.1"
FT                   /translation="MPKKILVVDDEKPISDIIKFNLTKEGFDVDTAYDGEEAVKKVDEY
FT                   DPDLMILDLMLPKKDGLEVAREVRQTHDMPIIMVTAKDTEIDKVLGLEMGADDYVTKPF
FT                   SNRELVARVKANLRRRDLTQKATEDDEDKNITISNLVIMPEAYMVEKNGEKIELTHREF
FT                   ELLHYLAQHMGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSSPTILVTR
FT                   RGVGYYVKNPSDE"
FT   gene            78920..80785
FT                   /locus_tag="LGAS_0065"
FT                   /note="LactoCOG number LaCOG00289"
FT   CDS_pept        78920..80785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0065"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59477"
FT                   /protein_id="ABJ59477.1"
FT                   /translation="MQLGQMKKIKSVLNSINFKIAVIFMLLLLATIEVVGASFTRQLEQ
FT                   NSIQNFESSIQVPNIITNQISSQLSRANSKKANQQLSQIISNYNLGDISQLMVVDNKGV
FT                   IRAVSNVNDQNRIGQRTSNVDIKSVLSNGKQVSKVINDNGNYMVQISPLTSANGTNTPV
FT                   GAIYVRASLQGVFNNLRQVSIYFLIASLIAAVLGAIVALVISRAITRPIEEMRKQALRV
FT                   ANGDYSGHVRVYAQDELGQLAEAFNTLSVRIERTQEISDSERRRLDNVLTHMTDGVIAT
FT                   DRHGNITIINETALDFLGKTEKDVIGKPITNLLGLKDVTIQDLLSTQQELVVRVNDNTR
FT                   DEMILHANFSLIQRVTGFVSGLVCVLHDITQQQKNEREQQQFVSNVSHELRTPLTSLRA
FT                   YVEALNDGAWKDPNIAPQFLHVIQDETERMIRMINDLLSLSRMDRGVARMDLEWVNLND
FT                   FVNHVLNRFDMMLKSDSDKMHKKKYTIKREFPHQALWVEIDTDKMMQVIDNIMNNAIKY
FT                   SPDGGVITVRLLQAQKHVILSISDQGLGIPRKDLNKIFDRFYRVDKARSRKQGGTGLGL
FT                   AISKEIVEAHHGRIWADSAEGAGSTFYISLPYEAISEEGENWDEV"
FT   gene            80679..82103
FT                   /locus_tag="LGAS_0066"
FT                   /note="LactoCOG number LaCOG01536"
FT   CDS_pept        80679..82103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59478"
FT                   /protein_id="ABJ59478.1"
FT                   /translation="MVEFGQIVLKEPAQLSTFLCHMKQLARKEKTGMRFKDKFSRIALR
FT                   VSLIAMVALSIILSAIIWGSDARFSRIEETSNQTQIKDLGQRSLRDIYLPTQTFYFKDK
FT                   QMYQVYDTKNNLPLEFSKLTQSVKPLLPIRVWSSQSKYEKLLKNPDYVQLTYPDQITIS
FT                   LFLTNVRKTDSREFNRFFVPARSSKYIYLGNDENYTIYRVRLNDVSFDNLVEHIQSAKT
FT                   QMPVTLQKVHDDYLPFYDKNLSLPTYSYLTNEESDSYFVYRLLGSNNPTQHSSGESITY
FT                   SNGVYERLIAAKHTHNYEYVDYQQDQVPKTISRKLNDSLYFVRKIGLSEPDLRFFDADN
FT                   NTVIYQNYVEEYPIFLPGKYKMRAQVKFASNGMTINFNSLDLQIPIPTNGEKKTLIPTN
FT                   EAMDELYQKGYHQKDIERIVIGYTAKSDNSKNKKLVDLEPAYYVKINKQWKTLDEWLNI
FT                   NNQITNSRKEGLVDGL"
FT   gene            82093..82914
FT                   /locus_tag="LGAS_0067"
FT                   /note="LactoCOG number LaCOG01537"
FT   CDS_pept        82093..82914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59479"
FT                   /protein_id="ABJ59479.1"
FT                   /translation="MDFKRIEWIFLVVFIGINIFLGIELWQTPTLLSAGSTPIQTDIKS
FT                   ETSADQITIPKVDDKQDDGYYLATKVDNSWTKKAAAQVNQQVETNTTENSISVNLNKPI
FT                   TLSKDSKKALKEIIHFKNNSQNVYEGKDYVYLSELSEGDDYVFNQKTKYGEVFAATARL
FT                   HIIVKNNQIVSYSQRYVSNLNPVRERQNTISSKAAVNSLYTYSELPNNSKIIWLKQVYT
FT                   KLITVRGSEIYIPTWVAAIENNNSHTMTLKRVNAFTGTIIQNNIAADDSKE"
FT   gene            82921..83718
FT                   /locus_tag="LGAS_0068"
FT                   /note="LactoCOG number LaCOG00288"
FT   CDS_pept        82921..83718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0068"
FT                   /product="Metal-dependent hydrolase of the beta-lactamase
FT                   superfamily I"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59480"
FT                   /protein_id="ABJ59480.1"
FT                   /translation="MKVSVLSSGSTGNSTLIETPQHKILMDAGLSGKKTKELLAQVGVD
FT                   IKDIDMVFISHDHTDHSGGLGVLMRRYPKISAYANSGTWNYLIESNKIGKLPVEQINTF
FT                   ESGITKTFGDLDVTSFATSHDAAQPQYYVFTSGGKRFACLTDTGYVSSTVKGEIRDADG
FT                   YLMEFNYDDMMLRNGPYSWALKHRIMSDVGHLSNDQAADTLLDVVSPKTKHIFLAHRSQ
FT                   HNNTQYLAHETAEDLLVAGDANLPADVKIIDTNPMQAGSLTKI"
FT   gene            83766..85025
FT                   /locus_tag="LGAS_0069"
FT                   /note="LactoCOG number LaCOG01440"
FT   CDS_pept        83766..85025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0069"
FT                   /product="Trypsin-like serine protease with PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59481"
FT                   /protein_id="ABJ59481.1"
FT                   /translation="MIRLEMKRKGEIFMAENNTKHPTKHNALIKTGIVGVVAGLLGGGV
FT                   AYAGLSQVNGQNAPQTSVVPTTKVEKSSSKNSSEMTNAFNTVKKSVVSVVNLKRQSSSS
FT                   SSDPFGIFGSDSSSSSKKNSKSDLETYSEGSGVIYMKSNGKGYIVTNNHVVSGSDEIQV
FT                   ILSNGKKVTAKKVGTDSETDLAVLTIDGKYVTQTAQFGSSKNLEPGQQVIAVGSPLGSE
FT                   YATSVTQGIISAKNRTVDVTNSAGQVTNQATVIQTDAAINPGNSGGPLVNMSGQVIGIN
FT                   SMKLSSSSDGTAVEGMGFAIPSDEVVSIINQLVKNGKITRPKLGVRVVSVDELTEYGRK
FT                   KLGLPDSVKSGVYVASVTKNGSADKAGIKSHDVITKIDGKDVDSVVSLHTALYTHKVGD
FT                   TVTLQVVRDGKSQNIKVTLS"
FT   gene            85539..86018
FT                   /locus_tag="LGAS_0070"
FT                   /note="LactoCOG number LaCOG01439"
FT   CDS_pept        85539..86018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59482"
FT                   /db_xref="GOA:Q046Z0"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046Z0"
FT                   /protein_id="ABJ59482.1"
FT                   /translation="MNIKIVCVGKLKEKYFKDGIAEYVKRMGRFAKVKIIQVPDEKAPE
FT                   KLSPAEMEQVKEIEGKRILDKIKDKEYVYVTAIKGKERTSEDFAKELADLTTYGHSDIT
FT                   FVIGGSLGTSNAVNKRADDLISFGKFTMPHQLMRLVLVEQIYRAFMINSGSPYHK"
FT   gene            complement(86019..86672)
FT                   /locus_tag="LGAS_0071"
FT                   /note="LactoCOG number LaCOG01573"
FT   CDS_pept        complement(86019..86672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0071"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component CbiQ related transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59483"
FT                   /protein_id="ABJ59483.1"
FT                   /translation="MNPGLKLFLILIISLEISLIPNLVANIIIIIASLGYLTFKHLSPK
FT                   KLLLLFLIPLFAALVVFITIYYFTPGHSFYHASVLFTRIYAYVFLGATFTEITSILSLA
FT                   RSLEQNFKLPSKFAYGTLAAFNVLPKIHAEVNRIRLVGDMRHYHLSFYSPTLYFKAILA
FT                   AISWSNSLAEGMISHGYREDKPRNVIVPIALTKKDWLIFSSILILLQPILFFIK"
FT   gene            complement(86686..88038)
FT                   /locus_tag="LGAS_0072"
FT                   /note="LactoCOG number LaCOG01574"
FT   CDS_pept        complement(86686..88038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0072"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59484"
FT                   /protein_id="ABJ59484.1"
FT                   /translation="MSSKQIKINQLSFQYQNQPIFKDLNLTINQGDFVLLTGQTGSGKS
FT                   TLLKLISGLDPTFNGKITAGSLKQPFTNWGMVFQDPNRQFTMATPREELIFALENELVD
FT                   RTAALKRINYASVRTNISSLLDQPFLQLSGGEKQRVALAILIAMKSDLFLLDEPFANCD
FT                   SHNRKFLLTCLAALHKEGKTILISDHNFSGYEKLVSTVLAIKDKNIKTITLPENTLKNQ
FT                   ALTFSLPDLKQNPVFSLESFSLSFPERKLISPTDLKIYSGRATLLTGENGSGKTSLFKA
FT                   LTKIIPYQGQLIFKSKDIKKWRRRRYLAKVGQIFQNPDDQFLNVTVKEELDFSLKHNQN
FT                   PSLNKTELKHLLTKLNLENLGEQVVYSLSGGQKRKLQILVMLMAYPEVLLLDEPFSGLD
FT                   QESVSEVIYLLKKYFLNSNHTLLVISHQLAQVQHLCDYHLTIKDQKLFYTN"
FT   gene            complement(88019..88603)
FT                   /locus_tag="LGAS_0073"
FT                   /note="LactoCOG number LaCOG01575"
FT   CDS_pept        complement(88019..88603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0073"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59485"
FT                   /protein_id="ABJ59485.1"
FT                   /translation="MAFLFREEKMKKLHVRDIILIALIAIIFGFIYLVSDGLYNVLTAL
FT                   LTPVGYGMLANDIMMGIWCMAGPLAGFLVRLPGAAFLGEFLGSCVELIAGEQWGAVNLI
FT                   SGAVQGLGSELGFTFTSYRRYNWFTLFLSATTTTIVTYLYDFIKNGYSYFSTFNMIFYF
FT                   VVRWLSMLLFTCVLVKLIINLLVKAHVVQTN"
FT   misc_binding    complement(88627..88717)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="THI element, riboswitch"
FT   gene            88813..89742
FT                   /locus_tag="LGAS_0074"
FT                   /note="LactoCOG number LaCOG02052"
FT   CDS_pept        88813..89742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0074"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59486"
FT                   /protein_id="ABJ59486.1"
FT                   /translation="MATATLKNYLSSLMQNTQGTEIEIRTENLLLPYSLYLETVHYDFT
FT                   EYQSSTSQLIYCFAGKCEVEINNKTFYLTAGNILLIEKDTDYIIKVSDKNAIIVKFKLK
FT                   SNFSWQKQVEQLDANTPTEQRLSTLFLKKLNQDSAFLFTTTSVTWGSQNLKGIIQDYLN
FT                   NVAFNGTIGLELLKIIILRNLREQNFKANEVKESTFKDEALDQYIDQHYNDISLAQAAK
FT                   YFGFNRNYFSTMVKEKTGKSFVEHVDERRMKEARRLLAKPNVSLKEIIETIGYSSKSFF
FT                   YKKFKHYYGMTPAEMRKRLFREAHINLK"
FT   gene            complement(89782..90672)
FT                   /locus_tag="LGAS_0075"
FT                   /note="LactoCOG number LaCOG01624"
FT   CDS_pept        complement(89782..90672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0075"
FT                   /product="Heat shock protein, Metallo peptidase, MEROPS
FT                   family M48B"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59487"
FT                   /protein_id="ABJ59487.1"
FT                   /translation="MLYQQIARNKRKTAFLLVIFVIILALVGGGLGYLINGEPLSGIVI
FT                   ALIGSLIYLFIVLQNPGNLVMSMNHGREIHEEDDPELWHIVEDMALAGQVPMPRVFIIN
FT                   DESPNAFATGRDPKHSFVAVTTGLRKRLNRSELEGVLGHEISHIRNYDILVSTIGVALA
FT                   AVISFISSFASRIWWWGGNSDRDDDDSSSLETIFKIVAIVFTLILGPLAAALAQMALSR
FT                   NREYLADASSVELTRNPQGLISALEKISNSEPMKDPDPSSAGLYIENPFHKRGLSSLFD
FT                   THPPTADRIKRLENM"
FT   gene            complement(90681..91238)
FT                   /locus_tag="LGAS_0076"
FT                   /note="LactoCOG number LaCOG01623"
FT   CDS_pept        complement(90681..91238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59488"
FT                   /protein_id="ABJ59488.1"
FT                   /translation="MTLTWIIIIILILLVAVYIGIYNGLQKAKVHADEAWSQIDVQLKR
FT                   RNDLIPNLVETVKGYAKHESGTLEKVVALRNQLVNIPNSDHEEAIKLSNQITDSLRSIF
FT                   ALAENYPDLKANQNFMSLQEELTNTENKIAYSRQLYNSTVAMFNEKLLTFPSNLVAKIH
FT                   GFKNMDYLQTPTEEKAVPKVKF"
FT   gene            complement(91355..92461)
FT                   /locus_tag="LGAS_0077"
FT                   /note="LactoCOG number LaCOG01181"
FT   CDS_pept        complement(91355..92461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0077"
FT                   /product="transporter, YbiR family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59489"
FT                   /protein_id="ABJ59489.1"
FT                   /translation="MTVIKNIAKDRILQITVVITIISLFFARPRIEDINFHTLYSILAM
FT                   LTIIQIFSYLHVLDVLAYKLTASARSTRRLTAIFTILSIISAMFLTNDITVLTLIPLYL
FT                   TIARRHHLPEILPVTLIGMGANIGAAFTPWGNPHNIFVVNRYNVSPIKFFSWSIPLLLV
FT                   SLIIVLVFIFFVKDKPIPTVPLEDIRISIRPMLLTIAVSIFFFFGVFNIVPAYVPAIVA
FT                   VILALIINPSIMLHVDYALLLTFTCFFIFISDIQQIPFIVTLISKTMFSEHSVFLTSII
FT                   SSQFISNVPSTILIGKFTNFAEALFLGSNIGGFGSIVGSMANMLVFKSFVENGTVSKRK
FT                   FFWVFSVLEFAGLIILTVLGWIVLDFVI"
FT   gene            92638..93048
FT                   /locus_tag="LGAS_0078"
FT                   /note="LactoCOG number LaCOG01864"
FT   CDS_pept        92638..93048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59490"
FT                   /protein_id="ABJ59490.1"
FT                   /translation="MVDSKNLELKIKDSAKEVLEKKIKPGQVVLLALNDGSNGYSKLGG
FT                   TCTIGANFQLVLLDHKDPEFSIKVNNNMGLDMYTSDKELAFLDDGLVLNARNATLSLSS
FT                   NEGIIDGGVTISEFKGEKLSADEMKKLGGKIC"
FT   gene            93127..93267
FT                   /locus_tag="LGAS_0079"
FT   CDS_pept        93127..93267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59491"
FT                   /protein_id="ABJ59491.1"
FT                   /translation="MRKGENYNTGVTPNLRPKNKKNSKARVKRAAEVVAFLNKAAKDEN
FT                   K"
FT   gene            93441..94301
FT                   /locus_tag="LGAS_0080"
FT                   /note="LactoCOG number LaCOG03208"
FT   CDS_pept        93441..94301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59492"
FT                   /protein_id="ABJ59492.1"
FT                   /translation="MNNISRKGLEVKAVFALVLPSLFLGLASNFSRNIFLGVMLLLILG
FT                   AVVGLSIPTIVSTWLILILTVLGISSLTLGYAAIDFYGKTLLLISFPLETYLTSQIKEC
FT                   VFRWQIFKKNQSSAYRYLKHYDQNVKLQTTYNAEKLYKKIKRILTEKNYLPLWCDFTII
FT                   DWEHDQQFAQFNLEDHDKILQQIARVLKTSRLVDENLYYLGNGQFLIISNTIAPGTLMV
FT                   LNDELKAELKRLQYGEYQPAFKMATQHITEQDFLEYPNFNAILKRLKRKLETDLVVEYL
FT                   KGVEA"
FT   gene            94434..95741
FT                   /locus_tag="LGAS_0081"
FT                   /note="LactoCOG number LaCOG00454"
FT   CDS_pept        94434..95741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0081"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59493"
FT                   /protein_id="ABJ59493.1"
FT                   /translation="MLNDFLAVSTLVSIWFSLLASLVTLYGATRFWLKHSKKVISITPL
FT                   KHYPAITIVVPAHNEEVVIANTTKGILNLNYPASKVELLLYADNCQDKTAAEMRKTVDL
FT                   PQYKYRNVQIIERRGSGGKAGVLNDALKIAQGEYICVYDADALPEKNALYFLVKKVLEN
FT                   PQRYMATFGRNKTRNAKQNFLTKCINQEVIVSQRLQHVGVWNLFKIGRIPGTNFIINTE
FT                   YVKKIGGWQSGALTEDTEISFRIMEDGYLIALAYNSEAFEQEPEHLRDYYYQRLRWAKG
FT                   NYQVVMNNFKHLFDTSNWRVKLETFYLACTFFWFNLAVVLSDIIFFVDLGCIITRFFNP
FT                   EIPIIFAMNSNILLMQLLLINWLLMILLYVIQINLALATQYGQATSDQIWLALVSYFTY
FT                   SQLFIAISLQAVCSVIGDKVFKRDGTKWVKTKRFAD"
FT   gene            95751..96869
FT                   /locus_tag="LGAS_0082"
FT                   /note="LactoCOG number LaCOG02303"
FT   CDS_pept        95751..96869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0082"
FT                   /product="Endoglucanase Y"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59494"
FT                   /protein_id="ABJ59494.1"
FT                   /translation="MKVKNLILILGTIIAYLGIIAYVRMSNDRTLEERCYHSWREDYIK
FT                   NKNQNEQYVNAAGRNNPSFALSEAQGYGMLLAAKAGEKHLGSRIDFQKLDNYYLAHRLT
FT                   NSNLMSWKQKDRKNIWRDNPVSASDGDIIIAQALLHADRVWPGHGYKSQAVNLINDIKR
FT                   LEINQKAKMVTVGNWANKDSRFYNVLRTSDVMPKAFEEFYQVTGDQAWLTIKRKMLNYL
FT                   QKLSKKYNTGLVPDFAWISNNYVRPAQANEVAINDDGHYSANACRVPMLLAESNDKEAA
FT                   QVVKKMLKFFKKKGTSAGFTLKGEKLHHYQSASFSAPIFVAASKYRNQGYDTLIEQEKY
FT                   IFSRPLPKDNYYDATLTVLAALNTNELTGLEK"
FT   gene            96984..97628
FT                   /locus_tag="LGAS_0083"
FT                   /note="LactoCOG number LaCOG01666"
FT   CDS_pept        96984..97628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0083"
FT                   /product="Predicted hydrolase of HD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59495"
FT                   /protein_id="ABJ59495.1"
FT                   /translation="MGLNAYIQGFNSLESIDRAPGYFKYQHHSVADHSFRTAELAQMMG
FT                   DIEEVVGKQKINWKALYEKSLNHDYTERFIGDIKTPVKYATPQLRKMIGDVEETMTAKF
FT                   IKDEIPKEFQKIYTKRLSEGKDDTLEGKILSICDKLDLLYEAYGEIELGNPNPVFMQMF
FT                   KESLETIKKFDDLTCVQYFIKKILPDLFKGDFAGKDKMQRIAFSILLMGEE"
FT   gene            97630..98559
FT                   /locus_tag="LGAS_0084"
FT                   /note="LactoCOG number LaCOG02227"
FT   CDS_pept        97630..98559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0084"
FT                   /product="Restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59496"
FT                   /protein_id="ABJ59496.1"
FT                   /translation="MKFQCASCGLRLDSLHFKQEGLMNPKLTSICDICLTRNLNAEDYE
FT                   NPVIENISQVMLYGFVGKKNTGKLNLESLNQYLVGSDHRRQYESFIQDYDGNEVALQQL
FT                   SRSEFNQAIIKSEDKEINYIPNSNVDFAVNMKNMGIEVDFSLNEVDFVDRERIRHKYNY
FT                   RCQYCGRRGTSVDHKDPVSLSHDNSFDNLILSCSECNRIKSNMPYNLFTKLNNQLTVVN
FT                   RKLVKYEDTLANLKEEFQQAKRDLAGQVHLKGVVNDPELNAMRKQNKKLQDAIDSLQSD
FT                   YDALRKLRKTYFETGWKLAQEKENSEII"
FT   gene            complement(98606..99370)
FT                   /locus_tag="LGAS_0085"
FT                   /note="LactoCOG number LaCOG02226"
FT   CDS_pept        complement(98606..99370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0085"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59497"
FT                   /protein_id="ABJ59497.1"
FT                   /translation="MNMNNNNEENILQVQHLQKKYGDHTVLKDISFDINKGEVMTIIGP
FT                   SGGGKSTMLRCINLLEEPSNGKILFHGNNILDSHFDRNKFRSKVGMVFQQFNLFNNKNV
FT                   LQNCMIGQEMVLGRSKEEAKKVAIENLKKVGMEPFLTAKPQQLSGGQQQRVAIARAISM
FT                   DPEILLFDEPTSALDPEMVGEVLNTMQLLAKTGLTMVIVTHEMGFARDVSDQVIFMSDG
FT                   VITEQGTPQEIFNDPQEEKTKKFLRNFRSNEL"
FT   gene            complement(99354..100967)
FT                   /locus_tag="LGAS_0086"
FT                   /note="LactoCOG number LaCOG01165"
FT   CDS_pept        complement(99354..100967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0086"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family / amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59498"
FT                   /protein_id="ABJ59498.1"
FT                   /translation="MKSKIRWFSALLALILSLVIGFSSNSSQTEAAKKEAPLKIGMEAN
FT                   YPPYNWTQTTDANGAVPIDGSKQYANGYDVQIAKIIGKKLHRKVVVEKTEWDGLLPALT
FT                   SGKIDLIIAGMSPTAERRKAINFSVPYRKSTFVVITSKTGKFAQAKGLNDFKGAKLTAQ
FT                   QGTLHYDLIKQLHGAKREPAMRSFSAMRQSLQSGTIDGYVAEDIEYQSYKAVNPNIVAV
FT                   NLNKMQGFKVDHDDSITSIGVKKGNTELLNQVNSILNGISKKKRDQLMADAVKEQPQAG
FT                   GSKKENWFMSIMHRYGSMILGGVGMTLLLALVGTIVGFFIGLLVGIVRTIPTPKSTGKK
FT                   WGLKIVDWILAVYIEVFRGTPMMVQAAVIYYGIAQLWHLNSNRTVAALVIVSINTGAYL
FT                   AEVIRGGINATPKGQFEAASAIGMTHSQQMWHIILPQAIRNCLPSITNEFIVNIKDTSV
FT                   LSIISVSELFFVGTTVASQTFQFFQTYFIISMIYLILTFSITRIFNFIEKKLEGPKNYN
FT                   LMANQLQVEDPKETGFEHEQ"
FT   misc_binding    complement(101082..101255)
FT                   /bound_moiety="lysine"
FT                   /note="Lysine riboswitch"
FT   gene            complement(101303..101872)
FT                   /locus_tag="LGAS_0087"
FT                   /note="LactoCOG number LaCOG01851"
FT   CDS_pept        complement(101303..101872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0087"
FT                   /product="3-methyladenine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59499"
FT                   /protein_id="ABJ59499.1"
FT                   /translation="MGRTLSFNNGNELLSGTIVEAEAYVGVKDRAAHSYGGRRSQANEG
FT                   LYRPGGSLYIYSQRQYFFFDVACQAEGEPQGVLIRAIDPLTGIDTMIKNRNGKTGPLLT
FT                   NGPGKMMQAFGITSRKWDLARLEDSPFDIDINHKRKIEKITALPRVGINQSDPKWAKKK
FT                   LRFIVAGNPYVSDIKKKDVKKNHGFI"
FT   gene            101960..102358
FT                   /locus_tag="LGAS_0088"
FT                   /note="LactoCOG number LaCOG02029"
FT   CDS_pept        101960..102358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59500"
FT                   /protein_id="ABJ59500.1"
FT                   /translation="MKVNINCRGNQKMNEIKVVRIYDHEQPAGYRILVDRLWPRGMSKV
FT                   KAHLDEWDKEIGPTNELRKWFNHEDDKFPEFKTKYIAQLKANPVTTEFVKNVKEKLAQE
FT                   DVIFLYGAKNKKHNQAVVLKDFIDSQLG"
FT   gene            complement(102355..103137)
FT                   /locus_tag="LGAS_0089"
FT                   /note="LactoCOG number LaCOG00731"
FT   CDS_pept        complement(102355..103137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59501"
FT                   /protein_id="ABJ59501.1"
FT                   /translation="MQLIKLYQPFFDANNWAHVLTSGQDWMMILTLILMECLLSVDNAV
FT                   VLAAQTQVLPTKDEQRKSLVYGLWGAYLFRFIVIGIGTYLINFWEIKLLGGLYLLYLVY
FT                   KYFYDLRHPAQVAKKEAAKKEAHKKKSSKTRKHHLSLFWRTVISIESMDIVFSIDSVLA
FT                   ALAMSNNPVVVLVGGMIGILCMRGVAEVIIKLMEIIPELQTMAYVLITIIAVKLLVSLP
FT                   PLNFKLPDAIFAGIVFGTVILTIIFHYVRQNLHGKKMP"
FT   gene            complement(103124..103654)
FT                   /locus_tag="LGAS_0090"
FT                   /note="LactoCOG number LaCOG00347"
FT   CDS_pept        complement(103124..103654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0090"
FT                   /product="Methylated DNA-protein cysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59502"
FT                   /protein_id="ABJ59502.1"
FT                   /translation="MPLAQAKVFYYDFVEIKPWTYELVISNLGLAFVGSKNSNIESSIL
FT                   GFYPNHILVQDSKKLAPYVQQLKEYFAGTRRSFTVPIDYSSFGTPFQNQVVKMIENIPY
FT                   GTTISYNDLASAINGSTSVRTVAHAVALNPSLIFIPSHRVILASDKVGSYRMGEKEKQR
FT                   LIKLEEGYLNAID"
FT   gene            complement(103770..104483)
FT                   /locus_tag="LGAS_0091"
FT                   /note="LactoCOG number LaCOG01614"
FT   CDS_pept        complement(103770..104483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0091"
FT                   /product="NAD-dependent protein deacetylase, SIR2 family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59503"
FT                   /protein_id="ABJ59503.1"
FT                   /translation="MDLNNQIAALQADLNNAHHVTYLTGAGVSTPSHIPDYRSKNGIYN
FT                   GISESPEQILSEDTLFHEPAKFHHFVMENMYFPNAQPNIIHQKIAASCNKNGTLITQNV
FT                   DGLDKKAGNKHVIEFHGNLYNIFCTKCHEKISYEEYKKSYLHAKDHGIIRPGIVLYGEP
FT                   INEMVLTDSVKAIQNSDLVIIAGTSFVVYPFAQLLAYRQATAKVWVINNTPVPTPKDVL
FT                   TIIENAEKVFDKLYI"
FT   gene            104529..105083
FT                   /locus_tag="LGAS_0092"
FT                   /note="LactoCOG number LaCOG02225"
FT   CDS_pept        104529..105083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59504"
FT                   /protein_id="ABJ59504.1"
FT                   /translation="MLREKVVFVIIEVRILTLINIFRRKDMSLLYIAFDILLIGYIFYS
FT                   WYWQANIDYKARFRSSSVIWALIFLLIGFYLDYFTDPTLLMNVFIATFLLMSIIDGVSG
FT                   LAKKRLVVSGYFKRTVKYSDIAHVTLITVPNPKKPTVMAIFQTNNRQAYYLRFSQQISD
FT                   VIANIRKYLGSNVGIEVQSMM"
FT   gene            complement(105164..106555)
FT                   /locus_tag="LGAS_0093"
FT                   /note="LactoCOG number LaCOG00668"
FT   CDS_pept        complement(105164..106555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0093"
FT                   /product="Phosphatidylserine/phosphatidylglycerophosphate/
FT                   cardiolipin synthase related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59505"
FT                   /protein_id="ABJ59505.1"
FT                   /translation="MFHRKRSVATSWAWLIILLIFPVLGFILYGFIGRGLSQENLFAIN
FT                   NQKHIGLNKVNKMIPRIPKDTGPTDTSKEAKILIDYFNFKHDSPLSKNNKISFYTDGEE
FT                   KFKALFKDINQAKETINVEYYSFMNDDLGNQFLNLLIKKAREGVKIRLIYDPWGSPGAS
FT                   KAWFKPLTDLGGEVAAFITAQNMIKKYRMNYHLHRKIVVVDGRISWTGGFNVGDQYVSK
FT                   SKKFGYWRDTHLRIVGSASLLLQERFVMDWNASVTNKNETISFNEKLFPKIEENKLTED
FT                   DVATQIVSDGPDTSTPYLRNGMIRMMMMARKTLWIQTPYLVPDDPMIATWVIAARSGVD
FT                   VRIMIPSMPDHPFIYRATQWYANYLLHEGIKIYVYNNGFIHAKTVMVDERFSAVGSMNQ
FT                   DFRSYSLNFETDAVFYDKNITRELNQIFKKDLANCTELTLDITNNWSRYLRFKQAFSRL
FT                   LSPIL"
FT   gene            complement(106639..107346)
FT                   /locus_tag="LGAS_0094"
FT                   /note="LactoCOG number LaCOG02016"
FT   CDS_pept        complement(106639..107346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0094"
FT                   /product="Predicted Zn-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59506"
FT                   /protein_id="ABJ59506.1"
FT                   /translation="MYYMPFFYDPYFWMIILGVAISGWASMNVNSTFNRYDQIQNQGNY
FT                   TGKVAARYILDQAGLYEVEIREVAGNLTDNYNPTNKVLSLSQSVYNSSSIAAVGVAAHE
FT                   VGHALQDASNYAPMRMRSALVPIVSLGSNLSMPLILLGLVLGMNQTLIKIGIWCFALVL
FT                   LFQVVTLPVEFNASHRALRMLNNGAILSPQEMPMARKVLFAAALTYVAAVLTSMLQLFR
FT                   LLLIFGGHNDDNN"
FT   gene            complement(107370..108293)
FT                   /locus_tag="LGAS_0095"
FT                   /note="LactoCOG number LaCOG01137"
FT   CDS_pept        complement(107370..108293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0095"
FT                   /product="alpha/beta hydrolase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59507"
FT                   /protein_id="ABJ59507.1"
FT                   /translation="MFFIQKRYSEEVEKNNKHKNKEPSIARMTFLGLMATFTPTRWLLR
FT                   MHKRKVEDSSTTEKASTITQTPIFYVHGFRGGDYTTNKMVHAACKAKGTDKFLKVTIDP
FT                   FGNFILEGTWTADPQPIVQLVFKDRIAGVYASSYYLRTALSYLSKRYHFKKYSAVAHSL
FT                   GAPSVVKVEMKTSLRKNFPHLDHCALIAGPFDGVMYLGDLPNVNRLNEKGRPILMSISY
FT                   LGMLFNQRRFNPNISVLNIYGNILDETNTDRFISVVSAKSIRYILAPVAHTFQEIEVRG
FT                   NAAEHSVLHDNPFVINIINKFLKLTD"
FT   gene            108377..109132
FT                   /locus_tag="LGAS_0096"
FT                   /note="LactoCOG number LaCOG01923"
FT   CDS_pept        108377..109132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0096"
FT                   /product="RNase HI"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59508"
FT                   /protein_id="ABJ59508.1"
FT                   /translation="MKYYAVKKGRTPGVYRTWEDAKKQVDGFSGAEYKSFEKITDATEY
FT                   LDWNKETQPDIVKEDSLSNAIKKIQAAKIVPQAKKKKIKKTSSNNPADYFATIYTDGGS
FT                   RNTGVHKGGHVNKTDKAAWAYLIEWQGGRTYGSGGEFGATNNKMELLGLINALEKLLEL
FT                   KFNDKHLLFVLDSQYVLNGINKHWIEGWKKRGWKRANGPLINASEWKKLDSLLGHFSDS
FT                   TFSWTKGHADNEGNVFVDHELNRYMDKMK"
FT   gene            complement(109292..110260)
FT                   /locus_tag="LGAS_0097"
FT                   /note="LactoCOG number LaCOG02036"
FT   CDS_pept        complement(109292..110260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0097"
FT                   /product="Predicted secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59509"
FT                   /protein_id="ABJ59509.1"
FT                   /translation="MKKILTALVAILTSGILGLTAISNTKTVKANENDTPVVTLGTSLT
FT                   SSQKQGTIDTLTQSLNGSNYTTITITGADLVKYLNPSGYDFTNNSGVWSSAMIQKTSSG
FT                   SGINVHILPYNGHNNITTITANQYKNAALTAGISDADIYVTSATPIDGSGALAGVYAAY
FT                   AKNGNSLNQNQINAAQTEMNTLSKITSQNKGKDGYSDAQLNNAVAGAKKEMAKQGQNIS
FT                   DSQIRDIVNNQININHLGDTITNNQKEQIINVLIKIKNSGALKDKNFQQQAGQLADQIQ
FT                   SGAKNIFSKFNTPETRNWFQKLIDSIVSWFRSIFGGVIVLN"
FT   gene            110388..111218
FT                   /locus_tag="LGAS_0098"
FT                   /note="LactoCOG number LaCOG00146"
FT   CDS_pept        110388..111218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0098"
FT                   /product="Glycosyltransferase related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59510"
FT                   /protein_id="ABJ59510.1"
FT                   /translation="MLRQPMLTVIMPVYNMEKYLGRALEALAKQKDKNFKLLIVNDGSK
FT                   DKTREVAEGYRDRFLYFDIINKKNGGLSDARNVGMAHVTTPYFTFHDGDDWVDPGYTAY
FT                   FVRAFDEHPDVDIVSCGFWIDSEKRHESHPVGNKQSGGLIDKREAYLKMTNVFGSPVKG
FT                   YTWNKGYKISVVKKYHLRFVEDLAFMEDQIFNVKYVSLTNGFYYSSTPYYHYWQRADSM
FT                   VHDLNPKKIPDNFRANYRVWHQIIKSLMAEREAQKENKKVAKKASLSDLDHQDL"
FT   gene            111243..111905
FT                   /locus_tag="LGAS_0099"
FT                   /note="LactoCOG number LaCOG00569"
FT   CDS_pept        111243..111905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0099"
FT                   /product="alpha/beta superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59511"
FT                   /protein_id="ABJ59511.1"
FT                   /translation="MKVKVNGVEIYYQKLGKGHPLILLHGHHQDGGIFDKLVAPLSLYY
FT                   TVVVPDMRGHGLSEGEASEHYQTEVEDLRAFISALKLEKPYILGFGSGGLVALSLAAQA
FT                   PELVSKIIVAGTYVNGNGVNAKHIAANTIRGFFKGDRDSKVALRESHIPVETLKRIKTP
FT                   TLCVVGEKDWVKVEHVRWYSQLLPNCRLVLMPRQTHYSYVVHSLKLLDLIKDFCKES"
FT   gene            111994..112356
FT                   /locus_tag="LGAS_0100"
FT                   /note="LactoCOG number LaCOG03209"
FT   CDS_pept        111994..112356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59512"
FT                   /protein_id="ABJ59512.1"
FT                   /translation="MTKIVVQGMNGEMSVDDDKIKIKHTAPLFPGKREVTLDIHSLQAV
FT                   VYKKAHILINGFLKLVPKGDNPMLYQTASLHQMGKDELAIVLRAFENTNPKDAEHFYNY
FT                   VVGRLNQIKAAENNQL"
FT   gene            112437..113429
FT                   /locus_tag="LGAS_0101"
FT                   /note="LactoCOG number LaCOG02224"
FT   CDS_pept        112437..113429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0101"
FT                   /product="Phosphoribosylpyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59513"
FT                   /protein_id="ABJ59513.1"
FT                   /translation="MMNKEELHEMLHPMKLIGLGGNQALAERIASALDKPLLETAVQHF
FT                   SDGEIQVNITESVRGCDVYVIQSIQDPVNENFMELMIVLDALHRASAHSVNVVIPYMAY
FT                   SRQDTKNRSREPITAKLLANLLQLTDIDDLIAVDLHASQIQGFYNIPVDHLHAMPILAQ
FT                   YFLDNGIASKDDDDVVVVSPDHSGAKLARTFGSYFDAPIAIVDQRGARYDAEAHDMIGD
FT                   VKDKTVIIVDDLIDTGSRIASSTKSVLAAGAKKVYVAATHALLSQNAIDVLNELPVEQI
FT                   VVTDTIKHKKYPDRMVRLSVARLLAKGIDYIYNDKSIHQIFDEQNRIQG"
FT   gene            113581..114795
FT                   /locus_tag="LGAS_0102"
FT                   /note="LactoCOG number LaCOG00122"
FT   CDS_pept        113581..114795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0102"
FT                   /product="immunity protein PlnI, membrane-bound protease
FT                   CAAX family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59514"
FT                   /protein_id="ABJ59514.1"
FT                   /translation="MDKMKRVFQAQLYLNILMAVIILINYRTVKDWIYLGILAVAVVVS
FT                   KNKRISQLINTVLIPMVFIDQVRNLSDILIQHFSQLTLLIFWIYAVGAIIVLIPVTIVE
FT                   YGKIKKPIWRLIASVWMINFVIMFCYLLTLKNVNPDGFLVSLNKSGLVYALAILVYVYF
FT                   AVKSWGYEFCFNLPTFKGKKMQLLSFILIFGIAIWISFFKVFSEFAQRWQELFWNWDFS
FT                   LLNPTESALLKNAWSVFLYSIEAGIGEEATRYINLVLLLVIFKNKKWQINGAVLGSAIL
FT                   FALPHIGNAFASELKQTPLATAFQVIDTFGFGCFAAALILYSGKLWPTMVIHALYDILA
FT                   FSKTPLTQDSVGIFGGNTGQFIHVIISLVLWVSFAAFLLIKNRKLVKQNVQILTRVQKT
FT                   DLTIS"
FT   gene            114928..116277
FT                   /locus_tag="LGAS_0103"
FT                   /note="LactoCOG number LaCOG00259"
FT   CDS_pept        114928..116277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0103"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59515"
FT                   /protein_id="ABJ59515.1"
FT                   /translation="MDEKEKLKLKRSLKSRHVTMIAIGGAIGTGLFLGSGTAIQSAGPS
FT                   IILSYLIVGIISFFMMRALGELILAEPDQHSFIESVKKYLGNRMEFVAGWTYWLCWLSL
FT                   AMADLTATGIYLKYWFKDLPQWVGPLVIVVLLMLVNMVNVGLFGELESWFSMIKVLAIL
FT                   ALIVTGLILLVMHSKIDSRTVSLSNLINYGGFFPTGSWGFLKSFQMVVFAFVGIEIVGL
FT                   TAGETANPDKDIPKAINTLPVRIGLFYVGSMIAIMAVYPWNKIVTTTSPFVQVFGAIGI
FT                   PAAAGILNFVVLTAAMSATNSAIFSTSRSLYALSRGNNAPKRFGKLSRKAVPNNALTFS
FT                   SLILFIVVILNYIMPAQVFDIISSVSTINFIMVWIIIMWTHLKYRAENKGKLGSFRMPG
FT                   FPITSWVTIIFYLVILIILALIPATRLPLLISIIFILALALSYTLLERKN"
FT   gene            116451..117110
FT                   /locus_tag="LGAS_0104"
FT                   /note="LactoCOG number LaCOG02037"
FT   CDS_pept        116451..117110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0104"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59516"
FT                   /protein_id="ABJ59516.1"
FT                   /translation="MARQKNLARRHEILRNTFMLLKKRGMENVSLQMIADKSGISKSLL
FT                   QSYYPRKNLLITEIVTNFMTAVLKSLNATDFKNLNTYSKMKIFIYLILEQGIQDEGVER
FT                   VVKSILSDGDSLDRWSQILDDWLKNEGVKHDLGNDRQVQIGLNFIVTAGGGLYVKRTEF
FT                   DLDADQISDIMVKTFMSTFLSIDESKISQTLVEAKSALQKYELTTLTQAINKMFDN"
FT   gene            117131..117970
FT                   /locus_tag="LGAS_0105"
FT                   /note="LactoCOG number LaCOG02223"
FT   CDS_pept        117131..117970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59517"
FT                   /protein_id="ABJ59517.1"
FT                   /translation="MAVRTRSELRRIDQAQTVHDKRSFGIAIFTIVVLFFSLVTFMNPI
FT                   FMKSQIAKESNGVVAERYINQKFDNFAAAIGADRSSNNSTNNLLTVKQTRPIANAMIDY
FT                   TLGVHLFRAENSSLASQIRKVILTKIDDNSSMEAKSVQEKLKKNKESGLYAIITSFGLA
FT                   NATLAANVELVFLILNILVIIFVGILAYQQIKRLKEIVSTGRLIHMFAAGGMRASLGLI
FT                   VVFGLLAFIPTIFNVEGLILNIGYFLEIASGIFLELVIVGVVLFVISTVTWQLTSAK"
FT   gene            complement(118298..119824)
FT                   /locus_tag="LGAS_0106"
FT                   /note="LactoCOG number LaCOG02222"
FT   CDS_pept        complement(118298..119824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0106"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59518"
FT                   /protein_id="ABJ59518.1"
FT                   /translation="MNFTKKATAFIVAITLSATTSTVTINEALAATFTKDEIQEVHQIQ
FT                   NQYSRLPKQTFNSSNLYASSPHLTAPFSPGSVTSSYISSQLDYINFYRRLFDLPSISTN
FT                   KTDNDNAQITASVMAAIKANPFTNQHGLPSETRPNYISDTYWTIAKNVSASSNLNFNVS
FT                   NQSAGDVITDLLTDTYNLDGSDTGHRAWLLSSRLTTTGIGAAYGENSYRYSVQQVAYSS
FT                   DGYKAAAKSAVAYPNSGVFPIELLQGNNIAWSLYLSDKTTPGIPKITVTDLDTGEVSQA
FT                   TNVNNFSNKAYGYFKTIITYFPGDIKLVSGHEYNVNINNVYQYSFKLFNQVAANQPKLK
FT                   TSNDNTETKSREKNSEKISSSQNIKDSSDKTTRKILKQVADPDSSATIKSALLLQAEKL
FT                   RDSLNKKRRMNTVIFGRSYQDGYSYYNLGNDQWFHNFYVYNNPDFTAGVVNIDNHSFDT
FT                   NIYTSPYPNLQKRTANHVTSGKSYAYGQSITTDHITWYYLGKKQWIRQNN"
FT   gene            119938..121065
FT                   /locus_tag="LGAS_0107"
FT                   /note="LactoCOG number LaCOG00245"
FT   CDS_pept        119938..121065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0107"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59519"
FT                   /db_xref="GOA:Q046V3"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046V3"
FT                   /protein_id="ABJ59519.1"
FT                   /translation="MFIIRFRGQKGDKNMTDKIKVGLIFGGNSSEYEVSIMSAHNIYEE
FT                   IDTNKFDVYPMWITNDGYLANDADSRKVLDNPKMEVANPHKVANISNIVELKDRPEIDV
FT                   FFPIVHGNLGEDGCLQGLFRVLDKPFVGDDVLAAAVTMDKEMTKILAQRAGVPVAKWIA
FT                   VKRFEYNDPDNNKLDYEYVASQLGSDLFVKPSNQGSSVGVSHVTNEKEYKVALAEAFKY
FT                   DDKVLVEETVHGTEVETAVLGNDKPIVAGVGQIINAKDSFYTYENKYDDNSTSTLEIPA
FT                   KLPEGIVEKVRKNALKVFQATECSGLARIDSMLRTEDKEVVLTEVNALPGFTNISMYPK
FT                   LFEEVGIPYTDLITKLIDYAMERYDHKKTLLHKHD"
FT   gene            121095..121814
FT                   /locus_tag="LGAS_0108"
FT                   /note="LactoCOG number LaCOG01579"
FT   CDS_pept        121095..121814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0108"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59520"
FT                   /protein_id="ABJ59520.1"
FT                   /translation="MASDHNFEELEAPAKTAEELHISVATLRKYSLIVEKVTGNKDYYE
FT                   RTKQKSRLYSAKDIEDLKAFKALSKKADLTLQEAARQIFAVSDKKAEEAKKAAKVQKEV
FT                   ATKTATVDADQVVKLLTMLQNTIASQNQAIQDLQKQVARVEAQNKKLIDRSHQLAEPES
FT                   TDSQKEVQSNKDQEAANNITEEQKSDQEVHEEILRKARENEEKRRKQKVEENIHRTLAQ
FT                   MQIRPKKKHHWWDRFFN"
FT   gene            complement(121848..123419)
FT                   /locus_tag="LGAS_0109"
FT                   /note="LactoCOG number LaCOG00278"
FT   CDS_pept        complement(121848..123419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0109"
FT                   /product="sodium/proton antiporter, CPA1 family"
FT                   /note="TC 2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59521"
FT                   /protein_id="ABJ59521.1"
FT                   /translation="MELMISTFTLAIAAAISIIIAQAIDKVSVNYISMIIGIIIGLVPF
FT                   LNQQVASFDSEIFMELIVAPLLFFEGQKTRIHNVGRRIKEIIGLTIIMVLLALIVSGFS
FT                   IHLLTDVSLPLAFIIGSISTPTDATASEAVTNGLRMPRRVMSALRAESLFNDASGIILL
FT                   NMSLLWFANGYINYGQTIQDFCISSIGGAVLGFAVAWVIIIFRQTLVRSRFNSLNAQNL
FT                   IYILTPLALYALAEHLQVSGIIAVVVAGLLHNAESQQSLLLNSRQVHMSRDLQNLISDI
FT                   FNSMVFIILGLMMVRISRNKLFNGDLAKWIIVGIIVYLANLLVRYLYGRLIIRYDRRES
FT                   IVFSLGGIHGAVTLALALTISVDFLGSQSYNLVIMSEAVLIILSMLVPIIVFQFILPHN
FT                   VSDEEAHIVMDKIRSEMVKRALVVVHKMYLPQRVKRHVIYTLLNQKRVVKTREYMRVLL
FT                   KTIDQPNLSKSEQYLQRLAFFRAFAIEREYLEMIGQKESKYRTYILNLYNDVLLAESLI
FT                   IEPEDE"
FT   gene            123528..124610
FT                   /locus_tag="LGAS_0110"
FT                   /note="LactoCOG number LaCOG00560"
FT   CDS_pept        123528..124610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0110"
FT                   /product="Predicted multitransmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59522"
FT                   /protein_id="ABJ59522.1"
FT                   /translation="MKKNQKVWLSLTTLIVGIVFTAITYFSTTFASKPIAVITDNHIQD
FT                   TLINKTKDNYENKDEVRQQILHLKIISGKYRGKRFVVTNTYSPSQAVSQKYRPHQRVIV
FT                   SFIKEKPKLVEPKRDWVVVLSMFLTISLIILITGKQASLLLISMVLNSIIFYFVIKNDI
FT                   KENGTKIFLVYGIAAILFTLISLIIVQGFNQKMIVTLCATLLGVFVSFGIFYLVMRLTH
FT                   EHGIDYEAVDYATQDPRALFLSQTILGVLGAVMDEATDIVSSLYALAKHKVDLTFKELF
FT                   LSGRTLGQEIMGPLINVLVLIFMAEALPMTILYLRDNNTLVYTFKYTLSLGVIQSLSSA
FT                   IGIVLTVIFATLASSVFLKK"
FT   gene            124632..125393
FT                   /locus_tag="LGAS_0111"
FT                   /note="LactoCOG number LaCOG00561"
FT   CDS_pept        124632..125393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0111"
FT                   /product="Predicted multitransmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59523"
FT                   /protein_id="ABJ59523.1"
FT                   /translation="MTTLTALLIILLILMIIVGGKTGLKSYLSVVINACLLILVALLIS
FT                   WGVNIILVGVIFIPLKLLTIIYLGTHDYTVAKNAFLTALCVSLIVMLIIILFESLAQTQ
FT                   GFGDQAGEELIGLSLNVGISFAQIAILVAIFSMLGAIAEASVAMSAGLLELKRHDPNIT
FT                   QKQLIKSGNEVGSDVLGTAMNTILFGLFGSFLPIFIWYMRLNYSLFEILNDKLFVDEFL
FT                   IIVYSFIGVLLTVPLTTIFLAHTLTHDEIKK"
FT   gene            125415..126233
FT                   /locus_tag="LGAS_0112"
FT                   /note="LactoCOG number LaCOG00317"
FT   CDS_pept        125415..126233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0112"
FT                   /product="Esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59524"
FT                   /protein_id="ABJ59524.1"
FT                   /translation="MKVEYLTQKNFNNREFKITYYGLQDNPQLLQKKRPLILVFPGGSF
FT                   DHLSLREGEPVALAYAARGFNAAVVSYNLTTDPGKIYPDAALSGLKAISYFRKNSEKLG
FT                   IDQDRITTIGFSAGGHVVSSMNVMAESEKWQAKYNFNHDQVAPNATILGYPLINIKDIG
FT                   FPLPPDANQKMPTVKELLDTALGVTPDTPPTFIFQAVDDPVVLIDNTIEYITALRKKRV
FT                   HFEAHLFNKGGHGFSLATPEVAMAGREPDSHLAHWFELSLEWLKDRKIYI"
FT   gene            complement(126335..129394)
FT                   /locus_tag="LGAS_0113"
FT                   /note="LactoCOG number LaCOG00488"
FT   CDS_pept        complement(126335..129394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0113"
FT                   /product="Alpha-glucosidase, family 31 of glycosyl
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59525"
FT                   /protein_id="ABJ59525.1"
FT                   /translation="MSEITNNQQPQQLSRLVQVAKGTRYYDLQFADRKRARLYIIAKGI
FT                   FRLIVDPTAEFKPLSPSLTIAAGNFSLRPFEESQLLVTDETFTIKSGQFSLRLQKNPAI
FT                   FSIFDDQLHRYRMMQSSPIELGADCSREFLRQNKNEFYYGGGMQNGSFSHKGKIIEIKN
FT                   TNLTGPGAVACPEGFFWSNAGFAELRNTWKDGIYNFKGENGNTAIITHQTPIFDNFYLL
FT                   GDSPAEILRQYYKITGSPLFLPKYALGLGYLGNYLDTCWSVAKPQENNAIKFEDGNTYK
FT                   IAHADNEIIAKSSLNGEEQYQFSARAMIERYRSYHLPLSWFVPNYNSKQALNETELANL
FT                   VDFAKEQNIKLGFYGALPTNAPANFLKFKTEAPNLANDKIMQDFAIASEPLVDKNKTNR
FT                   PWAMASNGWSAIQTLATTANEGVGGEWEQIATEIASFLSMSLSGQPNVGSAIDGKEGGG
FT                   NAQVNIRDLQWKVFTPLLYSIDNYGNIQKTPFAFNAKMTRITRAYLKLRGRITPYLYTL
FT                   TRAAQDGMPIVRPLFLSFPHEKVNYTNQVKHEFMLGNNLLVAPITNGREDPSGASLKDN
FT                   LYLPDHRTMWIDLFTGKKLIGGRIYDKLHYPLWHLPVYVRGGAILQESLRSALVYPQNK
FT                   SSAILYEDDNQTNDYEKGNAATTQITSSVNGSNLHITVYPTEGSYAGLEEKQATFLTIM
FT                   ADRYPGKVSLKLNDQIVPLPEYNDLDSFNKSEEGIFYQQDYVPCKEFGQFTGQLQPAIK
FT                   VKMPAVDIHDNKFELTIENFSYGSEVEQHAIIDSAMASPRSAAILTDRLTSKSITITWT
FT                   NPTNFAGKNIMADIEVNGIVHTNIDGDTFTFHELEPNTRYRFRIRNKFGNKVSDWSEYF
FT                   GTHTKRDQMDYAISNVKVTSAAESEKDSPVENLTDLKLASEWLSKDKISKDSPLDLTFN
FT                   FNHIYKLSRMVYVPRSRDRIGHILRVQVAISKDGENFSDFSKEINWPNDAKNKVIGLRD
FT                   VVAKAIKLRILATSDNLASGKEILFFMAKE"
FT   gene            129553..130272
FT                   /locus_tag="LGAS_0114"
FT                   /note="LactoCOG number LaCOG02304"
FT   CDS_pept        129553..130272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0114"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59526"
FT                   /protein_id="ABJ59526.1"
FT                   /translation="MKRPLYQQVISDLEKKIKTEMKPNDRLPSERQLLKEYGVSRNTIR
FT                   LALNNLEERGIIYRLHGKGTFVSTIYLDQTNLGSMYSFSEQMSEAGRKPTTQNRTLELV
FT                   VPDAAVANQLNLKAGEKAYKLVRLRLADGVPLMYGETYLPESIFPDLKMSDLNENHLYT
FT                   VMKRKYNEQSVLAFEDVQAVNLDKRDSKILGVKPGDASLKIFRRAINDKNVPIEFTISL
FT                   ARGDRFIYRSRQYNHLV"
FT   gene            130293..131459
FT                   /locus_tag="LGAS_0115"
FT                   /note="LactoCOG number LaCOG02305"
FT   CDS_pept        130293..131459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0115"
FT                   /product="galactosamine 6-phosphate isomerase AgaS"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59527"
FT                   /protein_id="ABJ59527.1"
FT                   /translation="MFTKSDAELKKMGADITTREIQQQPSLWKETFKIYQEKKQEIDDF
FT                   LAKINQKFNKVKVIFTGAGTSAYVGNTVMPYLRKHGDRTKYDFEAIDTTKIVSTPEDYL
FT                   EAETPTILVSFARSGNSPESVATVELAKQLVTNLYQIAITCAPEGHLAQDLKDDPNGLV
FT                   LLMPAKSLDQGFAMTGSFSCMSLATLLVFDTRGDAEKEAIVNEISKMGESVVDREAEIQ
FT                   KLVDTDFDRITYIGSGALGGLAEEARLKILELTAGKVAALFDTSMGLRHGPKSFLDKKT
FT                   IVFDFVSNNSYTRRYDLDILDEIKADEIVPLVMGVGQLKKGQDFDGKFFAFSGEELPDA
FT                   YLALPDIMFGQTIALLTSVKVGNTPDTPSPTGTVNRVVKGVTIHKFIK"
FT   gene            131521..132678
FT                   /locus_tag="LGAS_0116"
FT                   /note="LactoCOG number LaCOG00902"
FT   CDS_pept        131521..132678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0116"
FT                   /product="N-acetylglucosamine 6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59528"
FT                   /protein_id="ABJ59528.1"
FT                   /translation="MSYYIHAGKFFLENRTENGGYLEVQDDGNFGLYYREDEKPSHGLI
FT                   KEYGDQWIAPGYVDTHIHGLLDEDTMKSDWEGVNKISEGLLQAGVTSWLPTTITASDKE
FT                   LTETCEKFAAHKGEETGAKIQGLHFEGPFFTPKHGGAENPKYMTDPSIMLLKKWRKASD
FT                   DMLIKISMAPERKNARQFVREAVKMGLVVALGHSDSDFEDAIACVEAGASVFTHTFNGM
FT                   NGLSQHSPNIIGAAFSSRLTTDELICDGHHVEEPAVRALVNARGPEHIALITDCMQAGL
FT                   MPDGDYVLGELPVYVKDGMARLKDTNNLAGSILLLKDAVKNIVDWNVATPEDAVMMASY
FT                   VPAKSCNLLDKCGVIKPDHPADFVVLNHDMTVSETYLNGESRYKA"
FT   gene            132818..133306
FT                   /locus_tag="LGAS_0117"
FT                   /note="LactoCOG number LaCOG02306"
FT   CDS_pept        132818..133306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0117"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIB"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59529"
FT                   /protein_id="ABJ59529.1"
FT                   /translation="MNIVGARIDGRLVHGQVANLWTPKLQADRIIVVDEEAAKSDIQKS
FT                   GLRMATPLTTRLSVLPAQVAADHLIHERYGNQRIFIVAKKPAAFLDLLNLGLKLDTLNV
FT                   GTMSQTDTTKQVTKQINVEEKDVEDFKKIADKGVKITAQLTPSDDSHDFMKLMNEKIK"
FT   gene            133318..134235
FT                   /locus_tag="LGAS_0118"
FT                   /note="LactoCOG number LaCOG02307"
FT   CDS_pept        133318..134235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0118"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIC"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59530"
FT                   /protein_id="ABJ59530.1"
FT                   /translation="MAWWQILLLTLYAGYEILDELQIYSSLNTPVGAGLIAGLIMGDLK
FT                   TGLIIGGAMQLTVLGVGTFGGASKIDATTGTVLATAFSVSIKGMSPQVAISSIAVPVAA
FT                   IMVQLDVLARFANTYFAHRIDHLIEENNYKGIERNFLYGAIPWALSRAIPVFIALAFGR
FT                   GLVQTIANSLNGNLKWLGTGLTVAGAVLPAVGFAILLRYLPVKKHIAYLIMGFTFTTLF
FT                   SVLFTSIQTLGTGLQAANKSFTATFNGLPMLAMALIGLAFAILHYKDEISGKGGSGKGG
FT                   TKEAAATTESTNVASEGEITDDEL"
FT   gene            134222..135040
FT                   /locus_tag="LGAS_0119"
FT                   /note="LactoCOG number LaCOG02308"
FT   CDS_pept        134222..135040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0119"
FT                   /product="PTS system IID component, Man family"
FT                   /note="TC 4.A.6"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59531"
FT                   /protein_id="ABJ59531.1"
FT                   /translation="MMNSKPKYKLTDKDFNQINRRSLFGFQLGWNYERMQNTGYLFLIL
FT                   PQLRKIYGDNTPELQEMMKTHVQFFNTSNFFNTIITGIDLAIEENEGVEGKDTVTGLKV
FT                   GLMGPFAAIGDSIFAALIPTIFGALAASMASQGNPVGVFIWIAAQIAICFFRWKQLRFA
FT                   YDKGVTLVTEMRDRLNALTDAATVLGVFMVGALVATMVNVKFAWVPQIGKVTMNIQNNL
FT                   DMIIPKLLPALIVGFVYWLLGKKKMTSTKAILIVLVLSVVLGGIGVLAKI"
FT   gene            135064..135462
FT                   /locus_tag="LGAS_0120"
FT                   /note="LactoCOG number LaCOG02309"
FT   CDS_pept        135064..135462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0120"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose-specific component IIA"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59532"
FT                   /protein_id="ABJ59532.1"
FT                   /translation="MAKELVLISHGKMAEEVKKSAELIMGPQEHIHAVCLLPEEGPEDF
FT                   EKKFQDTINGIPEEDLTVFADLMGGTPANTVSRLIMGGQNIHLVAGMNLAMVIDWLNSQ
FT                   MIGNDSDAVNAGKAGIVDINQMLASMKK"
FT   gene            135495..135962
FT                   /locus_tag="LGAS_0121"
FT   CDS_pept        135495..135962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59533"
FT                   /protein_id="ABJ59533.1"
FT                   /translation="MVKPHVGRFFIIKKFIDFCFDQDRSKQLQDGVTKIIINSQVSTEG
FT                   QSEDLKALAKLMNNKPVKLNKHFDYAQRRIKEINEDPETREKIMLYETRMLEREQAAGK
FT                   AGYEQGKVDSAKIILENQLNNGRTLEQATEFVRNLKLISDKELEKVVAMYK"
FT   gene            136143..137315
FT                   /locus_tag="LGAS_0122"
FT                   /note="LactoCOG number LaCOG02121"
FT   CDS_pept        136143..137315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0122"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59534"
FT                   /protein_id="ABJ59534.1"
FT                   /translation="MNKFCPHCGKPIKPTDSFCSHCGKPVVSSESEKQLMPKRSEIHSN
FT                   RLKSKKRNIIIGVIVAVLVLIMGGWGLYQHGRNSAESTVIGGNGRLTNAEIKKIPRKQL
FT                   AAWAILYADKKYGKKWGEAADDLRSGHLTIKSYSKYRFGDYEISATDGSTLYVINDQVG
FT                   YLVSKDNKEITYVGNKSSYSNRSVLSQIYPEIKSENTEKNVNTWNDNLSIVTGKSDENA
FT                   SDQSSKTSKKTKKTVSEDKLWSSNQNDELISYMDEFGDKMHQSYEHYTGSGSLTTAAGQ
FT                   EYPSWLSQGRFKLSTGDHDSRDPEDMSSIDLKWNPQVTSEDSDDDTYNVVAIFNYNGKS
FT                   AEQHITYLFCFYHGEPVALVDQTTNGDYTIVHATANKDLTSHFEEIANND"
FT   gene            137322..138347
FT                   /locus_tag="LGAS_0123"
FT                   /note="LactoCOG number LaCOG02146"
FT   CDS_pept        137322..138347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59535"
FT                   /protein_id="ABJ59535.1"
FT                   /translation="MEIKMKNRVFIFLLVGFLVLTMAGCQSQIKQEKGSNEQARIIKKT
FT                   KANKNISIIGSYRDDADGAAIAFNSDHTGRYVYADPKNSDTDDQLTWKKTGKNTYIIRL
FT                   NDSDVSSALTAKLTGSTLVISGDGDWNTETFNKTKNKLNLDDFLSNRKVGNSTSSKANG
FT                   DVKNSKSTNSIPGDEGLFDMPNELRGTWYLANESDGSVSKLIIDKNTITGEGFVEKLHK
FT                   MSKNFDFTSYVQEHPSYQDMTKDWARVVVLSENGESKINVRGWLQGAGAGEYYNLATEH
FT                   GQKVLVIGGGAEAWVDGIGWKNKTDAEKYAKEKFSDLHYREDISLENNDDSDSATTNDE
FT                   N"
FT   gene            complement(138442..138918)
FT                   /locus_tag="LGAS_0124"
FT                   /note="LactoCOG number LaCOG00336"
FT   CDS_pept        complement(138442..138918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0124"
FT                   /product="nucleotide deoxyribosyltransferase"
FT                   /EC_number="2.4.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59536"
FT                   /protein_id="ABJ59536.1"
FT                   /translation="MTKQKTVYFGAGWFTETQNKAYKDAMSALNANPTIDLENSYVPLQ
FT                   NQYKDIRVDEHPEYLHDKEWAQATYSGDLVGIRTSDVMLGVYVPKEEDVGLGMELGYAM
FT                   SQGKYVLLVIPDDLYGESINLMSWGVADNVIKMSELATFDFNRPRYNFYDGAVY"
FT   gene            139003..139557
FT                   /locus_tag="LGAS_0125"
FT                   /note="LactoCOG number LaCOG02065"
FT   CDS_pept        139003..139557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0125"
FT                   /product="PTS system IIA component, Gat family"
FT                   /note="TC 4.A.5"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59537"
FT                   /protein_id="ABJ59537.1"
FT                   /translation="MFLKSVLYNETRNFCLGKAEPTTNTKKNLFDPEAVFVTDLTDRNE
FT                   IFKTVSQKLYDLGYVKEDFLGDIIEREDKYPTGISMRPLSRKLPDVAVPHTEGNYVSTQ
FT                   LIVPIALRNSATFNNMVNPTEKLKVKFLFLILNNDPDMHSTILAKIMDFLAGTSVDDLN
FT                   ELFNSDSNEEIYDFLENNFEN"
FT   gene            complement(139610..140347)
FT                   /locus_tag="LGAS_0126"
FT                   /note="LactoCOG number LaCOG02056"
FT   CDS_pept        complement(139610..140347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0126"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59538"
FT                   /protein_id="ABJ59538.1"
FT                   /translation="MIHIMDIPKYLQIENELKKEIISGKFKYGDKFYSEAQLKDKFNVS
FT                   SITVIRSVKDLVKAGYLVRHQGKGTFISRSRKDKLVRLSDNEVFSDNQQEDRVEVLKLQ
FT                   ENNKPDILERLGLPKYDSYYYIERLRLIGDKPFMLHRSFIPAKFINRNLAKDPNNYHSI
FT                   YETLQKDKQLYLFDEPFTETDTIIQADDKISQRLNIAKDYPVVRQVKKTILSATGEVVE
FT                   LVIGYKRCDYFSLSFSSTDYPEV"
FT   gene            complement(140344..141147)
FT                   /locus_tag="LGAS_0127"
FT                   /note="LactoCOG number LaCOG01224"
FT   CDS_pept        complement(140344..141147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0127"
FT                   /product="protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59539"
FT                   /protein_id="ABJ59539.1"
FT                   /translation="MSENYETKLIGIQNGRNFRELGGYKTVSGQTIKYNKLLRTGNLAD
FT                   LSSSDLDLLQKHGVKYDVDFRTEKEKTEHPDRVPEGAKYIFDPVFSDDLTNASKGIFAL
FT                   EENAEKDPEFGFKHMFFAYEDMINGQTAQKAYRKFFDLLLANDQEKNALLFHCTAGKDR
FT                   TGFGALLVLSALGVPFTTIKYDYTLTNVTTKSFVDGMLKQAAADGSSKRVLQSIKDIQS
FT                   VYPEYLDHAIHVLNQQYGGINEYLRSTMKLSSRDIMDLRRIYLKD"
FT   gene            141321..141815
FT                   /locus_tag="LGAS_0128"
FT                   /note="LactoCOG number LaCOG01933"
FT   CDS_pept        141321..141815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0128"
FT                   /product="Universal stress protein UspA related
FT                   nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59540"
FT                   /protein_id="ABJ59540.1"
FT                   /translation="MVKDYDNILVPVDGSETAERAFDKAVKIALDNNAHLDVLNVIDTR
FT                   QFMGEMQDTLISGDTIYQMTQDSEEYLKSLKEWAKEHFDFTDVSYHIRYGSPKRIIAVD
FT                   FIKDHHNDLIIMGATGMNAVERMLMGSVTAYVNQHALSDVLIIKTDIDNKKVAKPKKKL
FT                   F"
FT   gene            142219..143148
FT                   /locus_tag="LGAS_0129"
FT                   /note="LactoCOG number LaCOG00209"
FT   CDS_pept        142219..143148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0129"
FT                   /product="ABC-type phosphate/phosphonate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59541"
FT                   /protein_id="ABJ59541.1"
FT                   /translation="MKKFKKVLVGLFAILLAVVATACSNKSNGSKDGYTPKSLTIQFVP
FT                   SQAANKLEARAKPLEKMLSKKLGIPVHVSMSTDYNTVVEAMKSKKVDVGFLPPDGYVLA
FT                   HKQGAANVLLQAQRYGVKQPGGQATKNLVNSYRAEILVKKGSKIKSWKDLKGKSISVQN
FT                   PTSSAGYVFPVAELEEKGLNVPKDCKLVTVTGHDQAVLNVLNGDTDAAFVFEDARNIVK
FT                   KDNPKIMDQVVPIYFTKPIPNDTISIRSDMSKSFQKKLAKAFIEVGQSKEGKKIIESVY
FT                   SHEGYTKSKDSNFDIVRKYDKIIAKDKK"
FT   gene            143256..144041
FT                   /locus_tag="LGAS_0130"
FT                   /note="LactoCOG number LaCOG00210"
FT   CDS_pept        143256..144041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0130"
FT                   /product="ABC-type phosphate/phosphonate transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59542"
FT                   /db_xref="GOA:Q046T0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046T0"
FT                   /protein_id="ABJ59542.1"
FT                   /translation="MAATNQPMIQLKDVSKIYDNGTVGLKDINLNIDKGEFVVVVGLSG
FT                   AGKSTLLRSINRLQDVSKGDILIDGKSITSAKGKDLREIRRDIGMIFQSFNLVKRSSVL
FT                   RNVLTGRVAYYPTWKTTFNLFTKEDKQKAYEALQRVDLADKVYTRADQLSGGQQQRVAI
FT                   ARVLTQNPKIILADEPTASLDPQTSRRVMHDLKMLNEEYGMTVVANLHSVELAKEFGDR
FT                   VIGVRAGQIVYDGKMSETSQAVFDDIYNGGNGKKGEEDA"
FT   gene            143968..144837
FT                   /locus_tag="LGAS_0131"
FT                   /note="LactoCOG number LaCOG00211"
FT   CDS_pept        143968..144837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0131"
FT                   /product="ABC-type phosphate/phosphonate transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59543"
FT                   /protein_id="ABJ59543.1"
FT                   /translation="MKLLKPCLTISTMAETARKGKKMPKSKEQHLAELPKKKFKIMNLV
FT                   WVVIMVLGLFLSVNVTNTHISVLFNNFSQFTDIFVQMCHPDWGYAATAVPLLIETIKMA
FT                   ILGTVIGSAIAFVYSLLIARNIVKNKAVTGILRVIMNIVRTIPDLLLGAIFVAIVGIGP
FT                   VAGVLALSVFTFGVVVKLFYEAIETIDPGPIEALTAVGANKLQIIHFAVMPQIITYFIS
FT                   YVLYAFEINVRASTVLGYIGAGGIGLYLQQTLQVFDYAKTGLIILIIIVVVVLIDYVST
FT                   KSREALMK"
FT   gene            144837..145649
FT                   /locus_tag="LGAS_0132"
FT                   /note="LactoCOG number LaCOG00212"
FT   CDS_pept        144837..145649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0132"
FT                   /product="ABC-type phosphate/phosphonate transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59544"
FT                   /protein_id="ABJ59544.1"
FT                   /translation="MDTTMKKLPPKPIDTKKKIKHWVIAIVTVALIIWSFVGMNFGGIK
FT                   ATAGQIAGAILAGIFHPDWSYVYNGSGEDLISQLWETICIAFLGTFISAVISLPFAFWA
FT                   ANTRHKKWYTSRSGKIVLAIIRSFPEIVLALMFIKAVGPGSAAGVLALGFHSVGMLAKL
FT                   FSEAIENLEEGANEAVTAAGGSKFNIIMFATMPNLMPALISNTLYRFDVSIRSASILGL
FT                   VGAGGIGYPLIIALQYRQWNRVGVILVGIIVMVVIIDWISGWIRKKLV"
FT   gene            145736..146284
FT                   /locus_tag="LGAS_0133"
FT                   /note="LactoCOG number LaCOG02221"
FT   CDS_pept        145736..146284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59545"
FT                   /protein_id="ABJ59545.1"
FT                   /translation="MISKGKKELFCYNGSCISRRTMMDNLTTMTLADDIALSQEKIING
FT                   QQDLNTKRIYNEINSLGILDKPIEEYFDMTQDEYYNSESDGKLTLLHLDQPLSELSDRI
FT                   LTNHVDGYVDKDEINLTYNHEDPLQDGSYDRATDLHVLLYSLKVIGAVRAIAPDDLKKV
FT                   LSKDAVLSLGLAAAALAKN"
FT   gene            146322..147731
FT                   /locus_tag="LGAS_0134"
FT                   /note="LactoCOG number LaCOG02220"
FT   CDS_pept        146322..147731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0134"
FT                   /product="5'-nucleotidase/2',3'-cyclic phosphodiesterase
FT                   related esterase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59546"
FT                   /protein_id="ABJ59546.1"
FT                   /translation="MGKSIMKIINKTKGMIDKFSGMTRKMMRKKNNVPFDGMQKYMTVG
FT                   EYNVGAPEGTPHGEEYKLIVYKDTDNVLHQALRSVNASDLAPAYVRKFDKRLNRYTAFV
FT                   NKRTGRRYIVEDQLDQLVDYVKKHSRKGYNSINIGVITDTHYKDADSVDFYGHNGLRHV
FT                   KEFNYLEDKDILDLKAHLGDWMDGSDPGLVGEAELISLSRTFRSKKTNFAVIKGNHDEN
FT                   DKFDEHHDLRASFPENEFEDIMWPSMYAQDGIHYITRKHGVAYFDKDDVRIITVNTSDL
FT                   PYELDEQGKKKYDTKLSLAIREDQMQEIIEILENSNGKTIIFMSHANPITRKGTNALKF
FT                   NGRSLHELMVAFNQHEKGYLNSRDVPPEFTLANSFDFTKIKNAKIVAYFCGHRHTEDQY
FT                   RINGIQYIFFNCSALMGPNHALTTQYNKRWNRQMDHANEAAGYIVNVDIKRHLLQVFGY
FT                   GAASKRRFYRI"
FT   gene            147792..149741
FT                   /locus_tag="LGAS_0135"
FT                   /note="LactoCOG number LaCOG01503"
FT   CDS_pept        147792..149741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0135"
FT                   /product="Asparagine synthase (glutamine-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59547"
FT                   /protein_id="ABJ59547.1"
FT                   /translation="MCGICAFFDPELKDKDCAIQGMMDTIKHRGPSSDGKYTNDQVALG
FT                   FRRLSIIDLRGGSQPIFNEDKSRAIIFNGEIYNFKPLRKELIDAGHTFTTKADTEVLLH
FT                   GYEEWGMDGLLKRVRGMFAFVIWDDNTKTLYGARDFFGIKPMYYSDQNGKLIVGSELKS
FT                   FLAYPGFKKELNTEAVKPYLMNQYNDLKETFFKGVYRFPAGHWFEYKDGKMKTHQYWDA
FT                   KYVENSLSFEETLDKINEDLKETVDLYRNADVPVGAFLSEGIDSSYLTSLLDPEDVFSV
FT                   SFDDSTYNEASKAKALSDLHGWKFFADKVDADEAMRDFPEMQYHMDEPDANPSIIPLWY
FT                   LCKLARKHVTVALSGEGADELFAGYVNYGMHTHNDVIKVFTAGLKKLPKKSRVRLAHKI
FT                   KKMPNFPGKVHMYTNLAEPSEFYVGQSVIYDMDYPTIFTSKDANNILRDKYKNDLTVNG
FT                   IYQEDFKKVKNIDEVKQMQYIDLHHFMLNDIEQKADKISMAHSLELRVPYLDKKIAELA
FT                   NSIPTKYLVNRHDTKYALRKASEKVLPEEWAQRPKLGFPTPIKQWLKEPRFYKQVRELF
FT                   TEDFVNDIFDQKKIVKLLDDNYKGDGSARRQIWAIYTFLVWYKLFFVDYDETVKKYQHV
FT                   QPEVAELIESGRLV"
FT   gene            149771..151102
FT                   /locus_tag="LGAS_0136"
FT                   /note="LactoCOG number LaCOG01502"
FT   CDS_pept        149771..151102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0136"
FT                   /product="Predicted ATP-grasp enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59548"
FT                   /protein_id="ABJ59548.1"
FT                   /translation="MVQAKFTPILLGSDINVYGMARSFNEAYGIKVQAWAASQLAATRY
FT                   SKIVDVEVHEGFEEDPGFMNVMKQKIEEYKNHPEPVILIACGDGYAELLAKHKDELKDT
FT                   FVVPYIDYDLLEKLISKEGFYEIAEKYGLPYPHTKIVTMDDYKAENYLDLPFDYPIELK
FT                   PEDPVSWLNCQFEGRKKAFTIHDETELVDIVGKIYTNGYTEDLILQDFIPGDDSNMRVL
FT                   NAYVDKDHKVKMMCLGHPLLEDPTPQSIGNYMAILPAFSQKLYDTVQSFLEKLNYTGMA
FT                   NFDIKYDPRDGEYKFFEINLRQGRSSFYVTLNGYNLAKWYIDDYVEDNLKDKPTVYGNK
FT                   DGANYMLWLGVPKKIFKEYAYENGSKRLAEKLIDEGHYGTTVFYDKDRSFKRWLLMRYM
FT                   FHNYYARYKKYYEVNKGQYFEEEAKKLKKQALRDGQQENHENEI"
FT   gene            151213..151602
FT                   /locus_tag="LGAS_0137"
FT   CDS_pept        151213..151602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59549"
FT                   /protein_id="ABJ59549.1"
FT                   /translation="MIDWGLMALCIVTMLLGFFELYRTFRFYKWDKKTKEIPTAPYVIY
FT                   FGTFFSGVLIVVSAMFMMGNTSLTLPKIFYIILGIILVVVAVLMYRRGHQMAKKLGKDD
FT                   SNIAVWQTYLISTVILITGLINFLR"
FT   gene            151824..154040
FT                   /locus_tag="LGAS_0138"
FT                   /note="LactoCOG number LaCOG00187"
FT   CDS_pept        151824..154040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0138"
FT                   /product="ribonucleoside-triphosphate reductase class III
FT                   catalytic subunit / ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59550"
FT                   /protein_id="ABJ59550.1"
FT                   /translation="MTMLQQDAQIKSITQMTLPETAIKRDGSIYPFALYKIEMVLDNLH
FT                   LTKHEADILPSILKKLNGVKQTSTKDIADAFVQTLTELGFDDEANAYVDYRREDEANFE
FT                   KQTETTNRLDRLVHHDPTIVNENANKDSRVFSTQRDLTAGVVGKTIGLTMMPEHIAKAH
FT                   LRGDIHWHDLDYTPLSPLTNCCLIDFKEMLSHGFTIGNANIESPHSIETATAQMSQIIA
FT                   NVASSQYGGCSADRVDEVLAPYAEKNYHKNINEAREFFDDEEKIKAFAIKRTKKDIYDA
FT                   MQALEYEINTLLSSQGQTPFTTLGFGLGTSWIEREIQKAILKIRIEGLGKDKRTAIFPK
FT                   LVFTLKKGLNLHPGDPNYDIKELALECSTKRMYPDIVSYDMIKKITGSFKAPMGCRSFL
FT                   QGWKDPETGKEVNSGRMNLGVVTLNLPRIAMESKGDKDLFWQIFREKVQTAHEALQIKA
FT                   KRCTEAVPDNAPILYEYGAFGKRLNAEDNVNDLFKNGRCTISLGYIGLYEVGTVFYGPN
FT                   WEHNEEAHQFTINIVKELHDYCAKWEKEDPNHYHYSVYSTPSESLTDRFCRLDTKKFGK
FT                   VKDITDKEYYTNSFHYDVRKHPTPFEKLAFEAPYPFYAAGGFIHYCEYPNLKQNPKALE
FT                   AVWDWAYDKVGYLGTNTPIDQCYKCGFKGEFKATAKGFECPQCGNHDPETCDCVKRTCG
FT                   YLGNPLKRPMVHGRHEEIVHRVKHLNLGMEEKMAKDEVRKNDEY"
FT   gene            154040..154753
FT                   /locus_tag="LGAS_0139"
FT                   /note="LactoCOG number LaCOG00188"
FT   CDS_pept        154040..154753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0139"
FT                   /product="ribonucleoside-triphosphate reductase class III
FT                   activase subunit"
FT                   /EC_number="1.17.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59551"
FT                   /protein_id="ABJ59551.1"
FT                   /translation="MPEKDKNSQEGPDVRGNLIKVNVGGDTIFVDSNQYKPQVEHAKKL
FT                   KQQHRKPKNPKPQEWISEEYSKHKIADYKPFNFVDGEGVRCSLYVSGCLFDCPGCYNLA
FT                   AQNFNYGRPYTQELEDKIIEDMSQSYVQGLTLLGGEPFLNTWVCLKLINRVRKEFGHTK
FT                   DIWSWSGYTWDELQKETPDKKEMLSKIDILVDGRFMDDLKDLTLQFRGSSNQRIIDVQK
FT                   SLKAKKVVIWDKLVR"
FT   gene            154800..155402
FT                   /locus_tag="LGAS_0140"
FT                   /note="LactoCOG number LaCOG00614"
FT   CDS_pept        154800..155402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0140"
FT                   /product="Predicted metal-sulfur cluster biosynthetic
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59552"
FT                   /protein_id="ABJ59552.1"
FT                   /translation="MKKMQEKNLKLVDKIMTALQKVEDPELLVDVVNLGLIYGIDIEGD
FT                   HATIKMTLTIVGCPLSTYLQNSIEKAVLSVPEIKTCDVKLVWYPVWSPERMTTAAKQQL
FT                   GMLDNEQALDQEEEIEDTEEKQKIIDFSVPIKKLAEEYPDFVQIMYDCGFTRIKIPGLL
FT                   STVGRVMTIPLGAQAMKIDLDKIKRAFENKGYKVIDK"
FT   gene            155399..156595
FT                   /locus_tag="LGAS_0141"
FT                   /note="LactoCOG number LaCOG01055"
FT   CDS_pept        155399..156595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59553"
FT                   /protein_id="ABJ59553.1"
FT                   /translation="MKELDKQRQESILKILNFIQNGGELEEAKKMFQAAFDQVDVAEIT
FT                   AAERELIAQGLDPRKIQYLCNVHADVFKGNIKENKESPEFETPGHPVHTFKLENIVIKS
FT                   LINDALLPDLTKWEDGSSDALPKLKRELKDLAKIHYHYARKETSMFPIMTKYGITAPPK
FT                   VMWGVDDKIRKLIGQANMLVNQKNVDQSEVASVIKSAAHEVLEMIFKEEEIMLPMIDEV
FT                   ASEEDWGNVKNEEEQIGYTLIQKPMNWKPKIKEKVAGPISLDKLSSLALNFAEGSLNLK
FT                   QLSAILDLLPFAITFVDENDKVAYFGGGANIFPHSKNAIGNSVYSCHLPESVPRVKKIF
FT                   DDFHQGKKDKFEFWFEPRHMGRYLYLQYFAVRKNGRYLGCLEVAQDVTEIRSWKNERR"
FT   gene            156928..163599
FT                   /locus_tag="LGAS_0142"
FT                   /note="LactoCOG number LaCOG03211"
FT   CDS_pept        156928..163599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0142"
FT                   /product="Adhesion exoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59554"
FT                   /protein_id="ABJ59554.1"
FT                   /translation="MKGQAKMLFNKKDFDSKQRFSIRKLSVGVCSVLLSTLFLTFNEGQ
FT                   TVHASTDANAADTTTTSVSSNTTNNSSDNNTDKKDDSKVETSSLATAEKHAPIPIAAEV
FT                   KSNKSEDQTNSATTETATQVSKSKQAQSQTTTNIVKATATQASTSSKDSSDTTRFKDNS
FT                   AQNTVEKNRSTSTSKYTPVLTSETSVSTKTNQSNSNSATQEKSNIKPVTPHADSTEHIA
FT                   PKTYSMDSDSPAYVVAGSDLTNLASKFISNADVLTQNGATFSWVGNVPTPTQQDAIGGN
FT                   TITGTIKVTYKDGTSITIDIESYVEARSELQPSTFYYVNRVGDTPDFNTADANGNNFST
FT                   ILKNTDVYDPTAFSYKILGTLDTSSLGIHWANVQVTDNNTFAGAPDAPKVIGGLYIVKV
FT                   PYVVQGLKLKDNIPTDANGNPIINAQLATMPKSTSTTPTTPEAAFDPVHGNSTNFPAGL
FT                   WGQYFYQDYALAYALGIKVQVAADDLDNNGKWKNKPTDLVNTKTNHFAMTFNKLPNATQ
FT                   QEVDVNYVSAPHAEDMYIYNAANKTYMTGRPENAQAIKELLADGYMNDKVWVTLADGTK
FT                   VYASKLDYLNNGNNFVVGGAKAGRYNINFNASFDQKNSAGQPQIFSNNIFNTASADFND
FT                   DLNKWYRKTNNQTVANYAAPTAATWDKVSTNGISLAPTIKASDDPYEQDLTDGPVTFDS
FT                   EALKNVVKNPSTGAEVRKVQHTWLANMVPNSILDNNTKWPEGTKLTWAGNDGSTKLTFD
FT                   KAGESKTGNVTITLPSGSSYTVKDITVISKANVIAKSETVDYGKKLTAADLVTNQNVFP
FT                   AGTTYQFVDGSEPTWGTAGSYDHVKITATYKDASGASVNTPVANCAVAINDSRSIKVLA
FT                   GSDVPSVDSVLNLPNNWEEHTAFWTTPINTTATNEGLITIHYPSSNLDQKIKVYVTVIP
FT                   KTSAVDGQNFFTNGNKYDGTEGSIANGANQGAILTQANGQAIDYTTYSGSNTPGTQTSY
FT                   DTKTTSYTPTYGLSGLQTNSDGSLVSGVQTATVRVSVPKGTIGAKVDADDNYYYELNAK
FT                   VNIAQPVTFEFVDEYNNDQVVGQTYSQEFVPGIDTNLNFSMAMPDGYELGNGASIPSQY
FT                   TLPAFSQTTPVVKVPIHQKMHFYITFHDEDSNTNLGTVEVSGSAAAGTGGYYPSINTKL
FT                   TFPAGADAGDYYSVSTSGVPDGVQLVGSYGVSLTNPTADWTTPNYQWENTFSVLKALTG
FT                   ATMTINLKHKFNETQEKQTRTATVNYVKAKVNADGTYTQDGNAFTSAVLDVYYSRTKSE
FT                   DLVTKKITYTPWLWDTNQGDRTTPGYHVESGKWTSLPQHWAAVVADVPTLAGYTAATVT
FT                   DKSGKPANQFVFPTWNGSDQDTSNINKESLAYTENAPIYEARPVHTVLYIPNEQQARTI
FT                   TAKYVIAGGNNNGQKFAPDSQIQIFYGRTGTLNVANNKITYGNWQWDNTAGDQDTPGFH
FT                   VISGSWSLPTNGSSWQVNIPNSGNDYVVANLRYDGAYSTFTLAAPSYNANDVFTSSTSD
FT                   QWFTRNTLVTYYVPTSMVNKTVTRTITIFEPGQGSKTITQTAKLTRQVRVNNDDTGVVY
FT                   DGFAGSGWSTGTWGAQDVTTHDGYTMSATQTVNGVTTPIQLVNGQVPAEEVDGNTKNTT
FT                   INITWGAVATATLTGNGTSTYNGQAITNAELNNALKVNVTGPTAGAGTYTLQAGDVEFS
FT                   TDGTNWTTALPINAGNYQVRLTAQGKNGIIAKYGNNSIIWTQNGQSTITSNATYMINKL
FT                   AGNAVMTNAQIGNYEMTYNGAAPSTIDPSKFVFTTTVNGQNVELDTTGLDSSDFTWVDS
FT                   NAPVNVGTYKVILTDAGLAKLNVNNPNFNLSNSGNGTFTINQANASATLSGSASREYNG
FT                   QAVSVDDLNSTSTGNNITLTLHYPKDGNANYSTTVKLNAGYFTWNTPNGQAPVNVDSQP
FT                   YTISLNSDAIERIIKQAVGNGQNDVSNVKFASDAISGSANYTITPLESSAELSNITNGN
FT                   YTKVYNAETTNQIDASKLHITANLGGQNVDLDTTGITGSDYQWVDASGAELTSNPKNVG
FT                   TYYIKLSDTAFARLQAQNPNFKLTSNDGLGVYTITPATANITFGGTNSRVYNGQGTTTT
FT                   EINSNGQIKVHFTFPGSVLDASYTLKDRDYYLVDQDGAGYDGAQIINVGTYTIKLTQQG
FT                   MQNVIDTIHQLSGSGDGGYNINVDSATQLGNLTSTFDIVPSQNTISVSGTQTET"
FT   gene            163729..172200
FT                   /locus_tag="LGAS_0143"
FT                   /note="LactoCOG number LaCOG03211"
FT   CDS_pept        163729..172200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0143"
FT                   /product="Adhesion exoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59555"
FT                   /protein_id="ABJ59555.1"
FT                   /translation="MTDAGLTKIQNAVGDNYSVSLADTTGTLVINKAKASAVFSGDPSY
FT                   TYTGTPVSANDYLGKYSIKLTEPNNPTYNLVAGDIEFKFNGNWTTQAPVKVGQYEVRLS
FT                   QQGWNHIKAINSDNVEWSATASAGTGTYTINQAKVTADLSGSNSMTYTGSAVTTNDLYS
FT                   QDSTIKVVINGTDITNLPQTFELKDGDYVWQTTAGQAPKDVGNYQIKLTAAGISHIQKQ
FT                   INDALGAGNVALTTTADNAGTANFEIKQAVAENVQLYGDEQSTYDGDTVTFDPTNLDVK
FT                   NNFGFHNVEGLTIPNFTSADFDWYDANGENRIAAPKNAGHYTLKLNDQGKQVLADANKN
FT                   YTFVDQNGKSTISGQITYVVTPAELVVKVTGKASKVYNNQNAKITQDQINQGDIKLVWG
FT                   NSTTEPTDLGEFTLTPDDLEVVDASGQPAIHANYVDGQQTGDTYYVRLTADALAKIKQL
FT                   SGAANYNISQATDTATYQIYAHKAELTLTGNQTTAYGTELPFNESKYTLDFTNWVNTNI
FT                   PKPVITWQNGEMLINGQQPEDGYSYHTGDLYVEGYSDGGVPTNAGSYKVKISANLTKEL
FT                   QKIFPDYDFSGNIDSSTLNSNKTVNNDPVEASHEPASYVITPAEATITINGAQHVKYGE
FT                   STAIAGDQYTASVTAPVSGNETNVVTDVALTSDDLTTVPSNAGVGSYTIKLTPAGLAKI
FT                   QAAIIGHGDVTKNYGWTQAGNATANFFVDQMPVTITVSGGRTVTYGTQAWLRAIKANPA
FT                   GYTLTVTTENGTNLSYTANDGDLVFNQTPGNVGEYQVELSAQGLTNIGKALGTNYAYPQ
FT                   IAADVTAKGTFTVNRGAVTITLKGSDGKPYNAQQTLPSGLNLSKYGLDYSATVYSADGK
FT                   AQMLNLTANDLQIIGNATNVGTYQVELSQAGQEKIEQLTGNNGANYKWTFKTNADYVVK
FT                   AATASAELSGSNQKTFDGSAVTTTEVNSNGQILVHLTYPGSNVQSTYTLQDGDYTWETE
FT                   DGQTISAPTNAGTYTIKLNKQAILAHLQVALNQQAGLGDNDQPNVTVSADKLSGQASFK
FT                   INPQALTDVTISSPDQSKTYDAQVADLDVNGITITANGIVANNPLVNPGISASDFIWYD
FT                   ETGNKLESAPADVGTYQARLNASTLAELQNANPNYQFSSVTGLINYTINPAPATATISG
FT                   SATRDYNAQTTSVSDVMNNIKWDATGLVTDQDLNLTGLTANSYAWYSKDADGNYVAMTG
FT                   NPVNAGTYYLHLTKSAIEQVKADNSNYDFTSVNGEFTYTINAVNGIATLSGSSSKTYDG
FT                   QAVTTAEVNSTNGDIIVNFTFPGSSAQSTYVLQTGDYTWENKDGQVITAPTSAGTYTIK
FT                   LSADGITNLQNAINQYAGQGNVTLDVQDLLGAAVYTIKQKALDVILGNNSTGTDGKTYD
FT                   GQAGVINTQAVNFGVFTTSGLVNGETLNAANLTSDDYEWVDVSGNAITAPINAGTYYIA
FT                   LTANGLKKLQADNPNYVVSESGQFTYVISPAEENVTVSGSQESTSTSIDSANFTVHAPA
FT                   GVTVPAGMTYEFATGVPSESGVYVIKLTPESITTLEKANPNYKLDISSDAKFILDAILN
FT                   IEFEDTQDGNKQVGKTITKTGVANSTINDLKLVVPENYELAPDQELPTSYTFGKTLNQN
FT                   MYIKLVHKLNELNPTDPSTNPDPTNKNWFRENGLVKDITRTINYKGLSDDQFAQIPEAQ
FT                   KVQTVEFTRTAKYDLITGKIVANSEGSWTAVDGKDTFAGFTPFTFAGYTAAPARVEQVK
FT                   VTGDDKNSQITVAYTANTQTGKISYVDSDGKEVGQTALTGKTDQSVEVNPEAPTGWQIV
FT                   SGQDIPKTVIATPTGVPTVVVKVEHSTITVTPGTPEKDIPTGPVPGDPSKNYEKLASLM
FT                   STPTRTIVVTDPSGKQTRVTQTVNFTRTATFDEVTGEITYSDWKNSEPAEWQAYAAPEV
FT                   AGYTATSSVSAKSVTAETKNETVNISYTANTQTGKITYVDSDGKEVGQTAISGKTGETV
FT                   KVTPEVPSGWRIVLGQDIPETVTMGANGGPTVVVKVTHSTITVTPETPEKDIPTGPVPG
FT                   DPSKNYEKLGSLTSTPTRTIVVTDPSGKQTKVTQTVNFTRTATFDEVTGEITYSDWTSS
FT                   EPAEWSEYTAPEVAGYTATSNVSVKPVTAETKNETVNISYTANTQTGKITYVDGDGKEV
FT                   GQTTISGKTGETVKVTPEVPSGWRIVPGQDIPETITATATGVPTVVVKVERSTITVTPE
FT                   TPEKDIPTGPVPGDPSKNYEKLGSLTSTPTRTIVVTDPSGKQTTVTQTVNFTRTATFDE
FT                   VTGEITYSDWTSSEPAEWQAYTAPEVAGYTATSNVSAKPVTAETKNETVNISYTANTQT
FT                   GKITYVDGDGKEVGQTTISGKTGETVKVTPEVPSGWRIVPGQDIPETITATATGVPTVV
FT                   VKVERSTITVTPETPEKDIPTGSVPGDPSKNYEKLASLTSTPTRTIVVTDPSGKQTRVT
FT                   QTVNFTRTATFDEVTGGITYSDWKLQKSNAASHVAQWDSYTPQVITHYVPSVAEVPAKV
FT                   VNAHTANSQVEITYAPASESQVIRYVDQNGKEISTQIVPGKYGVDTTFTPKLPNNWQAA
FT                   NTIPTSIKIGENGGLTTIVVEAKTEKVQQAKTVTETIHYHTANGKQLFADKEMEVNFFR
FT                   TGVKNLVTGEITWNNWNKDKESFNEVPSPKVSGYMASPTKVAVQTVTPNSEDLVFNVIY
FT                   TKNSQTHPTIPENKPNKPQEENVSKQETKTQDKLIHEYGYKKRADGRLVDHTGHVYPAS
FT                   SKVKENGAIYSEKGELLSVGSRRKHELPQTGLHDNSLIAAIGSLLAGISIFGLLGGRKK
FT                   KDDDK"
FT   gene            172214..173530
FT                   /locus_tag="LGAS_0144"
FT                   /note="LactoCOG number LaCOG01456"
FT   CDS_pept        172214..173530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0144"
FT                   /product="Permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59556"
FT                   /protein_id="ABJ59556.1"
FT                   /translation="MKEAICLFFFTLVQNSSLIARLNVRVLEKRVKKVHGKQNIQPDDE
FT                   IKLHWLLLGELFTWIGASFIWPLTSVYLNKRLHVSLAMIGIVLLFNCLANMLGSFVAGW
FT                   AYDHFNPYYLIIAGAGLDALVLFGMAANHTWPIYWVWMTLTGLLGGWNGALINSIATSI
FT                   KSKPGRYVFNTIYFAQNLGVVLGTLIVGYIYDYSVTILFVIAASLFVIVCINSIINYRP
FT                   IIKFHLERKAQQNTNSKNKTTPMPGANLKLTIGFFTTLAVIWLMYMNWESNLSVYMVSL
FT                   GIPFHLYSLLWTINASIIVIVQAFLSRFPNTFKNLFHQVVFGVTMFAISFVTLIFAKDY
FT                   AHFVFSMVTLTLGESTAMPAMPAYVNDLSPVESKGKYQGLTISTSAIGRAFGPLFGGLV
FT                   IDKFGYINFFIVAAAGIFMMLAIIVPLHAQLKDKLKIFR"
FT   gene            173556..174644
FT                   /locus_tag="LGAS_0145"
FT                   /note="LactoCOG number LaCOG02310"
FT   CDS_pept        173556..174644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0145"
FT                   /product="tagatose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.40"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59557"
FT                   /protein_id="ABJ59557.1"
FT                   /translation="MKTFTECKRSLLFVKAPSYNIDVRLSKRRYIMRKISPEVAKHMDN
FT                   LSNEAGVISALAIDQRGSLKRMLAEAANKPADETTIVDFKKAVSKELTPYASAILTDPE
FT                   YGLPATKVRDKNCGLLLSYEKTGYDTTEPGRMCDLIADQSALRIKNDGADAVKFLLYYD
FT                   PDESDEINDKKKAFVERVGAETKANGLPFFLELLTYDGKMDDVKSEEYAKVKPEKVFKT
FT                   IEEFSKPQYDVTVLKVEIPFNIKYVEGFNGDNNVVYTQEEAKKLLKKQSDLTDLPYIFL
FT                   SAGVTSEEFIAEIKMAEEADADFNGVLCGRATWKPAIKPFAAEGEKQGREWLSTEGKQN
FT                   IENLNDALKGAKSWKDKLEVED"
FT   gene            174796..177699
FT                   /locus_tag="LGAS_0146"
FT                   /note="LactoCOG number LaCOG02801"
FT   CDS_pept        174796..177699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59558"
FT                   /protein_id="ABJ59558.1"
FT                   /translation="MEEKKMKGLKYTSLAVAALTATILASTNNGKVQAASTNENDTVTV
FT                   AKSDKEKAQAAINQAQNSVNNAQTVVDSKKSALTDAQEKAQAPDNAYSAQQAKVNDSQK
FT                   NLSAKQAQDKLNSATEISKQATPENIQKAQKNITVQQDAIKNAQQNVNDANADLNKAQA
FT                   QLATAKQKQADAQNVVNAKESAKQTADKNVAKAESDVKNSGLDEAKQDVEKVQTTLNDI
FT                   KKTNANNESILTTNKSALTENNQKIATVNNKIATANQAVVDAQNNVNAKQQALADAKKA
FT                   LKDLQDQVAKDQASGAAGFFKSIADNKDNSESLREDARTAYDIVTGKPNAYQDITVRWV
FT                   KQAVELGQEKDSTSFSNMEKALGYYEHWMTYRDKYGLSHPSISLTAVAIAMLSSDFQHY
FT                   SDEFNHPILLTAKYGPFYEDEEDISAGDVNPIDNWMSEKEDIDNYIKDHPDAAAYSFES
FT                   SHPLTEDDWARDVDFWSNKPVDIGHYTSMIKPDANYVGLAGNEYEIEPFMDNADSMDEI
FT                   EFDPINGMDFNSYQNLVHSYLQNIKQEDQINTLKANVETASQNLTAAQNAVQAAQNNVK
FT                   SLQANLAELNNGSTKINKAITDTQDALAKGRENLEFEQKQLDQANKNLAAVQAKVGAKA
FT                   KALDDAKAAQAKAADALAQAQNVLAGATAAVKSAQTTVDNAQGNVNAKNKDLKAAKASL
FT                   ESLKQTLSSLESAKANLASAQAALTAANNDVLTADKDVKAQELILASLEEAKGKSDAQV
FT                   ASAEKDLKKAEAALANEQSKLADAKAKLAELNKKANNNTGKSDSKPEINNQKPAKPATK
FT                   PGSESANTEKPEPDFSGNNKSDSKKEQNSTDNVKSDVKSENKSNKTKEESKSSSSVKIV
FT                   DNGDDSTASVVLAGSNTAVKVYGEKTVNGTTYYKIGANHWVKADKAHVVSIGGQATTKQ
FT                   LPQTGAKNELIAAISGLTVASVGIASAMGMSRKKKNN"
FT   gene            complement(177804..178595)
FT                   /locus_tag="LGAS_0147"
FT                   /note="LactoCOG number LaCOG01325"
FT   CDS_pept        complement(177804..178595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0147"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59559"
FT                   /protein_id="ABJ59559.1"
FT                   /translation="MVKFYRKGSTNMQNNDLSNAELHLWEIVQNNPQKIAKMSIVKLSQ
FT                   FAHVSTATIVRTMQKMGYSGYTSYRESLKLQDRSNSNFDVLNEADDKIKSVITKNEIEM
FT                   NNTLHNLSYSNIEDSISMTKQAKVVYIFARGLSESIGQEIMVKLQLTGKYVEFHADPNI
FT                   IKTASKRIKQDALVIFISLNGNTPELVDAAKSLSHHDVPTITFTTNPKGQLASLSTLTF
FT                   MGYMSKTNYFPDYEVRSRLPLQIMTRIFSDAYSVRTGFARQ"
FT   gene            178687..179613
FT                   /locus_tag="LGAS_0148"
FT                   /note="LactoCOG number LaCOG02311"
FT   CDS_pept        178687..179613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0148"
FT                   /product="Fructose-1-phosphate kinase related
FT                   fructose-6-phosphate kinase (PfkB)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59560"
FT                   /protein_id="ABJ59560.1"
FT                   /translation="MIYTITLNPAIDLVIITKKLEANTVNRTENFELQPNGKGVNVSFI
FT                   LKKMGIKNMATGIGGGFTLDYITAGLEEKGIKTKFLKVKEPTRINVFTRVLDQNVEYKE
FT                   VNPGPEVGPEVQDKFLKYLKDTLKADDTLIISGSFSKGIKAEYLVEIAKITAEKDIKLV
FT                   IDSSSKVVLDTLQYQPYLLKPNDQELASFFDLNEKLDQEKIIELARKLISAGCQNVLVS
FT                   LGENGAALINKDHAYFGNAPKIQALNTAGAGDTMLGTFIGEKSKAKSDTAALKSAIAAA
FT                   SDTASRSGLTDFKLEKYLKEIQVSEIK"
FT   gene            179632..181563
FT                   /locus_tag="LGAS_0149"
FT                   /note="LactoCOG number LaCOG02312"
FT   CDS_pept        179632..181563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0149"
FT                   /product="PTS system D-fructose-specific IIA component
FT                   (F1P-forming), Frc family / PTS system D-fructose-specific
FT                   IIB component (F1P-forming), Frc family / PTS system
FT                   D-fructose-specific IIC component (F1P-forming), Frc
FT                   family"
FT                   /note="TC 4.A.2.1.8; TC 4.A.2.1.8; TC 4.A.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59561"
FT                   /protein_id="ABJ59561.1"
FT                   /translation="MAQYDLVGATGCATGVAHTFMAEEALEKAAQKLGYKIKIETHGQT
FT                   GVEHELTPEEIKAAKGVVIASDVDVDPDRFAGKRVVIVPVAKGIKEPETLIREALSSET
FT                   PIYKPGQTAKSSTGKSSAGAEKLGTKIYTSLMNGVSHMLPFVVAGGVLIAVSFFWGIYS
FT                   ADPKSSQYNQFAYMLNTIGSTTMGLMVPVLGAFIAEALAKRSGLVVGFAAGMITSVGGG
FT                   GFLGAIIGGYLAAVVVLLLQKLMKPLPDKEFRGLKSIFLLPVLGVFITGAIMFWLNGPI
FT                   KAINTGMMSWLKGFENSSPILLGIIIGVMCASDFGGPINKAAYVTGTALLAQGNYYFMA
FT                   GVSAACIAPPLATGFAVLLNKKAYSKNERTAGYVNFLLGSTHITEGAIPFAAKHPLWNI
FT                   PAFMVGSAIAAALTYVSRIQVPAPHGGFIILPLVNKPFLWVLWIVVGALVSGVLLALIA
FT                   GRFAKTEPQFEDGPDIDVFGEEENVNKPVAEKETTDYNLKDILDTQNIKINVDVPDKDS
FT                   ALKYLANFAVKNGLASDSEEVYDKYLAREKESSTGMTDGFAIPHAQSAAIKQSAMLVLK
FT                   LKNPIDWNSLDGQKIDTVISFLIPAKDSKTHLQYLSNTAKLLTHKDFIEKLKEAKTPEE
FT                   IKKLFDGE"
FT   gene            181653..183602
FT                   /locus_tag="LGAS_0150"
FT                   /note="LactoCOG number LaCOG01198"
FT   CDS_pept        181653..183602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0150"
FT                   /product="oligopeptidase O2, Metallo peptidase, MEROPS
FT                   family M13"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59562"
FT                   /protein_id="ABJ59562.1"
FT                   /translation="MALFNVRGGAGDITKPDLNARPQDNLYLAVNSEWIEKAKIPSDRS
FT                   RISSFDGIDLNIEKSLMQDFADFAAGKKKLPEVPNFDKAVELYRIANNFDKRNEDGAKP
FT                   IKADLEEITSLRNLADLNLRAADFYKNAFDLPISVSVDADMKDTKVHVVYFGGPGLFLP
FT                   DTTTYDNPAAADLLKVLQDQSENLLKMAGVSEADAKKYVEDALKFDKKLSKVLKSTEEW
FT                   ADYPAMYNPISLAEFEAKFDSFKIDNFLASLFAKKPEKIIVTEPRFLDHVEELINEDNF
FT                   DEIKGWMVVKFINGVAAYLSQDFRKAAFPFSQALSGQPELSSGTKQAYHLANGMFSEVV
FT                   GVYYGQTYFGAEAKADVEDMIHKMIDVYEKRISENDWLSEDTKKKAIVKLRALILKIGY
FT                   PEKIEKIYDRLQVTPESEGGSLYSNESAAAVESIKYNLEKLTEPVDRTVWLMPGNLVNA
FT                   CYDPQRNDITFPAAILQKPFYDLKQSRSLNYGGIGVVIAHEISHAFDNNGAKFDEFGNL
FT                   KNWWTDEDFAEFKKRTQAEIDLFNGIEYGPVTLNGKQIVSENIADQGGLTAAVEANKGE
FT                   NGNMKEVFENFARVWANKQLPESIKTQVSVDVHAPGPERANVQSQCQEEFYKAFDVKPE
FT                   DGMWLDPEKRVVIW"
FT   gene            183747..185468
FT                   /locus_tag="LGAS_0151"
FT                   /note="LactoCOG number LaCOG02090"
FT   CDS_pept        183747..185468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0151"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59563"
FT                   /protein_id="ABJ59563.1"
FT                   /translation="MLEKIKTNKFCQFIWPYLLIILATTIVISPQLISHTILASDDTAD
FT                   TLFHYSRFYDAGMQLKTGIFSIFQTNFTFQQSGRIINAIYGPLFAYFNGILVLIAGNWF
FT                   NYQVILAYVISLLGAGSMYYLLQKVGINKLLATVIGIIYINIGMIPAFINRSSFNGWGQ
FT                   ALMPLVVLCGVRMIQDKEKPINWIQLMLVMSLLVQVHVLSTLMAALLLIPFFIYSLIIN
FT                   YNSKKVWIPFIKAVVGTIVLSANVIGAFLVLMPNNHLAANTEFDLSRGGLRPHVLWHNE
FT                   YGTAFAYILPIFVLLIIAQFVYVVMHYKKDRLNTFVTIWGTVLLGLSSFVFPWGLVQRI
FT                   FPSLKSYFQFPFRLTVVAYPLILLGMALTINQLLKQGVKPRAVGISLVVVLLLEAAVPN
FT                   IITNHIFTVACGKDAQVQTVAKASNSDQMLKMLKWHYLPDYLPTKDKSIDQNAAYLYKL
FT                   NVVDQYQKFNHKVAKNGDLILSWKGKKDKDIVLPVVLYKQSELTVNSKKFTGAKNVIGN
FT                   PIISQKSGLNRAVLRFIAPAWFYVVSAISLIAWLSVLVFYLWKKFINNNNNKIKVA"
FT   gene            185657..187315
FT                   /locus_tag="LGAS_0152"
FT                   /note="LactoCOG number LaCOG02038"
FT   CDS_pept        185657..187315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0152"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59564"
FT                   /protein_id="ABJ59564.1"
FT                   /translation="MSTQERYSHDELRKANKKFSRVRSTIESAFYGNNVHEVTSVAEAY
FT                   NLAKKQSGVIETDLPILHTKELGLPQGAKQLVYNHGKILGRTASARHFVDDPKEDPEAL
FT                   AGNLREDIYKGHDQKFLKATVLVGLDPTFTVKAHIMMPEDQAFNLLSYILNFHFFDEEA
FT                   EKIYKNSKVYDEGDIYFYFDPNTQDEDYPKGFGVFDAPHNCAAVFGLRYFGELKKGTLT
FT                   LAWAMAHRNGYTACHGGEKSFHFKDKDDKVFAFYGLSGSGKSTLTHEMYDGKYDITVLH
FT                   DDAFIISREDGSSVALEPSYFDKTHDYPAGHHETKYYTTIMNCAVTQDEDGKKVIVTED
FT                   LRNNNGRVIKTRYTSPHRVDYEDAPITALFWIMKDGSLPPILKVDDPVLATTMGLTLAT
FT                   KRTSAENLPKGFDMNTLVIEPFADPFRAYPVSGDYSDFKELFTKRGASCYILNTDAFMG
FT                   KDIPKEVTKKLVEDLANGSIKDSDWKPFGNFKGVSYLPIEGYEVHLEDPEYQKTLAKRM
FT                   QDRLDWLNKYDEEHPTQPIQEEAKKTLEGIIKELN"
FT   gene            complement(187408..189456)
FT                   /locus_tag="LGAS_0153"
FT                   /note="LactoCOG number LaCOG00418"
FT   CDS_pept        complement(187408..189456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0153"
FT                   /product="K+ transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59565"
FT                   /db_xref="GOA:Q046Q7"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046Q7"
FT                   /protein_id="ABJ59565.1"
FT                   /translation="MNSNLRKKVTLAGLLVSIGIVYGDIGTSPLYVMKAIVNENGGIAH
FT                   VSREYIVGSISLILWTITLLTTVKYVLIALKATNHGEGGIFSLYALVRKKAKWLVIPAL
FT                   VGGAALLADGTLTPAVTVTTAIEGLKNMKFGNDIPVPNQNSVIMITIVILLFLFSIQRM
FT                   GTSIIGKTFGPIMLVWFTFLGLTGIMNLSHDWSLLEALNPLLAVKILFSPANKVGVLIL
FT                   GAVFLATTGAEALYSDVGHVGKGNIMGSWPYVFICLALNYLGQGVWILENPNYHAGATD
FT                   FNPFFEALPSQWKFFAIILATLAAIIASQALITGSFTLVSEASGLKFLPRMKIIYPSTE
FT                   QGQLFIPSINKMLCAATIGIVFLFRTSEHMEAAYGLAITVTMLMTTVLLFEYLSLRKVN
FT                   LSLRLVFLLLFGAIETMFLISSLAKFLHGGYVTVIIAAFIGAIMYIWYFGNKIRDKREA
FT                   ENAYVRLDEFTTMLSNLSHDESIPLYATNLVYMAKVKYNKFIKRDMLYSILDKRPKRAH
FT                   AYWFVTVNVTNEPFTAEYAVNTYGTKNVINVQLYLGFKQQQKVNVYLRQIVHDLIKDGT
FT                   IESQPQEYTTTPGRDVGDFSFVIVNDVISPQTQLRSYEKFLVEARVWLQNLSSNPASWF
FT                   GLDYADTVIERVPLILGNQRRQHITRIAPKKFEDIKKKLQAEGELKE"
FT   gene            complement(189598..190017)
FT                   /locus_tag="LGAS_0154"
FT                   /note="LactoCOG number LaCOG01711"
FT   CDS_pept        complement(189598..190017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59566"
FT                   /protein_id="ABJ59566.1"
FT                   /translation="MTEDKKNTEETQEKEEFEVVMPEANRVEMPATEFKEQPDYLKTFA
FT                   NFYISKFDESDLEIMDVYDGNHDVIEINTYLTNNMAFSRQNLVKHVLNIHAERFMDMLN
FT                   NIQKQTGVDPQNMKTYEDWDKWYTDRRNEIKQTLS"
FT   gene            complement(190104..191021)
FT                   /locus_tag="LGAS_0155"
FT                   /note="LactoCOG number LaCOG01999"
FT   CDS_pept        complement(190104..191021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0155"
FT                   /product="hypothetical protein, lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59567"
FT                   /protein_id="ABJ59567.1"
FT                   /translation="MSQGKDAASSQKYEAAEEKFEDAHDVKATSESKAYADQAGAMKDA
FT                   QEEIREYEFKDALGELDKAANKTNGYSVMTKQATKLYKTINKVQDHITHDINPLYKQAK
FT                   LSYRDGNYQATVESCDQILDLSYINGKYYKKVKKNVKHLRKVANAKLNGEDVNDDINTE
FT                   NLDANDDDEATTSHKSTSSKSNSSNNSNTNTSSNSSQNNSNTANTQNNSAASKQSSHTT
FT                   TSNSNANNSSNTNSSSNSNSGMMIDGQTVTGRVIAQTRNQLSSLGVDTSSWSDQKVVNF
FT                   MRSAANNGHTTIDSYTKQDVENFQ"
FT   gene            191026..191253
FT                   /locus_tag="LGAS_0156"
FT   CDS_pept        191026..191253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59568"
FT                   /protein_id="ABJ59568.1"
FT                   /translation="MMYLSELLLDELFDDELEHPTAKKVIKNAIMATPIFDRFIVSSSY
FT                   KNEFILLKLYQISLVKNWLKKLAQFFEINR"
FT   gene            191331..191540
FT                   /locus_tag="LGAS_0157"
FT                   /note="LactoCOG number LaCOG03117"
FT   CDS_pept        191331..191540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59569"
FT                   /protein_id="ABJ59569.1"
FT                   /translation="MEFILKDQSVQFTFAGEKYSNGKKNRILKNVKKQASAEEVMKVGN
FT                   ALSKLQKDAGIKSARLISYSDIQA"
FT   gene            191588..191827
FT                   /locus_tag="LGAS_0158"
FT                   /note="LactoCOG number LaCOG01743"
FT   CDS_pept        191588..191827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0158"
FT                   /product="Small conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59570"
FT                   /protein_id="ABJ59570.1"
FT                   /translation="MTTTKTLRLTFKNAKNKKVNLSLPDAAENLTEEEVKTAMNEICEA
FT                   NLFVKEEVDQYQAPLSAQYVERTVTSVFDDSEKN"
FT   gene            192031..193902
FT                   /locus_tag="LGAS_0159"
FT                   /note="LactoCOG number LaCOG00186"
FT   CDS_pept        192031..193902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0159"
FT                   /product="Muramidase (Lysozyme subfamily 2)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59571"
FT                   /protein_id="ABJ59571.1"
FT                   /translation="MKKRTFTGIATAALITTAGISVTNNLKPENPLKTGEGTVQAATYQ
FT                   QEFLNKAIPAATTASSKYGTYTSVMLAQAAVESAWGQSGLAQAPNNNLFGIKGSYKGQS
FT                   VNMNTGEYGSNGYYTTNAGFRKYPSYTESFEDNGSLLRNQMGNYYSGTWVENSNNYAQA
FT                   TQNGLQGKYATAPNYAKTLNSVIAANGFDKYDPVTQVVNENRTVAQTTPIMSAPVDASV
FT                   GTQVGTARTGQNVNVTKYITYNNGVKRAYIGTGWINALAFSPITTNTTANNAATNKQVS
FT                   QTVKTPVAQTQQAKSQAPAAPVKTATVTVKAKSAAEVKTPVQTNTLNVKTENKVAQPVK
FT                   QLATSLAVAPAKKEVKKEVIKAEPAKTTPVKAASTKVETKQIKPATPAVKTTDTVKKVE
FT                   TPTVKPVESVKKESTPVVKTAPVTVTKEAAKTTEAPVVKPKKVEVKEVKTTPVTTSAKT
FT                   VVKPVQSYQNVVANNNYGTQWISTNTAPKAASTVLVKVTKTVDVLSAPDGQKLNQQVEA
FT                   GSEFVVIASKYYNGNLYYEISNGKWIMAKYTTQEAQITAKSGVLTINSKPDYGVPVWRV
FT                   PGQDQVSGKFLKDGSSWRYFRVANVHGQTWYDLGGNQWVSAKSVLVR"
FT   gene            193940..195403
FT                   /locus_tag="LGAS_0160"
FT                   /note="LactoCOG number LaCOG01653"
FT   CDS_pept        193940..195403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0160"
FT                   /product="Lyzozyme M1 (1,4-beta-N-acetylmuramidase)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59572"
FT                   /protein_id="ABJ59572.1"
FT                   /translation="MEEKFLMRSTNKRFISALACASAMTALAIADPMGVTKTHQVVQAA
FT                   TDNVPARSAGVDVASWQGTNLTQQAKSGAKFTVVKVSESTNYQNPHAQGQINSAEQNNM
FT                   MPMGYHYAHFGADSNRAVQEGNYAVSSAQQAGLPQGSYLAADWEQDAHNNTNGGREASA
FT                   NAITSFMDTVHNGGYNPMLYSSEWLLKAKVDTNKVTQKYPNSLWVAAYKTMGRQDQPDY
FT                   NYFPSMSNVAIWQYTPNWRGQNVDGNVNVLPLSNKSNNANQANTNTLNVNTNGQSSSQA
FT                   PANPVVNTSNKVVDTNWVKQEGTFTTGGAINLRTGASTNSSIIAQLPANSEVKYDAYST
FT                   KGNYTWLRQPRANNQYGYLVGRANGQDWGTFKVAPVANHVTKPTTNTAKPAQNVNKPSQ
FT                   PVHVNTNNNVNNNWTKQNGVFITGGAINLRTGASTNSKVIALLPTNTEIKYDAYRTTGQ
FT                   YTWLRQPRANGQYGYLVGRLNNQAWGTYR"
FT   gene            195487..196317
FT                   /locus_tag="LGAS_0161"
FT                   /note="LactoCOG number LaCOG03212"
FT   CDS_pept        195487..196317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0161"
FT                   /product="Fructose-1-phosphate kinase related
FT                   fructose-6-phosphate kinase (PfkB)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59573"
FT                   /protein_id="ABJ59573.1"
FT                   /translation="MEDIVLIYTVTLDPSESVVGKGINISLVLKKLGIESIATGIVNHK
FT                   NVEQVAEELDKAEIENQFIEQKRGIKITAKNQQKLLDYLKVLKAGDILVIAGGFAKGID
FT                   PVYLTDLAKVADKKAAGLVVDVPYENVLDILPMNPLLIKPNETELKHWFEKDNQKVTTK
FT                   ELINMAHDLVVKGAQHVLLSLGANGAAIVNMMDALMAHAPEIEEVVDSTGSGDALLGTF
FT                   LAGMLKGYMPVKNLSDAIAAGSDTAQSDWLTDFRTTPALQKQVIARRITFEEAE"
FT   gene            196407..198233
FT                   /locus_tag="LGAS_0162"
FT                   /note="LactoCOG number LaCOG01696"
FT   CDS_pept        196407..198233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0162"
FT                   /product="transporter, CPA2 family"
FT                   /note="TC 2.A.37"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59574"
FT                   /protein_id="ABJ59574.1"
FT                   /translation="MDLSLFIVSLAALVIPIIMARFKINAIPTAVAEIVTGIILGKSLL
FT                   NTIKITSSVSLLSNLGVILLMFLSGMEINFDLFKKKDLPDTKPSSVNPARIAVFSFATI
FT                   TVMALILAEILKLIGLFSDVMLAMIIFMTVALGVVIATLKEKEILSRPIGQTILLTAVL
FT                   GEVIPLLLLTVYASINGGNAGKLWLIILLFLVAIVLLKRFKQPYQWFNRISKSTTQLDI
FT                   RLAFFLIFTLVTVAERVGAENILGAFLAGMVMKLLEPSEATMDKLTSIGYGFFIPIFFI
FT                   TTGVKLDLKTLITNPNALMLIPVLVLFLLLSKLPIFLVYVRSFNKRNSIAGTFLIMTTI
FT                   TIVLPTLEVARKLNAITETQSDAFILAAVVVCILGPILFNSIFKLTKEDKIKQRVVIMG
FT                   TNVMTVPVAQELHDNWYDVLLVTHKKENYDTYKSKVANLKLISSLEETCLEKAGAFNCD
FT                   ILVAGFIEDELNRKIARMAKEHGVQRVIASQERPKPETIKNLTNEKIEIYNLFNVQTSV
FT                   LRALIESPSILRILTDTKNGLFEVTVRNHKYAGQKLMNLDFIEQMTVSRIWRNGTWLVP
FT                   HGNTIIETGDHLIFTAKGEDAERVREELGRKN"
FT   gene            complement(198272..199234)
FT                   /locus_tag="LGAS_0163"
FT                   /note="LactoCOG number LaCOG01015"
FT   CDS_pept        complement(198272..199234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0163"
FT                   /product="Predicted dehydrogenase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59575"
FT                   /protein_id="ABJ59575.1"
FT                   /translation="MKLGIIGSGKIVHDFLTIADQIPNLELTALATTKRSHQIGLDLQK
FT                   EYQITKLYDNNDDLFNDPNVDTVYVAVPNSFHFSISKAALEAGKNVICEKPFVATVDEA
FT                   RELKAIADQKKLIIIEAITNIYLENFKFIEENLDKIAPIHVVNLNYTQYSSRYDAFLAG
FT                   DIQPAFDPKKDGGALMDLGIYNLHIIIKLFGKPEAVNYFPTMQKNIDTSGILHLSYPDK
FT                   QASSIAAKDSFSPNVSTIEGEKGALIIYGHPNEMPKVGMQLKGQEVKVINNNKYSHRMV
FT                   AEFIEFTKIIAQHDFKEADQAFTHSLNTLAVLQEAKSQR"
FT   gene            complement(199246..200028)
FT                   /locus_tag="LGAS_0164"
FT                   /note="LactoCOG number LaCOG02218"
FT   CDS_pept        complement(199246..200028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59576"
FT                   /protein_id="ABJ59576.1"
FT                   /translation="MQKNKAKNKKIIFPNNQGGKIAALILAIIILVVIILGATFALGKP
FT                   SPKAALTKAADTEIQTARVDVKTTNSKGKMYSNYVVGPNNTIHITMRSIPKSDTNSELW
FT                   SNDQYVYHRDNDEAWNYIKQNAIFNEVYSGYKKLYTAHNFKQFSDDAFKKLKLKSNGFS
FT                   GYVISYHGNDKDVIKSMQKATSVASTSDPQSSNVKSIELRVKVNRKKELTDLYYKVTYY
FT                   SKKEGTLSLHLYDVNQVKKLKIPTSVTKNAKKLNIKSN"
FT   gene            complement(200050..200877)
FT                   /locus_tag="LGAS_0165"
FT                   /note="LactoCOG number LaCOG03134"
FT   CDS_pept        complement(200050..200877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59577"
FT                   /protein_id="ABJ59577.1"
FT                   /translation="MKKKFNFLLLLGVILVSLTTACSKKDSKPKTNPEPSASSLINAKF
FT                   NSSLANGHFTQTINSDEMSQKSKSEGLFKDKGDVTNLTYTLTQKKKSQTEQMWLTKKDM
FT                   YLLLEQNKGHWIKNSANANTFDPDQVKERFNPATFKKINKALAKKATVQKKNGNYDISF
FT                   NGTDSNLWNAVNPLVIDAMNTPGSQNMQVARLVKSAQVQNLKVTYLIDPTTKNVESMTF
FT                   KAQYIAGGKYNFTWTLTYDQLGQHADLAVPADIQKNAIDAEEIKKAQAEQNKQ"
FT   gene            complement(200961..201407)
FT                   /locus_tag="LGAS_0166"
FT                   /note="LactoCOG number LaCOG03214"
FT   CDS_pept        complement(200961..201407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59578"
FT                   /protein_id="ABJ59578.1"
FT                   /translation="MDRLEELPMDNINLDGGHLSLEQLNAIFRTIPQEMDVLDENDRVV
FT                   WSSMNKNRLFKRTEKDIGKTVFEVHPGHSQKHVKEVLNQMHAGNRKNISIMITKDEQPI
FT                   NISFYSLHNEDGKYIGCIEVTQAVKNLQVKGSKLRNILNVLKKH"
FT   gene            201543..202235
FT                   /locus_tag="LGAS_0167"
FT                   /note="LactoCOG number LaCOG00241"
FT   CDS_pept        201543..202235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0167"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59579"
FT                   /protein_id="ABJ59579.1"
FT                   /translation="MSKLVLIRHGQSEWNLSNQFTGWVDVNLSEKGVEEAKKAGRLIKE
FT                   HGLEFDQAYTSLLTRAIKTLHYALEESDQLWIPETKTWRLNERHYGALQGLNKKATAEK
FT                   YGDEQVHIWRRSYDVLPPAIDDDNEFSQAHDRRYANLDPHIVPKAENLHVCLDRVMPFW
FT                   EDHIAPDLLDGKNVIIAAHGNSLRALTKYIENISDDDIMNLEMKTGEPVVYTFDDKLDV
FT                   VNKEKLDD"
FT   gene            complement(202382..202639)
FT                   /locus_tag="LGAS_0168"
FT                   /note="LactoCOG number LaCOG00615"
FT   CDS_pept        complement(202382..202639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0168"
FT                   /product="SSU ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59580"
FT                   /protein_id="ABJ59580.1"
FT                   /translation="MAKKSKIVKAAKQRELIKKYYELKEAGDIEALAKLPLDAHPTHYH
FT                   NRDLHDGRPHGYMRKFGMSRLRFKELAHKGQLPGVRKASW"
FT   gene            complement(202868..202987)
FT                   /locus_tag="LGAS_0169"
FT   CDS_pept        complement(202868..202987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59581"
FT                   /protein_id="ABJ59581.1"
FT                   /translation="MINPQDDEIKLATSTCILKWVRSAKIPKSTPNPNTPINT"
FT   gene            203272..204204
FT                   /locus_tag="LGAS_0170"
FT                   /note="LactoCOG number LaCOG00061"
FT   CDS_pept        203272..204204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0170"
FT                   /product="Glycosyltransferase related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59582"
FT                   /protein_id="ABJ59582.1"
FT                   /translation="MKKLSIIVPCYNEEESVPLFYPAVNKVMDTIPDLEPEYWFINDGS
FT                   KDNTLKEIKELRKKDPEHVHFVSFSRNFGKESALYAGLQAATGDYVVVMDVDLQDPPKF
FT                   LPQMYDLIKTGEYDCIGTRRVDRTGEAKFKSFLSDMFYKVVNKISDTEIVPGARDYRMM
FT                   TRQMVNAVLDMPEYNRFSKGIFSWVGFKTKYLDYHNVERVAGESDWNTWKLFKYAMDGI
FT                   ADFSQAPLNLAVWIGTGSFVLSIIGLIIVIIRRALYPGSSIFGWASMVCIILLLGGLQL
FT                   LCIGILGKYIGRVYIQVKNRPIYIIKEKK"
FT   gene            204208..205020
FT                   /locus_tag="LGAS_0171"
FT                   /note="LactoCOG number LaCOG03215"
FT   CDS_pept        204208..205020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59583"
FT                   /protein_id="ABJ59583.1"
FT                   /translation="MQKVSELSHKFRNFFYEIINLKSEIILARENFRMKKISQNTWIKI
FT                   ALSILGVLAAILVYVPNYAAVDQGLKGRCAIFFIIAVVLLWLPMELKSSIFALNFYYEL
FT                   GLILIIVFLMTNQMAMNFTIGLVIALLLLTWVGMVIFKNNLVMKQKNSELLIIRLVMML
FT                   VLAYLAYISGFAALMGAEIFTVQGQTWLLILGFVLCVYYLVLAGSIWQPWFRRWTSWIM
FT                   ILAAVVLHMIFASATSLNVIFLPIIGEIIMLILVWRSNRILMKKKMIS"
FT   gene            205092..205955
FT                   /locus_tag="LGAS_0172"
FT                   /note="LactoCOG number LaCOG01531"
FT   CDS_pept        205092..205955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0172"
FT                   /product="Putative glucose uptake permease"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59584"
FT                   /protein_id="ABJ59584.1"
FT                   /translation="MKYVYLFLPAIGWGLMPLVIASVKNSTVYNQIVGTVAASFIFGAV
FT                   VMAIMHPAMSWSLFLLSALGGACWVIGQVGQYISYEKIGVSETMPISTGLQLIGVPLVG
FT                   VLAFGEWASPQAKLYGFIGILVLIIGVVLTSLTDRGTSEGNKSNQISTIILLVLTSLGY
FT                   ITSSSIPKALHGSSISIFFGQTFGMLVAVFIYTLVTKNLHVWKEKSTVQSGGAGILYAI
FT                   AALAYILSVQDNGVNMAFVISQLCVVISTLGGLVFLHEKKTRNGLIFTIAGLVLIIGGA
FT                   MLTTLF"
FT   gene            206235..207119
FT                   /locus_tag="LGAS_0173"
FT                   /note="LactoCOG number LaCOG01068"
FT   CDS_pept        206235..207119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0173"
FT                   /product="Galactose mutarotase related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59585"
FT                   /protein_id="ABJ59585.1"
FT                   /translation="MMVTIENNQLKVEINEVGAQLTHVVDKATNADYIWNGSEWERHAP
FT                   ILFPAIGRSNDNKYILNGKTYEMKQHGFARDYPWTVVDKGDDRVSLTLTENDETLAVYP
FT                   FRFSLMATYTLEANQLKVEFLVKNNSKETMPFGLGFHPGFNVPVAGDELEFSDYEINLS
FT                   PEVTELTQFQIDPIPFRNGKVIPVPNAQKSTLPLSYAEFDDGLIIINNPGLTGIELSSA
FT                   KSDHKISLTLEDFPYVALWAMTDPEAKFLCMEPFAGLPDIKSNELTDWMEKEGNNFLAP
FT                   DESSHFSTTITLE"
FT   gene            207235..208359
FT                   /locus_tag="LGAS_0174"
FT                   /note="LactoCOG number LaCOG00320"
FT   CDS_pept        207235..208359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0174"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59586"
FT                   /protein_id="ABJ59586.1"
FT                   /translation="MRKNIMDNKPKEPVLSRVELNKEKHSKKKPIRIIIAVVLVLVLGL
FT                   GAYAGSVYFKAKNAFDKTYDPKNAVKQDSFSGKEPFNILLLGTDTGAFGRKEVRGNSDT
FT                   MIIVTVNPAKKKLSLMSIPRDTMARMIGTESFSVHKINAAYNIGGAKMAMQTTSKVLNV
FT                   PIKYYISMNMGGMRKIVDGVGGVTVTPPLTFTYDGYTFTKGKKVHLNGSQALAYSRMRY
FT                   DDPKGDYGRQLRQREVIMSVLEHAMSFSTLKNLDSILGSVSTSLRTNLTFDSMVKISKN
FT                   YRKCTQNMSSDYLHGVGAMIGDASYQVMSDKELQRTSNIVRNDLGLDSMNIDNNETYQN
FT                   SMNSQFDWTSGDSNQVYYVYDPYTDELWNGDRAY"
FT   gene            208335..208979
FT                   /locus_tag="LGAS_0175"
FT                   /note="LactoCOG number LaCOG00684"
FT   CDS_pept        208335..208979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0175"
FT                   /product="acyl-phosphate glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59587"
FT                   /protein_id="ABJ59587.1"
FT                   /translation="MERRSCLLMNELISLVIGYFLGNILFAMIVAKIFLHKDPTKYGSG
FT                   NPGTANIGAVFGKKWGILTCIGDLAKTLAALLIVYSLYHGNRLDLSFAGLGVVLGHSFP
FT                   FWNHFKGGKGVAVTALWLVFFDWRAGLIALLFGLFLVIIMKNLTIPPLVYMLGFSIFTW
FT                   LNFGWEQGLIFLIATLIMIFQFRKDIVDFFTGHGKRVDVLVTIKKKLGIYK"
FT   gene            208976..211924
FT                   /locus_tag="LGAS_0176"
FT                   /note="LactoCOG number LaCOG02216"
FT   CDS_pept        208976..211924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0176"
FT                   /product="Phosphoglycerol transferase related protein,
FT                   alkaline phosphatase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59588"
FT                   /protein_id="ABJ59588.1"
FT                   /translation="MKSALRKTIQWILLLCLLLGILIQALGFWNYNPTSVSTKTRIGMV
FT                   ISLIQLIVVVWYGMSYGSKEYSFKEVVKNWLEGVITLIIFYLVFVISLPQLFSAWNLWG
FT                   VFFPVLTSTSALFSGIIISLFFQPFIFRLQERLNTKQNVLLLTTITLLIFTLSAGNSLL
FT                   TSYSIFGLYLVLPFAWGMLISKIKVSKKVLFGLVVATIILLPAVYYLTIKLMPIQTPQG
FT                   FIFSQMNMSWNTSLLMAPSSPLMILFVVTGALLFRSSMLGASHRVFSILIPAIIFGTTS
FT                   YGMSLWKEKLQLLLAPVSKKVTVLLILSLLVASFIINFIFVKFILSNKCVQRFLNKFDE
FT                   NNLDGLVKLLEAGLGFLKKHSRSIILFAFLIFLSIVGFYTVRDIQSASDFWVALVFIFT
FT                   SKFGTLVLSSIFLFAIYEIFYVITTRFWVSASIPTVLALGIAIADGIKMDLREEPVYPN
FT                   EISEIVNWKTLIPMIGVQTLIYILVGIALLVAVIVYLELKHPYNLKREKKSWVALIGSL
FT                   LILITPVWFNDEDSVIYYISKGFDNNPDFRNPPDSTANNGAVLTFLDFIKVPIMDKPAG
FT                   YSEHAIKEITKKYQKEAIAINKTRKNKLSDQTIVFNLSESFVDPKEFPGVKVSNNVRDP
FT                   MEYIRSLMTQTTSGKMLSAGYGGGTGNMEYESLTGFNMGNFSSALTPYTQVTSHYEFYP
FT                   TIGMNFPYSSAIHPFKGTYYGRIDNYRRFKFNKFAYLGSKYKIYDQKSLGTSPYLSDET
FT                   AYQNGLRQIKSRKGGQFINLISMQNHMPYGDYYSPNEYKDNVSGSSLADDNVKTSFAAY
FT                   TKGVEYTDKAVKEFIAQIDKLNKPVTLVFYGDHYPSIIDQSLLAKYPLKMHSTTYFIYS
FT                   NKYAREHGAKSKIVPDKYVATSSFIPMALEQTNAKVTAYQALLTRIYKDLPAMTINYSS
FT                   SDGFELVDQNGKKVSEKKLTKKQKELLKDYKLIQYDMSAGKGYTLDVKGFYK"
FT   misc_binding    211965..212173
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="T-box leader, riboswitch"
FT   gene            212167..213447
FT                   /locus_tag="LGAS_0177"
FT                   /note="LactoCOG number LaCOG00279"
FT   CDS_pept        212167..213447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0177"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59589"
FT                   /protein_id="ABJ59589.1"
FT                   /translation="MLGEIIMAKFDILEDLKWRGAINQETDEEGLRKYLAEHDDLALYC
FT                   GTDPTGDSLHIGHLIPFMILKRFQMAGYHPVILIGGGTGSIGDPSGRKTERVLQTAEQV
FT                   KHNEEKLTTQMKKLFGTENFEIKNNAEWLGKLNLIDFLRDYGKFFQVNNMINKDVVASR
FT                   LENGISFTEFSYQILQAIDFYHLNKDNGVQLQIGGSDQWGNITAGIDLIHKLEGQERPA
FT                   FGLTIPLMLKADGTKFGKSAGGAVWLDPEKTSPYEFYQFWINQDDRDVVKYLKYFTFLS
FT                   REEIEDLAEKTEKEPWKRAAQKRLAEEVTKFVHGEEGLKEAQMITEALFSGNVKSLSVP
FT                   QIEQALKNAPSAEATHEAKNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQNDIDFI
FT                   IEPDNDFDGKYVIIRKGKRKYTLVKIK"
FT   gene            213530..213602
FT                   /locus_tag="LGAS_t0178"
FT                   /note="tRNA_Thr_GGT"
FT   tRNA            213530..213602
FT                   /locus_tag="LGAS_t0178"
FT                   /product="tRNA-Thr"
FT   gene            213706..215043
FT                   /locus_tag="LGAS_0179"
FT                   /note="LactoCOG number LaCOG02080"
FT   CDS_pept        213706..215043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0179"
FT                   /product="cysteine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59590"
FT                   /protein_id="ABJ59590.1"
FT                   /translation="MIYERRINMAHELTLDEIAKFQQDYQRNKQNKIAELAVVNNGVQK
FT                   VSFNSEGIRDLNRTFSIEIPTDNVTDQKQSGRCWLFAALNVLRHKFAKQYHAKNFTFSQ
FT                   SYLFFWDRIERANIFFNHILETADKPVDDRTVHFYLQAPDTDGGQWHMAISLIRKYGLV
FT                   PTYAQDESFTANNTAAFNQALNMKLREDGLVLRKLAQAGKNDEVEQKRQEFLSEVYRMA
FT                   VIAFGQPVQKFDLEFKDDDGNYKLDQNLSPLDFFHNYFEDDLDDYVVLFNAPDHEYDKL
FT                   YAFPFEDNVEGGSPIRFLNTNIENLKEAAIKQLKDGETIWFGCDVGKQSDRQKGILAAD
FT                   LYETDTIFNIETKLSKKERLETGASGSTHAMTLVGVDVVDGKPRQWKVENSWGTKVGEK
FT                   GYFVMDDKWFNEYLFKVVVKKQYLPAKLVKIAEGKATPVPCWDSMA"
FT   gene            215060..215713
FT                   /locus_tag="LGAS_0180"
FT                   /note="LactoCOG number LaCOG00036"
FT   CDS_pept        215060..215713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0180"
FT                   /product="Predicted HD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59591"
FT                   /protein_id="ABJ59591.1"
FT                   /translation="MDIELVKQFTRVHLKGEKTGHDYYHGQRVANLATKMYLSDYPNAH
FT                   EDSRVVAIIQTGSYLHDTIDEKICENPSKVIAEIEELLPKVGFTELEVQDILFTIQHMS
FT                   FSDNIEHHYKLPLSGQYVQDADRIESLGAIGIARAFTYGGKHGNKIYDPEIKPEKLVSH
FT                   DQYRNHDETTINHFYEKLFDLEGLMNTPAAKKEAHRRTEYMREFVQEFMDEWNV"
FT   gene            complement(215778..217088)
FT                   /locus_tag="LGAS_0181"
FT                   /note="LactoCOG number LaCOG02080"
FT   CDS_pept        complement(215778..217088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0181"
FT                   /product="cysteine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59592"
FT                   /protein_id="ABJ59592.1"
FT                   /translation="MSHELTLQEIDQFRNDFDNSRNEVVSRAAMRSGVLEASFNPAVTN
FT                   RLNDVFSVEVETDNVTNQMQSGRCWLFATLNTLRHDFGKKYKAKNFTLSQAYNFFWDKI
FT                   ERANIFYDAIIDSADKPLDDRTVKAYMNFAGSDGGQWAMAASLVKKYGVVPTNAMPESF
FT                   NTNHTAGLADALARKERKDALVLRKLVQEGKTDEVEKKRKEFLSEIYRMTAIAVGEPPK
FT                   TFDLEYRDDDKKLHLDKNLTPVEFFNKYWDINFDDYVCLTNAPDHEYGKLYSLPFEDNV
FT                   NGGLPITFLNVPIEYLKEAAVKQLKDGESVWFGNDVLKEMDRKTGYLDTELYKTDELFD
FT                   VDTYMTKAERLATGEGEVSHAMTLVGVDLDKGEIRKWKVENSWSEKSGRKGYFTMSDKW
FT                   FDEFVYEVVVRKEFLTDDQKKLAESKPTPLPAWDSLA"
FT   gene            217178..217873
FT                   /locus_tag="LGAS_0182"
FT                   /note="LactoCOG number LaCOG01686"
FT   CDS_pept        217178..217873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0182"
FT                   /product="Uncharacterized conserved secreted or membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59593"
FT                   /protein_id="ABJ59593.1"
FT                   /translation="MKVAFISMTRDNMKYNIDNNIGGKTMKKNIFVSGITLMTMLLAVG
FT                   CSNSANQSSTNNEAKSSKTSHKKSHKAKKHTTKKDKTDVDTDDSETTNSDKKNDKSSES
FT                   SSNTNGKKTNKNESTNSNNSSDSTGSNNSNNASNSAASNNQTNGKSQNASSANNASDAM
FT                   FNKMVSDTIKEHGYSSSYGPDNFTLIDGGNGQYSLAEKSTGTIVGHYSVKNGELYKQDI
FT                   LTGNDVKVK"
FT   gene            217873..218334
FT                   /locus_tag="LGAS_0183"
FT                   /note="LactoCOG number LaCOG01576"
FT   CDS_pept        217873..218334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0183"
FT                   /product="transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59594"
FT                   /protein_id="ABJ59594.1"
FT                   /translation="MVYYQKMTPEGYQEIKDEIARLKKDRPRRIKILQEARSMGDLSEN
FT                   SEYTTAKMELGHLQSRLRYLDKQLRYSEIIQKDESGTIDLGSNVKLLFEGDDDAEEYRI
FT                   VGRMEADLAKGKISFDSPLGQALMKQKAGATVTVQAPAGSYDVKIIAVN"
FT   gene            complement(218380..218829)
FT                   /locus_tag="LGAS_0184"
FT                   /note="LactoCOG number LaCOG01553"
FT   CDS_pept        complement(218380..218829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0184"
FT                   /product="heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59595"
FT                   /protein_id="ABJ59595.1"
FT                   /translation="MEGSFIMANEMMKNRNNDNMMDQLSDWFSFPKDFFDDSSIKNIMQ
FT                   SDVAETDKDYIVKVDMPGMDKKDIKVSYKDGILNVSGSRDSFDNLDDKNGNLIHRERSV
FT                   GHIQRSYRIPDVDSKEISAKDIDGVLTITLPKLTEEDKENTITIE"
FT   gene            complement(218960..220450)
FT                   /locus_tag="LGAS_0185"
FT                   /note="LactoCOG number LaCOG00306"
FT   CDS_pept        complement(218960..220450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0185"
FT                   /product="Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59596"
FT                   /protein_id="ABJ59596.1"
FT                   /translation="MNFENAYFRKDVLNMTGYTMPKGFLWGGAVAAHQLEGAWNEDGKG
FT                   MSVADVMTVGSATKPREITDGVIPGKNYPNHDAIDFYHHYKGDIKLMAEMGFKAFRTSI
FT                   AWTRIFPKGDEKEPNEAGLKFYDDLFDECHKYGIEPVITLSHFEIPYHLVKEYGGFTNR
FT                   KLIDYFVRFARVCFKRYKNKVKYWMTFNEIDNQSSFNNDFLMATNSGILFKNGMGDKEK
FT                   EAAMYQAAHYELVASALAVKEGHKINPDFQIGCMINYSPVRPLTPSSDDVLLADKFEQR
FT                   RDFFSDVHVNGEYPNAVEDYIERNGYRPDITEEDKIALKEGTVDYVGFSYYQSTTVSSK
FT                   KVKPDELTDLQEAIVENPTLQRSDWGWEIDPEGLRISLNHLTDRYHKPLFIVENGLGAY
FT                   DKREADGSVHDPYRIDYLRKHIEQMEKAVVLDGVDLMGYLPWGCIDLVSAGTGQMDKRY
FT                   GFIYVDKNDKGEGTLERSKKDSFDWYKKVIESNGKDLD"
FT   gene            220522..221103
FT                   /locus_tag="LGAS_0186"
FT                   /note="LactoCOG number LaCOG02262"
FT   CDS_pept        220522..221103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59597"
FT                   /protein_id="ABJ59597.1"
FT                   /translation="MLQPFSISSIIQVLSELFRNNIERADTIMTKKDQSLEQKKHDMSV
FT                   RSINFSRYLMIRYFSAAFLFTNLFWLVFAICYKDIVASIISGLLFVLLLVASVEQVSKW
FT                   NVRNTDLKFTKLYYQLQLVANVIFAIGCYLPFGKVLFPFMATNDVANVIFTILVVGILG
FT                   SILILRRISNIQNGRDKYARAIKTFESNRQ"
FT   gene            221126..222478
FT                   /locus_tag="LGAS_0187"
FT                   /note="LactoCOG number LaCOG00113"
FT   CDS_pept        221126..222478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0187"
FT                   /product="cellobiose-specific PTS system IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59598"
FT                   /protein_id="ABJ59598.1"
FT                   /translation="MSDTAQPSFKDKMMKILGKFSGSRFVRAIMGAGYSIIAFSIIGSM
FT                   FLVLTVLTQVITAKGFVDFYNNTFGRFNNIYTVIYNATMGIIAIYFAGSFAYNYADIYR
FT                   KEENLLLDPLNAVFLTLMGLFITVPQLVWKGGNTVFVNILKKDNVIAGGYGVSGSGLTR
FT                   IGATGIFTGLIVAWLTVQIYRFCIKHNWRIKMPASVPSGVANSFTALIPGFVIAIVIAL
FT                   IDVILIVLGTDIFQLLFIPFSFVSNIANTWWGVLIIFFLIHFLWWFGIHGATIISSFYQ
FT                   AIVLSNMAANASGAHYVFAGEFANAFVIMGGSGATLGMALWMAFASRSKQLRELGKLEA
FT                   VPAVFNINEPLLFGLPIVYNVRLFVPFLLAPMTCSMVAYAAIATHLVPKIIVQQPWPIP
FT                   VGIGGMMATASWQGAVLALVNAIVAFLIWYPFIKHYDNELLKKEQAGAEKA"
FT   gene            222554..223252
FT                   /locus_tag="LGAS_0188"
FT                   /note="LactoCOG number LaCOG02778"
FT   CDS_pept        222554..223252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0188"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59599"
FT                   /protein_id="ABJ59599.1"
FT                   /translation="MKKYELVADKIKDYITEKQLHHGDKLPTITDLMKKYQVGKSTILQ
FT                   AITLLTQRGIVYKVQGSGVFVRPTGQDGYMSLTDNAGFAHVLKKPTTEVIEFSEKKAPK
FT                   PISEHLHSNEECYFIKRLRKQDGKPFVLEESYYRKSIIPFMSKEIAEGSIFDYIREGLK
FT                   KEIRFSDKYMRVRKLTADEAKYLELKEGDPCLEVYDTFYLANGTAFDSSKLVYNYKNSK
FT                   FYDQSSDDII"
FT   gene            complement(223296..223556)
FT                   /locus_tag="LGAS_0189"
FT                   /note="LactoCOG number LaCOG02828"
FT   CDS_pept        complement(223296..223556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59600"
FT                   /protein_id="ABJ59600.1"
FT                   /translation="MKAEITEYEFGKKYVSIFKSSKLDVKIAYYLEDNDRGCQITFKED
FT                   VLSFDEKKHSNLGTWFYNWQLKQGAKKQLKQMKNNVLAYAK"
FT   gene            complement(223783..225276)
FT                   /locus_tag="LGAS_0190"
FT                   /note="LactoCOG number LaCOG00306"
FT   CDS_pept        complement(223783..225276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0190"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59601"
FT                   /protein_id="ABJ59601.1"
FT                   /translation="MTKTYSMPKNFYWGGASAANQYEGGYNEGGKGLNAIDVLTNGSAT
FT                   EPRKVTWKTNDGKTGVTPMTWGKEFKLPDGAKPALLDNYYYPSHEGTDFYHHYQEDIKY
FT                   MAEMGFNMFRLSLNWSRILPNGDDQEPNKEGLAFYDKVFDECAKYGIEPLVTLSHYETP
FT                   LSLINRFGGWKDRKMIDIFVHYADIVMNHYKGKVKYWLTFNEINAMDMAPYMGGGLIDG
FT                   SKQNRAQGAHNQFVASSKVVKLAHEIDKNNQVGQMLAYSAYYPYTSDPADQLLVMKAKQ
FT                   EMLFYSDVQTGGRYPEYRLKEYERDGIKLDDRPEDYELIEKYPVDFLSFSCYTSNVLTT
FT                   HEADAKANGNMSAGGVKNPYLDYNAWGWATDPDVLRIALNDLWDRYHKPLFIVENGLGW
FT                   GDELTKDHKVHDDYRINYLRAQIKSMEEAVNEDGIPLMGYTMWSAIDLVSNGTGEMKKR
FT                   YGFVYVDRDDKGNGSLKRYPKDSFNWYKKVIASHGKDLD"
FT   gene            complement(225343..226068)
FT                   /locus_tag="LGAS_0191"
FT                   /note="LactoCOG number LaCOG01560"
FT   CDS_pept        complement(225343..226068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0191"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59602"
FT                   /protein_id="ABJ59602.1"
FT                   /translation="MTAEAKYLKVARILQKRIEDGVYKTQAPLPDQKTLADELQVSRLT
FT                   VKKALDGLQRKGLVYKESGLGTFVLGPVPIQDKFDSPANAFSGLANLLGSDEVTSDIIE
FT                   FNVEFPNENIQHYLKLKSSDPVYNIRRLRRLKGKPLILEHTFMPVHLVPNLTEDILHNS
FT                   IYNYLHQDLKLKFGIAYRKIKAVKADDWDQKYLKAKKNDPILELEQIVWLNNGQPVEYS
FT                   TSRNRYDERNYVVVETSSF"
FT   gene            complement(226068..226394)
FT                   /locus_tag="LGAS_0192"
FT                   /note="LactoCOG number LaCOG00304"
FT   CDS_pept        complement(226068..226394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0192"
FT                   /product="cellobiose-specific PTS system IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59603"
FT                   /protein_id="ABJ59603.1"
FT                   /translation="MAQENSDNMQVVMGIIMQAGNAKAAAMQAIQAAKKGDFDKADEFI
FT                   KQANEGLVNAHNVQTDMLTQEAQGNHVKVDLYMVHAQDHLMTAITFIDLAKEVVAVYKK
FT                   MAEK"
FT   gene            complement(226635..226733)
FT                   /locus_tag="LGAS_0193"
FT                   /note="LactoCOG number LaCOG03217"
FT   CDS_pept        complement(226635..226733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59604"
FT                   /protein_id="ABJ59604.1"
FT                   /translation="MNDEIKIVNEFDRDGHHFKIGVSADGQVSLSI"
FT   gene            complement(226739..227062)
FT                   /locus_tag="LGAS_0194"
FT                   /note="LactoCOG number LaCOG00303"
FT   CDS_pept        complement(226739..227062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0194"
FT                   /product="cellobiose-specific PTS system IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59605"
FT                   /protein_id="ABJ59605.1"
FT                   /translation="MADKTIMLACSAGMSTSLLVSKMQNAAKEKGKDYKIFATAASGIQ
FT                   DEIDKEHPDILMLGPQVQYMEDSVKKITDAAGIPLTVINMQDYGMMNGEHVLETAQELM
FT                   GDK"
FT   gene            complement(227209..228639)
FT                   /locus_tag="LGAS_0195"
FT                   /note="LactoCOG number LaCOG00113"
FT   CDS_pept        complement(227209..228639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0195"
FT                   /product="cellobiose-specific PTS system IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59606"
FT                   /protein_id="ABJ59606.1"
FT                   /translation="MSEQKKSGFSVFVNKHILPPVMKFVNTKAIQALQNGMIYTLPFIL
FT                   IGSIFLILGNIPIKSVADAINASGWGAFFNQAYTTTFSIMAMWASVGIAYIYVKNEGYE
FT                   PLAPGLTSLASFLMLQTLTIDSPLKNAMAKGIDGQMTAKAVTENIDKLPHALQSFLESP
FT                   VTGVFNITWLGGDGMIAAIIVGLLVGWIYSAIMKKGWTIKLPEQVPAAVSNQFTAMIPS
FT                   GMILIGTMLIYAGFKLTTGSDFLQWTYQTLQIPLQGISDSLGGAIAIGFLVPFFWFFGV
FT                   HGGLIVGSLAGPMLQANSFDNAQLYKAGKLTIANGAHVVTNEFYNNFINLTGSGITIGL
FT                   IIFILIAAKSAQLRSIGKVELVPGIFNINEPFLFGLPIVMNPFLAIPFFLTPVVVAIST
FT                   YFVIKTGIVPPLNGFACPWTMPAVISGFLIGGWKMAIWQACTLVISTLIYWPFAKKYDN
FT                   ILVKREAATLKKDEAESK"
FT   gene            complement(228639..230036)
FT                   /locus_tag="LGAS_0196"
FT                   /note="LactoCOG number LaCOG00568"
FT   CDS_pept        complement(228639..230036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0196"
FT                   /product="Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59607"
FT                   /protein_id="ABJ59607.1"
FT                   /translation="MQRGNIMNKQKMPKDFFWGNSVSSMQTEGAWNEDGKGLSVYDVRP
FT                   ATENTTDWHTAIDEYHRYDEDLDLMKEMNMNMYRIQISWSRVCPEGDGKFNLKGIDFYD
FT                   KLINAMLKRGIEPMICLYHFDMPLHLAKEYNGFMSRHVVDAFVRFGKKMIDHFSDRVKY
FT                   WIVFNEHNLYFQDEVFNISGYEKGDKTLDDMYTIFHHTMISHIRLANYIHEKYDDVKIG
FT                   GMLAYQQIYPETSKATDVWAAKQAQEFLNFNIYDADTGRGYSPEVMQYAKDHHINWDIT
FT                   DEDQEEMKKAQADFLAFSYYSSWTLSADKIPEDIAPNRYMNYGGVKNKYLKTNAWGWTI
FT                   DPLGFRNAITTMYNHYKIPVFPIENGIGLKETWDGEHMIEDDERIAYHEEHIKAMKDAM
FT                   FLDGAKVLGYLGWGLIDIPSSHADVEKRYGAVYVNRSNHDLKDLKRVPKKSFYWSQKVL
FT                   KNNGDEI"
FT   gene            complement(230221..231162)
FT                   /locus_tag="LGAS_0197"
FT                   /note="LactoCOG number LaCOG00969"
FT   CDS_pept        complement(230221..231162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0197"
FT                   /product="Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59608"
FT                   /protein_id="ABJ59608.1"
FT                   /translation="MKNIYLLKSPSYIISMKVTRIREEIFIMNLIAIDIGGTTIKIATW
FT                   INKKLKMVFTVDTPDNLETFYHKLSDAVNEIKTNNKIDGVAISSPGAVNKKTGVIEGAS
FT                   ALPYIHNFKIVPELEKRFGLPVSIENDANCAALAELVAGSAKDCRSMAFLVIGTGVGGS
FT                   VIINNQIWHGAHLYGGEFGFMIIDGQQLSVLASPVSMAKRHNEKTGKNFDGKTVFELAD
FT                   TDDLVAQEERGKLIHALATAIYNIQHSFDPEKIIIGGGISQNQELIPLLNDEISKIRNK
FT                   LDIATVKPILDICTLKNEANLRGAVADFEKEH"
FT   gene            231227..231889
FT                   /locus_tag="LGAS_0198"
FT                   /note="LactoCOG number LaCOG02209"
FT   CDS_pept        231227..231889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0198"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59609"
FT                   /protein_id="ABJ59609.1"
FT                   /translation="MNTPSSRQGNLTRYAVYLVLYLIVIGIKKLTLLDDQVNKIGYFFF
FT                   LIFTLFALYFYIRQFNREQRFFEKKPSMPLLADYSFLVGVSILVILGRIFISYLQAKGA
FT                   VPLMNFQIIYQKGESNLLFWFFIFSIGILIPALQVYLTSGFFFNYGFRAQNMTSGVVGI
FT                   ICSGFFFGILNFQASLALFVINSLYGMLFAWSYLYSQRILMPIYLAILNGIFMVILA"
FT   gene            complement(231930..232000)
FT                   /locus_tag="LGAS_t0199"
FT                   /note="tRNA_Gly_CCC"
FT   tRNA            complement(231930..232000)
FT                   /locus_tag="LGAS_t0199"
FT                   /product="tRNA-Gly"
FT   gene            complement(232028..232639)
FT                   /locus_tag="LGAS_0200"
FT                   /note="LactoCOG number LaCOG02314"
FT   CDS_pept        complement(232028..232639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59610"
FT                   /protein_id="ABJ59610.1"
FT                   /translation="MCSHFAMPSLKEIKTYLTTDLKLPLIVPKNIEDKFSAATQIYPKS
FT                   SSLVMLYSNNELKLVEKKWGYPSPFQKNRVLYNARVERFYEEKPSMWDNSFARQRCIIL
FT                   ASEFWESSKQTYLASNNQTYHEHSSFTAIEEPMTLIAGIYQGNDFSMVTTVANNTVLPV
FT                   HERMPLVLKPSELRRWLFQNFTSLLDRSEYNLARHQLPHR"
FT   gene            232761..233801
FT                   /locus_tag="LGAS_0201"
FT                   /note="LactoCOG number LaCOG00037"
FT   CDS_pept        232761..233801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0201"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59611"
FT                   /protein_id="ABJ59611.1"
FT                   /translation="MEKIMTKEILLTGDRPTGKLHIGHYIGSLKNRVKLQNEGKYEPYI
FT                   MIADTQALTDNARDPEKIKNSLIQVALDYLAVGLDPEKSTIYVQSQIPALFELTAYYMD
FT                   LVTVARLERNPTVKTEIKQKNFKDSIPVGFLNYPVSQAADITAFKATVVPVGDDQEPML
FT                   EQTREIVRTFNRVYNTDILVEPKGYFPPKGQGRLPGLDGNAKMSKSLGNAIYLSDDAKT
FT                   VQKKVMSMYTDPNHIHVEDPGQVEGNTVFTYLDVFAPDKDKVAELKEQYQKGGLGDVKI
FT                   KRYLNKVLEEELGPIRERREKFAQNPDAVYEMLLEGSKKANEVANQTLQEVREAIGLNY
FT                   FDRLNK"
FT   gene            233821..234309
FT                   /locus_tag="LGAS_0202"
FT                   /note="LactoCOG number LaCOG00765"
FT   CDS_pept        233821..234309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0202"
FT                   /product="Deoxycytidylate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59612"
FT                   /protein_id="ABJ59612.1"
FT                   /translation="MTRDRIPWKQYFMMQALVIAQRSTCDRALVGSVLVKDDRMIATGY
FT                   NGSVSGQPHCDDVGHLMVDGHCVRTIHSEMNALIQCAKNGISTEGTEIYVTYFPCFNCS
FT                   KCLVQAGIKKINYYYDYHDNPLALKLLREKGVAIEQVTLDHKYVQSLADRLEKADNEK"
FT   gene            234299..234886
FT                   /locus_tag="LGAS_0203"
FT                   /note="LactoCOG number LaCOG02208"
FT   CDS_pept        234299..234886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0203"
FT                   /product="Beta-propeller domain of methanol dehydrogenase
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59613"
FT                   /protein_id="ABJ59613.1"
FT                   /translation="MKNKVIGLVALLICILTLTASTKSFVSDPQGLFDNQTKELVNQKN
FT                   ESYQKTKTKPEIRLLSLKDSKDLNRIQPLKNQIIIAVALQNKKKNVQIIVGKNYQDLLT
FT                   QNKCGNIIRYAGNKLRSKKAATFNSGIRLVFNACATLVAQKDKLSYDKNSLTQDELQKI
FT                   DHPQSVNLVWGLVIAALISFGLVLFKSFRKKK"
FT   gene            235186..236184
FT                   /pseudo
FT                   /locus_tag="LGAS_0204"
FT   gene            236236..238281
FT                   /locus_tag="LGAS_0205"
FT                   /note="LactoCOG number LaCOG00547"
FT   CDS_pept        236236..238281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0205"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59614"
FT                   /protein_id="ABJ59614.1"
FT                   /translation="MYKLSPTCYVILAIKRLMRGRIKMAEKKTFYITTPIFYPSGKLTI
FT                   GNAYTAIAADAMTRYKKSRGFDTFFLTGTDEHGLKIEQKAEAQGIKPQEFVDKMAASYK
FT                   ELWKMLDVSYDRFIRTTDEDHVKAVQKIFEKLLKQGDIYLGEYTGWYSVEDEEYFTESQ
FT                   LAEVYRDDDGNVIGGKAPSGHEVRLVKEPSYFFRMSKYADRLLQYYKDHPDFILPHSRE
FT                   KEMVNNFIKPGLEDLSVTRTTVDWGIPVPSDPKHVVYVWIDALSNYITALGYGSDDDSL
FT                   FKKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKQIFGHGWVLMRDGKMSKSKGNA
FT                   VYPEMIAKRYGLDALRYYLMRAIPFGSDGIFTPEDFVERVNFDLANDLGNLLNRTVSMI
FT                   NQYQDGYVAPVAADQDEFAQDLIKTAKETIAEYQKQMDALHFSQALDSVWKLISRANKY
FT                   IDETTPWTLNKEGKSEELSKVMSNLAESLRLVAILIAPVMTQSPVKMFNQLGLDWNKEA
FT                   QKKLEFGAFDWDIKVTEKPTPIFPRLKNDVEVKYIKEEMKKAKPKKKTRSQQKEEKHIT
FT                   IDDFDKVKIQVGQILSVEPVKGSSKLLMFKLDFGDGNERQILSGIRKFYPDASELLDKK
FT                   VLAVTNLKPRKMLGHESQGMLLSSEKDGQVKLALVGDEHEVGAELG"
FT   gene            238281..239051
FT                   /locus_tag="LGAS_0206"
FT                   /note="LactoCOG number LaCOG00457"
FT   CDS_pept        238281..239051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0206"
FT                   /product="Mg-dependent DNase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59615"
FT                   /protein_id="ABJ59615.1"
FT                   /translation="MEIFDSHTHLNDVPFRGKEEIYLDRAKELGVVKSAVAGQDPEFNE
FT                   RAIDLSQRFDNLYAIVGYCPDVAKGYDQNAEDVLVEQLKKPKTVALGEIGLDYYWDESP
FT                   RDVQRKVFARQLDLAHSLKMPVNIHTRDAFEDTYQVLKNSHVGEYGGIIHNFNGDPEWL
FT                   KKFLDLGMMVSFSGVVSFTKAIDVHASAKVVPWDKFLIETDAPYLTPKPYRGKQNETGY
FT                   VRYVAEAIAKLRDVSVEEVAKHTFENTMRAYGIK"
FT   gene            239038..239601
FT                   /locus_tag="LGAS_0207"
FT                   /note="LactoCOG number LaCOG00459"
FT   CDS_pept        239038..239601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0207"
FT                   /product="RNAse M5"
FT                   /EC_number="3.1.26.8"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59616"
FT                   /protein_id="ABJ59616.1"
FT                   /translation="MESNNQKQFNAVVVVEGRDDTKRLKQFFPGIETIETNGSEVSDQT
FT                   LAEIKKLAKTREIIIFTDPDYNGERIRRLVTNAAPNAKQAFITRKEGEPTKRGNSLGVE
FT                   HASKEALVRALGDLHEIQAVESDITKEKYDDLGLAVSPEARLLREKVGIKLGIGYGNSK
FT                   QFLKRLKMFGITYDELKRAVEDVK"
FT   gene            239585..240481
FT                   /locus_tag="LGAS_0208"
FT                   /note="LactoCOG number LaCOG00460"
FT   CDS_pept        239585..240481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0208"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59617"
FT                   /protein_id="ABJ59617.1"
FT                   /translation="MKMSNSMPIASPVRTQAIVNRYFMHAKKNLGQNFLVDLAAIKGIV
FT                   EAADIQSGDQVIEIGPGIGSLTEQLLLAGAKVLAYEVDQDLPEILKNELPQKIDGEELN
FT                   SRFKLVMKDVLKANFTKDSDGFLDLNKPVKIVANLPYYITTPIIFNLIKSDLDFSSLTL
FT                   MMQKEVAERLVAIPKTKEYGPLTIAVQSRMNVELAEEVKSTSFMPRPKVDSAVVVLTPL
FT                   TEKPNIDDYSFFDHVVKMCFAQRRKTLANNLKSLVRDKDMREKMINDLGLDLRVRPEEL
FT                   TLNQFVELAHLLKDQQA"
FT   gene            240558..240797
FT                   /locus_tag="LGAS_0209"
FT                   /note="LactoCOG number LaCOG00508"
FT   CDS_pept        240558..240797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59618"
FT                   /protein_id="ABJ59618.1"
FT                   /translation="MPTTLMAIKHNLDSHLGESLVVVAQAGRKKVTRRKGRLTKTYRAV
FT                   FVVDLDQDQNNFERVSYSYTDLLTKNIELEFDEM"
FT   gene            240918..241754
FT                   /locus_tag="LGAS_0210"
FT                   /note="LactoCOG number LaCOG01526"
FT   CDS_pept        240918..241754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0210"
FT                   /product="Adenine/guanine phosphoribosyltransferase related
FT                   PRPP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59619"
FT                   /protein_id="ABJ59619.1"
FT                   /translation="MKRSERLVDMVKYLLARPHTLIALPFFADRYGAAKSSISEDLAIL
FT                   RQTLANDQNGILETVAGAAGGVRYIPFVGKKEATNYLHDLADRIEDPDRILPGNFVYLS
FT                   DILGSPQDLQQIGQLIATKYAYSNVDYVMTIETKGIAIAQAVSRFLNVPFVMVRRRPKI
FT                   TEGSTISVNYVASSSERVEKMELAKRLLPEGSNVLIVDDFMKGGGTLTGMEELVKEFKG
FT                   TVAGMCVLCETKYASQKVVDDYQSLIKITEVDRTKKLIKVRPGNFLEQTDFNRFPK"
FT   gene            241802..243187
FT                   /locus_tag="LGAS_0211"
FT                   /note="LactoCOG number LaCOG01259"
FT   CDS_pept        241802..243187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0211"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.7.7.23"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59620"
FT                   /db_xref="GOA:Q046K2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046K2"
FT                   /protein_id="ABJ59620.1"
FT                   /translation="MNKYVVILAAGKGTRMKSQLYKVLHKVCGKTMVEHVVNAAKGTNP
FT                   DKIITVVGNGADSVKDVLAGQSDFAFQEQQLGTGDAVLAASDLLENLDGSTLVATGDTP
FT                   LFTAETFNNLFKKHEESGNSATVLTAKAPNPFGYGRIIRDEDGNVLRIVEQKDGTPEEL
FT                   AVDEINTGVFCFDNKELFKALKQVGNDNAQGEYYLTDVLEIMRKAGHKVGAYEMPDFSE
FT                   SLGVNDRIALAQATKIMQRRINEEHMKNGVSFIDPDTAYIDSDVKIGNDTVIEGNVVIK
FT                   GNTEIGSDCYITNSSRIVDSKIGNHVTITSSTLQEAQMDDNTDIGPNSHLRPKAVIRKG
FT                   AHIGNFVEIKKAEIGENSKVGHLTYVGDATLGKDINIGCGTIFSNYDGVKKFHTNVGDH
FT                   SFIGAGATIIAPVNIADHSFVAADSTITKDVARYDMAIARGRQTNKPDYWHKLPLSKDK
FT                   EWE"
FT   gene            243285..244268
FT                   /locus_tag="LGAS_0212"
FT                   /note="LactoCOG number LaCOG00564"
FT   CDS_pept        243285..244268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0212"
FT                   /product="Phosphoribosylpyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59621"
FT                   /protein_id="ABJ59621.1"
FT                   /translation="MEEIMSQLDKEIKIFALNSNKPLAEKIADKVGVKLGKSDVKRFSD
FT                   GEIQINIDESVRGKDVYLVQSTSAPVNDNLMELLIMIDAVKRASARSVNLVMPYYGYAR
FT                   QDRKTRAREPITAKLVADMLQKAGADRVLSLDLHAPQIQGFFDIPVDNLMGAPLLADYF
FT                   LSHELEKDAVVVSPDHGGVTRARKLAEFLKTPIAIVDKRRPKANVAEVMNIIGDVKGKR
FT                   AIIIDDMIDTAGTITLASQALMDAGATEVYASATHAVLSGPAIERLNNSPIKKLILTDS
FT                   INQPEEKDLSKAEIVSVGPLMGEAIKLIQEHKPVSPLFNTRFQSHN"
FT   gene            244421..245365
FT                   /locus_tag="LGAS_0213"
FT                   /note="LactoCOG number LaCOG01564"
FT   CDS_pept        244421..245365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0213"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59622"
FT                   /protein_id="ABJ59622.1"
FT                   /translation="MTTLSDVAKKASVSKMTVSRVINHPQQVTPELRKIVEQAMEQLNY
FT                   HPNSVASALAHHRTNVVKLVILEDIDTTEPYYMNLLFGIASGLGKKHYALQLATDSEVS
FT                   GGDGYIITGGRANDAKWLDQLNKPFVLFGENRYGYDFIDTDNKLGEQIATQYALDKNYQ
FT                   SIVFIGIDEKEPFEYSREAGYINTLQKHNMIPKIFRIQNHSSLAEKLIISNWKKFAPNT
FT                   CFICASDRIAVGVVRAIQRKNGNIPRDFGIIGFDGVFLDQVSNPKLTTIKQNLFKLGEL
FT                   LAEMILQKIQQGGAQQGEVLIEPELIKSESTRN"
FT   gene            245469..247127
FT                   /locus_tag="LGAS_0214"
FT                   /note="LactoCOG number LaCOG01565"
FT   CDS_pept        245469..247127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0214"
FT                   /product="alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59623"
FT                   /protein_id="ABJ59623.1"
FT                   /translation="MRHWYDRAIIYQIYPKSFQDSNGDGIGDLNGIRKRIPYLKELGVN
FT                   AVWLNPVFVSPQVDNGYDVSNYFAIDPKMGTMEDMDDLIKEMHEAGIHVIMDFVLNHTS
FT                   DQHPWFQDAIKNPDSIYRDYYIFAGKNNQRPNNWGSFFGGSVWEKDPAGTGQFYFHLFD
FT                   KRMPDLNWKNPEVRHAMSEIAKYWLEKGIDGLRLDAFIHIAKADLRQNFPVNSENEEPV
FT                   IAEPFFANLPQVQKWMRPFCEEIKQDYPDALLLGEAASANVNLAVDYTNKDNHLMDSVI
FT                   TFRYFTEDQSQIDPSFSAQYQPKSLDLVKFKQNQAVWQQTLSGVSKPTLYWNNHDMARI
FT                   ATRIAKNDIQARSLAMLMYLQNGLPIIYYGEELGMKNLEFEDATQFEDETVKEFIESAK
FT                   KAGKTSQEALLMASKTHKLPARGPMPWNNEKNNGFSDGNPWLKGKKVDYANAADEIADN
FT                   HSMFNFYKKLIALKKEALFEDGGYYLLPTSNDSYVYERNLEDQKALVAVSLSKDPIELD
FT                   VDPEFKQEKLVAGNYQLKDGKLKLAPYAGVVLEKD"
FT   gene            247138..248862
FT                   /locus_tag="LGAS_0215"
FT                   /note="LactoCOG number LaCOG01105"
FT   CDS_pept        247138..248862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0215"
FT                   /product="neopullulanase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59624"
FT                   /protein_id="ABJ59624.1"
FT                   /translation="MQLAALKHRTESEDCTVIDHSHVKIRLHTAKDDVKKVFVHYIDNY
FT                   LPPVDAATLEMKKAGSGQVNDYWTATLTAPYHRIKYTFEVIGNDGSHIIFGDRSIEKFS
FT                   DEKLREDGLYFKVPYFHDIDRIKTPAWLKDVVWYQIFPERFANGDKSNDPVNVKPWNPE
FT                   DHPGREDFYGGDLQGVLDHLDDLQRLGITGLYFCPIFKASSNHKYDTIDYLQVDPAFGD
FT                   KDLFAKVVNEAHKRGMKVMLDAVFNHLGDQSMQWQDVVKNGAKSRFKDWFHINSYPVEP
FT                   YRDPSKGEKNPPYETFAFEKHMPKLNTANPEVQDFLLEIATYWVKYFDIDAWRLDVANE
FT                   VDHHFWKRFHDELIKIKPDFYIVGEIWHSARPWLQGDQFTGVMNYPYTLQIEDHFFKHK
FT                   LDGKELSEHLTDQLMMYPDIVNQAMMNMLDSHDTARILTLANGNQDLALQAIAYEFVQP
FT                   GIPCIYYGTEMGMSGDNDPDCRKPMDWGKLNGPVWKRVYELVKFRLDHQDTLNQGDVKL
FT                   TVTENDLLKVERTGKETINAYYNTSDHDIKIDKKPSLSQNYEDGILAPDGFLVEVKA"
FT   gene            249010..251286
FT                   /locus_tag="LGAS_0216"
FT                   /note="LactoCOG number LaCOG01103"
FT   CDS_pept        249010..251286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0216"
FT                   /product="maltose phosphorylase"
FT                   /EC_number="2.4.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59625"
FT                   /protein_id="ABJ59625.1"
FT                   /translation="MMMKRIFEVDPWKVTTHEFSKEDKRLQESITAIGNDYMGMRGNFE
FT                   EGYSGDTLQGTYLAGVWFPDKTVVGWWKNGYPKYFGKTPNAPSFIGIGITVNGEKLDLA
FT                   KVKFSDFELSLDMHQGLLSRSFIYEGKDVKVKFEFERFLHIIQKEAALIKVKATVLEGH
FT                   AKIDFDSTLDGTVVNEDSNYDERFWIPLGEDKDRRTIQVKTKPNPYEVPQFTVLLKQAL
FT                   RHNGKALQGEVTTDEAKLSEKLSVELDQGQSYELEKDVIVVTSRDIEEKDQADVAEDFM
FT                   KKLQTKSFEENLAEHTATWKKRWETSDVEIDGDAAAQQGIRFNILQLFMTYYGEDERLN
FT                   VGPKGFTGEKYGGATYWDTEAFIVPMYLAITKPSVTKALLQYRHNQLPGAYHNAKEQGL
FT                   PGALFPMVTFNGIECHNEWEITFEEIHRNADIPHAIAMYTEYTGDDSYVKNEGMDVLVG
FT                   TARFWAARVHWSKWRNKYVMHGVTGPNEYENNVNNNWFTSTMARWLLKYTLERLPLATK
FT                   EAQERVHVTEEEKEKWQDIVDKIYLPEDKDLGIFLQQDDFLDKEIRPVSEIEDQRPINQ
FT                   HWSWDKILRSPFIKQADVLQGIYFFPENYTKEQKEKNFDFYEPLTVHESSLSPSIHSVL
FT                   AAELGKKDKAVELYERTARLDLDNYNNDTVDGLHITSMSGSWLAIVQGFAGMRYDHDQL
FT                   KFKLFIPDNWNHYSFKINYRGRLIEVYVDHQETKISLLKGEDLEILVNDQKVMLKEGET
FT                   ECLKA"
FT   gene            251271..251933
FT                   /locus_tag="LGAS_0217"
FT                   /note="LactoCOG number LaCOG00316"
FT   CDS_pept        251271..251933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0217"
FT                   /product="Predicted sugar phosphatase of HAD family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59626"
FT                   /protein_id="ABJ59626.1"
FT                   /translation="MLKGLIFDLDGVLTNSAVYHLTAWNNLAKELGINLTDEQLDSLRG
FT                   ISRMDSLNLILKYGGQENKYSEAEKEKFAEEKNTKFVEQVEKMTPADILPGIPELLSDA
FT                   KKQNLKMVIASASKNAPKILTKLGIMDEFDGIVDPATLHRGKPDPEIYEKAQKLLGLNA
FT                   NEVISFEDAQAGVQSIKSAGQFAVGIGDKEVLKEADYIVPTTKELKLSEIESVFNKK"
FT   gene            251954..253057
FT                   /locus_tag="LGAS_0218"
FT                   /note="LactoCOG number LaCOG00309"
FT   CDS_pept        251954..253057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0218"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family"
FT                   /note="TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59627"
FT                   /protein_id="ABJ59627.1"
FT                   /translation="MVEVDLNHIYKKYEGNDKYSVNDFDLHIKDKEFIVFVGPSGCGKS
FT                   TTLRMVAGLEDISKGTLEIDHKVMNDVAPKDRNIAMVFQNYALYPHMSIYDNMAFGLKL
FT                   RHYKKDEIDKRVKHAAEILGLSEYLDKKPSELSGGQRQRVALGRAIVRDAPIFLMDEPL
FT                   SNLDAKLRVTMRAEIAKLHQNLGTTTIYVTHDQTEAMTLADRVVVMSVGQVQQIGTPLE
FT                   VYNKPVNMFVAGFIGSPQMNFFNVHFKGNRISDGKGLNIEIPEGKAKMLKDKGYEDKDL
FT                   VFGIRPEDIHSEEAFLETWPNQTVKSTVVVSELLGSTIQLYQKVDGTEFVAIVNARDYH
FT                   TPGDKVEMGFDVNKAHFFDKDTTNAIR"
FT   gene            253114..254385
FT                   /locus_tag="LGAS_0219"
FT                   /note="LactoCOG number LaCOG00971"
FT   CDS_pept        253114..254385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0219"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59628"
FT                   /protein_id="ABJ59628.1"
FT                   /translation="MVHGCNNVFSLLWLGGNIMKLWKKLALGSVVALSAISLTACGKSS
FT                   NSNESKSSDKQLTLWVDTARVSWYKGVVKDFEKEHPNIKVKVTQNPNGSANAKTDVGKD
FT                   PSKAADVFGVPNDQLGQMADSGYINPLSPSDTKEIKKNSVPEAYKGAEWKGKLYAYPYA
FT                   EQAQTVYYDKSKLSPEDVKSWKTMTSKGVVATDFTNAYVMWPVMFSAGTKLFGDSGEEV
FT                   KGSTFDSQNGVNAMKWYAEQKNNKGVMQTSNALNQLKKGHAQAILDGPWNAANIKKILG
FT                   KNLGVAPYPTIELGGKTAQMEAFLGIECFAVNSHTSNAKNAAILAKYLSNKENQLIVHK
FT                   NAGEIPVNKAAQNTAEVKNDPVAKAVIQMAQPGYSVLQPKLPQMSIFWNDSAPLISGAY
FT                   DGKIKPSQYKTKLAKLQKSISKKE"
FT   gene            254422..255777
FT                   /locus_tag="LGAS_0220"
FT                   /note="LactoCOG number LaCOG01107"
FT   CDS_pept        254422..255777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0220"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59629"
FT                   /protein_id="ABJ59629.1"
FT                   /translation="MFKKKHATPAVTLKETWKDGDTVTKLTFFIMGLNAIKHRQWLKGF
FT                   SLLFSEIIFLIWFFLSGIHSIAGLSNLGAIKTKRVVFDKAQGVYVTQQPDNSVLILLFG
FT                   ILALFIVAGIIYLYIINLKSNKHTFLLEKRHEHIPTNREEIASLFDQRLHATLMTIPIV
FT                   LIILFTVLPTVFMISMAFTNYDRQHSIGFSWTGFQAFGNVLGGDLAGTFFPVLGWTLIW
FT                   AVAATATTFFFGVLLALLIESKGIKHKNLWRTIFVIVYAVPQFVSLLMMAQFLDYQGPL
FT                   NTLLMNWGWISHPIHFIDNQASPLVARITVIVVNMWIGIPVSMLTSTAIIQNLPQDQIE
FT                   AARIDGASPVQIFNHITFPQILFVMSPALIQQFIGNINNFNVIYLLTGGAPMNNNYNGA
FT                   GSTDLLVTWLYNLTFGQEQRYNASAVLGILIFIISATFSLIAYRHTNAYKEG"
FT   gene            255780..256637
FT                   /locus_tag="LGAS_0221"
FT                   /note="LactoCOG number LaCOG01108"
FT   CDS_pept        255780..256637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0221"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59630"
FT                   /protein_id="ABJ59630.1"
FT                   /translation="MKSYHNQRKIALIFRYVLLAILAVLWIFPIIWIILASFSYNNTGF
FT                   ISTIWPDKFTWQNYIGIFTNSQYPFVNWVLNTLFVAVISATLSTFVTIAVAYVLSRLRF
FT                   RFRKPFLQIALVLGMFPGFMSMIALYYILKALNMLNLGGLILVYVGGAGLGFYIAKGFF
FT                   DTMPRAIDEAAEIDGATKWQVFIHIGLPLSKPMIVYTALTSFMAPWVDFIFSGIILSTS
FT                   GNPKTYTVAYGLYNMVHSSKGMMAQFFTQFIAGCVVIAIPITILFIVMQKFYVNGITAG
FT                   ADKG"
FT   gene            256708..258324
FT                   /locus_tag="LGAS_0222"
FT                   /note="LactoCOG number LaCOG01104"
FT   CDS_pept        256708..258324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0222"
FT                   /product="Trehalose-6-phosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59631"
FT                   /protein_id="ABJ59631.1"
FT                   /translation="MTPWWKKAVIYQIYPKSFQDSNGDGIGDIPGIISRLEYLEKLGID
FT                   AIWLSPVYLSPGIDNGYDISDYQKIDPQYGTMKDMDNLIKEAKKHHIRIVMDLVVNHTS
FT                   DQHPWFVEAKKSQDNPYRDFYIWRDPVDGHEPNDLKSAFSGSAWKFDEKTGQYYLHFFA
FT                   DQQPDLNWKNPELRNKVYDMMNYWIDKGISGFRMDVIELIGKDPDQKIRENGPMLHPYL
FT                   KEMNEHTFANKDMMTVGETWNATPKIAEEYSDPARHELSMVFQFENQALDQEPGKEKWD
FT                   VRPLDLGELKKVLIKWQTEIDFNHAWNSLFWENHDIPRVISRWGNDQEYRVQCAKMFAI
FT                   ILHLMRGTPYIYNGEEIGMTNCPVKSIDEVEDIESINMYHERLEQGYKRADLINSINVK
FT                   GRDNARRPMQWSNEENAGFTSGNPWLKVNPNYQKINVKAALADLDSIFYTYQKLIKLRH
FT                   ENPVVVDGDFELVENTGDSVLAFWRKLGSEKWLIVANLSGDRQRFNLDNDFKEVLISNY
FT                   EKQDSLKNIILKPYEAFAVKA"
FT   gene            complement(258371..259735)
FT                   /locus_tag="LGAS_0223"
FT                   /note="LactoCOG number LaCOG00717"
FT   CDS_pept        complement(258371..259735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0223"
FT                   /product="HD superfamily phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59632"
FT                   /protein_id="ABJ59632.1"
FT                   /translation="MEKFQSKKLDHEKVLRDPVHNYIHVKDKVILDIINSKEFQRLRRI
FT                   KQLGPASYVFQGATHTRFEHNLGVYELTRRICDIFEEKYTSKEPGDGLWDPNERLLAEC
FT                   AALLHDIGHGPYSHTFEHLFGTNHEKMGQQIITDKSTEVNQALRQVSPNFPELVASVIA
FT                   KTYSNPQVVKLISSQADADRMDYLLRDAYFTGVTYGSFDLTRILEVIRPYRDGICFTDK
FT                   GIHAVEDYIISRYQMYQQVYFHRVNRSMEVILHHLLERAQIIYEAGKLQVTPQLEAFLK
FT                   GNWTLEDYLNLDDGVMETNFLLWTNSGDQILSDLSSRYLYRHPLESVKINEDTKSLLPK
FT                   LKNLIKQAGFDPNYYTATNSAFDEPYDAYKPIGKNAHSPIEIMQADGSLVELSELSPLV
FT                   KSLNGTLQGDERFFFPKVMVKETDEPQIFDPIYQEFQKYIRNNTLRYLRRPNKKK"
FT   gene            259833..260270
FT                   /locus_tag="LGAS_0224"
FT                   /note="LactoCOG number LaCOG01620"
FT   CDS_pept        259833..260270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59633"
FT                   /protein_id="ABJ59633.1"
FT                   /translation="MKVKIMNKEVEIKITSEIHQEDDSAVFEREGLGSLEKIGNNWRLK
FT                   YNEKNKAGDVEVKLLIKPNELVMQRGDIKGDHTLMKFEPGEKQECKVMAAGKQMDLVSL
FT                   TNKLDFSKISPGKMQLKVEYDLFSGLYLVGNYAIKIEVTDL"
FT   gene            260293..260853
FT                   /locus_tag="LGAS_0225"
FT                   /note="LactoCOG number LaCOG00427"
FT   CDS_pept        260293..260853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0225"
FT                   /product="DNA-directed RNA polymerase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59634"
FT                   /protein_id="ABJ59634.1"
FT                   /translation="MKGRATVGLDDFKGQNKDELSMIEVARAILQDSGKRMAFADIVNA
FT                   VQNFLGKSDEEIRERLPQFYTDMNTDGEFISMGDNVWALRSWFPYESVDEEVNHPEDED
FT                   DVPRKKHHKKVNAFIGDSDDDDIIDYDSDDPEDEDLDVDDDDNNEDDYSDDDLDDADDN
FT                   ELDDGIEGQLSELHQDDLDDDDD"
FT   gene            260941..262605
FT                   /locus_tag="LGAS_0226"
FT                   /note="LactoCOG number LaCOG00334"
FT   CDS_pept        260941..262605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0226"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59635"
FT                   /protein_id="ABJ59635.1"
FT                   /translation="MILTKNKRKERKHGMTKYIFVTGGVVSSLGKGISASSLGRLLKNR
FT                   GLKVTMQKFDPYINIDPGTMNPYQHGEVYVTDDGTEADLDLGHYERIVDVRTSKYSNVT
FT                   TGKIYQEVLDKERRGDYHGATVQVIPHITDMIKKKIMRAALTTDSDVIISEIGGTVGDI
FT                   ESTPFMEAIRQMRREVGEENVMYIHCTLVPYLHAAHEMKTKPTQHSVAELRSIGIQPNM
FT                   LVLRAEKPVPQDLKNKISTFTDVPVDRIIESIDAPSLFDLPLAFQAQGMDQKVCDFLHL
FT                   ESPKPEADMEAWKKLDERAKNLKHETTITLVGKYVELEDAYISVTDALQHAGYLYDTKI
FT                   KVNKVQAEDITEDNIAEIMKGSDGLIVPGGFGTRGLEGMITSIKYAREHDIPFLGICLG
FT                   MQMASVEFARDVLGLKDANSAEADPETKNNIIDIMADKRDEENIGGTLRLGLYPATLKK
FT                   GTKTRAAYDDQDVIQERHRHRYEFNNDYREAFEKAGMVFSGVSPDNHLVEIIEIPDKKF
FT                   FIAAQYHPEFLSRPQRPEGLFKAFIGAASGLPAQHFN"
FT   gene            262739..264004
FT                   /locus_tag="LGAS_0227"
FT                   /note="LactoCOG number LaCOG00220"
FT   CDS_pept        262739..264004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0227"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59636"
FT                   /protein_id="ABJ59636.1"
FT                   /translation="MKQMIIHGGKPLKGDVWIGGAKNSTVALIPASILSRTPVTLEGVP
FT                   RIADVDNLMDLLSEMDVKCDFHETTLRINPDDIKRSPLPAGKIKSLRASYYFMGALLGR
FT                   FGKAVVGFPGGDDIGPRPIDQHIKGFEALGATVENENDQIIITAPKTGLRGAKIHLKMP
FT                   SVGATMNIIMASVMAKGQTIIENAAKEPEIIDLATFLNNMGAVIRGAGTDVIRIEGVEE
FT                   LKAQTPHTIIPDRIEAGTYVALAACIGDGIRIHNIIEEHLDSYLAKVEEMGVVIDADED
FT                   SLYVYPAGDLKMVQVKTDVYPGFATDLQQPITPLLLTAKTGEGVVIDRIYPKRVGHIPE
FT                   LQKMGANIQVEDNIILVHPTHHLHGAHVSAGEIRAGACLMLAGLMADGETIISNAGNIL
FT                   RGYDRIEQKLRQLGAEVSVIDV"
FT   gene            complement(264080..265408)
FT                   /locus_tag="LGAS_0228"
FT                   /note="LactoCOG number LaCOG00771"
FT   CDS_pept        complement(264080..265408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0228"
FT                   /product="Xanthine/uracil permease"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59637"
FT                   /protein_id="ABJ59637.1"
FT                   /translation="MKHMQVNHKKAALLGLQHLLAMYSGAIAVPLLIGTALKFNSTQMT
FT                   YLVSIDIFMCGLATALQLLRNRYFGIGLPVVLGCAIQAVAPLQMIGKKFTIGTMYGAII
FT                   VAGIFVFLVAGYFSKIKKLFPPVVTGSLITVIGLSLIPVSIQNLGGGNSAAKNFGDPKN
FT                   LLTGFITVAIILALQVWGRGFIKSIAVLVGLIAGTLIASTLGMVSLTPVAQASWFHLPQ
FT                   PFYFGMPQFEWSSSLTMIIIALVSMVESTGVFFAIGDLLHKDISSDDLKKGYRAEGLAQ
FT                   ILGGVFNTFPYTTFSQNVGLLELSGITTKRPIYWASGFLMLMGLLPKFGALVTIIPDSV
FT                   LGGAMLVMFTMIAVQGMRMLKRVDFDDTRNILIVAISIGLGLGVTVYPQVFQSLPETIQ
FT                   LFLGNGIVVASLSATILNLLFKGKSGLEEQHIPAAPEKIEVQH"
FT   gene            complement(265409..265987)
FT                   /locus_tag="LGAS_0229"
FT                   /note="LactoCOG number LaCOG00770"
FT   CDS_pept        complement(265409..265987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0229"
FT                   /product="Adenine/guanine phosphoribosyltransferase related
FT                   PRPP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59638"
FT                   /db_xref="GOA:Q046I4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010079"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046I4"
FT                   /protein_id="ABJ59638.1"
FT                   /translation="MKLLEERIRKDGEVLDGDVLKINSFLNHQVDPELMMQVGEEFKRL
FT                   FENEKITKVLTCEASGIAPGIMAAYQLGVPMVFARKKKPSTLNDAVYWADVFSYTKKVN
FT                   NKICVEKKFLSSDDHLLIIDDFLAHGEAVKGMLNIAKQANAAVAGVGVVVAKEFQGGSD
FT                   WVKEHGYRLEALARISNFENNQVHFVGEK"
FT   misc_binding    complement(266058..266157)
FT                   /bound_moiety="guanine"
FT                   /note="Purine riboswitch"
FT   gene            complement(266202..266987)
FT                   /locus_tag="LGAS_0230"
FT                   /note="LactoCOG number LaCOG02315"
FT   CDS_pept        complement(266202..266987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59639"
FT                   /protein_id="ABJ59639.1"
FT                   /translation="MIIMSNENYISYSATQDFLSARRRSSTLIASGVMLCIFSPIVLLL
FT                   LISFTRLDILTWSINFATGIGVIVLLAFIAAAVALFIAGNRWLKVHENYEYEDCNLSNK
FT                   LREKIIKENKVYENQHMIFKIIGITFCILSAIPLMSGALFVDALASSRLDDLMTGLSSV
FT                   TLLLVGIGVFFLVKTNIIHDSFNIILQLDDYTSEKKAGKKLIEKYATIYWMVISFIYLA
FT                   YSFMSNNWSQSWIIWPLAGIAYGIFETVMSLKKKKAISE"
FT   gene            267163..268716
FT                   /locus_tag="LGAS_0231"
FT                   /note="LactoCOG number LaCOG00967"
FT   CDS_pept        267163..268716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0231"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59640"
FT                   /db_xref="GOA:Q046I2"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046I2"
FT                   /protein_id="ABJ59640.1"
FT                   /translation="MAKTNLNDFDKIIVLDFGSQYNQLITRRIRDFGIYSELLPHDLSI
FT                   EKIKKMAPKGIIFSGGPNSVYDEGALKVDPEIFKLGIPILGICYGMQLMSYDLGGKVEK
FT                   ADNSEYGRADIEVTDPNAVLFEGLPKEQYVWMSHGDLVTKAPEGFKVTAKSKNCPISAI
FT                   ANDEKKFYGIQFHAEVRNSEYGLDILKNFAFNVCDAKANWTMDDFIEMQVDEIREKVGD
FT                   KKVILGLSGGVDSSVTATLLHKAIGDQLTAIFVDHGMLRKDEGDQVMQALNKDLGVNII
FT                   RVNAQKRFLDKLKGVTDPEQKRKIIGKEFIEVFNEEAKKLKDVDFLAQGTLYTDVIESG
FT                   TNTAQTIKSHHNVGGLPEDMHFELIEPLRKLFKDEVRELGEKLGIPHDLVWRQPFPGPG
FT                   LAIRVLGEVTEDKLKIVRESDAILRDEIKKAGLQEDIWQYFTVLPGIRSVGVMGDGRTY
FT                   DYTIGIRAVTSIDGMTADFAKLPWDVLSKISTRIVDECDHINRVVYDITSKPPSTIEWE
FT                   "
FT   gene            complement(269229..269330)
FT                   /locus_tag="LGAS_0232"
FT   CDS_pept        complement(269229..269330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59641"
FT                   /protein_id="ABJ59641.1"
FT                   /translation="MLELLEEVLFAQPVKPTVRSAIAPKNNCFLKFI"
FT   gene            269440..269781
FT                   /locus_tag="LGAS_0233"
FT   CDS_pept        269440..269781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59642"
FT                   /protein_id="ABJ59642.1"
FT                   /translation="MLQNGHTLWYYQTKNHNDGSKNDSGNWHYEGHNKFSITLTHRDDN
FT                   NQEVNTNANLLLEGKKLTMTEKNGQNKQVFTKTSNEAKEYDEIFNPGKKVDSDDPSTSA
FT                   NKDDQSSNN"
FT   gene            complement(269839..270843)
FT                   /locus_tag="LGAS_0234"
FT                   /note="LactoCOG number LaCOG00006"
FT   CDS_pept        complement(269839..270843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0234"
FT                   /product="Transcriptional regulator, xre family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59643"
FT                   /protein_id="ABJ59643.1"
FT                   /translation="MRLGQKIADLRKKNNLSQEGLAEKMNVSRQAVSKWESEQSIPDIE
FT                   KIVNLSELFGVTTDYLLKSGEPSFELKNEDINDKDKLPVLSDELVKKYLAASQKSSKLR
FT                   ALAIALIIFSPVWLCFACILSIFFDHDSHYETPLTFTISLSGYVAAIITIAIALGLFIY
FT                   SLLNMREFKQIKKQHFDLTEERKKLEFTIKLFHQNNDKYVVFASILAVLSIIGPMINWF
FT                   SNFSSSSIGFIITWGITFIIFSSASYLFTFYLFQRNYLSTLIKHKKHLPIKLHRLFVYG
FT                   SWIYVFCVLGIFYITTRLPYGLYIPFFNPTLFVYLSITVYCLFTYFFIKEKAE"
FT   gene            271013..271279
FT                   /locus_tag="LGAS_0235"
FT   CDS_pept        271013..271279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59644"
FT                   /protein_id="ABJ59644.1"
FT                   /translation="MGGNLMDFLKDNKTAKVFKAGNSEAIRLTKQDTAIFKVKPGDQVI
FT                   KEVSPDGMSITFKKMPEVSEDVKKEVSDILNEDADLIQALKDL"
FT   gene            271281..271688
FT                   /locus_tag="LGAS_0236"
FT   CDS_pept        271281..271688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0236"
FT                   /product="Prophage maintenance system killer protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59645"
FT                   /protein_id="ABJ59645.1"
FT                   /translation="MEYRYLSSSDLIYVNKRVLEFTGEKQEVIQYPEGLSVIIEQPQMV
FT                   LFGHELYPSLWLKAAFVLQKSTKKHIFTDGNKRTAYVVTKLFLKLNGYSLKVSKSQGIA
FT                   LMLSVTTSADSEEIMQKVAIFLQKNSVRINK"
FT   gene            272275..272802
FT                   /locus_tag="LGAS_0237"
FT                   /note="LactoCOG number LaCOG02316"
FT   CDS_pept        272275..272802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0237"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59646"
FT                   /protein_id="ABJ59646.1"
FT                   /translation="MNTQDKLVGKTITVIDKYGYQNLSLRKLTATLGLTTGAFYKHFKS
FT                   KDALYEKVAIELSRNFIDKISLPDNATAQEKLLIIAKNFCQYVDQHNNLAEFLFFNSTT
FT                   LKVFSTKKSKYDFLDKMKVLVNELNPKKNVSNQDLFIQIWSFIQGYAALVNKKIVEYDE
FT                   DLVKRTLDEFLQ"
FT   gene            272818..273399
FT                   /locus_tag="LGAS_0238"
FT                   /note="LactoCOG number LaCOG02317"
FT   CDS_pept        272818..273399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0238"
FT                   /product="Putative NADPH-quinone reductase (modulator of
FT                   drug activity B)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59647"
FT                   /protein_id="ABJ59647.1"
FT                   /translation="MDCLIIYCHPYDKSFNHAVLENVGNNLRQNNKDYKLIDLYKDGFV
FT                   PIYDLEEMRLFHTGQTHDPLVKKYLSWLKETPEVIFITPFWWNGIPGMLKGFIDKVMKE
FT                   GQGLSHTVTKTGIHGELTNVKHTYVFTTSTSPTFYLKLFLGNGIKKIFVNKTLKQLGMQ
FT                   DRHWYNFGGVSTSSVGRRKKYLDKIAKMNL"
FT   gene            273544..273957
FT                   /locus_tag="LGAS_0239"
FT                   /note="LactoCOG number LaCOG01842"
FT   CDS_pept        273544..273957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59648"
FT                   /protein_id="ABJ59648.1"
FT                   /translation="MIKGELTIIFDDPFYKAIFERIDGTNYEVAQVNLGASLPHMPEIL
FT                   KLVNFHYSKLHFYQTTVEKEKIYHVNPKRAQRLAHKVTQKKIIGTKAQQALKKQFEQSK
FT                   IAKKKANKDRKRKEQEKRFFQKQAKRREKHRGH"
FT   gene            274049..274237
FT                   /locus_tag="LGAS_0240"
FT   CDS_pept        274049..274237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59649"
FT                   /protein_id="ABJ59649.1"
FT                   /translation="MQPALRAVVLNVNFCDERYSITGQSYTLSGVFIFCGGRYRLAKLA
FT                   QTYQTKALKNAFVNRHG"
FT   gene            274398..274919
FT                   /locus_tag="LGAS_0241"
FT   CDS_pept        274398..274919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59650"
FT                   /protein_id="ABJ59650.1"
FT                   /translation="MGVFCVIRIRNKIFSRRGKMMKYIKKMFTDPNMYNEVEFSKKIHE
FT                   DNVLLKIMQEILPEERIVSVGFRFPEDKDNRNIFAKTSDGETIIIGLLVADKETWPSGL
FT                   NYFQNMLKDEVYRFMRNELLLCRTYFILLTPVDPWKNGREKYTISFRNEQSEELTEMLK
FT                   SRLVVVCPEN"
FT   gene            274977..275279
FT                   /locus_tag="LGAS_0242"
FT   CDS_pept        274977..275279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59651"
FT                   /protein_id="ABJ59651.1"
FT                   /translation="MILLMRKGERMLYPYAEFPGRLIVTYTQPLKDKNGAVKVEVNFEL
FT                   PTDDGFSEARYTLPDYSCLYNDGFTPSETKRNEKILHNNAKLILAAAREKEETNA"
FT   gene            275272..275553
FT                   /locus_tag="LGAS_0243"
FT   CDS_pept        275272..275553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59652"
FT                   /protein_id="ABJ59652.1"
FT                   /translation="MPNYFTYAGYKLYFWSNEGDEPIHVHVTKGHPNPASTKFWILEDG
FT                   TVQMANNKAELSKKDLKKITAFLEANIDEICDTWKDYFRLDKISFYKD"
FT   gene            275687..276100
FT                   /locus_tag="LGAS_0244"
FT                   /note="LactoCOG number LaCOG01842"
FT   CDS_pept        275687..276100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59653"
FT                   /protein_id="ABJ59653.1"
FT                   /translation="MIKGVLTIVFDEPFYKAIFERIDGNSYSVAQVNLGTSLPRMPEII
FT                   YLVNRKYSKLNFYRTTIENRADRHINPKRAQRLAHTATQQKQIGTKAQIALKKQFEESK
FT                   IIKKMSVKENKQLEKERKFLKKQAKKREKHRGH"
FT   gene            complement(276773..277291)
FT                   /locus_tag="LGAS_0245"
FT                   /note="LactoCOG number LaCOG00347"
FT   CDS_pept        complement(276773..277291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0245"
FT                   /product="Methylated DNA-protein cysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59654"
FT                   /protein_id="ABJ59654.1"
FT                   /translation="MKTISYYNSPIGKILLASDEQGLVGLWLDTDRYYGDILAKNYSEG
FT                   ENEYLVSAKKWLDIYFQGKEPTFTPQLHFTGTDFQKRVWQALLKIPYGTTITYKKIAVQ
FT                   VAKDKEHLPIRATGGAVGRNHICIIVPCHRVVGVNHNLTGYAAGIDKKIKLLRLEGVDI
FT                   SQFKNHINH"
FT   gene            complement(277380..277907)
FT                   /locus_tag="LGAS_0246"
FT                   /note="LactoCOG number LaCOG03219"
FT   CDS_pept        complement(277380..277907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59655"
FT                   /protein_id="ABJ59655.1"
FT                   /translation="MDILVMKDNYTIDHDMYLMNHKNGDVLKVTVDNKDKSLKNLQLYR
FT                   QDGLGNYYYDKNSQLKHQDNLATKKDIVKASKEIGAHNTHHIDKWHHKVTPVYNAEHKI
FT                   TDFEPKLALEHHAKIKNAKRYLRHLNHHHADFLFLANKGLLRQPLNYLKDAIYTDRNKE
FT                   MVIAHKVHKIAK"
FT   gene            complement(278099..279457)
FT                   /locus_tag="LGAS_0247"
FT                   /note="LactoCOG number LaCOG03229"
FT   CDS_pept        complement(278099..279457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0247"
FT                   /product="Predicted acyl-CoA transferase/carnitine
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59656"
FT                   /protein_id="ABJ59656.1"
FT                   /translation="MSENEKNEQNEYAPLKGIKIVDWTQVQSGPSCTQLLAWLGADVIK
FT                   IERTNTGDPTRNELLDIKDSWSLYYLQLNANKRSLTLDIKTPEGKKIMYDLAKKADVFV
FT                   ENIAPGSADRNGFGWEKLHSINPRLIYASLKGFNEGSRFENVKAFEPVAQAAGGSASAT
FT                   GWNKGVNNVPTQSAAALGDSNTGMHLAIGILAALLQREHTGEGTFVYQSMQDAVLNLCR
FT                   IKLRDQLMLDNLGALPHYAVYPNWKWGKAIPRAENTEGGQVIGWTYKAKGWETDPNAYV
FT                   YIVIQNENKKWDKMCEAMGHPEWEKDPRFVDWQHRQLHKEELYPLIEAYTKQYDKYTLT
FT                   KELGAAGVPVGPVLDWHELENDPDLNSDGTIVTIDQGGNRGKFKTIGLPFSLSNYKPAY
FT                   DRAPDLGENNKEILTELGYDADQIEDLVNKGVISKAKGPKNPRVHVIIDGKEH"
FT   gene            complement(279463..281199)
FT                   /locus_tag="LGAS_0248"
FT                   /note="LactoCOG number LaCOG00801"
FT   CDS_pept        complement(279463..281199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0248"
FT                   /product="Acetolactate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59657"
FT                   /protein_id="ABJ59657.1"
FT                   /translation="MVDDSLNRTGASLLIDALQKNGINNLYGVVGIPITDLARLAELRG
FT                   MKYYGFRREDSAVDAAAAAGFLTKKPGVAMTVSAPGFLNGLTALAQATKNCFPLIMISG
FT                   SSERHIIDLAQGDYEGLDQYNVAKPFCKKAYRVDRAQDVGLAVARAIRTAVSGRPGGVY
FT                   LDLPADTIAQLNDDLGEKNMGVYKLVDPAPLQEPSDDAINRAVDIIKQAKKPLIILGKG
FT                   AAYDRTEKQVQELINKTDIPFLPMSMAKGLVPDDDKHSAAAARSLSLKNADVVILIGAR
FT                   LNWMLSYGDAPQFNPEAKFIQLDIDATQFDSAQKISAPLQGDLTSILNKLVPALTATGY
FT                   KVPSDWLDAIAQDTAKNDAKFAKRIKAGETNPEFGYYGAIEPINDYFQEHPDTYLVSEG
FT                   ANTLDIGRDMIGMKLPRHRLDTGTWGVMGVGMGYAIATAVETGKHVVALDGDSAFGFDG
FT                   MDVETMCRYNLPITVVVINNGGIYNGVDNVVPDQLGPTTLDPTGRYDLIAKAFGGDNYY
FT                   VTNYQEMKDTFATAVESGRPSIINVQIDPSMGKESGHIGNLNPELNLKPLEEAEQKKID
FT                   KE"
FT   gene            281556..282737
FT                   /locus_tag="LGAS_0249"
FT                   /note="LactoCOG number LaCOG02033"
FT   CDS_pept        281556..282737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0249"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59658"
FT                   /protein_id="ABJ59658.1"
FT                   /translation="MISILVNDIIPILVIMLLGYLCGKFYFFDNDQRQGLNKLVLDIAL
FT                   PAALFISIVKATRKMFAQDIVLTLISIVGVVGLFMLSYYLDKLLFHRTTQQAAVCALIA
FT                   GSPTIGFLGFAVLDPIYGNNATTNLVIGIVSIVVNAITIPLGLALINKGQTLTKKKANA
FT                   NPNNKGTKVEVEDIKGKGLNKTKKKVVVTIPDGVPVTDAEAKALKEKGIEREIDLARAE
FT                   IADHADEPHQPMNPTLKSVINAIKQPVAAAPLIAVILVLIGIRIPTSWAPTFDLIAKAN
FT                   AGVAVLAAGLALSTVKFSIDKEVIWNTFFRLFLTPAVIVAAAYLCGMGSDPTKISMLCL
FT                   ATGLPPAFSGIIISSRYNIYVKEGASSVAVSTVFFAVSCIFWIWLLPILAHMF"
FT   gene            282800..283063
FT                   /locus_tag="LGAS_0250"
FT                   /note="LactoCOG number LaCOG03220"
FT   CDS_pept        282800..283063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59659"
FT                   /protein_id="ABJ59659.1"
FT                   /translation="MIDNKNLLKILRTELRKMSDRKRLKFLTYKKDRSITVEKTGDSFE
FT                   VIENGYRKIAWHNLTEAEVLKQIKKVQKIEFPRSNKLYLVRN"
FT   gene            283220..284528
FT                   /pseudo
FT                   /locus_tag="LGAS_0251"
FT   gene            complement(284613..285329)
FT                   /locus_tag="LGAS_0252"
FT                   /note="LactoCOG number LaCOG01276"
FT   CDS_pept        complement(284613..285329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59660"
FT                   /protein_id="ABJ59660.1"
FT                   /translation="MKNNNKKFILIPLLSSLVILLSACSIIVSDHNDSKPEIRTTISNQ
FT                   GFNKLAVSVAISDISVKYGDKYKVEYAGPKNLKPIVNRKNGVLTIKQSASGVHHVNSDL
FT                   TIAITVPKQLLKNVTLSTNDGDIEVENIATTNSISVATNDGDIDITNLRAPNGKINTND
FT                   GDININKLISKNGFKVNTDDGDIKVSNSSFTGYRLDTSDGDIKVKDSSSSSTFIENKNS
FT                   SNVLIASTQDGDIKIK"
FT   gene            285412..285864
FT                   /locus_tag="LGAS_0253"
FT                   /note="LactoCOG number LaCOG03222"
FT   CDS_pept        285412..285864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59661"
FT                   /protein_id="ABJ59661.1"
FT                   /translation="MKKLPPIQKILEAYTAIVDKHVNLTKDQAEVASSNGAKTYTVNWD
FT                   DNEYHSNDNATYWQGYAGYPVIAVLMLQGKLPFNQKLADNFKSVNWNEINSKFKRNYAK
FT                   AATEVIKKKGLDENEVMAELGAVYEDLKKLPITIKRGSLRPPKARK"
FT   gene            complement(285888..286370)
FT                   /locus_tag="LGAS_0254"
FT   CDS_pept        complement(285888..286370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59662"
FT                   /protein_id="ABJ59662.1"
FT                   /translation="MKNKSKKIKRKHNMQGTYESVKVIGTFHRYGIQQSVDSNGTFYYR
FT                   PVVYMQDCQDLSNTDLKLPEYLLFNLTKGFKSLGILNPGTKLEINCRHYLKEERNAGYG
FT                   YPTNIVIANNRPDFPDDPNVLAGMIMVKNQDNPEAEKDPINTDLIQIYKKWLENKE"
FT   gene            complement(286490..287905)
FT                   /locus_tag="LGAS_0255"
FT                   /note="LactoCOG number LaCOG00171"
FT   CDS_pept        complement(286490..287905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0255"
FT                   /product="dipeptidase A, Cysteine peptidase, MEROPS family
FT                   C69"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59663"
FT                   /protein_id="ABJ59663.1"
FT                   /translation="MKQTECTTILVGKNATIDGSTMIARSEDGGRTIIPERFEVVMPKD
FT                   QPKHYESVISHQKIDDADLLSNPLRYTSAPDASGKNGIWAAAGINSDNIAMTATETITT
FT                   NSRIQGIDPLLEEGGLGEEDFVTLTLPYIHSAYEGVERVGYLLEKYGTYEMNGMAFSDK
FT                   DEIWYLETIGGHHWAARRIPDDAYVIAPNRLNIDEFHFDDDDFASSKDLKNLIEEYHLN
FT                   PDLEGYNLRHIFGSSTIKDAHYNNPRAWYIHNYFDPDFGGEPSDQNQPFICHANRKISI
FT                   EDIKWAESSHYQDTPFDAYGDQGSAEQKKTFRPIGINRNFETHILQIRNDVPEKIAGVQ
FT                   WLAFGPNTFNSMVPFYTNITTTPASFQTGPKFDLNKIFWLNKLTAQLGDINFRVYGELE
FT                   ADFEQKSLAQCHKIQHETDKEAKKYSGDELQDKLNEANQKMADTVYDNTVELLGNMVNE
FT                   GHGLMTLKYDLLD"
FT   gene            288055..289290
FT                   /locus_tag="LGAS_0256"
FT                   /note="LactoCOG number LaCOG00400"
FT   CDS_pept        288055..289290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0256"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59664"
FT                   /db_xref="GOA:Q046F8"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046F8"
FT                   /protein_id="ABJ59664.1"
FT                   /translation="MNYGEKAPALWDAIKNEEKRQEDTIELIASENIVSDAVREAQGSV
FT                   LTNKYAEGYPGKRYYGGCQYIDQVEQLAIDYAKKLFNAEYANVQPHSGSQANMTVYNAL
FT                   LKPGDTILGMGMDAGGHLTHGSKVNFSGKIFNSVSYDLNPETEELDFEKIRQIALENKP
FT                   KLIIAGASAYSRIIDWQKFREIADEVGAYLMVDMAHIAGLVATGAHPSPIPVADVVTTT
FT                   THKTLRGPRGGMILSNNKKLGKKIDSALFPGTQGGPLEHVIAAKAQAFYEDLQPEFSTY
FT                   IEQVVKNAQAMADEFKKSENIRVVSGGTDNHLMIVDITKTGVTGKDAQNLLDSVNITTN
FT                   KESIPGDTRSPFITSGLRIGTPAITSRGFKENDAREVARIIIKVLDNPEDKDVLTEAKS
FT                   SVKSLVDKHQIK"
FT   gene            289414..291645
FT                   /locus_tag="LGAS_0257"
FT                   /note="LactoCOG number LaCOG02055"
FT   CDS_pept        289414..291645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0257"
FT                   /product="Alpha-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59665"
FT                   /protein_id="ABJ59665.1"
FT                   /translation="MIDVIDNKYFYLHNGAVAYLFGLLPNHQLEHLYYGEDLGELSKND
FT                   LEYMSLHPNKASGTVKYSKKIKNFTLADRMQEFPTYGTSDFREGAVSIENEGAYLYPDF
FT                   KYDHFEITTGKKRNLDFPTSYGNDSENLIVSLIDTDHQLELQLSYSIFENWSAIVRKAT
FT                   IINHGKQEVKLTNLQSTVLDLPNDSYDFLQLSGAWTKERHITTRPLTQGITKIESLRGA
FT                   SSHQENPFIALVDKNVTNDSGNIYASNLIYSGNFISQVEVDEWGQSRLMTGINPATFKW
FT                   KLAPNQDFSTPEAVLFYSKQGFNGLMKQTHNFVKKHIIDQKWQQRDRLIVINNWEATYF
FT                   DFNEEKLLKLAAQANQLGIECFVLDDGWFGKRDSDNSSLGNWTVDKRKFPQGLDHFSAQ
FT                   VHKMGMKFGLWFEPEMVSADTELYNMHPDWVVRHPYKRYSVGRRQYVLDFANPAVVDNI
FT                   YQQMAKIIEDAQVDYIKWDMNRNITEAYSPYLYSINHPQGEIFHRYIQGVYKLYAKLLT
FT                   SFPDLLIEGCASGGGRFDLGILYYSPQIWPSDDSDAVERLDIMSGTLLAYPLSTFSNHV
FT                   SAVPNDQVKRITSLKFRQNVACFGPLGYELDLNKLSTEEKNQIKNWIRWYKENRKLLVN
FT                   GTFDQLLKFDPSQNTYAWSVSNSNKQIVGFYRKLARPNETLDQYLPLKHLNDHQKYQIN
FT                   FDQMVSGRVLQKFGLREPYQFNASNPDTAQISGDFQSYLYQIKTIDRKI"
FT   gene            291854..292897
FT                   /locus_tag="LGAS_0258"
FT                   /note="LactoCOG number LaCOG01915"
FT   CDS_pept        291854..292897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0258"
FT                   /product="ABC-type uncharacterized transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59666"
FT                   /protein_id="ABJ59666.1"
FT                   /translation="MIGICMESDSYFLWGKIMKRMYGLIAILITFLAVAFFTENREQEA
FT                   DKKVPQVGVLTLMHHPALDEIYRGFKAELKEAGYIDGKNIKIDYQNANNDQSNLRTMAT
FT                   KLTDEQSKVLVGITTPAAQALANSTSKTPIVLGAVTNPKASGLVKNERHPESNVTGVSD
FT                   AAPIKQQLDLIKEFMPNLKTLGVIYTSSDSSAVSGFHEIEQECKRRKINLKVFSIANSN
FT                   DLNQVSEQMFRQVDAAIVPTDNTIAGAMETLVKNGNAAKKPIFPAAATMVKQGGLATYS
FT                   VNQYKLGQMTGKMTIAILKGKRVSSLPVERVQKGEPVVNLKEAKELNLQAPQRFLKECQ
FT                   RNGVVYR"
FT   gene            292867..293793
FT                   /locus_tag="LGAS_0259"
FT                   /note="LactoCOG number LaCOG01073"
FT   CDS_pept        292867..293793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0259"
FT                   /product="Ribose/xylose/arabinose/galactoside ABC-type
FT                   transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59667"
FT                   /protein_id="ABJ59667.1"
FT                   /translation="MSKKWGCVQMNLIVSAIGQGLLWALLGLGLYLTFRILNFADMTVE
FT                   GTFPLGAAVAVANLAHGMSPYLATFLALLAGMLAGLVTGLLYTKGKIPILLAGILTMTA
FT                   IYSINLRIMGGSNISLIGKKTLLNNEFLRSLPQYFNSVVLGIIVVVIITGILVFFLNTD
FT                   FGQAFIATGDNPKMAKSLGIYTDSMIIIGLMLSNGIVALCGALIAQNNGYADINMGIGT
FT                   IVIALASIIIGEVAFGELTLNQRLVAVTLGSIIYRLILLAVLQLGFSANDLNLISSIVL
FT                   ALCMMLPQLEKIVHLKKPIEKGVKKHD"
FT   gene            293786..294550
FT                   /locus_tag="LGAS_0260"
FT                   /note="LactoCOG number LaCOG01916"
FT   CDS_pept        293786..294550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0260"
FT                   /product="ABC-type uncharacterized transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59668"
FT                   /protein_id="ABJ59668.1"
FT                   /translation="MTKPILELKDVKTTVKTADGEIVPILKGIDLKIKAGDFITIIGTN
FT                   GAGKSTLLNTIAGSLRPDSGFLLHNGLDITKMSEEKRTQFIGRVFQDPKLGTAPRMTVA
FT                   ENLLLATKRGKRRFLRIRKLKQNLPRFKKLAAVMNNGLENRLNTFVEGLSGGQRQALSF
FT                   LMATIERPDILLLDEHTAALDPHTSENLLAVTDQQIKENKLTALMITHHMEDALKYGNR
FT                   LLVLKDGKVKADINEREKQNLKVGDLYKYFED"
FT   gene            complement(294586..294750)
FT                   /locus_tag="LGAS_0261"
FT   CDS_pept        complement(294586..294750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59669"
FT                   /protein_id="ABJ59669.1"
FT                   /translation="MAADPDPKSHPDPINELRASIIAENKLILCLLLFTASPIFIIKYM
FT                   LKTIKNYFN"
FT   gene            294773..296248
FT                   /locus_tag="LGAS_0262"
FT                   /note="LactoCOG number LaCOG02318"
FT   CDS_pept        294773..296248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0262"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59670"
FT                   /protein_id="ABJ59670.1"
FT                   /translation="MSWIIGAVIIIAIALTYVELGAMFPESGGMSKYAQYSHGPMLGFI
FT                   AAWANWISLVTLVPMEAVAAVQYMSSWPWKWANWTHYFMQGGNITTPGLLVVFAFMIIF
FT                   TLINFWSIKIMTHFTNLISVFKVLLPTITIIMLFASSFHPANFGHDVKTFMPYGSRAIF
FT                   EAASGAGIIMSYDAFQTIINIGGELKNPRKNIIRGVLISMLVTAAIYILLQIAFIGAVD
FT                   PAMIAKNSWHGINFASPFADIAILLGINWLVILLYMDAFVSPFGTGVAFVATASRALAA
FT                   MTHTKHLPAWLGRLNRRYLVPRFAMIADLILAMILVSVFRNWNLLATVITCATLIAYLT
FT                   GPVTTITLRKIAPDLDRPYKPGYMRWFAPLTFVLTSLAIYWTMWPTTIQVILVIVLGIP
FT                   IYFYYEVKYQKRNFKSQFKHAAWLLGYLVFISIMSYCGSDGFGGQNWISYPWDFLVISI
FT                   ASLLFYKFAINSGLEKIDSAARKVNEKIKLEED"
FT   gene            296366..296617
FT                   /locus_tag="LGAS_0263"
FT                   /note="LactoCOG number LaCOG01045"
FT   CDS_pept        296366..296617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0263"
FT                   /product="LSU ribosomal protein L31P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59671"
FT                   /db_xref="GOA:Q046F1"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046F1"
FT                   /protein_id="ABJ59671.1"
FT                   /translation="MRKGIHPDYQEVVFMDSATGAKFVAGSTLKPEETIEFEGKTYPLV
FT                   RVEISSDSHPFYTGKQKFAQADGRIEKFNKKYGISSKN"
FT   gene            296783..298150
FT                   /locus_tag="LGAS_0264"
FT                   /note="LactoCOG number LaCOG00246"
FT   CDS_pept        296783..298150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0264"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59672"
FT                   /protein_id="ABJ59672.1"
FT                   /translation="MKMQLAEIAKALNSSVNMGEDKVITSVVFDSRKATPNSLFIPLAG
FT                   VRDGHDFVSNAMANGAEATLWKKGHEGKPTDVPVIEVEDPLTALQSLAKYYLGKVNPTV
FT                   VGITGSNGKTTTKDMVAAVLAKRFNVHKTQANFNNEIGVPVTILEMKPSTEILVLEMGM
FT                   DRPGQLHHLSELVRPDVCVITMIGEAHIEFFGTRDKIADAKMEITDFLKEDGKFIYNGD
FT                   EPLLEERAAKIKQDKSTFGFREEDTVFATTFRSYMHHATFEINDSEQQFKIPMIGKHNV
FT                   SNALAAISVGRHFGENDEQIAQALANFTPTANRMQWKKGDVGEAIMDDVYNSNPTAVKA
FT                   VTTSFGQVMVQDGGRRIAVLGDMLELGDESAELHASLANALDPAIINELYLYGPEMKNL
FT                   YDALVDKYPAANLHYYPQDEMNHMIDDLKNDIKPADIVMLKGSHGMHLEKVLDRLM"
FT   gene            298166..299623
FT                   /locus_tag="LGAS_0265"
FT                   /note="LactoCOG number LaCOG00254"
FT   CDS_pept        298166..299623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0265"
FT                   /product="Superfamily II DNA and RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59673"
FT                   /protein_id="ABJ59673.1"
FT                   /translation="MKFSEMNLKPEILKAIKRSGFEEATPIQEKTIPLVLEGKDVIGQA
FT                   QTGTGKTAAFGLPILQNLDKQHDSIQAIVIEPTRELAIQTQEELFRLGRDEKARVQVVY
FT                   GGADIRRQIRALKQTPAILVGTPGRLLDHLKRGTIDISKVKTIVLDEADEMLDMGFIQD
FT                   IESILNYASSKHQTLLFSATMPKPILRIGEKFMHDPEIVKIKGKELTANLIDQYFVRAK
FT                   ENEKFDILCRLIDVQNPDLAVIFGRTKRRVDELTRGLQARGYNAAGIHGDLSQAKRMSV
FT                   LKRFRKGKLDILVATDVAARGLDISGVSHVYNYDIPQDPDSYVHRIGRTGRAGQNGMSV
FT                   TFVTPNEIGYMRTIEQLTHKKMMPLKPPTDEEAFKGQLSAANKKVTELLDGDLSKYTTE
FT                   ASQLLDDYSAVDLVAALLKNLSKDAESVKVKITPEKPLPFKSKHGNSNHHFKRNFKRGG
FT                   DRNERYHRKPNARRGGRKHDFVIKKKD"
FT   gene            299678..300055
FT                   /locus_tag="LGAS_0266"
FT                   /note="LactoCOG number LaCOG00584"
FT   CDS_pept        299678..300055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0266"
FT                   /product="Phosphopantetheinyl transferase (holo-ACP
FT                   synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59674"
FT                   /protein_id="ABJ59674.1"
FT                   /translation="MCEVKIMIRGFGIDSVEVERMKKIVEKGDKFAKRVLTPKEFAQYQ
FT                   QLKGKRRVEYLGGRFSLKESFSKALGTGLGKYVGFQDIETLWDDLGYPVTTSTKFSGNI
FT                   FASITHDDHEIITGVVLEELN"
FT   gene            300055..301185
FT                   /locus_tag="LGAS_0267"
FT                   /note="LactoCOG number LaCOG00585"
FT   CDS_pept        300055..301185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0267"
FT                   /product="Alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59675"
FT                   /db_xref="GOA:Q046E7"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046E7"
FT                   /protein_id="ABJ59675.1"
FT                   /translation="MVPGIHRPAVVKVNLGAIKRNIENEMQHLEPGQKMLAVVKANGYG
FT                   HGAVEVAKVADQIGAAGFCVAILDEALELRRADITKTILVLGVVSPEYAPIAAANDISL
FT                   TVPNLEWLKEAEKYLENSDLQLKIHLGIDSGMGRIGFNEDKDFIAANKFLENNDNFYIE
FT                   GMFAHFASADSSDETYFKHQCEKFNHMKSLLTVKPKWIHVDNTAASIFHNGIKSDLVRF
FT                   GIGIYGLNPSSNPNSPDLKSKIALDPALSFESELTHVKTIHQGDGVGYGSTFVADKDTI
FT                   IGTVPVGYADGFIRKFQGFKVKVGNTYCPIVGRICMDQFMVEMPKEMPLGTKVVIISDN
FT                   PDDLNNIKAAADYVDTIHYEVACLLNDRLPRVYYED"
FT   gene            complement(301243..301923)
FT                   /locus_tag="LGAS_0268"
FT                   /note="LactoCOG number LaCOG01627"
FT   CDS_pept        complement(301243..301923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0268"
FT                   /product="CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59676"
FT                   /protein_id="ABJ59676.1"
FT                   /translation="MLIKSLVYKKDYLTTVNEKATLAEALKILEDSGFRCVPILDDTGT
FT                   IFRGNIYKMHIYRHKSQGGDMNLPVTYLLKNATKTIKVNSPFFRVFFNIKDLPYIAVLD
FT                   EENHFYGILTHARLLDMLSDAWNIKNGSYVLTILSDNDRGNLVKMAKIISKYSNIAGCL
FT                   TLDVKTGELVRRNLFTLPIGVSRETMTAIVNRLEKKGFVVPEIEDLQSGLTIRSAEQPG
FT                   ELKD"
FT   gene            complement(302066..303037)
FT                   /locus_tag="LGAS_0269"
FT                   /note="LactoCOG number LaCOG00899"
FT   CDS_pept        complement(302066..303037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0269"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59677"
FT                   /protein_id="ABJ59677.1"
FT                   /translation="MSEEKIHKIILVGDGAVGSTYAFSLVQQGIAQELGIVDIVKERTQ
FT                   GDAIDLADATPWIAPKTIYSAEYSDAKDADLVVISAGAPQKPGETRLDLVNKNLKILSS
FT                   IVEPIVESGFNGIFLVAANPVDILTHATWRMSGFPKDRVIGSGTSLDTGRLQKVIGEME
FT                   HVDPRSVNAYMLGEHGDTEFPVWSYNNVGGVKVSDWVKAHPEVGENKLEAIHKEVADMA
FT                   YDIINKKGATFYGIGTALAFITKAILNNEHRVLPLSVPMDGEYGLHDLHIGTPAVVGRH
FT                   GLEQVIEMPLSADEQAKMEASAKQLKEVMDKAFKETGVKVRQ"
FT   gene            303218..303775
FT                   /locus_tag="LGAS_0270"
FT                   /note="LactoCOG number LaCOG00008"
FT   CDS_pept        303218..303775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0270"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59678"
FT                   /db_xref="GOA:Q046E4"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046E4"
FT                   /protein_id="ABJ59678.1"
FT                   /translation="MKLIAGLGNPGKKYDQTKHNTGFMALDHYLSKNNLDLDKDKFEGL
FT                   WTKQKVNGEDVIFLEPQTFMNDSGKSIAQVANFFKIAPEDILVIHDDMDMPIGKIRIRA
FT                   NGKSGGHNGIKSIMACLGTNNFNRLKIGIRHPQKESVVSWVLSPFNDEQQKLMDAAFEV
FT                   SENIINDFIKGKNAQYLMNQYN"
FT   gene            303777..307274
FT                   /locus_tag="LGAS_0271"
FT                   /note="LactoCOG number LaCOG00009"
FT   CDS_pept        303777..307274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0271"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59679"
FT                   /protein_id="ABJ59679.1"
FT                   /translation="MNITELLNKDKDLNNFINKALKEKRSLLTGVNSGAFSAVLMQMLS
FT                   TWQRPLILVEDSEDKAQLLLDELGNLLPDEMVFSFPVDATIATQTAVASPDELSQRLQT
FT                   LKFLTEKRAGIVVITPQALQYKLSDPRDFIKAKQVFKPEAEFDLDELTAWFTQAGYRRE
FT                   NIVARPGEFARRGDILDVYPLDQENPVRIEFFGDEVDTVKEFDAATQRSLEEKDIVSIG
FT                   PALDRVFSSRNLHEAIEKIKQDMNESIANEENVKNHFVKAIDLLEADGLPENYAFLIDY
FT                   LLPKSFNLVDYLDKNGLLLFDDWQAIKKNVADVDAQNEAFISEEIKAGAMLNSQKLRHN
FT                   FEQVVQKVKQAQVLFSLFQKGMGRLKFDQILNFTTREVQQFFSQMPLIKSELTRFANEG
FT                   NTVVLQADSATRAKQIAQNLVDYGVDLPVVKPDQILAKKAQITVGDFAHGFALPSLNLV
FT                   YLTERELFNQRPHHRKRIKTLENAQRLRNYNELKPGDYVVHVNHGIGRFEGIKTLDVDG
FT                   KKRDYITITYQHHDQLFVPADQLGLVQKYVASEGKVPHINKLGSAEWAKTKKRVQSKVE
FT                   DIADDLIELYAKRESEKGFAFSPDDDLQKEFEDAFPYPETPDQLRSIREIKADMESPKP
FT                   MDRLLVGDVGFGKTEVALRAAFKAIRDGKQVAFLAPTTILAQQHFETMQDRFKNFPVNC
FT                   ALLSRFQTPAEVKAIIEGVKNGKIDMVVGTHRLLSKDVKFKDLGLLIVDEEQRFGVKHK
FT                   ERLKELKANIDVLTLTATPIPRTLHMSMVGVRDLSVMETPPTNRYPIQTYVMEEMPSVV
FT                   REAVLREMKRNGQVFFLHNRIDDIDKVVSRLEELIPEAKIEYIHGRMSENQMEDIMYRF
FT                   SRNEFDILVTTTIIETGVDMPNVNTMIVENADHYGLSQLYQLRGRIGRSARLAYAYFLY
FT                   QPNKVLTEIGEKRLSAIRDFTELGSGFKIAMRDLSIRGAGNMLGKQQHGFIDSVGYDLY
FT                   AQMLDDAIKKRKGKKVAVKSNAEVQFNLEAYIPDDYIADQEQKIEFYKKIKGINDQKEA
FT                   ENIADELIDRFGDYPLAVENLLNVSKVKADADLAQVVAINQKSNDKLQIIFNNRASEEL
FT                   EGPNIFKALEHVSLRARINMDPQKRMNVMLELEKKMSTRQLFNELHTFLTAASDIVQR"
FT   gene            307255..307530
FT                   /locus_tag="LGAS_0272"
FT                   /note="LactoCOG number LaCOG00010"
FT   CDS_pept        307255..307530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0272"
FT                   /product="Ribosome-associated heat shock protein implicated
FT                   in the recycling of the 50S subunit (S4 paralog)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59680"
FT                   /protein_id="ABJ59680.1"
FT                   /translation="MILFKGREENKMRIDKFLKVSRLVKRRTVAKEMADQGRVKVNERV
FT                   VKSSYDVKVGDVIEIGFGTKQLKARVLDLRETTKKAEASDLYELID"
FT   gene            307619..307996
FT                   /locus_tag="LGAS_0273"
FT                   /note="LactoCOG number LaCOG00011"
FT   CDS_pept        307619..307996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0273"
FT                   /product="Septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59681"
FT                   /protein_id="ABJ59681.1"
FT                   /translation="MQRGPRLYNALSDEERLARLRRKAARKEKEVHRVRRNRIVACFAI
FT                   AILIFGLQLIMVHVQTGRINSQIQTNKTELNQVNKTNKKLKAQVADLKDPDYVAKVIRY
FT                   KFYYSKSGESIYTLPDKEEDY"
FT   gene            307996..308352
FT                   /locus_tag="LGAS_0274"
FT                   /note="LactoCOG number LaCOG02207"
FT   CDS_pept        307996..308352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0274"
FT                   /product="RNA binding protein (S1 domain)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59682"
FT                   /protein_id="ABJ59682.1"
FT                   /translation="MKFPIGLRLNAKVNNITKLGLFVTLPHHHHGLIFYKDFGDKWESA
FT                   RNKYSIGDEVRAVIINNHQGKLSLSLSQVNNPDLIDPTNEFKDSKDFTPLAKLVENSTK
FT                   KIADLKNSIELSDQ"
FT   gene            308374..309669
FT                   /locus_tag="LGAS_0275"
FT                   /note="LactoCOG number LaCOG00013"
FT   CDS_pept        308374..309669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0275"
FT                   /product="tRNA(Ile)-lysidine synthetase, MesJ"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59683"
FT                   /db_xref="GOA:Q046D9"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046D9"
FT                   /protein_id="ABJ59683.1"
FT                   /translation="MTEFTNFFTKNNIEIKNKKFLLAASGGPDSVALFHMLVNFLPNPS
FT                   KQLIVAHLDHCLRKDSYLESELLQKLTTAFKIKLIEKSWPVALHPQTGIEAKAREFRYA
FT                   FLAHTGKKYQVDYLLTAHHGDDLIENILLKFIRSGDVAEMNSLQIVGNLDSMRLLRPLI
FT                   KYSKDQLLEYDKRNGLDYIEDETNFEDDTLRNRLRHYVVPLLKKETNHLVENAYRFSES
FT                   AALLSDCQNSFFESLILPIDFGKALRGKKSDLINLNENQLAAFFDYLVYKKWHQRVHFD
FT                   EIRRRKKATFNKENFQLIFYQDYYYLINRNGLTPIDSKKKKIKLDEKFSLNGKEYLISH
FT                   DKKIGNLVGYFYGVRTDFLEVGSLPQGSKLRLADGRQTKAKKKFAENGIPLILRPYCLT
FT                   IWQKENPVYVENVYQNQEYNANFVRYNVYIYL"
FT   gene            309753..311879
FT                   /locus_tag="LGAS_0276"
FT                   /note="LactoCOG number LaCOG00015"
FT   CDS_pept        309753..311879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0276"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59684"
FT                   /protein_id="ABJ59684.1"
FT                   /translation="MKNRRNRLLSNGLFYIIVFVILLAGINWAVGGSGSNGSTENIRYS
FT                   QLVKDLKAGKVKSINVQPSNGVYTVTGSYKKAQKSKNQNNTGFGLIPSSQSSSEVTRFS
FT                   TTMLQNDSMVKTVSDLAQKSGASISGQGESQSGTWISTIVMLVPTLIFIVMLWMMMNQG
FT                   GQGRGGGMMNFGKSHVKPQDPSKNKVRFSDVAGEEEEKQELVEIVEFLKNPAKYTKLGA
FT                   RIPAGVLLEGPPGTGKTLLARAVAGEAGVPFYSISGSDFVEMFVGVGASRVRDLFETAK
FT                   KNAPSIIFIDEIDAVGRKRGNGVSGGHDEREQTLNQLLVEMDGFEGDEGVIVMAATNRS
FT                   DVLDPALLRPGRFDRKVLVGRPDVKGREAILKVHAKNKPLAPDVDLKEVARQTPGFVGA
FT                   DLENVLNEAALVAARRNKTEITASDIDEAEDRVIAGPAKKDTVISPEERKRVAYHEAGH
FT                   AIVGLVLSDSRTVRKVTIVPRGRAGGYNIMLPKEDENIITKKQLMEQVAGLMGGRAGEE
FT                   VVVGDKSTGASNDFEQATNIARGMVTQYGMTDVGMTELESPSMQVPYGTKPYSEATAAK
FT                   IDEAVKEILDEGHKQAVDIIKSHRETHKIIAEALLKYETLNEKQILSLFKTGKMPENDE
FT                   NEFPSESKASTYEEAKAAMEKKDQQREETENKDDKEDVHPLPDDHKNIDDIPLNPPSEK
FT                   KNSDEHNSDENKDK"
FT   gene            311950..314661
FT                   /locus_tag="LGAS_0277"
FT                   /note="LactoCOG number LaCOG00576"
FT   CDS_pept        311950..314661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0277"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59685"
FT                   /protein_id="ABJ59685.1"
FT                   /translation="MVLRMKYLSKKDKKILKLSLISCLTTMVLFFLLSTFTDCNPIFGG
FT                   VLYGGDLPNQYLSFFQYYRHLVLGNWASAGYTFSNGLGGDMAGNIAYYVLSPLNFIVFL
FT                   FPANKINIAVYVIILFKLGLMSGTFTWLILKWFNFKYQAYAIFLGIAYSLSGYSVAYAG
FT                   NVMWFDGLILLPLITYALVRGIKINKWLTYSILLACAIIFNYYIGYMICIFMVIIFLAY
FT                   TINNFKDIKLFFHQFLNFAISSIISGLISAIVLLPTLFNLSSNKLAQSDFNSNFNIKLL
FT                   ITGGKTVSRLFIGDTYNDWPPIFVGTLAAIIFIIYFIDSRNSVKARITNLIIGIIFVLS
FT                   IIVRPLYLFWHGGQQTIAYPYRFSFLIVFWILLLAAKELSYQNFKKKDRIIATTIYLLL
FT                   SLMTVYIRRRIGPNNFYEWIAVALVLLFGLLIYFSNKNFVRIILILVGLVELSGNAYTG
FT                   LSHLGMKSDYYPKYVAENSEVISKIPAADKTGRIAKNYELNNDRGEGYTFNYRGVEEFS
FT                   SNNDSRISSLMTDLGFSTFRYFYYYQTGTVVTDAIFNVKSFINSSLTNQSISPEYVNYG
FT                   LRDDLKTRPVILKQGDKTVYRNETLPFAFAGNLSNKLKFKDENPVYNQNLVLNSLTQSK
FT                   SNVLDYSNKKARITTNNLSVKYGKVKYHVIKKHKKITKRTEQKYFTIKRYDKERPGTMR
FT                   FTYDNLKPNQVGYIRFSKNLMQLVLALNNYQWNKNPDYRPPFSVTINGKQVQLQEYTDQ
FT                   LIGVQADKNGKVDIKMTVDGKGGKFILKYPKFVNIDFSALHDKVKKAHEREMKFTSFED
FT                   GYVAGKVKINKNQNLVTTIPYSKGWQVKVDGKPVKINRTLGVFIGLKMKPGTHQITLKY
FT                   RTPGVLVGALLSIIGIISLIVFTLFLKKNKKD"
FT   gene            314836..315756
FT                   /locus_tag="LGAS_0278"
FT                   /note="LactoCOG number LaCOG01304"
FT   CDS_pept        314836..315756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0278"
FT                   /product="Disulfide bond chaperones of the HSP33 family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59686"
FT                   /protein_id="ABJ59686.1"
FT                   /translation="MKSMFYRLYFLGERKMNDYLVKAIDKTKNLRLITVNAKELVSEAQ
FT                   KRHDTWSASSAVLGRTLIGGLLLSAALLKDKDELTVRLLGNGPVGATVVTAKADLTIKG
FT                   YVQNPHIALPPKKDGHIDVAKAVGEGWLEVTKDQGLKEPYTGQVPIVSGEIAEDFTYYL
FT                   AKSEQIPSAVGLSVFVEPNNSIGAAGGFVLQALPGATDEQLAQVEKRIKALPNLSTLFL
FT                   DGMSPENLAERILGTDCKILAKENVAFSCDCSKEKYSKILATLKPGQLKEMIEKDHGAE
FT                   LVCRFCKEKYHFTEDELKDVLKKAN"
FT   gene            315816..316823
FT                   /locus_tag="LGAS_0279"
FT                   /note="LactoCOG number LaCOG01306"
FT   CDS_pept        315816..316823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0279"
FT                   /product="tRNA-U20-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59687"
FT                   /protein_id="ABJ59687.1"
FT                   /translation="MKNDSWKIRDVEIPNRVVVAPMAGISNAAFRVVCKEFGAGLVVCE
FT                   MISDHGIIYRNKKTLEMLTVDPREHPMSIQIFGGSEETLVEAAHYVDTHTAADIININM
FT                   GCPVPKVTKTDAGARWLLDPNKIYQMVHAVVRNVSKPVTVKMRTGWDQKHIFAVENALA
FT                   AQEAGASAVAMHGRTRKQMYMGEADWETLKEVADALTIPFVGNGDVTTPEKAKAMLEDV
FT                   GADAVMVGRAALGNPWIIKDMVHYLDTGEKLRPQTVEEKVATAKEQLNGLIDLKGEKIA
FT                   VPEFRRQAAYYLKGIPRSARTRAKINDVWTKQEVFDLLDDFVEKYEARQKQFNR"
FT   gene            316838..318352
FT                   /locus_tag="LGAS_0280"
FT                   /note="LactoCOG number LaCOG00271"
FT   CDS_pept        316838..318352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0280"
FT                   /product="Lysyl-tRNA synthetase (class II)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59688"
FT                   /protein_id="ABJ59688.1"
FT                   /translation="MAKNEMNDQLIVRREKMDEMRENGIEPFGVRKFDRQDLARTLNEK
FT                   YSKEDKDELNADMPTTKIAGRMLAKRGKGKVGFADLYDRTGKIQIYVRKDIVGEDNYKI
FT                   FKKSDIGDFLGIDGEVMKTDTGELTIRATHVTFLSKALRPLPNKWDGLKDVEQIYRQRY
FT                   LDLITNHESYMRFVHRTQIIQAIRNYLNKQDFLEVETPVLHNIPGGAEARPFITHHNAL
FT                   DIDLYMRIALELPLKRLIVGGMERVYEIGRVFRNEGVDTRHNPEFTELETYAAYWDFHD
FT                   VMDEAEEIIRAAAKVVSPDGKINYQGTDIDLGKPFRRVHMVDLIKEKTGVDFWKEMTDE
FT                   EAKKIAEEHGIHTEPFWKVGHVINAFFDEFCEKTIVDPTFVYGHPVEISPLAKKNADDP
FT                   RFTDRFEIFILGMEYGNAFSELNDPVDQRHRFEEQMEEREAGNDEADMIDEDYIRAMEF
FT                   GMPPTGGLGIGIDRLVMLLTDAPAIRDVLLFPTMRPEKVEDVDAEV"
FT   gene            318480..318554
FT                   /locus_tag="LGAS_t0281"
FT                   /note="tRNA_Gly_GCC"
FT   tRNA            318480..318554
FT                   /locus_tag="LGAS_t0281"
FT                   /product="tRNA-Gly"
FT   gene            318595..318668
FT                   /locus_tag="LGAS_t0282"
FT                   /note="tRNA_Pro_CGG"
FT   tRNA            318595..318668
FT                   /locus_tag="LGAS_t0282"
FT                   /product="tRNA-Pro"
FT   gene            318784..321300
FT                   /locus_tag="LGAS_0283"
FT                   /note="LactoCOG number LaCOG00432"
FT   CDS_pept        318784..321300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0283"
FT                   /product="ATP-binding subunit of Clp protease and DnaK/DnaJ
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59689"
FT                   /protein_id="ABJ59689.1"
FT                   /translation="MSKDCSMILKEIRRCRMEKSYSDSAKNVLEIAKEQAQNFHHRIIG
FT                   TEHVLLALVIEANGDAGKLLRERNVTPTLVREEIERYTGYGSSPKATYMEMSPRLSLVL
FT                   NFAKQKSDELGTPQIETKHILLGLLASDQILASLILKNIGVEPRDLSQDINDSFMDDSG
FT                   EANNIFDVSSATRTKKGKSLTPNLDKVSVNLNKRAREGAIDPVIGRDKEIKRVIQILSR
FT                   RTKNNPVLVGEPGVGKTAVAQGIASAIVNREVPDNLAKKRVMALDMGSLIAGTKYRGEF
FT                   EDRMKKILKEIQRDGSVILFVDEMHTLIGAGGAEGAIDASNILKPSLARGDIQMIGATT
FT                   FDEYQKYIEKDQALARRFQQVKIGEPSKEETVDILKGLRPKYEKFHNVKIEDEAIKDAV
FT                   EFSTRYIANRFLPDKAIDLIDEASAAVKIQAVGKADPRLTKLDTQINDVIHQKEEAAEN
FT                   QNFVQAAKLRDEENKLTQDRDKLIARVENKNSKKSIVDSNKIAQIVSEWTGVPVTRMKK
FT                   SETKRLAHLESILHERVIGQDKAISAVSRAIRRSRSGIKDENRPIGSFLFLGPTGVGKT
FT                   ELAKALAAAVFGSERNIIRVDMSEYMDQVATSKLIGSAPGYVGYEEGGQLSERVRRNPY
FT                   SVILLDEVEKAHPDVFNLLLQVLDEGFLTDSKGRKVDFRNTIIIMTSNLGSRSLQEDKT
FT                   VGFAADNEDKNKLQQEKVTAAVKQFFRPEFLNRIDETVVFDSLTKKQLREIVSLMTSHL
FT                   ISRLARKEVTLKISPAALDVLAKDGFDPEMGARPLRRAIQHELEDVIAEDLISEKIKAG
FT                   QTVKVGAHQGKLKFTIVDKDKPLVKN"
FT   gene            321501..325139
FT                   /locus_tag="LGAS_0284"
FT                   /note="LactoCOG number LaCOG01197"
FT   CDS_pept        321501..325139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0284"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59690"
FT                   /db_xref="GOA:Q046D2"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046D2"
FT                   /protein_id="ABJ59690.1"
FT                   /translation="MFSLLGHAVNYGSHRTRRSFSRIKEVLKLPNLTDVQTQSYKWFLN
FT                   EGIREMFDDIMPISDFSGKLSLEFVDYKLLKPKYTLEEARDHDANYSAPLHVTLKLTNH
FT                   ETGEIKTQDVFFGEFPLMTDSGTFVINGAERIIVSQLVRSPGVYYHSDFDKNGRQIFGA
FT                   TVIPNRGAWLEYETDAKDLAYVRIDRTRKLPLTVLIRALGFGSDSEVADMFGESDSLRF
FT                   TLEKDIHKNPADSRVAEALKDIYERLRPGEPKTTDSSRSLLYARFFDPRRYDLAPVGRY
FT                   KINKKLSLKNRLLRQTLAETLADPDTGEIIAKKGDVVTHEILDKLSPYLDRDDFKMVTY
FT                   EPSKEGVLPDPVTVQEIKVYSKVDPERVIKLMSNGHIADDVKHLTPADVLASINYFFNL
FT                   QDNIGTTDDIDHLGNRRIRRVGELLQNQFRIGLARMERVVRERMSIQDISTVTPQQLIN
FT                   IRPVVASVKEFFGSSQLSQFMDQNNPLGELTHKRRMSALGPGGLSRDRAGYEVRDVHYT
FT                   HYGRLCPIETPEGPNIGLINSLATYAIVNKYGFIETPYRRVSWDTHKVTDKIDYLTADV
FT                   EDNYIIAGANAPLNEDGSFKDKIVLARHKEDNLEVTPDKIDYMDVIPKQVVSVTSACIP
FT                   FLENDDSNRALMGANHQRQAVPLINPHAPIVGTGMEYRAAHDSGDALVAKAPGVVEYVD
FT                   ANEIRIRRDDDTLDKYVLEKFRRSNATKNYNQTPAVKQGERVVADEVIADGPAMENGEL
FT                   ALGQNPIIAFLTWNMYNYEDAVMISERMVKDDVYTSIHIEDYESEARDTKLGPEEITRE
FT                   IPNVGEDALKDLDEEGIVRIGAEVQDGDILVGKVTPKGVTELSAEERLLHAIFGEKARE
FT                   VRDTSLRVPHGGGGIVQNVQVFTREAGDELPPGVNKMVRVYIVQKRKIQVGDKMSGRHG
FT                   NKGTIALVCPEEDMPYLPDGRPVDICLNPMGVPSRMNIGQVLELHLGIAAKQLGIHVAT
FT                   PVFDGASEDDMWNMVREAGIGKDGKTVLYDGRTGEPFHNRVSVGIMYYLKLTHMVDDKI
FT                   HARSIGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDVVGRV
FT                   KAYEAIVKGERIPKPGVPESFRVLVKELQSLGLDIKVLDMDHKEIELRDMDDDSNDHFN
FT                   IDTLSKLAEQQEKKKLAEEAAKKDDKSAEPVDQSDSSTSSDDKVSK"
FT   gene            325155..328826
FT                   /locus_tag="LGAS_0285"
FT                   /note="LactoCOG number LaCOG01196"
FT   CDS_pept        325155..328826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0285"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59691"
FT                   /db_xref="GOA:Q046D1"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046D1"
FT                   /protein_id="ABJ59691.1"
FT                   /translation="MIDVNKFESMQIGLASPNKIRSWSYGEVKKPETINYRTLKPEKDG
FT                   LFDERIFGPTKDWSCACGKYKGIRYRGIVCDRCGVEVTSAKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDISPRALEEVIYFAAYIVIDAGDTDLEDKQLLTEAEYREKKAKFG
FT                   NRFEAKMGAEAVKELLEQVDIDKEVHDLKEELKTATGQKRTRAIRRLDILDAFKNSGNK
FT                   PSWMVMDCIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLNAPRIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVVGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIDVSPKLKFYQCGVPRPMALELFKPFVMHELVKRGLASNIKNAKRKIDREDDDIWD
FT                   ILEDVIKERPVLLNRAPTLHRLGIQAFEPVLVPGKSIRLHPLACEAYNADFDGDQMAIH
FT                   VPLSDEAVAESRLLMLAAHHILAPKDGKPIVTPSQDIVLGNYWLTQAERGREGEGMIFD
FT                   SPAEAAIAYANGDIHYHTRIGLAADSMPEKPWPKGYEHGIFVTTYGKLVFNQIFPKDFF
FT                   YINDPTQENLTHPVDERYFLQPGEDIHEKLDNMKLGKAFKKGFLSDSIAQIYKDYKVQR
FT                   TSDFLDDLKELGYTVCTTSGLTIGVEDIPTITDKDDIVAEARKKVDVVSKQYRRGLITD
FT                   EERHDRVISIWNNCKDIVQNEIAQIHAPRNPITIMADSGARGNISNFTQLAGMRGLMAA
FT                   PNGGMMEIPVTSNFREGLSVLEMFMSTHGARKGMTDTALKTANSGYLTRRLVDVAQDVI
FT                   IREEDCGTDRGLTVHAITEGDEMIEPLFDRLVGRYTSKSVYDPETHEVICPADVLMDED
FT                   MAHKIVDAGVTEVTIRSVFTCNTQHGVCKKCYGMNLATGDDVEVGEAVGTVAAQSIGEP
FT                   GTQLTMRNFHNGGVAGAADITQGLPRVQELFEARNPKGRATISEVTGEITSIEEDPAEH
FT                   TRQITVKGQTDTRTYDVPYTASVAVAEGDHVVRGDKLTLGSIDPKELIRVRDALTTEKY
FT                   ILSEIQKAYRMQGVEIADKHVEVMARQMLQKVRILDPGETDILPGELMDIGEFKARNRE
FT                   VIISGGIPATAQSVILGITKAALETNSFLSAASFQETTRVLTDASIRGKNDPLLGLKEN
FT                   VIIGKIIPAGTGMPVYREMEPKVDVPEDEKKKSVYSIADIEKKLAAADAEKDKGSAD"
FT   gene            complement(328894..329571)
FT                   /locus_tag="LGAS_0286"
FT                   /note="LactoCOG number LaCOG01354"
FT   CDS_pept        complement(328894..329571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0286"
FT                   /product="Type II secretory pathway, prepilin signal
FT                   peptidase PulO related peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59692"
FT                   /protein_id="ABJ59692.1"
FT                   /translation="MSNSFIYIFNFVIGSIIGSHLLVIVQRFETENFITDKSHCDNCQI
FT                   PLTLLNQIPIFSFLRYQGKCFFCHAYIPIETFYCEILGGLAFMPLNPLANQTSYFFIIF
FT                   IFLISIFDYIDQSFPVQILIPLIAIVVFKIPYSTSNYTTIEWILISFVILIFLIMNLKK
FT                   KFGYGDTIIFIILIFYYNFYIAEYLFLLSSIFLIITHLITQNQKQYPFIPFIFLSIIFY
FT                   NFI"
FT   gene            329739..330146
FT                   /locus_tag="LGAS_0287"
FT                   /note="LactoCOG number LaCOG01529"
FT   CDS_pept        329739..330146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0287"
FT                   /product="SSU ribosomal protein S12P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59693"
FT                   /db_xref="GOA:Q046C9"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046C9"
FT                   /protein_id="ABJ59693.1"
FT                   /translation="MPTINQLVRKGRHSKTTKSDSPALNYAYNSMKKKMNYNPAPQMRG
FT                   VATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIIRGALDTAGVDGRKQGRSKYGAKKG"
FT   gene            330172..330642
FT                   /locus_tag="LGAS_0288"
FT                   /note="LactoCOG number LaCOG01528"
FT   CDS_pept        330172..330642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0288"
FT                   /product="SSU ribosomal protein S7P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59694"
FT                   /db_xref="GOA:Q046C8"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046C8"
FT                   /protein_id="ABJ59694.1"
FT                   /translation="MPRKGNVAKRDVLADPVYNSKLVTKLINHLMIDGKKAKASSILYD
FT                   AFGIIQDKTGKEPVEVFEEAMNNVMPVLEVKARRIGGSNYQIPVEVRPERRTTLGLRWL
FT                   VSYARLRNEHTMDERLANEIMDAANNTGSAVKKREDVHRMAEANRAFAHYRF"
FT   gene            330672..332768
FT                   /locus_tag="LGAS_0289"
FT                   /note="LactoCOG number LaCOG01527"
FT   CDS_pept        330672..332768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0289"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59695"
FT                   /db_xref="GOA:Q046C7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046C7"
FT                   /protein_id="ABJ59695.1"
FT                   /translation="MANKREFPLDKTRNIGIMAHIDAGKTTTTERILYYTGKIHKIGET
FT                   HEGDSQMDWMDEEKERGITITSAATTAQWKDYRINIIDTPGHVDFTIEVERSLRVLDGA
FT                   VTVLDAQAGVEPQTENVWRQAETYGVPRIVFVNKMDKIGADFDKSVKSLHERLNANAHA
FT                   VQMPIGSADTFEGVIDLINMVADVYDEDKLGSKWDTIPVPDEYKEEALKRRNELIEAVA
FT                   DVDDGIMDKYLGGEEISNDELKAAIRKATLNLEFFPVYAGSAFKNKGVQMMLDGVIDYL
FT                   PSPLDVKPYVAHDPKTGDEVELMADDKKPFAALAFKIATDPFVGRLTFIRVYTGSLQSG
FT                   SYVLNASKNARERVGRLLQMHANSRTEIPEVFSGDIAGAIGLKNTTTGDSLTDPDHPLI
FT                   LESLQVPDPVIQVSVEPKSKADRDKMDVALQKLTEEDPTFRAETNPETGQTLISGMGEL
FT                   HLDIMVERMKREFNVEATIGEPQVAYRETFTKEAKAQGKFVRQSGGKGQYGDVWIDFTP
FT                   NEEGKGYEFEDAIVGGVVPREFIPSVDQGLQEAMKNGVLAGYPLIDVKAKLYDGSYHEV
FT                   DSSEAAFKVAASLALRNAAAKAGAVILEPIMKVQVTTPEEYLGDVMGSITARRGSMEGM
FT                   EDRAGAKVINSFVPLSEMFGYATTLRSSTQGRGTFTMVFDHYSPTPKSIQAEIIKKRGG
FT                   EDAE"
FT   gene            333040..333348
FT                   /locus_tag="LGAS_0290"
FT                   /note="LactoCOG number LaCOG01411"
FT   CDS_pept        333040..333348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0290"
FT                   /product="SSU ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59696"
FT                   /db_xref="GOA:Q046C6"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046C6"
FT                   /protein_id="ABJ59696.1"
FT                   /translation="MASQQIRIRLKSYEHGILDESAAKIVATAERTGAQISGPVPLPTE
FT                   RTLFTVLRSPHKNKDSREQFEIRTHKRLIDILNPTPKTVDSLMKLDLPSGVDIEIKL"
FT   gene            333375..334004
FT                   /locus_tag="LGAS_0291"
FT                   /note="LactoCOG number LaCOG01410"
FT   CDS_pept        333375..334004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0291"
FT                   /product="LSU ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59697"
FT                   /db_xref="GOA:Q046C5"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046C5"
FT                   /protein_id="ABJ59697.1"
FT                   /translation="MTKGILGRKVGMTQIFTKNGILVPVTVIEATPNVVLQVKTNESDG
FT                   YEAVQVGYQDMREVLSNKPAKGHAAKAKTSPKRFIREIRDVELKDYEVGSEITVDSFSE
FT                   GDVVDVTGTTRGHGTQGNIKRWGQSRGPETHGSRYHRIPGSMGSIINRVPKGKKLPGHM
FT                   GGKKVTVQNLVIEKVVPEKNVLLVKGNVPGAKNSLIFVKSAAKAAK"
FT   gene            334019..334636
FT                   /locus_tag="LGAS_0292"
FT                   /note="LactoCOG number LaCOG01409"
FT   CDS_pept        334019..334636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0292"
FT                   /product="LSU ribosomal protein L4P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59698"
FT                   /db_xref="GOA:Q046C4"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046C4"
FT                   /protein_id="ABJ59698.1"
FT                   /translation="MANLEIIDQKGKSAGNVDLNEEIFGIEPNESVVFDAIIRQRAGKR
FT                   QGTSAVKNRSAVRGGGKKPWRQKGTGRARQGSIRAPQWRGGGTVFGPTPRSYKMDMPRK
FT                   ARRLAMKSVLSQKVADKDLIILDQLTLEAPKTKELKAILDNANVSGKVLVVSDDKNVQL
FT                   SGKNLPKVKVVPVNGLNVVDAVDYQKLVLTQDAIKRIEEVLA"
FT   gene            334636..334932
FT                   /locus_tag="LGAS_0293"
FT                   /note="LactoCOG number LaCOG01408"
FT   CDS_pept        334636..334932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0293"
FT                   /product="LSU ribosomal protein L23P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59699"
FT                   /db_xref="GOA:Q046C3"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046C3"
FT                   /protein_id="ABJ59699.1"
FT                   /translation="MDARDIILRPVVTEKSMNLMDDKKYTFDVLVSATKTQVRNAVEEI
FT                   FDVKVKNVNIMNVRGKEKRVGRYTGKTARRRKAIVTLTEDSNDIKIFNDNKEN"
FT   gene            334952..335788
FT                   /locus_tag="LGAS_0294"
FT                   /note="LactoCOG number LaCOG01407"
FT   CDS_pept        334952..335788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0294"
FT                   /product="LSU ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59700"
FT                   /db_xref="GOA:Q046C2"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046C2"
FT                   /protein_id="ABJ59700.1"
FT                   /translation="MAIIKYKPTTNGRRNMTSSDFAEITKKKPEKTLLESQSHTAGRNS
FT                   YGHITVRHRGGGHKQKYRIIDFKRNKDDVKAVVKAIEYDPNRTANIALLHYTDGIKAYI
FT                   LAPKDLKVGTVVESGPNADIKPGNALPLSAIPAGTEIHNIELKPGKGGQLVRSAGTVAQ
FT                   VLGNDGKYTLVRLQSGEVRKILSTCRATIGSVGNEQHSLIQLGKAGRKRWLGKRPQSRG
FT                   SVMNPNDHPHGGGEGKAPVGRPQPMTPWGKKSRGIKTRNSKARSEKLIIRHRKGNK"
FT   gene            335810..336097
FT                   /locus_tag="LGAS_0295"
FT                   /note="LactoCOG number LaCOG01406"
FT   CDS_pept        335810..336097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0295"
FT                   /product="SSU ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59701"
FT                   /db_xref="GOA:Q046C1"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046C1"
FT                   /protein_id="ABJ59701.1"
FT                   /translation="MSRSIKKGPFADASLLKKIEAQEGSEKKQVIKTWSRRSTIFPSFV
FT                   GFTIAVYDGRKHVPVYITEDMVGHKLGEFVPTRTFRGHKVADKATTTVGK"
FT   gene            336118..336471
FT                   /locus_tag="LGAS_0296"
FT                   /note="LactoCOG number LaCOG01405"
FT   CDS_pept        336118..336471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0296"
FT                   /product="LSU ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59702"
FT                   /db_xref="GOA:Q046C0"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046C0"
FT                   /protein_id="ABJ59702.1"
FT                   /translation="MAEQISSAKAEARTVRIAPRKARLVVDLIRGKSVAEALAILQFTP
FT                   RAASPIVEKVLKSAIANAEHNYDLESANLYVSEAYVNEGATLKRFRPRAKGMASPINKR
FT                   TSHVVVVVSEKND"
FT   gene            336486..337154
FT                   /locus_tag="LGAS_0297"
FT                   /note="LactoCOG number LaCOG01404"
FT   CDS_pept        336486..337154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0297"
FT                   /product="SSU ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59703"
FT                   /db_xref="GOA:Q046B9"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046B9"
FT                   /protein_id="ABJ59703.1"
FT                   /translation="MGQKINPNGFRLGVNRDWEAKWYADKNYADTLNEDLRIRKFISEK
FT                   LADASVSTVEIERAANRINISIHTAKPGMVIGKGGKEVEALRKQLSALTKKNVHINIVE
FT                   IKKPDLDAKLVGEGIARQLEARIAFRRATRQATQRSMRSGAKGIKVQTAGRLNGADMAR
FT                   REWHTEGSVPLHTLRADIDYAWVEAATTYGQIGVKVWINRGEILPQRKNKPSKKTKGGN
FT                   "
FT   gene            337157..337594
FT                   /locus_tag="LGAS_0298"
FT                   /note="LactoCOG number LaCOG01403"
FT   CDS_pept        337157..337594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0298"
FT                   /product="LSU ribosomal protein L16P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59704"
FT                   /db_xref="GOA:Q046B8"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046B8"
FT                   /protein_id="ABJ59704.1"
FT                   /translation="MLVPKRVKHRREFRGKMRGEAKGGKTIAFGEYGLEAVESHWITNR
FT                   QIEAARIAMTRFMKRGGRVWIRIFPQKSYTAKGVGVRMGSGKGAPAGWVAVVKRGKIMF
FT                   EIGGVSEDVAREALRLASNKLPIKTKFVKKSSEVGGESNEG"
FT   gene            337572..337781
FT                   /locus_tag="LGAS_0299"
FT                   /note="LactoCOG number LaCOG01402"
FT   CDS_pept        337572..337781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0299"
FT                   /product="LSU ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59705"
FT                   /protein_id="ABJ59705.1"
FT                   /translation="MANLMKAKDIRALTTDQMLEKEKQYKEELFNLRFQQATGQLENTA
FT                   RLRQVRKNIARIKTILSEKELSKN"
FT   gene            337804..338070
FT                   /locus_tag="LGAS_0300"
FT                   /note="LactoCOG number LaCOG01401"
FT   CDS_pept        337804..338070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0300"
FT                   /product="SSU ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59706"
FT                   /db_xref="GOA:Q046B6"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046B6"
FT                   /protein_id="ABJ59706.1"
FT                   /translation="MSETNERNNRHVYQGRVVSDKMDKTITVVVDTYKNHPVYKKRIKY
FT                   SKKYYAHDENNEAKIGDTVRIMETRPLSHAKRYRLTKIVKKSI"
FT   gene            338104..338472
FT                   /locus_tag="LGAS_0301"
FT                   /note="LactoCOG number LaCOG01400"
FT   CDS_pept        338104..338472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0301"
FT                   /product="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59707"
FT                   /db_xref="GOA:Q046B5"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046B5"
FT                   /protein_id="ABJ59707.1"
FT                   /translation="MIQHESRLKVADNSGARELLVIKILGGSKRKTGNIGDIVVAAVKQ
FT                   ATPGGVVKKGDVVKAVIVRTKSGARREDGSYIKFDENAAVVINADKSPRGTRIFGPVAR
FT                   ELREHDFMKIVSLAPEVL"
FT   gene            338493..338732
FT                   /locus_tag="LGAS_0302"
FT                   /note="LactoCOG number LaCOG01399"
FT   CDS_pept        338493..338732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0302"
FT                   /product="LSU ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59708"
FT                   /db_xref="GOA:Q046B4"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046B4"
FT                   /protein_id="ABJ59708.1"
FT                   /translation="MFVKTGDKVKVIAGKDKGKEGTVLSVNAKTNRIVVKGVNKIKKHE
FT                   KPSQANANGGVVEKEGSIHASNVKVIAKKEDNNK"
FT   gene            338747..339289
FT                   /locus_tag="LGAS_0303"
FT                   /note="LactoCOG number LaCOG01398"
FT   CDS_pept        338747..339289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0303"
FT                   /product="LSU ribosomal protein L5P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59709"
FT                   /db_xref="GOA:Q046B3"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046B3"
FT                   /protein_id="ABJ59709.1"
FT                   /translation="MVNSLVEKYSNEIAPAMNKKFNYDSVMEIPKIDKIVLNMGVGDAV
FT                   SNAKNLDEAVEELTLISGQKPLITKAKKSIANFRLREGMSIGAKVTLRGDRMYDFLYKL
FT                   INVSLPRVRDFRGISSRSFDGRGNYTLGIKEQLIFPEIDYDKVNRVRGLDVVIVTTANT
FT                   DEEARELLTEFGMPFAK"
FT   gene            339514..339912
FT                   /locus_tag="LGAS_0304"
FT                   /note="LactoCOG number LaCOG01396"
FT   CDS_pept        339514..339912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0304"
FT                   /product="SSU ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59710"
FT                   /db_xref="GOA:Q046B2"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046B2"
FT                   /protein_id="ABJ59710.1"
FT                   /translation="MVMTDPIADYLTRIRNANMAKHSSVEIPASSMKKSLSEILKNEGF
FT                   IRDYQVEDDNKQGMIKIFLKYGPNNERVISGLKRISKPGLRNYVSAENLPKVLNGLGIA
FT                   IISTSAGVITDKEAREKNVGGEVIAYVW"
FT   gene            339937..340467
FT                   /locus_tag="LGAS_0305"
FT                   /note="LactoCOG number LaCOG01395"
FT   CDS_pept        339937..340467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0305"
FT                   /product="LSU ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59711"
FT                   /db_xref="GOA:Q046B1"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046B1"
FT                   /protein_id="ABJ59711.1"
FT                   /translation="MSRIGLKVIEVPEKVTVTKNGDDITVKGPKGELTRYFDPRITFEQ
FT                   KDGEIHFSRSSEADKALHGTERANLASMIEGVTDGYVKKLTLVGVGYRAVAQGKKLTLN
FT                   VGYSHPVVFEAPEGVTVKTPSATSIEIEGISKQVVGQFAAEIRDVRPPEPYKGKGIRYE
FT                   DEYVRRKEGKTGK"
FT   gene            340496..340855
FT                   /locus_tag="LGAS_0306"
FT                   /note="LactoCOG number LaCOG01394"
FT   CDS_pept        340496..340855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0306"
FT                   /product="LSU ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59712"
FT                   /db_xref="GOA:Q046B0"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046B0"
FT                   /protein_id="ABJ59712.1"
FT                   /translation="MISKPDKNKLRLKRHKRIRGKISGTAERPRLSVFRSNKNIYAQLI
FT                   DDVEGVTLASASTNDKNISAEGSKMEQAAEVGKALAETAAKKNIKSVVFDRSGYLYHGR
FT                   VQALADAARENGLEF"
FT   gene            340873..341397
FT                   /locus_tag="LGAS_0307"
FT                   /note="LactoCOG number LaCOG01393"
FT   CDS_pept        340873..341397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0307"
FT                   /product="SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59713"
FT                   /db_xref="GOA:Q046A9"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046A9"
FT                   /protein_id="ABJ59713.1"
FT                   /translation="MANRNDSRRDSRKDRKKDDIEDQLVAINRITKVVKGGRRMRFAAV
FT                   VIVGDRKGHVGFGTGKAQEVPEAIRKAVEAGKKRMIKVPTVGTTIPHEVMGHYGSGNIM
FT                   LKPAEAGSGVAAGGAVRIIMDLAGISDVTSKSLGSNTPINVIRATMDGLSKLKTREDVL
FT                   KLRESAKSLED"
FT   gene            341410..341592
FT                   /locus_tag="LGAS_0308"
FT                   /note="LactoCOG number LaCOG01392"
FT   CDS_pept        341410..341592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0308"
FT                   /product="LSU ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59714"
FT                   /db_xref="GOA:Q046A8"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046A8"
FT                   /protein_id="ABJ59714.1"
FT                   /translation="MDLKVTLIKSVAHRLPKQRKIVKALGLGKVNSTVVLPDNAATRGA
FT                   LLKIAHLISVEEVNK"
FT   gene            341618..342058
FT                   /locus_tag="LGAS_0309"
FT                   /note="LactoCOG number LaCOG01391"
FT   CDS_pept        341618..342058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0309"
FT                   /product="LSU ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59715"
FT                   /db_xref="GOA:Q046A7"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046A7"
FT                   /protein_id="ABJ59715.1"
FT                   /translation="MKLNELKPNEGSRRNRKRVGRGTSSGYGKTAGRGQKGQLARTGGK
FT                   TRLGFEGGQMPLFRRMPKRGFKNVNRKEYAIINLNDLNRFDDGSEVTIDTLKSSGLVKK
FT                   ELAGVKLLANGELKVKLTVKVNKVSEAAKKAVEAAGGTVEVI"
FT   gene            342058..343353
FT                   /locus_tag="LGAS_0310"
FT                   /note="LactoCOG number LaCOG01390"
FT   CDS_pept        342058..343353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0310"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59716"
FT                   /protein_id="ABJ59716.1"
FT                   /translation="MFSTLKNAFKDKDIRSKIFFTLFILLLYRIGANITVPGVNAKAIT
FT                   RVAQTGLVPMLDTVSGGGLDTYSIFSLGVSPYITAQIVIQLLQMDIVPKLVEWGKQGEV
FT                   GRRKTNQVTRYLTLVVAFVQSLGITLGFNVLTEMGLVKTQTPQTYIEIAIIMTAGTMLL
FT                   TWLGDEITDKGLGNGVSVIIFAGIIARLPNGIYQLFKDFIINNSASDRWQGILFFIAII
FT                   IAILLVTQFVTWFQQADLRVPIQYTRRAATSGSESFLPLKVNVSGVIPVIFASSFIITP
FT                   ATILMAFQRSHGNEQWFKICNQIFSLQTTPGALIYTLLIILFTFFYAFVQVNPEKLAEN
FT                   LQKQGAYIPSVWPGKDTQKYVSKILIRLSTVGAVFLGLVALLPQLATNIFGLPSSIGLG
FT                   GTSLLIVIGVVLELARQVDGLLMKREYVGFIR"
FT   gene            343365..344018
FT                   /locus_tag="LGAS_0311"
FT                   /note="LactoCOG number LaCOG01389"
FT   CDS_pept        343365..344018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0311"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59717"
FT                   /db_xref="GOA:Q046A5"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046A5"
FT                   /protein_id="ABJ59717.1"
FT                   /translation="MINLILLGLPGAGKGTASESIVDKYHLAHISTGDMFREAMANETP
FT                   VGLEAKSYIDKGDLVPDEVTAKLVEERLKQPDTKNGFILDGFPRTTVQAELLEGITKRL
FT                   EKPLTNVIAIDVDEDVLIKRLSARYICKNCGATYNKISNPTKVEGTCDRCGGHEFFQRE
FT                   DDKPEVVKNRLEVNKKMNTPLRDFYEEKGILSTVNGEQTPEKVFEDIDKILSKD"
FT   gene            344062..344313
FT                   /locus_tag="LGAS_0312"
FT                   /note="LactoCOG number LaCOG01388"
FT   CDS_pept        344062..344313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0312"
FT                   /product="bacterial translation initiation factor 1
FT                   (bIF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59718"
FT                   /db_xref="GOA:Q046A4"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046A4"
FT                   /protein_id="ABJ59718.1"
FT                   /translation="MTICSCGGTILAKEDVIEVEGKVVDTLPNAMFKVELENGATILAH
FT                   VSGKIRMHYIRILPGDRVTVELSPYDLTKGRITYRFIK"
FT   gene            344328..344444
FT                   /locus_tag="LGAS_0313"
FT                   /note="LactoCOG number LaCOG01387"
FT   CDS_pept        344328..344444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0313"
FT                   /product="LSU ribosomal protein L36P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59719"
FT                   /db_xref="GOA:Q046A3"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046A3"
FT                   /protein_id="ABJ59719.1"
FT                   /translation="MKVRPSVKPMCEHCKIIKRHGRVMVICSANPKHKQRQG"
FT   gene            344478..344825
FT                   /locus_tag="LGAS_0314"
FT                   /note="LactoCOG number LaCOG01386"
FT   CDS_pept        344478..344825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0314"
FT                   /product="SSU ribosomal protein S13P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59720"
FT                   /db_xref="GOA:Q046A2"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046A2"
FT                   /protein_id="ABJ59720.1"
FT                   /translation="MARIAGVDLPRNKRVVVALTYIYGIGEPTAKKICKDAGISEDIRT
FT                   NDLTPEDQEKLRSEVDKYRVEGDLRREVSLNIKRLVEIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGSKRK"
FT   gene            344850..345239
FT                   /locus_tag="LGAS_0315"
FT                   /note="LactoCOG number LaCOG01385"
FT   CDS_pept        344850..345239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0315"
FT                   /product="SSU ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59721"
FT                   /db_xref="GOA:Q046A1"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046A1"
FT                   /protein_id="ABJ59721.1"
FT                   /translation="MAAKKTARKRRVKKHVESGVAHIHSTFNNTLVMITDVQGNAVAWS
FT                   SAGALGFKGSRKSTPFAAQMAAEAAAKSAMDQGMKHVEVSVKGPGAGREAAIRALQAAG
FT                   LEITAIRDVTPVPHNGSRPPKRRRV"
FT   gene            345285..346223
FT                   /locus_tag="LGAS_0316"
FT                   /note="LactoCOG number LaCOG01384"
FT   CDS_pept        345285..346223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0316"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59722"
FT                   /db_xref="GOA:Q046A0"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q046A0"
FT                   /protein_id="ABJ59722.1"
FT                   /translation="MIEFEKPNITVVDQEEAYGKFVVEPLERGFGTTLGNSLRRVLLTS
FT                   IPGTALSYIQIDGVLHEFSTVPGVREDVTKIILNLKKLELKSLSDEEKIAEIDVTGPAI
FT                   VTAADLKVDSDIEVLNPDQYICSIADGGHLHMNVAIKNGRGYVPASENKTDDMPIGVIP
FT                   VDSLFSPIKKVNYQVESARVGKRDDYDKLTLEIWTDGSITPNDALSFAAKILVEHFKVF
FT                   MSTDMDAQFDDVMVEKEDDKNEKKLEMTIEELDLSVRSYNCLKRAGINTVQELTDKSEA
FT                   DMMRVRNLGRKSLEEVKNKLAELGLSLRQDD"
FT   gene            346250..346633
FT                   /locus_tag="LGAS_0317"
FT                   /note="LactoCOG number LaCOG01383"
FT   CDS_pept        346250..346633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0317"
FT                   /product="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59723"
FT                   /db_xref="GOA:Q045Z9"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045Z9"
FT                   /protein_id="ABJ59723.1"
FT                   /translation="MAYRKLGRDSAHRKAMLREMTTQLIMNERIVTTETRAKEIRKTTE
FT                   KMITLGKRGDLSARRKAAAFVRNEIADIHEEKDAVVVKSALQKLFSDIAPRYKDRNGGY
FT                   TRMYKLATPRKGDAAPMVIIELV"
FT   gene            346807..347664
FT                   /locus_tag="LGAS_0318"
FT                   /note="LactoCOG number LaCOG00190"
FT   CDS_pept        346807..347664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0318"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59724"
FT                   /db_xref="GOA:Q045Z8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045Z8"
FT                   /protein_id="ABJ59724.1"
FT                   /translation="MIFMKDNIVTVEHLSFTYKDSEEPAVKDVSFSIPKGTWTTLVGHN
FT                   GSGKSTIARLLNGILLPDDNPETLINIDGITLTEKTMWDIRDRVGIVFQNPDNQFVGAT
FT                   VEDDVAFGLENRQVPRPKMKSIVQDVLNQVGMTNFQKSEPQYLSGGQKQRVAIAGILAI
FT                   GPKLIILDESTSMLDPAGKFKILKLIRKLQKENELTIFSITHDINEAEHADQILVLDKG
FT                   SLLASDSPVDIFKDVSLIKNAGLDLPLFYKIKNKLINKGISIPQEVNTEEKLVKYLCQL
FT                   NSKM"
FT   gene            347640..348506
FT                   /locus_tag="LGAS_0319"
FT                   /note="LactoCOG number LaCOG00191"
FT   CDS_pept        347640..348506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0319"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59725"
FT                   /db_xref="GOA:Q045Z7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045Z7"
FT                   /protein_id="ABJ59725.1"
FT                   /translation="MSIEFKNVDYIYAPGTPFQTQGLTNISFKIRSGSFVAIAGHTGSG
FT                   KSTLMQHFDGLLLPSKGSVTIADKSITSNTSSKSLKEIRKKVGLVFQFPESQLFEETVL
FT                   KDVMFGPLNFGFSEQKAKEQAIQWIRKVGLSEQVMNKSPFELSGGQMRRVAIAGVMAYE
FT                   PDILCLDEPAAGLDPEGQKQMFDIFKNYQREGHTVILISHNMDDISQYADDMLVLEHGH
FT                   LIKHASPKEVFSDPDWLKKHFLDEPATSKFARKLEKGGFQFSEMPLTVDSLVNEITTKL
FT                   KSKGGNE"
FT   gene            348503..349306
FT                   /locus_tag="LGAS_0320"
FT                   /note="LactoCOG number LaCOG00192"
FT   CDS_pept        348503..349306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0320"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component CbiQ related transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59726"
FT                   /protein_id="ABJ59726.1"
FT                   /translation="MSKIIIGRYIPGNSIIYKMDPRGKIIATFLFIVIIFLANNWLSYL
FT                   FLSFFTLLAVGATKLKPKVFWDGVKPLIWLILFTSVLQLFFTTGGKVYWHWGIFNISEY
FT                   GIQNSIFIFIRFVMIILISTVLTLTTTSLEIADGMEWLLRPLGYLKVPVAQIALVMSIA
FT                   LRFVPTLLDQAVRIMNAQRARGADFNSGGLIKRIHAIIPILIPLFISSLTIAIDLATAM
FT                   EARGYREGAKRTRYRVLRWSKYDWDWVNLGYFALLTLILLLTRTY"
FT   gene            349307..350101
FT                   /locus_tag="LGAS_0321"
FT                   /note="LactoCOG number LaCOG00330"
FT   CDS_pept        349307..350101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0321"
FT                   /product="Pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59727"
FT                   /protein_id="ABJ59727.1"
FT                   /translation="MMTTRYKLTMAYDGHLFHGFQIQPNERTVQGVIEEALKKMTKGKR
FT                   VVVHGSGRTDAGVHAKGQVIHFDYPGKEIPAKNMMLALNALMPIDTVFFDSEIVDSDFH
FT                   VQYSTKGKWYRYIVDQHRFTDPFNRFYTGHYPYPLDIALMKKAAKDLIGEHDFTSFAAS
FT                   GGQIVDKVRTIYYVNITSDPDNKKIIFDFIGNGFLYNMVRILVGTLLEIGNKKRPVDDI
FT                   PRVLAAKDRQEVRTTAPASGLYLQHVFYEEVPKKYRLDLKKD"
FT   gene            350171..350647
FT                   /locus_tag="LGAS_0322"
FT                   /note="LactoCOG number LaCOG01522"
FT   CDS_pept        350171..350647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0322"
FT                   /product="LSU ribosomal protein L13P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59728"
FT                   /protein_id="ABJ59728.1"
FT                   /translation="MSNRRKTEEFKVRTTPLAKTSDIKRKWYVIDATDVSLGRLSTAVA
FT                   SILRGKNKPQYTPNVDTGDYVIVVNAGKLKLTGKKATDKIYYHHSDYRGGLRATPAGEL
FT                   LAKNPVRLVELSVKGMLPKNTLGHQEFMKMHVYAGEDHEHAAQKPEKLDINELI"
FT   gene            350661..351056
FT                   /locus_tag="LGAS_0323"
FT                   /note="LactoCOG number LaCOG01521"
FT   CDS_pept        350661..351056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0323"
FT                   /product="SSU ribosomal protein S9P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59729"
FT                   /protein_id="ABJ59729.1"
FT                   /translation="MAQQAAYAGTGRRKDSVARVRLVPGNGQITINKEDVTKYIPYPNL
FT                   VQDMKQPLALTETEGQYNVEVNVNGGGFSGQAGAIRLGIARALLEVDPDFRGPLKKAGM
FT                   LTRDPRMKERKKPGLKKARKASQFSKR"
FT   gene            351179..351619
FT                   /locus_tag="LGAS_0324"
FT   CDS_pept        351179..351619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59730"
FT                   /protein_id="ABJ59730.1"
FT                   /translation="MIIYTRYKFNGEVLFSRFINFEEIMDRKYSCLGQMTRVTIKGRKT
FT                   YEGFADEPYLSNKGKCLTLIWYDIDYGTLGLRSGKVTTIFIPLDIIIGIESILHSNPRW
FT                   GHPPINEFVFSSELRSRLMKLHEKYMQSEEKSRPKKIYLNFD"
FT   gene            351689..352555
FT                   /locus_tag="LGAS_0325"
FT                   /note="LactoCOG number LaCOG01460"
FT   CDS_pept        351689..352555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0325"
FT                   /product="Predicted nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59731"
FT                   /protein_id="ABJ59731.1"
FT                   /translation="MKYLITGATGNLGEKVTRWLRTMTSENNIRVGIHNLKKANKFDDL
FT                   AVEKVKLDYFDLDTLQKAVSGVDLVVYIPSLTYDLQKRITEFENVLQVVKNAKAKLIFV
FT                   SFFADQENNPFVMSPFYAYVPRRLASSNVEYSIVKNSLYADPLVPYLEELIKRKNIIYP
FT                   VGTQPLSFITRNDSAHAIACLAMQPVMRDQGQTYLLSMDKNYNMVELSYIMSRITDHKI
FT                   GYAPVTTTEFAKIYAQEGDGKELASMYAGGAKGLLSATSDDFHRLTGREPEEVEHFLRN
FT                   GYQIARL"
FT   gene            complement(352802..353386)
FT                   /locus_tag="LGAS_0326"
FT                   /note="LactoCOG number LaCOG01996"
FT   CDS_pept        complement(352802..353386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0326"
FT                   /product="4-methyl-5(B-hydroxyethyl)-thiazole monophosphate
FT                   biosynthesis enzyme, amidase family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59732"
FT                   /protein_id="ABJ59732.1"
FT                   /translation="MTKVAVVFADGCEEVEGLSVVDVLRRLNIDCDMVGLDKKEIDGDH
FT                   HILLTCDKVVDDSLLDYDLVAFPGGRTGALNLRNNKKLADLMIQRNKAGKWDAAMCAAP
FT                   IALGHYGLLEGANYTCYPGFEKQIEEECPNGHFSTDITVVDKEHKIITSRGPATAWAYA
FT                   YTIARTLGHDTSDLEKGMLYDYLAKNIDASL"
FT   gene            353664..354353
FT                   /locus_tag="LGAS_0327"
FT                   /note="LactoCOG number LaCOG00658"
FT   CDS_pept        353664..354353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0327"
FT                   /product="Phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59733"
FT                   /protein_id="ABJ59733.1"
FT                   /translation="MATEVYLVRHGETMFNQLNKVQGWADSPLTVKGINDLKVTASNLS
FT                   QVHFDKMYSSDLKRAIDTVHLIADTNEVSEIGKIKKLPAFREVFFGTFEGDDIDETWEK
FT                   VAKAGGMKPTSDVVKIIQTLGIHDFREATKKADPRHLAEDAEALDNRMDQAISQLAQET
FT                   KGLGRVLVVSHGDFIKTLGIKYWDQASGDHDIPFPDNGSVTRGIIDNSGKFRIINYGVK
FT                   NTDIPNL"
FT   gene            complement(354380..354715)
FT                   /locus_tag="LGAS_0328"
FT                   /note="LactoCOG number LaCOG01051"
FT   CDS_pept        complement(354380..354715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0328"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59734"
FT                   /protein_id="ABJ59734.1"
FT                   /translation="MVIIMRLNTSLVNEAAKIYKVLSNSRRISILFFLRNSSKEVDVST
FT                   IATTLELAQPVVSKQLGILEKYNLVKHHKHGTHVFYFLNDPDVLSMIDAMIEHVEHTAK
FT                   EHPSNLY"
FT   gene            354801..355685
FT                   /locus_tag="LGAS_0329"
FT                   /note="LactoCOG number LaCOG01052"
FT   CDS_pept        354801..355685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0329"
FT                   /product="Co/Zn/Cd efflux system component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59735"
FT                   /protein_id="ABJ59735.1"
FT                   /translation="MKDKSSLRYFWVTLLNIIITIAEFIGGAISGSLALLSDAVHNLSD
FT                   VGSIVLAFVANLISKRKRNTSKTFGYDRAEILAAFTNGIILIVISIYLFIEGIQRFSHP
FT                   EPIRGMIMLIVSLIGLAANVISMFVVMKEAKTSLNAKATFLNMLSDAITSVAVVLGAIV
FT                   ISIWKIYWIDPVLTIAASVFLLKEAYEVTIKAANILMETNPSIDLNKVNELVLSCPHVN
FT                   NIHHVHVWQYSDNVTMLDAHINVDKNLDAVQLEKIYTEIAEKLKSLGINHVTLQAECTR
FT                   GIDDKMIFADKED"
FT   gene            355697..356008
FT                   /locus_tag="LGAS_0330"
FT                   /note="LactoCOG number LaCOG03224"
FT   CDS_pept        355697..356008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59736"
FT                   /protein_id="ABJ59736.1"
FT                   /translation="MLLFGKIGAKPFIFMEKKMKFDTDDLKESLKNYQQKASDQFKDFA
FT                   ENDWPDIKDHMTEKGQQAGDYLKKNGGKVYQNSVKAFKKGVRDLDQWVNGTSVHKDDK"
FT   gene            356010..356195
FT                   /locus_tag="LGAS_0331"
FT                   /note="LactoCOG number LaCOG03092"
FT   CDS_pept        356010..356195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59737"
FT                   /protein_id="ABJ59737.1"
FT                   /translation="MKVNIWVAVIVLIVGLWDLYYAYNRYQEKKVTKRGSKADAISFAI
FT                   LGTIFTIGGIIMLFMH"
FT   gene            356202..356891
FT                   /locus_tag="LGAS_0332"
FT                   /note="LactoCOG number LaCOG01638"
FT   CDS_pept        356202..356891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0332"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59738"
FT                   /protein_id="ABJ59738.1"
FT                   /translation="MVRNLVKLVLVRHGESIANRDNVYTGWNDVPLSKKGIEQAKDAGL
FT                   KVAKIPDFVPTHIHTSVLSRAIMTANIIADVCSFLYLPITKTWRLNERHYGALRGINKD
FT                   VSKKIFGKEQVLKWRRGFDSVPPLLTQPVQDRRYQKYDMRLMPQGESLHQTQDRLMPYF
FT                   WDHIAPELMSGHDQLIVAHGSSLRALIKKIEGISNKDIVKVEVPNAEPIVYTFDSDLHI
FT                   IKKEILH"
FT   gene            357001..357936
FT                   /locus_tag="LGAS_0333"
FT                   /note="LactoCOG number LaCOG02171"
FT   CDS_pept        357001..357936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0333"
FT                   /product="Predicted kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59739"
FT                   /protein_id="ABJ59739.1"
FT                   /translation="MRKIFLLRGAPGSGKSSFIARHHLQPYAISRDEIRLLLADLTVYY
FT                   EESTDHLHQVIPRHVTVRTEQMVDNLVQHKMAYGETVIVDGTHITPDKIEHFRPWVEKY
FT                   RYELFVVDLMQNNSLESLLRRNQTRMHYDWVKPDVIKMMYEQYEANPEVPSWAYSILPN
FT                   GMERALSQREKNLDHYSHVVCVPDKVKPEDFPHVHISNFYFSFNDEFTRKYGTYRNVIT
FT                   LGKTRDEVIEQFRLPYFVFKFHHKHFLISAYPIRNEMLDPIRKVKGVWSYSTGLYNVAD
FT                   FVKEFPENEHQHVHQFNLSKIDPTRLLHIW"
FT   gene            complement(358001..359350)
FT                   /locus_tag="LGAS_0334"
FT                   /note="LactoCOG number LaCOG01254"
FT   CDS_pept        complement(358001..359350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0334"
FT                   /product="aminopeptidase C, Cysteine peptidase, MEROPS
FT                   family C01B"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59740"
FT                   /protein_id="ABJ59740.1"
FT                   /translation="MSKEITNDLINDFENDFNSSKANKIAARAAQENGIFKASQNLQTK
FT                   INLDPTFSIEIDTGKVANQKQSGRCWMFSALNTMRHSIQKNFKIKDFELSQNYTNFWDK
FT                   FEKSNWFFENVIATADKDLGDRKVSFLFTTPQQDGGQWDMLCGIIEKYGIAPKKVYPET
FT                   ANATNSSALNDTLNTLLRKDGLELRKMVQDGKSEDEVQARKNEMLREVYRILAISLGVP
FT                   PKKFDFEYKDDDGNYHRDADLSPQDFFKKYVNWDLSQYISTINAPTKDKPFHKVFSVEY
FT                   LGNVEGGRQVRHLNLPVDEMKDLIIKQLKNGEVVWFGSNVVKDSERQAGLLDTELYKRD
FT                   DLFDVDFNMSKADMLDSGESMMDHAMVITGVDLVDGKPTKWKIENSWGEKPGFKGYFVM
FT                   SDKWFDKFVYQAVINKKYLSDDLKKAFEEGSKDPIQLLPWDPMGALAKNY"
FT   gene            359544..360095
FT                   /locus_tag="LGAS_0335"
FT                   /note="LactoCOG number LaCOG00115"
FT   CDS_pept        359544..360095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0335"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59741"
FT                   /protein_id="ABJ59741.1"
FT                   /translation="MKKRGFEIVSKYRNAGLHLPQRQTIASAGYDFECAQDIVLPSIWC
FT                   TNFVRIFRLIRNSHELNERDLELAEKVLKPFLVPTGIKAYMPEDEVLILANRSSNTYKR
FT                   NVTLPNGIGVIDSDYYNNEKNEGEIYFQLINYGVRPLKIKKGERIGQGIFMPYLKADND
FT                   EPVQRQRLGGFGSSGTRNEE"
FT   gene            360095..361474
FT                   /locus_tag="LGAS_0336"
FT                   /note="LactoCOG number LaCOG01381"
FT   CDS_pept        360095..361474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0336"
FT                   /product="DNA replication and repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59742"
FT                   /protein_id="ABJ59742.1"
FT                   /translation="MAKVKTRYKCRNCGYISASYLGRCPNCGAWNQFEEETQEVKKVST
FT                   KATASRLMTKIGNNDPVKLNEVKAEKEKRIVTPFEELNRVLGGGIVPGSLVLIGGDPGI
FT                   GKSTLMLQITGALAKEHSVLYVSGEESASQIKMRADRLGVSNSGILLYPETNMQNIREQ
FT                   IDEIKPDFLVIDSIQTMNEPSLDSMVGSASQVREVTSELMKIAKNDQITTFVIGHVTKE
FT                   GAIAGPKIMEHMVDTVLYFEGDGHHSYRILRSVKNRFGAANEIGMFEMKNEGLTEVNNP
FT                   SAIFLDERLPNSTGSAVVVSLEGTRPLLADIQALVTPTAFGYAKRTTSGLDFNRVALLL
FT                   AVLEKRGNLMLQNQDAFLTATGGIKLNEPAIDLAICMAVASSYKNKEISATDCFVGEVG
FT                   LTGEIRRVNQIEARVKEAAKVGFKRIFIPKHNLTTELKNNSAIEVIGVASLPQALKLVF
FT                   N"
FT   gene            361556..363055
FT                   /locus_tag="LGAS_0337"
FT                   /note="LactoCOG number LaCOG01374"
FT   CDS_pept        361556..363055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0337"
FT                   /product="glutamate--tRNA(Gln) ligase / glutamyl-tRNA
FT                   synthetase"
FT                   /EC_number="6.1.1.24"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59743"
FT                   /db_xref="GOA:Q045X9"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045X9"
FT                   /protein_id="ABJ59743.1"
FT                   /translation="MAKQKIRVRYAPSPTGHLHIGNARTALFNYLFARHNKGTMVLRIE
FT                   DTDQKRNVEGGSKSQMENLHWLGIDWDEGPDKGGDFGPYRQSERKDIYNKYIKQLIDEG
FT                   KAYYSYKTEEELEAQREEQRAMGIAPHYTYEYEGMTADEIKQAQADAEAKGLKPVVRIH
FT                   IPENRTYAWDDMVKGKVSFESDTIGGDFVIQKRDGMPTYNFAVVIDDHLMEITHVLRGD
FT                   DHVANTPKQLVVYEALGWEPPKFGHMTLIINSETGKKLSKRDESVLQFIEQYRDLGYLP
FT                   EAMFNFITLLGWSPVGESEIFSQRELIKSFDPKRLSKSPAAFDQKKLEWINNQYVKKAD
FT                   RDVLLDLALNNLQEAGLVGKEVSPEKMEWVRQLVNIYAVQMSYTKQIVDITKIFFEEAP
FT                   ELSDAEVEEIKKDDARPVIEEFKKQLNAIPRFTAVQVMNAIQATRRETGVKGRKLFMPI
FT                   RIAATRSMVGPGIGEAIELMGKEKVNKHIDLTLKQLSDLGL"
FT   gene            363143..364561
FT                   /locus_tag="LGAS_0338"
FT                   /note="LactoCOG number LaCOG01232"
FT   CDS_pept        363143..364561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0338"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59744"
FT                   /db_xref="GOA:Q045X8"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045X8"
FT                   /protein_id="ABJ59744.1"
FT                   /translation="MIMKVFNTLTRQKEEFKPLVAGKVSMYVCGPTVYNYIHIGNARSV
FT                   IAFDTIRRYFEYRGYDVKYVSNFTDVDDKMINEARKEHTTVGELADRYIKAFMEDTEAL
FT                   NIEPATLHPRATHEIQEIIDFVQDLIDKGFAYEVDGDVYYRAKKFPNYGQLSDQNIAEL
FT                   EEGASEHINEEEQSKKEDPIDFALWKAQKDDDEIAWDSPWGKGRPGWHIECSVMSTKYL
FT                   GDTIDIHGGGQDLEFPHHENEIAQSEAKTGKKFVNYWMHNGFVTVGKKQEKMSKSLHNF
FT                   VTVHDILKQIDPQVLRFYMSSVQYRRPINYSEDGLKQAETVLKRYQNTLRNLDARLMDE
FT                   QETLEDSILRDNLTQAKAEFIEAMDDDFNVQNALSIMYDLTSNLNTHLQKNQVDKPALK
FT                   KAKKLLLAWLEIFGVSFNEKQTENDDEIEVMVAKRDEARKNKNWAESDRLRDELQAKGI
FT                   VIEDTPQGTRWHRA"
FT   gene            364521..364997
FT                   /locus_tag="LGAS_0339"
FT                   /note="LactoCOG number LaCOG01231"
FT   CDS_pept        364521..364997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59745"
FT                   /protein_id="ABJ59745.1"
FT                   /translation="MKILHKERGGIVLKPKVLTEKKTNPDSLGPLTLAYLGDGVYEVYI
FT                   RRHLVKGGIVKPQMLQRYATHYVSAKAQAGLITKMQDLKMLDEAELAAFKRGRNAKSHT
FT                   HAKNTSINTYKLSTGFEAMFGYLDLLGKKDRVDELANWCIDQVEQGGLDDYEFE"
FT   gene            364984..365739
FT                   /locus_tag="LGAS_0340"
FT                   /note="LactoCOG number LaCOG01248"
FT   CDS_pept        364984..365739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0340"
FT                   /product="rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59746"
FT                   /protein_id="ABJ59746.1"
FT                   /translation="MSSNNDEFVYGRHAGIDFLKTQDANLINKVFLQNGVQEEFANQVY
FT                   QLARKKNLVVQNAPKNKLDQMVNHENHQGLVLTVAPFEYADLDELLDKFDQDGKDPFIL
FT                   MLDSIEDPHNLGSILRTCDATGVDAVIIPKRRATGLTSVVAKTSTGAIDYVPVARVNNL
FT                   VQTTKLLKKRGYWIFGTAMEGEDYRKWNANGKTVLVIGNEGKGISPLLLKQMDQTLTIP
FT                   MVGHVQSLNASVATGVLLYGMFNSRHPEK"
FT   gene            365869..366783
FT                   /locus_tag="LGAS_0341"
FT                   /note="LactoCOG number LaCOG00950"
FT   CDS_pept        365869..366783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0341"
FT                   /product="transcriptional antiterminator, BglG family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59747"
FT                   /protein_id="ABJ59747.1"
FT                   /translation="MGLFSSLFLSFFKEVGELLLIKRVFNNNSALVELGNNREAVVVGN
FT                   GIAFKKTEGKEIDTSKVENIFYLENSATKRTIFSLLKNTPIDIAVTTMHVVNHAYKKYH
FT                   YELFDYFYLSLSEHILGVYHRILDNTYQTSQIPDIKDEYPLENKIAQESVKIIERDLKI
FT                   KLPVSERKNIMLHLINARIPEKKQVNREKNIINIEEMLHIVQVILDQHNIYRLASNNDE
FT                   YERFMIHLQYLFRRLEQGKKFRSSDITKKVKDELISEYPESFVVVKEIDEQLKQDFQWE
FT                   ISDEEKLYLIVHIQRIYEKSSKY"
FT   gene            366793..367152
FT                   /locus_tag="LGAS_0342"
FT                   /note="LactoCOG number LaCOG00304"
FT   CDS_pept        366793..367152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0342"
FT                   /product="PTS system lactose-specific IIA component, Lac
FT                   family"
FT                   /note="TC 4.A.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59748"
FT                   /protein_id="ABJ59748.1"
FT                   /translation="MVSKEEISMVGFTIVAYAGDAKTDLLNALKLAREGKFEEAEKLIE
FT                   EANNSLVDAHNAQTKLMSQEASGEELETTFIMSHGQDTLMTTMLLRDEVKYFIDLYKQN
FT                   LALRAEIEQLKEKMN"
FT   gene            367171..368874
FT                   /locus_tag="LGAS_0343"
FT                   /note="LactoCOG number LaCOG00113"
FT   CDS_pept        367171..368874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0343"
FT                   /product="PTS system lactose-specific IIB component, Lac
FT                   family / PTS system lactose-specific IIC component, Lac
FT                   family"
FT                   /note="TC 4.A.3.1.1; TC 4.A.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59749"
FT                   /protein_id="ABJ59749.1"
FT                   /translation="MDGLVKRIEKAQPFFRKVATNQYLRAIRDGFIALMPIIIFSSFFL
FT                   LIANVPQIWGFVWPKKVATALNLFYNLSMGFLSLMAASTVAKALTGSLNLKLPKTNQIP
FT                   VAGVQYTAQISFAFVAIDTLLNKGNLYLATDMIGTKGLICAFLVAFIVPNIYYFCFKHN
FT                   VTITLPDVVPQNIAQAFKNIVPFAIATTFFWAFTLIFRALTNMNLAAWIIKSLTPLFTA
FT                   ADGYVGLAIIYGAMAFFWFIGIQGPSIVEPAVTAIYLTNVEANLRAFNSGNIQGANHIL
FT                   SQGIQMFVATLGGTGATLVVTFMFAFLSKSKQLKAVGRASTIPVIFGVNEPILFGAPLI
FT                   LNPIFFIPFIFAPILNVWIFKIFVDVLHMPSFIYNLPWTTPPTLGLWMGTGFNILALLL
FT                   GILLLVVDSLLYYPFFKAYDASMLAQEEKKEELEEKDNKKSVVSSAEPKFNESEIPLGK
FT                   TKDQQALNVLVLCAGGGTSGILAKSLNKLAKEDKLPLNAAAAAFGSHHDLISGMDVVIL
FT                   APQMDTMKDELAKECKQNNARMITTTGKQYIYMTQHANECLKLLINDINK"
FT   gene            368858..370312
FT                   /locus_tag="LGAS_0344"
FT                   /note="LactoCOG number LaCOG00306"
FT   CDS_pept        368858..370312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0344"
FT                   /product="6-phospho-beta-galactosidase"
FT                   /EC_number="3.2.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59750"
FT                   /protein_id="ABJ59750.1"
FT                   /translation="MILINDGGSMSTLLKRVKKLPKGFVWGAATAAYQVEGNTNLDGKG
FT                   KIMWDDYLKNQGNFSPNPACDFYHRYPEDLKIAHNLGLNAIRISIAWTRIFPNGYVTDE
FT                   PNEAGVKYYHRLFHECLKNNLVPYVTLHHFDSPKTLFDQGDWLNREMIDEFVKYADFCF
FT                   QEFVEVDNWFTINELISLAMCQYIQGTFPPNKLFDVSDAIQAQHNELVAHAKVVNLFKA
FT                   KGYKGRIGLIHVIQPVYPATNSEADRHAADLRDAFMNRFLLDGTLLGFYSDRTRHLIKE
FT                   ILVANNAELHILPEDLEILKQASKQNDMLGINYYQNQTVASYDGPSETYHNGNGKKGSS
FT                   VFAFHGVGKDVRNPAIPTTDWDWNIYPEGLYDVLKRIAHDYPDYPVIYITENGMGAKEA
FT                   WDSSKEYLDDNYRIDFIDQHLAAILKARNEGVNVQGYFLWSLQDQFSWSNGYNKRYGLI
FT                   YVDFASQDRHLKRSALWFKALSKTMK"
FT   gene            370457..371014
FT                   /locus_tag="LGAS_0345"
FT                   /note="LactoCOG number LaCOG01447"
FT   CDS_pept        370457..371014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0345"
FT                   /product="ComX"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59751"
FT                   /protein_id="ABJ59751.1"
FT                   /translation="MEKVNEVYLIRRVKEKQDMKALHELLDRYRPLINGAKMNFFIRNF
FT                   DNDDWEQEALIMCYQSCCTYDEDRADNFGAYYRTKFYNHLRSLLRYELAQKRTAFTKSI
FT                   SYDNVVQKNLIKEEVEEMHITPRKEMYQKFIKELSDKEVIALKVFLGELTIEEASQKTK
FT                   YSRYQLLQAKARCKAKMQKELF"
FT   gene            371082..371300
FT                   /locus_tag="LGAS_0346"
FT                   /note="LactoCOG number LaCOG01978"
FT   CDS_pept        371082..371300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59752"
FT                   /protein_id="ABJ59752.1"
FT                   /translation="MADEVIKTELLDRHMKEVFDWSDSDIPVRDALWDYFMEKNGRDTM
FT                   KTESDMLPFLKDSDDKIEAFVNENLKK"
FT   gene            371424..372932
FT                   /locus_tag="LGAS_0347"
FT                   /note="LactoCOG number LaCOG01473"
FT   CDS_pept        371424..372932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0347"
FT                   /product="gluconate kinase, FGGY family"
FT                   /EC_number="2.7.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59753"
FT                   /protein_id="ABJ59753.1"
FT                   /translation="MDYIIGMDIGTTASKGVLYQENGKKIAEATIPYPLIQEKVDQAEE
FT                   DPQVIFDAVQKIIFDLSKKVSGKISAISWSSQMHSLIGLGKDNQLLTNSITWADNRSRE
FT                   VVTTAKKSGLANSIYQRTGMPPHPMAPVYKLLWIKEELPELFTQVQKWIGIKEYIIWRL
FT                   TGKMMTDITMAAGTGLLNLKNLSWDEDLLNQINLEKEKLPTLDKPETVVEGIIPNYIQK
FT                   LGLSDQTKIILGASDGYLSTIGVGVLNEKSFALNVGTSGAVRVIAPEVVVDSENRFFCY
FT                   PVDKKHYLLGGPVNNGGIVFEWARKTIFGPDQTAEDFINVAESVPAGSNGLIFHPYLGG
FT                   ERAPIWNAQARGSFIGLTRNHTKPQMARSVLEGIVFNLLGAARGLREKIGEPDALRVTG
FT                   GFVKSDFVRQLIADIFNLPVIVIKNDQSGTLAAMFLAQVGMKKEADLEKIAKKIDGSKI
FT                   YFPNPKNVAVYQDIIPIYREVEHDLDQSYEKIASFQEKYPKLFE"
FT   gene            complement(372980..374116)
FT                   /locus_tag="LGAS_0348"
FT                   /note="LactoCOG number LaCOG00594"
FT   CDS_pept        complement(372980..374116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0348"
FT                   /product="Glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59754"
FT                   /protein_id="ABJ59754.1"
FT                   /translation="MKIIIAPDSFKGSLTAKEVANSIYTGLKRALPSVEYIEIPMADGG
FT                   EGTMQALVDATNGKIFTKSVRGPLNTSVAAHYGILGDKKTAVIEMAEAAGLQYVNDQTK
FT                   NPLITTTYGVGELIKTVLDAKIRKIIIGLGGSCTNDGGAGMAQALGVKLLNLQGKDIPF
FT                   GGGNLSQLIRIDNSKIDPRLKDTEIILASDVTNPLTGKNGASTVFGPQKGATPEMVKKL
FT                   DQNLHHFAAIARRDLKQDYEHTPGAGAAGGLGFGLLTFTNATIQSGVEAVLEMTNFKEK
FT                   TKNADFIFTGEGATDFQTQFGKTPYGVAKAAKEVAPNSTVICLTGNIGKKVSELYGPID
FT                   AIFATESGAKDLKQAIKDSKHDLAQTSENIGRLIKKLK"
FT   gene            complement(374215..374340)
FT                   /pseudo
FT                   /locus_tag="LGAS_0349"
FT   gene            complement(374678..375973)
FT                   /locus_tag="LGAS_0350"
FT                   /note="LactoCOG number LaCOG01099"
FT   CDS_pept        complement(374678..375973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0350"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59755"
FT                   /protein_id="ABJ59755.1"
FT                   /translation="MNKHPEFLLNKIENPKDLKKLDLKELEQLASEIRTLILEKDAAEG
FT                   GHLGPDLGIVEATIAYHYVFDAPKDKIIWDVSHQTYPHKMLTGRAYAWLDPDKYEDVTP
FT                   YSNPDESPYDYYAVGHTSTSVALATGMARARDMMGNHENITALIGDGSLTGGLAFEGFN
FT                   NAADEKHNLIIVVNDNQMSIDDNVGGVVTALKKLRESNGQAEDNPFTAMGLDYKYVGQG
FT                   NDIKSMIDAFKAVKDIDHPIVLHINTLKGKGYEPAIENEASHHWVLPFDLKTDKPTVPA
FT                   PKTPNASTVILDFLKKHIENQENILVINAAIPGVFGLGEIKNNYPKNYKDVGIAEQESV
FT                   AFAAGAVKEGITPILFENSTFLQRAYDQLSHDVAANDLPVVMIVAGGGITAASKTHLGI
FT                   FDNTMVANWPNWEYLAPTTLNELKSMLEWAVK"
FT   gene            complement(376072..377319)
FT                   /locus_tag="LGAS_0351"
FT                   /note="LactoCOG number LaCOG01775"
FT   CDS_pept        complement(376072..377319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0351"
FT                   /product="Permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59756"
FT                   /protein_id="ABJ59756.1"
FT                   /translation="MNKKQNSSHFFAWWVFIASCLISLVGFGLIVNTIGLFFEPISKSF
FT                   HVGRASVALMTTLQNAAAAITLLFAGKIMTKLNLRWLLTFCFTAIGISILSLSVAQSLT
FT                   HFYIAWIIIGICQPIAITLSIPVLLGNWFNEKLGTVMGIALGVSAFGGTIFNPIIGDII
FT                   TNFGWRGGFICEGLLILGILVPTAFFLREKPNKKHHAYGKVKNIPEKVLETTGISLKAA
FT                   LKTPVFYALAFAMLALQFVSGSVQHISGHITSQGLPLTIGASVVSGVMLGAAAGKISIG
FT                   FMLDRFNTRLTLLIYSLFGLLGWSGEIFFKTSLPLIASAFILGLGQGVCLVALPYLIRE
FT                   EFGAKDYSTILSVINMAGAFAMSASVYLNGLLFDTTGSYNFGWAINSAAFALSFIALFL
FT                   TLKKQTTSQGLEESID"
FT   gene            complement(377416..378432)
FT                   /locus_tag="LGAS_0352"
FT                   /note="LactoCOG number LaCOG00120"
FT   CDS_pept        complement(377416..378432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0352"
FT                   /product="Geranylgeranyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59757"
FT                   /protein_id="ABJ59757.1"
FT                   /translation="MLEKRNNIKNKFTFWDSFPQVQKDMIEISHIILTHVNSVPGLLGQ
FT                   ALEDTFAVPGKMLRPACVMLFGAFGPDADQKHDELQKIATSIETLHNATLIHDDIIDES
FT                   SMRHGRPSIQTKYGKHIAVYAGDYLVALSLTLLSENAQSLHSVIADGKTMQNILVGETE
FT                   QYNNAYNIDISEKEYLDQIKGKTGVLFGLACFIGAYESGTKVTKALKTKKFGEYLGQAF
FT                   QLRDDILDYTTTSSTFKKPVLLDVKDGIYSGPLIFALQNDDNNHLHELVKMGKDLTQDQ
FT                   LHEIENLVNHLGGVERAQKLADQYTEKALASLKKHWPDNENRALIEQLTGRLLKRQY"
FT   gene            378835..379005
FT                   /locus_tag="LGAS_0353"
FT                   /note="LactoCOG number LaCOG01417"
FT   CDS_pept        378835..379005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0353"
FT                   /product="LSU ribosomal protein L33P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59758"
FT                   /db_xref="GOA:Q045W4"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045W4"
FT                   /protein_id="ABJ59758.1"
FT                   /translation="MQFRSGFMAVKKAALACTVCGSRNYSIAASKNRTQRLELKKFCKH
FT                   CGKQTLHKETR"
FT   gene            379013..379183
FT                   /locus_tag="LGAS_0354"
FT                   /note="LactoCOG number LaCOG01416"
FT   CDS_pept        379013..379183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0354"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59759"
FT                   /protein_id="ABJ59759.1"
FT                   /translation="MFKFFKSVNQTMAKVSWPTWKQNRRDTGVVVISSILFGAYLGLLD
FT                   LLFSYLTQLFL"
FT   gene            379278..379829
FT                   /locus_tag="LGAS_0355"
FT                   /note="LactoCOG number LaCOG01415"
FT   CDS_pept        379278..379829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0355"
FT                   /product="transcription antitermination protein nusG"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59760"
FT                   /protein_id="ABJ59760.1"
FT                   /translation="MVETSEKKWYVLHTYSGYEEKVKKDLLSRAQSMGMQNYIFRVIVP
FT                   EEQKTETVRGKKQEVDEKVFPGYVLVEMVMTDESWYVVRNTPNVTGFVGSHGGGSKPSP
FT                   LYDEEIERILKSQGQPAKEPKADYEVGETVTIIDGAFSGMSGKITEINPEKDKLYVSID
FT                   MFGRETNAELDYNQVKEFDE"
FT   gene            379954..380385
FT                   /locus_tag="LGAS_0356"
FT                   /note="LactoCOG number LaCOG01339"
FT   CDS_pept        379954..380385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0356"
FT                   /product="LSU ribosomal protein L11P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59761"
FT                   /protein_id="ABJ59761.1"
FT                   /translation="MTVAKKVINVVKLQIPAGAATPAPPVGPALGQAGINIVGFTKDFN
FT                   ARTADQKGMIIPVVITVYEDRSFEFITKTPPAAVLLKKAAKVDKGSGEPNTKKVAKVTK
FT                   DQVKEIAETKMKDLNAADVEAAMRMIEGTARSMGFTVED"
FT   gene            380483..381175
FT                   /locus_tag="LGAS_0357"
FT                   /note="LactoCOG number LaCOG01338"
FT   CDS_pept        380483..381175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0357"
FT                   /product="LSU ribosomal protein L1P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59762"
FT                   /db_xref="GOA:Q045W0"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045W0"
FT                   /protein_id="ABJ59762.1"
FT                   /translation="MAKHGKRYLEAAKKVDSTKFYSVDEAMKLAKETSYANFDATIEVA
FT                   YNLSVDPKQADQQIRGALVLPNGTGKSKKVVVFAEGPQADQAKEAGADEVGSDDLVEKV
FT                   QNGYLDFDVVIATPMMMAKVGRLGRILGPKGLMPNPKTGTVTMDVAKAVENQKAGQVEY
FT                   RVDKQGLIHAPIGKASFDADKLAQNFDALRDVILRARPASAKGQYIKSVAVSATFGPGI
FT                   HLDPLNLD"
FT   gene            381297..381950
FT                   /locus_tag="LGAS_0358"
FT                   /note="LactoCOG number LaCOG01888"
FT   CDS_pept        381297..381950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0358"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59763"
FT                   /protein_id="ABJ59763.1"
FT                   /translation="MKEVLNYIFSILPSLFSGAWLTIEIFFWTTVVSIPLGLLVAFGLH
FT                   SNLKLVKAILKFYVWIIRGTPLLLQLIFIFYGLPTVGIVFPRYEAALVAFIINYAAYFA
FT                   EIFRGGLQAVPVGQFEAAQVLGLSRWQTINRIVRPQVVKIVLPSIGNELINLVKDSSLV
FT                   YVIGLGDLLRAGNVATARDVSLVPLVLVGCVYLAMTAVLTALLRVVEKKSNVWK"
FT   gene            381937..382584
FT                   /locus_tag="LGAS_0359"
FT                   /note="LactoCOG number LaCOG01887"
FT   CDS_pept        381937..382584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0359"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59764"
FT                   /protein_id="ABJ59764.1"
FT                   /translation="MSGNKVLELKNISKSFGTRKIIDKLNLSLDQGDILSIIGPSGAGK
FT                   TTLLRLIAGLESADSGKFIHNGKEFDPTDRNNHLLGMVFQDYNLFPNLSVMDNITLAPI
FT                   MVNKMSKADAEKVAEPVLKQLDLEKFKNLYPYQLSGGQKQRVAIARALQMKPEILCYDE
FT                   PTSALDPELVGKVKEIFLKLKQTGMTQVVITHDHQFGKAVADKILKVEPIEK"
FT   gene            382581..383372
FT                   /locus_tag="LGAS_0360"
FT                   /note="LactoCOG number LaCOG01886"
FT   CDS_pept        382581..383372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0360"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59765"
FT                   /protein_id="ABJ59765.1"
FT                   /translation="MMKKIIKLLGLLIIVITSVGLAGCQRQASSWQKIKERGTLVIGVD
FT                   DSFVPMDFRQKNGKLVGFDVDLATAVCKEIGLKPDFQTIDWSMKETELRNGTIDVIWNG
FT                   YTKTKARAKKVAFSRPYLENDQILVTRKKEQINNYCQMKGRILGVQTGSSGADDLDNYP
FT                   NVLKKRVKSTVLYDTYNNAFIDLKAGRIDGLLIDGVYANYYLAHSKYQKEFKKEKLPYP
FT                   SEKFSVGINKKDQILKDKINQALDHLEKTGELEKIKQKWFN"
FT   gene            383500..384072
FT                   /locus_tag="LGAS_0361"
FT                   /note="LactoCOG number LaCOG00859"
FT   CDS_pept        383500..384072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0361"
FT                   /product="LSU ribosomal protein L10P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59766"
FT                   /protein_id="ABJ59766.1"
FT                   /translation="MSFWHGVFISADRIYLKVNLEVNSLSKAIIAKKEKLVDDFAAELK
FT                   EAKAILVIDYLGLTVEEVTNLRKDLRDSNVKMKVIKNTYLKRAAEKAGIEGLDDTFVGP
FT                   TAVVYTADADDITEPARIVSKYEDDIDALSIKGGMLEGKVASQEEIKKLAAIPGREGLL
FT                   SMLVSVLQAPVRNFAYAVKAVADSKDE"
FT   gene            384116..384478
FT                   /locus_tag="LGAS_0362"
FT                   /note="LactoCOG number LaCOG00858"
FT   CDS_pept        384116..384478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0362"
FT                   /product="LSU ribosomal protein L12P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59767"
FT                   /db_xref="GOA:Q045V5"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045V5"
FT                   /protein_id="ABJ59767.1"
FT                   /translation="MALDTEKIIEDLKGASILELNDLVKAIEDEFGVSAAAPVAAAGAA
FT                   GAGAEKTEFDVELTDVGQEKVKVIKVVRDITGLGLKDSKDLVDGAPKNVKEGVSEDEAN
FT                   DIKAKLEEVGATVTVK"
FT   gene            384508..385386
FT                   /locus_tag="LGAS_0363"
FT                   /note="LactoCOG number LaCOG00637"
FT   CDS_pept        384508..385386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0363"
FT                   /product="Kef-type K+ transport system, predicted
FT                   NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59768"
FT                   /protein_id="ABJ59768.1"
FT                   /translation="MRTLFYGVLIFVYNKIMLKKNFYKWFKATLAIVSIVLIVLDFAAI
FT                   IDINGTNSKWFWLNNIILIILAIDYFYRLYLAKDRRAFFRNNIFELVAIIPVGIAFNWM
FT                   KFAQLGDIGLYFRLLRLIRLAGLVGMLKDILHTHGILYVIYFSIAFLMLGSVAISITEH
FT                   VSLDQAFWWAITTASTVGYGDISRHTISPQSLLGKLVILAMILIGVGVMGIVTSSLTAY
FT                   LMRRNEGKVSIKDKDAELTLILDKLDRLEQQNKLLAEQNQNLQKQIQELKDTHTPSEWN
FT                   KFKDWIEKKKR"
FT   gene            complement(385427..385651)
FT                   /locus_tag="LGAS_0364"
FT   CDS_pept        complement(385427..385651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59769"
FT                   /protein_id="ABJ59769.1"
FT                   /translation="MLVSIPIFILAIIVGIFCLWMGFRIKGNQAVFGRVLSTNSQTWAR
FT                   FWLTAGWVIIILAGCYLLFMIILHFYLTM"
FT   gene            385715..386368
FT                   /locus_tag="LGAS_0365"
FT                   /note="LactoCOG number LaCOG00939"
FT   CDS_pept        385715..386368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0365"
FT                   /product="16S rRNA m(2)G 1207 methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59770"
FT                   /protein_id="ABJ59770.1"
FT                   /translation="MINYKIEIKEARIIMTKKNQMYFAANPDAKHDEHLVDYHIDDIDL
FT                   KFTTDAGVFSKLRIDYGSGVLIKTMKELTFPEAGILDVGTGYGPMGLFAAKFWPDQEVD
FT                   MVDVNERAIDLAKRNAQFNHIDNVNIYESNIYEQVDNKYGLIITNPPIRAGKKVVDQIL
FT                   SEAKEHLVENGILLVVIQKKQGAPSAKKLMTKVYGNCEILARDKGYYILMSKNN"
FT   gene            386445..386627
FT                   /locus_tag="LGAS_0366"
FT   CDS_pept        386445..386627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59771"
FT                   /protein_id="ABJ59771.1"
FT                   /translation="MKLLINIILVLIVLAGFGGMIYLSVNGNRFLGAAGLAMLYFVGSI
FT                   GYFVNCYTIKKRGRI"
FT   gene            386790..387272
FT                   /locus_tag="LGAS_0367"
FT                   /note="LactoCOG number LaCOG00487"
FT   CDS_pept        386790..387272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0367"
FT                   /product="tRNA-adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59772"
FT                   /protein_id="ABJ59772.1"
FT                   /translation="MFEKKDKEKYMQLAFAQAKKAEDQGEVPIGAIVVDKDGNVIGEGY
FT                   NRRELDEDATQHAEMIAIRQACQNLGSWRLVDCSLFITLEPCPMCSGAIINSRLAEVYY
FT                   GAFDPKAGAAGSVIDLFKVEKFNHHPKVFGGLFKDQAAQMLKDFFREIRRKQKQDK"
FT   gene            387449..389257
FT                   /locus_tag="LGAS_0368"
FT                   /note="LactoCOG number LaCOG01482"
FT   CDS_pept        387449..389257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0368"
FT                   /product="DNA polymerase III, gamma/tau subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59773"
FT                   /protein_id="ABJ59773.1"
FT                   /translation="MAYQALYRKWRPRTFDGVVGQTAITDTLKNAIKRGKISHAFLFAG
FT                   PRGTGKTSCAKIFAKALNCTNLQDGEPCNECENCLAADKGTMNDIIEIDAASNNGVDEI
FT                   RDIRDKVKYAPTQGKYKVYIIDEVHMLSMGAFNALLKTLEEPPEHVVFILATTELQKVP
FT                   ATIISRTQRYNFKRIDQHDLIARMTYILGQEKIDFEEKALEVIAQVADGGMRDSLSILD
FT                   QILSYDQDKVKYDDALKITGYAAQEKIEQVLLDLLKGQTSEAFEIVHNLLQDGASTKNI
FT                   LDELISLTVKGMLVVKSNKEATFLTKDYVTELAKIPEEKFYNLVQAANTALNDLRYTNQ
FT                   QQIPLDVFVVQVTQAAGEKAPVEQGDAVSSAVVQKLKSEIDSLSKQVAELKNRPVQATR
FT                   RISSDFSGTIKTETNSHPKKVVDQAADTEQKPKRRKASANNQAAQENNRRQVYHVLENA
FT                   TKEDLNTVKDIWPDLLSTLKVSQRAVMEVLNPVAASHEQIVLKCKYELWFERANQDGDL
FT                   ISQLETEIAKLTKHNYSIVLVADSSWLKVRHDFVASHKEELLAKKFQKIEKSEQEANEN
FT                   QVDPQAKKEVIDKAKELFGDLAQIKD"
FT   gene            389270..389599
FT                   /locus_tag="LGAS_0369"
FT                   /note="LactoCOG number LaCOG00072"
FT   CDS_pept        389270..389599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59774"
FT                   /db_xref="GOA:Q045U8"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045U8"
FT                   /protein_id="ABJ59774.1"
FT                   /translation="MSRRPNFGGMGMGNMQGLIKQAKKMQQQMEAEQANLATQEFVGKS
FT                   ADDMVVATFSGDRQLKDLKIDKEAIDPDDPDMLQDLVIDAVNKGIKAVDDATQASMGKY
FT                   TKGLM"
FT   gene            389602..390201
FT                   /locus_tag="LGAS_0370"
FT                   /note="LactoCOG number LaCOG00244"
FT   CDS_pept        389602..390201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0370"
FT                   /product="DNA replication and repair protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59775"
FT                   /db_xref="GOA:Q045U7"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045U7"
FT                   /protein_id="ABJ59775.1"
FT                   /translation="MQYPLPIARLIDNYMKLPGIGEKTATRLAFYTMDMPEDDVEDFSK
FT                   SLIQVKENLHSCSICGNITESDPCEICRDANRDRSTIMVVEQPKDVMAFEEMGEYNGLY
FT                   HVLHGVLSPMDGVGPEEINIKSLITRLQKQDEVKEVILALNSSPEGEATAMYLAKLIKP
FT                   AGLKVTRLAAGLAVGSDIEYANSITLKRAVQGRTDL"
FT   gene            390198..390434
FT                   /locus_tag="LGAS_0371"
FT                   /note="LactoCOG number LaCOG02168"
FT   CDS_pept        390198..390434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59776"
FT                   /protein_id="ABJ59776.1"
FT                   /translation="MIGKRHKVKKAGDERLLKVVAQLQRQLAEQKVFDQTTIDYSFDNR
FT                   VLNKILHAKFIFLYEEARRRNTKSSSSSSVITR"
FT   gene            390530..391183
FT                   /locus_tag="LGAS_0372"
FT                   /note="LactoCOG number LaCOG00291"
FT   CDS_pept        390530..391183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0372"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59777"
FT                   /protein_id="ABJ59777.1"
FT                   /translation="MGVDMRGYLITFEGPDGAGKTTVINELIKQLPKEIQEKTIITREP
FT                   GGSKISENIRTIILDPANKEMDDRTEALLYAAQRSQHVSEVIRPALEAGKIVLSDRFID
FT                   SSLAYQGVGRNLGVEAVKQINDFGTGGLEPDLTIFLDLDPATGLARIEKERAGQEDRLE
FT                   QEKLAFHQKVYAGYTDLLKRYPDRIKKVDANLPIKEVAANSVKIIRKQLPDIFM"
FT   gene            391188..391523
FT                   /locus_tag="LGAS_0373"
FT                   /note="LactoCOG number LaCOG01657"
FT   CDS_pept        391188..391523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59778"
FT                   /protein_id="ABJ59778.1"
FT                   /translation="MVRMKLVLAIVQDKDADALAREFIQNNVRATKLATSGGFLKAGNT
FT                   TFIVGIEDDRVNEVLEIIKKSSHTREQYVSNVNMDAAGTSMLGKPVQVTVGGATVFVLP
FT                   VEEFKHF"
FT   gene            391523..392380
FT                   /locus_tag="LGAS_0374"
FT                   /note="LactoCOG number LaCOG00292"
FT   CDS_pept        391523..392380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0374"
FT                   /product="DNA replication ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59779"
FT                   /protein_id="ABJ59779.1"
FT                   /translation="MIDLKNVGQKQTNLLRDAYLNKKVAHSYLFVDPMQKKGLNTAYWL
FT                   ACLFNCLGENKPDGTCNNCQRILDGNHPDVFLVKLEGKQTLSIDQIRPLKEELAKSPVE
FT                   GKRRFFIIENAEKLTLAASNALLNLLEEPVAPVVTILITNNENQILPTVKSRTQILNFS
FT                   DEKIDSKRAQLLEYGLTDEEIEDLGDTAKLEEESKYLFQELLEQNDLALVRVSQISSLA
FT                   TKPASQKFIFYQLKTLAMKSLAAGEKLRKSAFLLELLMTCDKMRASNVSFHNTLDYLVL
FT                   SFER"
FT   gene            392391..392735
FT                   /locus_tag="LGAS_0375"
FT                   /note="LactoCOG number LaCOG00294"
FT   CDS_pept        392391..392735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0375"
FT                   /product="Regulator of replication initiation timing"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59780"
FT                   /db_xref="GOA:Q045U2"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045U2"
FT                   /protein_id="ABJ59780.1"
FT                   /translation="MDPFSQLSQLQQNLQAMTKTVAGLENDMLEVLKENTELKVENQLL
FT                   REKISKLDANKEPAENKSQAGLKSLRNIYDSGYHICNMYYGSHRESGEDCMFCLDILDN
FT                   FVNHGQKNRG"
FT   gene            392739..393596
FT                   /locus_tag="LGAS_0376"
FT                   /note="LactoCOG number LaCOG00295"
FT   CDS_pept        392739..393596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0376"
FT                   /product="Predicted methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59781"
FT                   /protein_id="ABJ59781.1"
FT                   /translation="MQAQSSFNEKDKGRLYLVPTPIGNLEDITLRAKRILTEADYIAAE
FT                   DTRTSGILLEKIGVHNKMISFHKYNSKERAPELIKLLKEGNTIAEISDAGMPVISDPGY
FT                   ILVQECIKNDIPVVALPGPSAFATALIASGFDAQPFTYYGFLPRKSSEQKEYFEMMNQA
FT                   RATSIFYEAPHRLQKTLKTLAEVIKPDRKIVLARELTKIHEEYLRGTISEINEYFTKND
FT                   PRGEFVVLVSPNDDEEKQLSWDELIKQVADRVEAGESKKDAIKLVAKANKVSKNELYDK
FT                   YHQN"
FT   gene            393614..394348
FT                   /locus_tag="LGAS_0377"
FT                   /note="LactoCOG number LaCOG00766"
FT   CDS_pept        393614..394348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0377"
FT                   /product="Acyl-ACP thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59782"
FT                   /protein_id="ABJ59782.1"
FT                   /translation="MEKIFKEEHQVTYGDCDETGKIQLPKLIEHFMKVSNDQLTQGGAG
FT                   IYDLLKQNLGWVVVEYHLDLKRLPEAGEEITVTTNGSGYNRFFEYSDFGIIDSTNKKIV
FT                   DAKSQWVILDLKNRKITEADSQMMEKFGNPYLKHMPRFKRLRPLKEYDSSQTYAVRYYD
FT                   LDTNHHLTNSVYFDWMIDTLPREFLNSHTVKSVDISFKKEVQYGDQALSELTLDQNTLI
FT                   SYHLISNQGEVSALAEISWREN"
FT   gene            394372..394914
FT                   /locus_tag="LGAS_0378"
FT                   /note="LactoCOG number LaCOG02072"
FT   CDS_pept        394372..394914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0378"
FT                   /product="Uncharacterized conserved secreted or membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59783"
FT                   /protein_id="ABJ59783.1"
FT                   /translation="MLFWKVGMPMKTGIKKIDLQGLVTLALFVAMDIVLEKISFGPSTI
FT                   KVGLGFIGSALLGYYFGPLWGGIGALISDLLRSAIFGVEGGFFPGFTLSAIVGVVIYAL
FT                   FLYQKPIKWWRVVAATLLVTLIVNVLMNTYWIHLLYGLDLRAAFLQRILKELITPWIQI
FT                   VVLYVILNAFQRVKIRR"
FT   gene            394945..395670
FT                   /locus_tag="LGAS_0379"
FT                   /note="LactoCOG number LaCOG00203"
FT   CDS_pept        394945..395670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0379"
FT                   /product="Metal-dependent protease-like protein, putative
FT                   molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59784"
FT                   /protein_id="ABJ59784.1"
FT                   /translation="MKILSITTATNHLSVALNDGDKIVEKNEEDHRNHSEHLDPLINEL
FT                   LKENNLTLKDIDRFAVAEGPGSYTGLRIGITTAKMFASILNKDLVGVSTLAALANRVND
FT                   GVIVSELDARNKNFFAGVYRKVNGKLENLVPDGHYHLDDLINKVKELGLSEEVVFVGSP
FT                   IDKYQAEIAELLGSEDFKQAAGDNQIHAGEIGKLALNKEAIDPDKMVPKYLRRTQAEID
FT                   WHNKTGKAFGPDSDYVEEV"
FT   gene            395636..396211
FT                   /locus_tag="LGAS_0380"
FT                   /note="LactoCOG number LaCOG00204"
FT   CDS_pept        395636..396211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0380"
FT                   /product="Acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59785"
FT                   /protein_id="ABJ59785.1"
FT                   /translation="MVQIATMLRKFSLFFHPEEIDLSFSPFALRLDNQTYQIMKASDEN
FT                   IADLLCIEQEVYFGRTPWSRFSFKSELKKHANSLYLVVYQGSTLVGFIGMRMQAQEGHI
FT                   TNIAVKPAFQRRGIGGFLLRTMIEIAQRNHAVQMTLEVRSDNYNAQSLYRKIGFRDNFI
FT                   RKNYYSAEHADAVSMIKKIADKEQEEVN"
FT   gene            396208..397254
FT                   /locus_tag="LGAS_0381"
FT                   /note="LactoCOG number LaCOG00206"
FT   CDS_pept        396208..397254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0381"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59786"
FT                   /db_xref="GOA:Q045T6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045T6"
FT                   /protein_id="ABJ59786.1"
FT                   /translation="MTKKDIRILAFESSCDETSTAVIKNGREIESLIVATQIKSHQRFG
FT                   GVVPEVASRHHIEVITQITKEALAEANATWDDIDAIAVTYGPGLVGALLIGVSAAKAAS
FT                   MATGIPLIGVDHIMGHIMAAQLKDEIEYPALALQVSGGHTEIVLMKDPIHFEIVGDTRD
FT                   DAAGEAYDKIGRVLGVNYPAGKTIDEWAHKGKDTFHFPRAMMEDDDYDFSLSGLKSAFI
FT                   NTCHHADQIHEKLDKYDLAASFQASVVDVLSHKTIRAIKEYKPKTFILGGGVAANHGLR
FT                   DRLAEEIEKLPADIKPKVILPDLKLCGDNAAMIGAAAYNLYKAGKFSDENLNADPSLEL
FT                   PYADSMLK"
FT   gene            397606..399165
FT                   /locus_tag="LGAS_0382"
FT                   /note="LactoCOG number LaCOG03225"
FT   CDS_pept        397606..399165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59787"
FT                   /protein_id="ABJ59787.1"
FT                   /translation="MEDVAMKNKDKLLYVSAAVLAAGSVAGVKTTTVKAAEVKQANVNA
FT                   NSKLDLNKASQEKQAAAQDKTAQGQIKQDTATVQNTQDQIKQDQAAKTQAETAKTEAQN
FT                   TLPAKQEAVSSAQTKLDQAKNDLTQTQAQNKDLHAQYDTTTENAVHTAQEAEKKLDQKV
FT                   NDLTGQVQTAQNKQTDLLNQRTSAESEIKTNTETLNNVNEQLNKAQADSAQAQKHFDAV
FT                   QKAYAPIQNEYNAKKANAEKAATNLKQNETDLAQSQKQLTDLQTKNNDLAKTVNDTQGQ
FT                   LDNANKDLANAKTDVSQSQTKLNDVQNQSNDINGKLTNAIVKRDQAKSALDSQSENQTK
FT                   IIITPEFNKAFHKWNDNHDPNYVQWTPENDAEMVKELGALSKQEAEMNHFEHNAKDKEQ
FT                   KIDMMHLTYEQRLEANKFGINLVNQIRTQMGKKPVKLTVGSLKYANDVAKYYEADHPKD
FT                   SFSNGNVDGSHPGHDTKAINKALVENGVKPGMGGEKPATMVFGMVMTYTDILQHILTIW
FT                   TI"
FT   gene            399153..400583
FT                   /locus_tag="LGAS_0383"
FT                   /note="LactoCOG number LaCOG03226"
FT   CDS_pept        399153..400583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59788"
FT                   /protein_id="ABJ59788.1"
FT                   /translation="MDDLKHEIYNAVTRWMFNYEQGEWEHASIVVSMQLWDNTNYKNHN
FT                   EEDPTYFGFAIMANGPYNGNGDLGINLETIVDNTIPGNPLSHPIDYNKFNVKDVIPTDT
FT                   DNSQAGQVYAAAQNEVNNLQGQKNSLDGQIKSLHDHLAQSQNRVNDLTKTINDLSTKLS
FT                   NAKTEQATVQGQIGQVSKHVDELKAAQPALVQARDNTAKALADYEQTHATVLNDYNSAK
FT                   SQLDQANNKLQSATKAKDEAEKVLNQNKAKLANINQELAAVKAQLADLTTKLSDAKSSQ
FT                   TSAKANLEKAQADYDNYVNTHKDLIDSIAKSDKELAAKKEAVRVAQSAYDKASQEYEAA
FT                   KKEADKLANKVKDLDQSITKSQETIKSLTNRIASNTQIIENNKQVHAQAAKLAARKAFD
FT                   AQINKALDNVVYGTKTISQHTVKAATVKPAVSTKNTKHALPQTGANDKLSLFAALAGLS
FT                   LSSIGLGSLVSDKKRRRN"
FT   gene            400587..401474
FT                   /locus_tag="LGAS_0384"
FT                   /note="LactoCOG number LaCOG03227"
FT   CDS_pept        400587..401474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59789"
FT                   /protein_id="ABJ59789.1"
FT                   /translation="MDEQEVLRKLGFESEAELLSVKQLAKYHPIYATDYFDLSIDEKET
FT                   NDSIDRLSVDKTFLPIFYYSVYGRIMISGWRALLNTDYKNKVISINTKDHHESWIKEQR
FT                   DKTDYFSVDNVMIDEKIPVYLNEQKKEIGRLFLKIDQGHVLGKFSNLLSYIENFLGNEQ
FT                   NINNIDIYPQFARANRNSKKDHGQVNFECIITKHPATPFYYEAEAIFTHPLDKIPIGTR
FT                   IKIITLEKTEDGHYQKSTDPDAIFEHVFIPNCDYAESDPASVLSSDNTAVDYRNFFKEG
FT                   DLRALKWKNIDFQK"
FT   gene            401695..402318
FT                   /locus_tag="LGAS_0385"
FT                   /note="LactoCOG number LaCOG01967"
FT   CDS_pept        401695..402318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0385"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59790"
FT                   /protein_id="ABJ59790.1"
FT                   /translation="MKDEVQSPQEEAPNTYWRWLVESWRHPLGHDPAEKWYGVVTLLGE
FT                   DIVLFIGLAVASNYIANLFGITLLHHASGFTFWAIVILFVVQIITILCSMVGHLFVFGN
FT                   TGGFWQYVNKVAQVTNWNFWIVICAFFFLILSLSSGLLGFGEALVWIFYALFSLGSFLL
FT                   VVCPDPGTEEMIHDPFWGAVIYLVMIAVIYSIIWGLAFSIMINL"
FT   gene            complement(402402..403775)
FT                   /locus_tag="LGAS_0386"
FT                   /note="LactoCOG number LaCOG03228"
FT   CDS_pept        complement(402402..403775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0386"
FT                   /product="Chloride channel protein EriC"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59791"
FT                   /protein_id="ABJ59791.1"
FT                   /translation="MIKTAKQVLAKPFTSNFFFIFLQGIMIGIITGLIIGTFRWIIDHT
FT                   MKFLFFIYPLMRQKPIYLVPYIIITLLIVLILGKIIKPVLSNITGSGVPQVEAVMLNEN
FT                   KMNWWSILWRKFVGGLLAICPGLFLGREGPCIQMGAMVGQAFGEDLFHADPDDFKRLQG
FT                   CGIAAGLSAAFSAPLAGVFFLVEEITFNFTPKEVLSALAAAMSSDLMTLCFFGTQPCLY
FT                   LPLDKSLPLTSYWFVAIIGVVLGLLAYLYQYCLLSLKPVYAKITKIPAIYHSIIPLLLV
FT                   IPIGLWNANLLGGSHDFISSLFDPIFMKSIQTGTLSLMLLPLVWFVVRFIFSMISYGAS
FT                   VPGGIFMPILVLGALLGVVFAVLMIHFNIAPKRCYGIIIVTSMCAYFGAIEKAPFTALT
FT                   LLTEMVGSVEQIFPMLITTFIAYFVLDLLGGKPIYAALRYQMDYHKLANLPKVKHAEE"
FT   gene            complement(403885..404187)
FT                   /locus_tag="LGAS_0387"
FT   CDS_pept        complement(403885..404187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59792"
FT                   /protein_id="ABJ59792.1"
FT                   /translation="MEVSFMKKNKYVTESFINAITKEVSILIAANDHMSTEKAKNLFKK
FT                   SKVYNFLCFPPDYFYEEDPQYFYEMYENLEHKGIMVDNNQLYLMQNPQLYKLPTD"
FT   gene            complement(404159..404689)
FT                   /locus_tag="LGAS_0388"
FT                   /note="LactoCOG number LaCOG00517"
FT   CDS_pept        complement(404159..404689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0388"
FT                   /product="Sortase (surface protein transpeptidase)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59793"
FT                   /protein_id="ABJ59793.1"
FT                   /translation="MKISIPNLLYHGSDVIVEKPDIHAGKPRHDFGKGFYLTTDINQAA
FT                   KWSKHKIKINSSKLKQNPYNILISKYVFDKKQFYSLRVKIFDHVSEDWLNYIIKNRKNI
FT                   DFALNTDYDLVIGPVVDGANSWEALTLYSNGTISFEKAISRLKPENLTDQWAFKTQNSI
FT                   NCLKYGGVLYEEK"
FT   gene            complement(404843..405835)
FT                   /locus_tag="LGAS_0389"
FT                   /note="LactoCOG number LaCOG00769"
FT   CDS_pept        complement(404843..405835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0389"
FT                   /product="IMP dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59794"
FT                   /db_xref="GOA:Q045S8"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005994"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045S8"
FT                   /protein_id="ABJ59794.1"
FT                   /translation="MSNYFSMEAFDYDDIQLVPNKCIIKSRKEADTSVKFGSRTFKIPV
FT                   VPANMESVIDDDLAIWLAENGYYYVMHRFHPEKRANFIKMMHDKGLFASISVGIKDSEY
FT                   DFIDYLAKEKIIPEYITIDVAHGHSDYVIKMIKYIKDKLPDTFLTAGNIATPEAVRELE
FT                   NAGADATKVGVGPGRACITKLKTGFGTGGWQLAALRMCSKAARKPLIADGGIRHNGDIA
FT                   KSVRFGASMVMIGSLFAGHEESPGNLITIDGKRYKQYWGSASEVQKGAYRNVEGKQMLV
FT                   PYRGSIKDTLREMQEDLQSSISYAGGKDLSAIRVVDYVIVKSSIFDGDK"
FT   gene            406026..407315
FT                   /locus_tag="LGAS_0390"
FT                   /note="LactoCOG number LaCOG01301"
FT   CDS_pept        406026..407315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0390"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59795"
FT                   /db_xref="GOA:Q045S7"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045S7"
FT                   /protein_id="ABJ59795.1"
FT                   /translation="MTAIAVVGSQWGDEGKGKITDFLSKDAAMAVRSNGGNNAGHTIEI
FT                   GDKTFKMRLIPSGIFAAKKGAVIGNGVVINPEVMFGELDNLEKEGIDISGLKISNRAHV
FT                   IMPYHILQDTYQEEAKGDKKIGTTKNGIGPCYMDKASRIGIRVCDLLERDTFEEKLRTN
FT                   LAEKNALFTKVYNKPALKFEDIFEKYLEYGQKMKKYVTDTSVVVNDALDKNEKVLFEGA
FT                   QGVMLDIDEGTYPYVTSSNTISGGIASGIGMGANRLNTVIGVCKAYTTRVGEGPFPTEL
FT                   LDEVGDRIRETAHEYGTVTGRPRRVGWFDSVALRHAKRVAGINALSLNLLDVFSGFDKI
FT                   KIATAYELDGKKIDYYPASLKELYRCKPVYEELPAWDEDITNVKTWEDLPENAKKFLNR
FT                   VSELVGVPLVTVSVGPDREQTIVLKNPWEM"
FT   gene            407319..408614
FT                   /locus_tag="LGAS_0391"
FT                   /note="LactoCOG number LaCOG01078"
FT   CDS_pept        407319..408614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0391"
FT                   /product="Adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59796"
FT                   /protein_id="ABJ59796.1"
FT                   /translation="MLERYTRPEMGKIWSLKNKYNAWLKVEIAATNAWAELGEVPAEDA
FT                   KKIADNASFTVERVSKLEAITHHDVVAFTRTVSESLGEEKKWVHFGLTSTDVVDTAQGY
FT                   ILKQADEIILKDLEALKETIANSARKYKYTVEMGRTHGVQAEPTTFGLKLARWYAEINR
FT                   DIERFKAAAKDVESGKISGAVGTFANVPPAVETSVLKQLGLTQQPVTSQVLPRDLHAYY
FT                   IATIALIATSIENWATEIRGLQRSEIHEVEEHFRAGQKGSSAMPHKHNPIGSENLCGMA
FT                   RVMRGFMVPAYEDVALWHERDISHSSAERVILPDATIGIDYMLNRFNRILANLDVFPET
FT                   MLKNMDRTYGLIYSQRVLLKLIDEAGLSREKAYDMVQKLANKSWQEQTSFRKLIEDSEV
FT                   MNYLSEADLDDAFDYHYHLKHVDEIFEKCGLD"
FT   gene            408692..409141
FT                   /locus_tag="LGAS_0392"
FT                   /note="LactoCOG number LaCOG01683"
FT   CDS_pept        408692..409141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0392"
FT                   /product="NUDIX family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59797"
FT                   /protein_id="ABJ59797.1"
FT                   /translation="MKHEHSAGAIIWRNKNNETQYLLIQSQPYKQFKSAWAFSKGHLEA
FT                   GETAQEAAKREIFEEVGLKPEFNFDFSESYSYQVTSEIEKTVTLFLAKYNLDQKIKRQE
FT                   SEIKQIAWLNYEDAQKRIREQNFKEFSFEDLSSILAKANDYLNGH"
FT   gene            409214..409558
FT                   /locus_tag="LGAS_0393"
FT                   /note="LactoCOG number LaCOG02814"
FT   CDS_pept        409214..409558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0393"
FT                   /product="DNA-damage-inducible protein J"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59798"
FT                   /protein_id="ABJ59798.1"
FT                   /translation="MYINCSIILDKGVINMAHTYSYRADSKDHDEVKRILDNLGLDMST
FT                   SIKMYFKQIIRHNGIPFSVTNSDTLTEDTKKALLLAEAKDMGLIEDDTPAFKDTNKLIS
FT                   YMKKRAKELE"
FT   gene            409558..409866
FT                   /locus_tag="LGAS_0394"
FT   CDS_pept        409558..409866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59799"
FT                   /protein_id="ABJ59799.1"
FT                   /translation="MYEIKAEDTFIQDVNRWSKKIPNLWDEIQAITSYMQETGEIPEEY
FT                   DPHLLTNEELNYVGYFEFHLFEGKLDLLVIHTKNKNKKVFRLVRLGSHNELFHSDLR"
FT   gene            409954..411153
FT                   /locus_tag="LGAS_0395"
FT                   /note="LactoCOG number LaCOG03229"
FT   CDS_pept        409954..411153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0395"
FT                   /product="Predicted acyl-CoA transferase/carnitine
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59800"
FT                   /protein_id="ABJ59800.1"
FT                   /translation="MYIKMSEPNYAKLEASNPHLDKEKPYPLAGILVVDFTHVLSGPTC
FT                   TRMLADAGARVIHIERKTGDDTRHMGPYIADGSSEYFRICNAGKESIALDLKDPKDHAL
FT                   AEKMIAKADVVVENFRPGVMARLGFDPEEMVKKYPKLIFASVSGFGQYGPWSKQAAYDT
FT                   IIQAVSGLMDATGEPNGKPTRVGTSVSDVVAGIMGYSAITTALVARERTGKGTTIDVSM
FT                   LDSTFSLMVQDLMLALGPHEVPHRIGNRHPDMYPFDTFDCQDQPIAICCGNDHLWGLLS
FT                   HALGHEEWINQADFKTNDLREKNWQKVKNAMQDVLKTKPAAEWDKILHEAGVPAGLVLN
FT                   VDKTRRLDQIIERGMVKTLPDGNEVLGSPLKYGTWNSYGLQKDAPKLDEQGEQIRKEFE
FT                   "
FT   gene            complement(411223..412080)
FT                   /locus_tag="LGAS_0396"
FT                   /note="LactoCOG number LaCOG00348"
FT   CDS_pept        complement(411223..412080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0396"
FT                   /product="AraC-like transcriptional regulator (HTH and
FT                   ligand binding domain)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59801"
FT                   /protein_id="ABJ59801.1"
FT                   /translation="MIKERGNFRIMKITHEQILNKSIAPFKAFSFRSRDSSRIIPPHWH
FT                   ESTEILFVLSGKMNTTINGRLQEIKQNQFIIINPCVIHSTNALKNSHILCIQYPFTFLN
FT                   LVTNGKFQQFFHFNSKLNSISSSTLSANTINLVKFLETQDKDISINLSIYILGLQILQE
FT                   LIEKYLVVTHCSTSKNIPFLNEFIDFVSKHYTENISLHMVADHFGYSVAYCSRLIRKNL
FT                   DHSFSDYLTSLRLEQSLRLSLQSNLNIEKIAEKSGFKCYRNLYNAFKKVYNCTPEEAFN
FT                   QLKE"
FT   gene            412148..414430
FT                   /locus_tag="LGAS_0397"
FT                   /note="LactoCOG number LaCOG00343"
FT   CDS_pept        412148..414430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0397"
FT                   /product="Beta-glucosidase-related glycosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59802"
FT                   /protein_id="ABJ59802.1"
FT                   /translation="MINYLKSIVKRINISRIKMKQEKIFTLLNEMSLDEKIGQLIQLSG
FT                   EFFSASDISIGPIEKLGISKKMVNLCGSALNVVGAENIRRVQDQQMQKQPHHIPMLFMS
FT                   DVIYGFKTIFPIPLGLGSSWDPKLVKRAYSVAAEEASASGNQVAFAPMVDVVHDARWGR
FT                   VLESPGEDPYLNSVYSKNMVEGLQENLANKTGQVSCIKHYAAYGAVEAGREYNQVDMSL
FT                   SNLYQNFLPPYKAGVKAGAGMVMTALTTLNGVPSTADKWLLSDVLRKKWKFNGIIISDY
FT                   ASIYELIKHGFARDSTDAALKAIDAGVDIDMKSPCYANGLHELVTNGTLDEEKINNAVL
FT                   KVLNLKNQLGLFENPYFGASVEKEKNSILTPQKRKLARKLAQESLVLIQNKNNILPLKK
FT                   DAKVALIGPYANSQKLIGMWAIHGNSKDTVTIADGLRQYTNNLTVTHGTDLCRDKALLK
FT                   KLGFLTEEDINKIVSSPEKERLHIQNAFKAAKAADIIVLTLGEETYEAGEAGAKTNLNI
FT                   APNQLKLLDKLSQLNKPIILVLISGRPLVLTKVKDKVDAILESWFPGTEGGNAIADILF
FT                   GKVNPSGRLTMSFPYASAQEPLYYNHLSTGRPENNSQHVGRFVSKYIDASARALYPFGY
FT                   GLSYGKIKYSNLTISSERLFLDKPVKISLDIENLSDYDRKETVQLYIHQETASIVQPVK
FT                   RLIDFTKIAISGHSSQHVEFYINASQLSFYDNIGRSHKESSKIQVYVGTNGVQLLKGKF
FT                   DFINKRS"
FT   gene            414527..416491
FT                   /locus_tag="LGAS_0398"
FT                   /note="LactoCOG number LaCOG00949"
FT   CDS_pept        414527..416491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0398"
FT                   /product="PTS system sucrose-specific IIC component, Glc
FT                   family / PTS system sucrose-specific IIB component, Glc
FT                   family / PTS system sucrose-specific IIA component, Glc
FT                   family"
FT                   /note="TC 4.A.1.2.12; TC 4.A.1.2.12; TC 4.A.1.2.12"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59803"
FT                   /protein_id="ABJ59803.1"
FT                   /translation="MSSKENKKIAEEVIAAIGGKENIVSLAHCATRLRIVVKDRKKVNE
FT                   KALDKIDKAKGYFFTAGQYQIIFGTGLVNDVYEAVKEEGVSTTSKDDLNDVAAKQSGWF
FT                   QRSIRMFADVFVPIIPALVATGLFMGLQGLLTQPALLKMMGMSAKSIPVQFTTYFNILT
FT                   GTAFSFLPVLICWSAFRVFGGSPILGILLGLMLVNPALPSAWDVAQGKVAPLMFFGFIP
FT                   VAGYQASVLPAFILGFIGAKTEKWIHKHVISSLDLIVTPFATLLVGSILGLLCVGPIFR
FT                   IVEQGILHAAEWIVQLPFGLGGLIWGAVCQMIVVTGLHHALNLVEIQLLANTHWNPVNP
FT                   IGSAAIAAQAGAALAVALRIHSNKMKQIAYPSTISALLGITEPAIYGVNIKYIKPFLFG
FT                   CIGGGIGGFLSSILNLKATGMSITVIPGILLFLNQQLPLYILVCVVGFGVAFGLTYVYY
FT                   GKHAFDSNKNSKKEDIEKKQNTFKQEPSHVSDEVIDAPVSGKIEALNLVSDKAFASGMM
FT                   GKGIAIEPSSNNIVSPVNGTITVAYPTGHAYGIKSDDGAEILIHLGIDTVNLKGKGFNT
FT                   VVKQGQKINKGELLGTYDYQEIGKEGYDNIVIVLITNSKDYAEVDPIASGNVQAQQKLI
FT                   ALTEPTMSEQAKGTVNELN"
FT   gene            416518..418116
FT                   /locus_tag="LGAS_0399"
FT                   /note="LactoCOG number LaCOG01566"
FT   CDS_pept        416518..418116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0399"
FT                   /product="beta-fructofuranosidase"
FT                   /EC_number="3.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59804"
FT                   /protein_id="ABJ59804.1"
FT                   /translation="MYQYLPLFLDTISFLFYQNECVKMINRRKQFEYLVSNLKDIPKEN
FT                   LNKEKNSVKRSPYHQRIHIESLFGMLGDPNGFSYFNGYYHLFHQWFPMKYSTNPNYFQQ
FT                   GWFHWKSRNLVDWIPVGEAMNNDTVFDKYGVYSGSAIPINNKLFLMYNGNSWTNTDTDD
FT                   WHRVPSQLGAYMNENDNVAKLANPLIKGPISGYTGHFRDPKIFKKNGKYYSIIGAQTKA
FT                   KTGTVLIYESQNLKLWNKVGEIKTNFEKNGYMWECSDYFELDNKGVVLFCPQGLKSKGN
FT                   QFLNAFQACYAIGNKLDFRNLYFEGKKYEEIDSGFDFYAPQTMIAPDGRRILSAWMSIM
FT                   NSNSPLIKYHYDGCLIFPRELSVQNDKLIQKPVSEITKLYTTDYKGKRTISKNQEIIAG
FT                   LVNCRDIKFDISTKYNNAISIIDLFADRKNTNHLRLVLNRMKNRFIVQRGKAGLEFEDE
FT                   FGNERSCKLKVENSVSIRIIQDISSAEIFINNGENVFTMRVFVPKDQYHIFVKNVNGEV
FT                   NVKYQIHQLRKMSSE"
FT   gene            418311..419129
FT                   /locus_tag="LGAS_0400"
FT                   /note="LactoCOG number LaCOG02240"
FT   CDS_pept        418311..419129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0400"
FT                   /product="Transcriptional regulator, xre family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59805"
FT                   /protein_id="ABJ59805.1"
FT                   /translation="MTIGEALYEERQKLGLTQENMVKGIINKGHYSKIERGLENISIDT
FT                   LFRIILKHHIDISDFFNKVKDNYYTFEDKKAEELKQKIMYAFNNNQREELRIYLNEILD
FT                   LKEHQIFKYRTVIAIASLENNLADLSPSFKNKIVTKFSEHENWLENIGALQLFSDCMKI
FT                   FTLEQLDYFLSQLLKHYQKHTYSESMQERIAIICNNYLCYCYKQKIAGSNIQNALSYLK
FT                   NLEPVGHFLLYKICYDLYFYLFEGNTEKANQIKKLLINCGYQDCIERWQI"
FT   gene            419231..419695
FT                   /locus_tag="LGAS_0401"
FT                   /note="LactoCOG number LaCOG03230"
FT   CDS_pept        419231..419695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59806"
FT                   /protein_id="ABJ59806.1"
FT                   /translation="MKNKKLVVTALVALLLLVGGGVWFYHNQTTVPKGWVNQSLMTLEK
FT                   SDNKLSNSFYLMFDKNTAYLATRLGGNEESKPSKLSKDILNAFSLKENERPQAGQWVKL
FT                   GRVKTEKLKNGYKFKTRKVTFILKKTANGAYQSQDGTYWQFVPEGVAESK"
FT   gene            complement(419831..421762)
FT                   /locus_tag="LGAS_0402"
FT                   /note="LactoCOG number LaCOG00708"
FT   CDS_pept        complement(419831..421762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0402"
FT                   /product="ATPase component of ABC transporter with
FT                   duplicated ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59807"
FT                   /protein_id="ABJ59807.1"
FT                   /translation="MIIAQAQDLEQRFGGNTIFSNISFSVPDNARIGLVGPNGAGKTTL
FT                   LKIMTGQQEPTSGQFTINKGLKVGYIAQENGLDEDKTIWDEMLTVFNDLIEKNKKITKM
FT                   QEQIADHPEDEDLLKRYDQLAYDFEQEGGFTYQAEIKSILNGFNFKENTWNKVIGTLSG
FT                   GEKTRLAFVKLLLQKPPVLLLDEPTNYLDLDTLDWLEAFLKNYQGAIITVSHDQYFLDH
FT                   LANQIFELNFGKLTTFKGNYSQYVKERELMDSQQEAAYEKQQEKIKKEEEFIQKNLVRA
FT                   STTKRAQSRRKVLDKMERIKPPKHKQKVRINFTSERPSGKEVLIAKDLTIGYPDKVMVS
FT                   DIDFQVNKNDRVAIIGPNGIGKSTLLKTIMKKLEPKDGSIKYGASLDIGYYDQELQSLD
FT                   PSKTVLDTIWDRHKTMPEKDVRSILASFLFTAEDIDKTVGQLSGGQKARLTLTVLSLEK
FT                   DNFLLMDEPTNHLDIEAKEVLEEALDNYDGTLLFVSHDRYFINELANKIISVRDGHAKI
FT                   YNGNYSYYLDEKAKQAAAAQEAEAQTAEAETTPAASQNKGKLSYQEQKARDSQKRKLER
FT                   AVSDAEAKIEKLEAEEKEIQTEMANPDIAASFEKLGPLQEKLSAVQKQLDQANNDWENA
FT                   LDALDEFE"
FT   gene            421930..422574
FT                   /locus_tag="LGAS_0403"
FT                   /note="LactoCOG number LaCOG00707"
FT   CDS_pept        421930..422574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0403"
FT                   /product="AT-rich DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59808"
FT                   /db_xref="GOA:Q045R4"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045R4"
FT                   /protein_id="ABJ59808.1"
FT                   /translation="MDEIKIPKATARRLPLYYRYLIFLNDEGKEKVSSTELAEAVQVDS
FT                   ASIRRDFSYFGALGKRGYGYDVKNLLNFFKKILNQDTLTNVALVGVGNMGHALLNYNFK
FT                   RTNNIRISAAFDINPEITGTIMSGVPVYDMSEMKKQLREQQITIAILCVPQTAAQKTAN
FT                   EMFDAGIKGIMNFTPLRLSAPSSVRVQNVDLATELQTLIYFLDSDKDKNKK"
FT   gene            422614..423279
FT                   /locus_tag="LGAS_0404"
FT                   /note="LactoCOG number LaCOG00337"
FT   CDS_pept        422614..423279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0404"
FT                   /product="Predicted Rossmann fold nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59809"
FT                   /protein_id="ABJ59809.1"
FT                   /translation="MCIFLYTFICNQSGNNFKINRHRIFKFRNKVDKMIKKIAVYCGAR
FT                   SGNRPGYAKAAYEFGKKMANHQIELVYGGGKYGLMRAVADGVLENGGIVHGIITEELKD
FT                   RGAAYDKVQDFRVVPSMDKRKDTMMNLADGMVALPGSIGTLEEISQAISWTAIGDNAKP
FT                   VAFYDYAGFYDYLDKLLKRMNQDDFLENIYLDTVYFGTDFDKILQFMEDYQAPAYRKY"
FT   gene            423450..423917
FT                   /locus_tag="LGAS_0405"
FT                   /note="LactoCOG number LaCOG00352"
FT   CDS_pept        423450..423917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0405"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59810"
FT                   /protein_id="ABJ59810.1"
FT                   /translation="MRIVKVKLELDPDQQETEITIHAKSLTPEVERIYHQLQTDSEHPD
FT                   QIEGMMDNTSYYLSINDILFFETDAKQVMAHTTRNAYFVKYKLYELENLLSGQFMRVSK
FT                   STILNLDQIYAVTKSISNCQIKFHDSYKTVYVSRRYYRDLNERLKERRTLS"
FT   gene            423914..424672
FT                   /locus_tag="LGAS_0406"
FT                   /note="LactoCOG number LaCOG01782"
FT   CDS_pept        423914..424672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0406"
FT                   /product="Uncharacterized conserved secreted or membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59811"
FT                   /protein_id="ABJ59811.1"
FT                   /translation="MRKASFGRVLWGLGLLAAAAFLVLDQLHLMPLELGFWAIFWTVVF
FT                   GATLITSLINKSLGGSIFSIAFLLIIYAKPLHIERIVPWTVLLAAFLIWGGLRLIFKKS
FT                   WKPTVIINGEKVNANWSDLKAPHKFKAEHVFSDTSSSDNDDNIVISEKLSSTSRYVHSQ
FT                   HLETVTVNVSMGDVNVYLDSAKPAGDEVLANINMSMGDINIYIPTSWRVDDQLEHKFGD
FT                   FTIDGDQPAEGPTLVLQGRANMGDVTIKRV"
FT   gene            complement(424807..425061)
FT                   /locus_tag="LGAS_0407"
FT   CDS_pept        complement(424807..425061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59812"
FT                   /protein_id="ABJ59812.1"
FT                   /translation="MLKSANLLDIYLKIQYGLSVIFDKIRALGLYCLVIGKACARYDQV
FT                   GKSRKKAHKSYPRFVEEKISKQKSRLMTFGRVKSDFLVC"
FT   gene            425208..425492
FT                   /locus_tag="LGAS_0408"
FT                   /note="LactoCOG number LaCOG00286"
FT   CDS_pept        425208..425492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0408"
FT                   /product="Co-chaperonin GroES (HSP10)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59813"
FT                   /db_xref="GOA:Q045Q9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045Q9"
FT                   /protein_id="ABJ59813.1"
FT                   /translation="MLQPIGDRVIVKVKDEEEEKVGGIVLASNAKEKPQMGEIIAVGNG
FT                   KRNANGDLIPMSVAKGETVFFDKYSGTNLKYEGEKYLVLRESDLLAVVK"
FT   gene            425524..427155
FT                   /locus_tag="LGAS_0409"
FT                   /note="LactoCOG number LaCOG00287"
FT   CDS_pept        425524..427155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0409"
FT                   /product="Chaperonin GroEL (HSP60 family)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59814"
FT                   /db_xref="GOA:Q045Q8"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045Q8"
FT                   /protein_id="ABJ59814.1"
FT                   /translation="MAKDIKFSENARRSLLKGVDKLADTVKTTLGPKGRNVVLEKSYGA
FT                   PDITNDGVTIAKSIDLKDHFENMGAKLVSEAAQKTNDIAGDGTTTATVLTQAIVREGMK
FT                   NVTAGANPVGIRRGIETATKAAVDELHKISHKVSTKDEIAQVASVSSASTEVGNLIADA
FT                   MEKVGHDGVITIEESKGIDTELSVVEGMQFDRGYLSQYMVTDNDKMEADLDNPYILITD
FT                   KKISNIQDILPLLQEIVQQGKSLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGD
FT                   RRKAMLEDIAILTGGTVISSDLGLELKDTKIDQLGKAGKVTVTKDSTTIVEGAGSKDAI
FT                   SERVDQIKKQIADTTSDFDREKLQERLAKLAGGVAVIKVGAATETELKERKYRIEDALN
FT                   ATRAAVEEGYVAGGGTALVDVMKSIQGNVKGDSQDAQTGVNIVMKALGAPVRQIAENAG
FT                   KDGAVILDHLEHEDPEIGYNAATDKWENMVKAGIIDPTKVTRSALQNAASIAALLLTTE
FT                   AVVADAPEDDKNQAPAAPNPGMGMGM"
FT   gene            427527..434900
FT                   /locus_tag="LGAS_0410"
FT                   /note="LactoCOG number LaCOG03211"
FT   CDS_pept        427527..434900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0410"
FT                   /product="Adhesion Exoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59815"
FT                   /protein_id="ABJ59815.1"
FT                   /translation="MVPQFTWGGVNAQAVRADSVNEDATEQVEKKDEANVKAAEVKTTE
FT                   QKQENNKTAVSATNENAKQNVAENTSDSKKVASNRDVNVIKNDVTTDEKAAAKSSVQTD
FT                   KDVNANKLNTNTVSVNKLQRNVNVAGLAESKATSEINSTLSVRESMQQKAVSLKANEIA
FT                   RTVIMNKPAGPDQITQSVKLGTMLGSSNGQIIDGKTTKIYTATVIAVGSSTDMKKYRVT
FT                   VDSDTGEILAGQDLYDTFMNLQPSDFKVNLDAIDQSQIDVPGYTWKITSATPAGANIGK
FT                   EDYTFGNPQTITIDYTRDVEGNIKKKVTEITDKLVNNQMTTEPARTVILKKTTTGAAND
FT                   ETIVQKADIRGLARTSSKTVAGITEKKIEVAIAPYVEPDKPSSQYYKQYTITFNPDTGQ
FT                   IISGQNDYDQLMALKRSDFKADLPAIEDSQIDVPGYTAIITSATPAGAGLEAETYTFGH
FT                   PQTITIDYTKVKHTVTYQFKDPFGNQVGTSVPVTGAVGSNQSVNLTLPDGYQLASGSLP
FT                   TSVTIPESDKIIPIPVKHQLTITLSGESVFNYADDNWQNLVETNELPASGYYVEFNDAN
FT                   ARVQLNDGDVTYNENRNAGTYTVSLTEKGLNDIKDQSHDNFIYPDLKDVKSEAKFIINK
FT                   GNKTISLMGGDTKVFDNTSTLPDQGTFYSGLGLADNDQGRISVYNSDGNPRTIQLTPAD
FT                   VEFWFNGHKIAKDQAKNVGNYNLRLTDDFINKVKAADGNNGNNYEWAYGTNTPTGSDTY
FT                   TADYVIYQATGKAKLSGNNSKLYDGNAVTTDDVNKGRKITIDLTLPVYKQADEPGDEPQ
FT                   LLGTVDLGKYTLQDGDYTWANGTAPTKGGSYTINLNKDKILAHLQDRLVALAGKGTDPD
FT                   DSTKSLSNVTISADDMAGQATFAIETTTTYQFVDDDDNGSKVGTPVSKTGLKGESSNIS
FT                   LTVPTNYVLAAGQTLPTSVTFGDTNTTVDIHLKHATKTVDKNNVPDGYTKDDFAETINR
FT                   TITAKEPTGDVDLSQTTELTRTGTYDEVTKKVISYGNWTTGNFDEVTAPEVAGYTPSQA
FT                   NVAAVTGVTPDYVDPKVVITYAPNDQTGKISYVDVNTGTEVGNTPLTGKTDEEVTINPV
FT                   APTGWKIVDGQSIPRTEKATPTGIPPVTVKVEHKTTVVPPTDPKTPKDKLPDNPDKHYP
FT                   DGVGEKDLNKIIVRQITVVKPDGTREKHDQSVKLTRNATVDEVTGEVIKYGDWTTSNFG
FT                   EYDAPTVPGYTPSQAKVEGVKVTADSDFAPVTITYTANPHTLNINYVDKDGNKIGNSYQ
FT                   VPGRTDETVAVDVPGHVPANWELVPKQKYTTSITFGSDDPQDQNYVIQHKTTTTDGRDH
FT                   KDNQDLYREVTRTILMKVPNATSQGRETETLSFYRIKTHDEVTGKDTYSDWASNVTGDK
FT                   IAFDEFDVSKTNDGKEIAAGYTPTSNDVVLEDKNGDKFVPSQSALKNGVPADSFTVEVA
FT                   YTPNAQRTTVTYVDENGKEITNPDGSVIPGSHYDLTGVTDQSNVPTNIQNNVPTNWHIT
FT                   DPEVPATITFGADGHTPIKVHVAHNTKPVDKNDVPDGYKESDFSKTINRTITANEPSKS
FT                   VDLSQKTELTRTGTYDVVTKKVISYGNWTTGKFDEVKAPEVAGYTPNPASVNAESVTAD
FT                   YVDPKLVINYTPNDQTGKISYVDVNTGTEVGITPLTGKTDSDVTITPSAPAGWKIVDGQ
FT                   NIPTTEKATPTGIATVTVKVEHKTTTVPPTDPKTPKDKLPDNPDKHYPDGVSEKDLNKT
FT                   VVRQITVVKPDGTKESHDQSIKLTRTATVDEVTGEVTKYSDWTTGNFGEYDAPVIPGYT
FT                   PSQAKVEGVKVTADSDFTPVEITYTPNAQKTTVTYVDENDKEITNPDGSVIPGSHYDVT
FT                   GVTNKKVDTNIQKNVPTNWHITDPEVPATITFGADGHTPITVHVAHNTKPVDKNDLPDN
FT                   YKESDFSKTINRTITAKEPNKDVDLSQEIELTRTGTYDEVTKKVISYSDWTTGKFDEVK
FT                   APEVAGYTPSQAKVDGVDKVTVDYVDPNVVITYIEDPVGQDITVKKGDTPDPEDGVKNH
FT                   GDLDKITDPKHPGTKTTYTWKKTPDTSVAGDVPATVVVHYPDGSDKPVDITVHVVDDTP
FT                   VVPTKNPDPVGQDITVKKGDTPDPEDGVKNHGDLDKITDPKHPGTKTTYTWKKTPDTSV
FT                   AGDVPATVVVHYPDGSDKSVDITVHVVDDTPVVPTKNPDPVGQDITVKKGDTPDPEDGV
FT                   NNHGDLDKITDPKHPGTKTTYTWKKTPDTSVAGDVPATVVVHYPDGSDKSVDITVHVVD
FT                   DTPVVPTKNPDPTGQDIHTPQGKVPTPESAITNKDKMPDGTKYTWKEIPDVNTLGKHPN
FT                   VVVVTYPDGTAVEVKVNVFVDGTPEVKKETKAPVVKKQVVEPTKVETRQKLVNNYVAPR
FT                   AVEVQRAQAKGKRQLPQTGAKENIASEVLGMLSVGLGALTAGFASKRRKKNR"
FT   gene            435152..436915
FT                   /locus_tag="LGAS_0411"
FT                   /note="LactoCOG number LaCOG02319"
FT   CDS_pept        435152..436915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0411"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59816"
FT                   /protein_id="ABJ59816.1"
FT                   /translation="MKHLQKLNQYFKELTRTYHLFFKSAPLVATCVLLLAPLQAVIPLL
FT                   AVAAGQKVIDQVTNHSPFMEMIIVWIVATTFQQFLPSLSTMVQGVLTDKLTGFINISLM
FT                   KKSADLQSISIFDDSKYFDDLQMLRDDASWRPVNLIVYGVSVLQSFLTLAFMLIYLARY
FT                   NWWLALLLLVVMVPQSLSYYRIQQQSFETMVERSKNARYLHYYSGLLLDRRDAKEVRLF
FT                   NMFPKIIEKYTSLFEQTKKDVNQIRKKQLATSSLFVVLTVGVFGYGFYWFTNSVRTGAL
FT                   EVGVLLMFVSVIGYISTSMARVVEDSSLLYDSLLWVEKYFKFLEYQDDFKNGGQNFPDD
FT                   FDDINIKNLSFTYPFSDTEILHNVSFSVKSGEKVAIVGENGSGKSTLVKLLMRFYDPTN
FT                   GKISVDNYDLKDFNIFDLHKNLSATFQDFSRFKLTLKENVITGYSFNKGRVNNVLKAAG
FT                   LGDLLANDHLNLNTMLAKDFENGTDLSGGQWQKIALARDLYANGKIEFLDEPTAALDAK
FT                   SESEIYQRFLKENDKKTIFFVTHRLSAVRFADKVLFLDGGKVSGFDTHTNLLQTNPKYK
FT                   EMYDLQKNAYL"
FT   gene            437057..439630
FT                   /locus_tag="LGAS_0412"
FT                   /note="LactoCOG number LaCOG01491"
FT   CDS_pept        437057..439630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0412"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59817"
FT                   /db_xref="GOA:Q045Q5"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045Q5"
FT                   /protein_id="ABJ59817.1"
FT                   /translation="MAKKDTTPMMKQYYEIKEQYPDAFLFYRVGDFYELFEDDAVKGAQ
FT                   ILELTLTHRSNKTKNPIPMAGVPHLAVDTYVNTLVEKGYKVALCEQLEDPKKAKGMVKR
FT                   GIIQLITPGTMMHERPDQAKDSNYLTSVISTNSGFGLAYSDLSTGETFSTHLTDFEGVA
FT                   NELLSLQTREVVYNGHLTEANKDFLKKANITVSEPVKVEGEHAEISYVTQNLTDDAEIK
FT                   ATKQLVAYLLSTQKRSLAHLQVAQSYEPTQYLQMSHTVQTNLELIKSAKTSKKMGSLFW
FT                   LLDKTSTAMGGRLLKSWIERPLLSVTEITRRQEMVQALLDDYFTREKVIDSLKGVYDLE
FT                   RLTGRIAFGSVNAREMLQLAHSLGAIPDILNSLLETNNPHLQNFAKQIDPLKGIHDLIV
FT                   NTIVDNPPLLTTEGGLIREGVSDQLDRYRDAMNNGKKWLSEMESHEREVTGINNLKVGY
FT                   NKVFGYYIEVTNSNKDKVPTDRYTRKQTLTNAERYITPDLKEHESLILEAEAKSTGLEY
FT                   DLFVKLRENVKKYIPALQKLAKQVASLDVLTNFATVSEQNNYVRPDFTVDKQEINVVNG
FT                   RHPVVEQVMTAGSYIPNDVKMDQDTDIFLITGPNMSGKSTYMRQMALIAIMAQIGCFVP
FT                   ADSATLPIFDQIFTRIGAADDLISGQSTFMVEMSEANDALQHATKRSLVLFDEIGRGTA
FT                   TYDGMALAGAIVKYLHDKVGAKTLFATHYHELTDLDQTLKHLKNIHVGATEENGKLIFL
FT                   HKILPGPADQSYGIHVAQLAGLPHKVLREATTMLKRLEKQGAGELQPASEQLDLFTAEE
FT                   ASVPAISDDEKDVLDDIQNVYLADKTPLQVMELVAQWQQELKDKD"
FT   gene            439636..441528
FT                   /locus_tag="LGAS_0413"
FT                   /note="LactoCOG number LaCOG01489"
FT   CDS_pept        439636..441528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0413"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59818"
FT                   /db_xref="GOA:Q045Q4"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045Q4"
FT                   /protein_id="ABJ59818.1"
FT                   /translation="MSKIHELSPELTNQIAAGEVIERPASVVKELCENSLDAGSSRIRI
FT                   NFIDAGLKQITVQDNGSGIAKDQLNLAFTRHATSKIATERDLFNISTLGFRGEALASIA
FT                   AVSHVEVITSSDNLGGVRAIFVGSEKKLQEDAASPKGTKISVSDLFFNTPARLKYLRSE
FT                   RTETLKIVDIVNRLALGHPDVSFTLTNNGKILLKTNGRNDLRQDIANIYGHQLAEKMEV
FT                   LKGSSPDFKITGLLSDPNTTRSSRNFISLLLNGRYIRNYRLTQAIIAGYGSKLRPRRYP
FT                   IAVVNIELDPLLVDVNVHPTKQEVRLSKEQELERLLTTSISEALDQNSQIDSGLNNLLT
FT                   PKKSTNIDQLKFNLNKDVVDTVRPVEFTPQVEADKSAEVHETAASFVSLDKVRNDDKYV
FT                   ITATWDENVDKQVQLSPFDEEKDLQGKDDSIISSGDEILANSLPELIYLGQTKSYLVAR
FT                   HDEDLYLIDQVAAYRRLAYDQIFRDLNSENISQQGLLSPLILDFSNVDYLKLKENLNNL
FT                   QELGIFLEDFGQNSLILRTYPIWLQPDVEKNVRMILDLYLNQNEQDFTKLKAQIAGEIT
FT                   LRQSTRRRNLNPVEAQELLKNLRNSSDPYQDFEGKIIIIQLSENDLNKMFKKDE"
FT   gene            441534..442112
FT                   /locus_tag="LGAS_0414"
FT                   /note="LactoCOG number LaCOG01488"
FT   CDS_pept        441534..442112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0414"
FT                   /product="Holliday junction DNA helicase subunit RuvA"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59819"
FT                   /db_xref="GOA:Q045Q3"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045Q3"
FT                   /protein_id="ABJ59819.1"
FT                   /translation="MFEYLKGIVAKIDPAYVVLDVNGIGYKILCPTPYSYQENQPATIY
FT                   VEQVVRDTGITLYGFLSLEDKELFLKLLSVSGIGPKSAVAIMAAEDTDSLASAIQNGEV
FT                   KYLTRFPGVGKKTASQIVLDLKGKLGDYVKKSAVATDLTPSLQDALLALVALGYTQKEV
FT                   DRITPKLAKLPENTADGYIKEALALLLKK"
FT   gene            442140..443159
FT                   /locus_tag="LGAS_0415"
FT                   /note="LactoCOG number LaCOG01487"
FT   CDS_pept        442140..443159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0415"
FT                   /product="Holliday junction DNA helicase subunit RuvB"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59820"
FT                   /db_xref="GOA:Q045Q2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045Q2"
FT                   /protein_id="ABJ59820.1"
FT                   /translation="MKDVNDEERIIGAESNEEDETIELSLRPQLLAQYIGQDKVKSEMK
FT                   IYIKAAKQRDEALDHVLLYGPPGLGKTTLAFVIANEMGVHLKSTSGPAIEKAGDLVALL
FT                   SELNPGDVLFIDEIHRLAKPVEEVLYSAMEDFYIDIVVGEGQTTHAVHVPLPPFTLIGA
FT                   TTRAGQLSAPLRDRFGIIEHMQYYSIDDLEKIIQRSSVVFNTKIDPEAAIELARRSRGT
FT                   PRVANRLLKRVRDFAEVKGEEAISLATTKHSLHLLEVDDEGLDQTDRKLLRMMIENYGG
FT                   GPVGIKTIAANVGEDTDTIEEVYEPYLLQKGFITRTPRGRSVTQKAYLQLGYPPKKAE"
FT   gene            443220..443672
FT                   /locus_tag="LGAS_0416"
FT                   /note="LactoCOG number LaCOG01437"
FT   CDS_pept        443220..443672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0416"
FT                   /product="protein translocase subunit yajC"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59821"
FT                   /protein_id="ABJ59821.1"
FT                   /translation="MRCNTLNTFFLAQSAAGMNNMFMIIAMIAIFVFFYFSMIKPQKKQ
FT                   QQERMKMMSELKKGDQVIMVDGLHGKVDSINDADKTVVIDADGIFLTFERMAIRRVLPT
FT                   AAAPAKDVEANEAKEEKVETEEKPTESSKPEETASDKTDDTNSEDK"
FT   gene            443780..445228
FT                   /locus_tag="LGAS_0417"
FT                   /note="LactoCOG number LaCOG01497"
FT   CDS_pept        443780..445228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0417"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59822"
FT                   /protein_id="ABJ59822.1"
FT                   /translation="MENIPVVMIIFGGSGDLAHRKLYPALFNLYQKGLIHDHFSVIGTA
FT                   RRPWSHEYLQEQVVEAIKESNSSFDEKDAKEFASHFYYQSHDVTDVDHYIALKELATKL
FT                   DKKYHAEGNRIFYMAMAPRFFGTIATHINDQKLVGSGFNRLVIEKPFGHDLASAEKLNQ
FT                   EISESFAEDSVYRIDHYLGKEMVQNIMPLRMTNPIVNNIWCKKYIANMQVTLAESLGVG
FT                   TRGGYYETSGALRDMVQNHIFQIITLLAMPEPKALDSDHIHEAKQELLDSLVIPTPEMV
FT                   KQHFSRGQYLASDDEVEYLKADQVAPDSKVETFVAGEVNFKKGPVAGVPIYFRTGKKMK
FT                   DKVSRIDIVLHHMNNLYGNAHSNNISIIIDPRSEIFFTINGKKITTEGLRRENLSYKFS
FT                   KEEMAQVPDGYERLLHDVFVADRTNFTHWSELKQYWKFVDAVEAAWQDENKDIKQLEQY
FT                   PSGEFGTESSNHIFEKDTEHWIYR"
FT   gene            445228..446349
FT                   /locus_tag="LGAS_0418"
FT                   /note="LactoCOG number LaCOG01355"
FT   CDS_pept        445228..446349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0418"
FT                   /product="Nucleotidyltransferase/DNA polymerase for DNA
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59823"
FT                   /protein_id="ABJ59823.1"
FT                   /translation="MDLLPKNNTKRKIIHLDMDAFYASVEIRDNPALRNKAVLIGGDPK
FT                   KNRGHGVVATANYVARQYGAHSAMPTAKAIRLIPAEKLVIIQPHFEKYRAVSAEIHRLM
FT                   HKMTDRVESVALDEAYLDVTENKLHLADPVRIATILQEQIYQKVGLTSSFGVSYNKFLA
FT                   KMGSEYAKPFGRTVIRPETALDFLAKQKIEKFPGIGPKTQERLAEMGVYTGADLIKIPT
FT                   DVLIKKFNRMGYLIAQHAHGIDLRAVVTDSERNRKSIGIERTFNQSLFDENEALTRLRA
FT                   YSGELENRLKKRHFLANCVVLKIRDANFKTITKRRKLKQGTNDKIVIYDTGRVLFETEK
FT                   GMLTTGVRLLGLTVTDFEEHPVENLSLDIFENK"
FT   gene            446336..447355
FT                   /locus_tag="LGAS_0419"
FT                   /note="LactoCOG number LaCOG00499"
FT   CDS_pept        446336..447355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0419"
FT                   /product="Phosphoesterase, DHH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59824"
FT                   /protein_id="ABJ59824.1"
FT                   /translation="MKTSNDKINLVNNKEKRLMATFDEIYEKIKEYPTIILHRHTSPDP
FT                   DAIGSQAGLARSLRLAFPDKKILCAGENDEGDLIWINKMDEVTPEDYQGALVITTDTAN
FT                   TPRISNKNYDKGDFLIKIDHHPDVDPYADMSYVDPDAPAASEIVFDFLKAENLPVTKEV
FT                   AAALYAGIVGDTGRFMYPETSAHTFDVAAELTKTGINITDIAREIADVTFDEAKLQALA
FT                   MDKMEINPVGAAYTILMQDDLKKMGLTDDQANVAVSTPGRIKDVLAWNVFVEKPDGTFR
FT                   VHYRSKGPVINHLAEKHDGGGHALASGANAKDMDEVKQVFDEVVEVTKKYNEEHGTNK"
FT   gene            447330..448724
FT                   /locus_tag="LGAS_0420"
FT                   /note="LactoCOG number LaCOG00301"
FT   CDS_pept        447330..448724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0420"
FT                   /product="Superfamily II DNA and RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59825"
FT                   /protein_id="ABJ59825.1"
FT                   /translation="MKNMAQTNSIFQSEKIRPELRAGLEKINFSKPTKVQAAVIPALLS
FT                   NKSVVVQAATGSGKTHAYLLPLLNMIDENAPVTQAVVTAPSRELANQLYKVARQLRDAS
FT                   GLNISIEYLGGGNDRNRQIEKAENRAPQLIIATPGRLHDFASKKVINLDNVKAFIIDEA
FT                   DMTLDMGFLSQMDEIISKLDKKVVLGAFSATIPVKLENFLRKYMSKPDFIVIDNPAIIA
FT                   PTIQNDLIDVGSRDKKEILYKLLTMGQPYLALVFANTKKTVDELTNYLEEQGLKVAKIH
FT                   GGITERERKRIIRQVREGQYQYVVASDLAARGIDVPGVSLVVNYEIPKDLEFVIHRIGR
FT                   TGRNGLEGHAITLIYDEEMPQIEDLEKLGIHFDFKEIKNGELVERTHYHRRDNRQARSH
FT                   KLDNRMIGMVKKTKKKVKPGYKKKIKQAIQKDRQQKRKIEERHQIRKAKRRRKREREQA
FT                   RGNFDN"
FT   misc_binding    448753..448941
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="T-box leader, riboswitch"
FT   gene            448954..451602
FT                   /locus_tag="LGAS_0421"
FT                   /note="LactoCOG number LaCOG01132"
FT   CDS_pept        448954..451602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0421"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59826"
FT                   /db_xref="GOA:Q045P6"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045P6"
FT                   /protein_id="ABJ59826.1"
FT                   /translation="MKQLTSSQVRQMFLDFFKEHGHMVMPSASLIPQDDPTLLWINSGV
FT                   ATMKKYFDGSVVPKNHRITSSQKSIRTNDIENVGKTARHQTFFEMLGNFSVGDYFKKEV
FT                   IPWAWEFLTSPKWLGLDPDKLYVTVYPKDTEAYHMWHDVVGLPEDHIVKLEDNFWDIGE
FT                   GPCGPDSEIFYDRGQENNDVAEDDPENFPGGENARYLEIWNIVFSQFNHLPNGKYVDQP
FT                   HKNIDTGMGLERVVSIIQDAPTNFETDLFMPIIKETEKLSDGKKYAANKEDDVAFKIIA
FT                   DHVRAVSFAIADGALPSNSGRGYVLRRLIRRADLNGQRLGIKGAFLYKLVPVVGEIMKS
FT                   HYPEVVDQQAFIQKVIKNEEERFQVTLSSGLNLLDNIIAEAKKSDDKTVSGKDAFKLFD
FT                   TYGFPYELTFEAAQDAGLKVDKKGFDEEMKAQKERARKARGNLQSMGSQDVTLMNIKDK
FT                   SEFEYGTLEEKHAKLIDIVVNDKLVDKADGEHATLIFDKTPFYAERGGQVADHGEILNQ
FT                   NGELVARVTDVQHAPNDQNLHFVDIILPLEKGQEYILKVDQKRRRGLKHNHTATHLLHA
FT                   ALREVLGTHTHQAGSLVEPDYLRFDFTSLEPMTKKEIANVEKIVNEKIWEEIPVKTTVT
FT                   DPDTGLKMGALALFGEKYGDTVRVVQIDDFSTEFCGGTHCENTDQIGMLKIVSESAVGA
FT                   GTRRIIAVTGPEAYKYVTDRDEILKEVQDEVKATKAEDVTNKISSLEEDLRASQKEAEQ
FT                   LKAQINKAKAGDLFNDVKQVKGLTVIAAQADVEGMNDLRELADNWKSSDKSDVLVLAAE
FT                   VNGKANMVISLNDKAIKAGLKAGDLIKTAAPIFGGGGGGRPNMAQAGGKNPAGLKDAIA
FT                   KVLQEVEEKQN"
FT   gene            451656..451913
FT                   /locus_tag="LGAS_0422"
FT                   /note="LactoCOG number LaCOG00085"
FT   CDS_pept        451656..451913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59827"
FT                   /db_xref="InterPro:IPR009309"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045P5"
FT                   /protein_id="ABJ59827.1"
FT                   /translation="MSSLDKTMHFDFNQNKGKNVYDTLQDVYNALEEKGYSPINQIVGY
FT                   LLSGDPAYIPRHNDARNLILKHERDEIIEELVKSYLGKNK"
FT   gene            451913..452344
FT                   /locus_tag="LGAS_0423"
FT                   /note="LactoCOG number LaCOG00086"
FT   CDS_pept        451913..452344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0423"
FT                   /product="RNase H-like ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59828"
FT                   /db_xref="GOA:Q045P4"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045P4"
FT                   /protein_id="ABJ59828.1"
FT                   /translation="MRLLGLDVGSKTVGVAISDPLGITAQELETIKIDESKFSFGMRQI
FT                   RKLVRKYDVEGFVLGLPKNMDGSSGHSVERSKQYGERLKEKFDLPVHYMDERLTTVQAD
FT                   RILVQEAGVHDRVERKKVIDQMAAVLILQSYLEATRKDK"
FT   gene            452346..452660
FT                   /locus_tag="LGAS_0424"
FT                   /note="LactoCOG number LaCOG00087"
FT   CDS_pept        452346..452660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59829"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045P3"
FT                   /protein_id="ABJ59829.1"
FT                   /translation="MSEKINANQDNDRQITLVDDQGNEELFEILFTFTSEDYGKSYVLL
FT                   YPAAVSDDDDVEVQAFSYDADEDGDVTSSDLHEISDDDEWNMVQGVLNTFLSDDRLSGE
FT                   "
FT   gene            452718..453260
FT                   /locus_tag="LGAS_0425"
FT                   /note="LactoCOG number LaCOG01082"
FT   CDS_pept        452718..453260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0425"
FT                   /product="Uncharacterized membrane protein, required for
FT                   colicin V production"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59830"
FT                   /protein_id="ABJ59830.1"
FT                   /translation="MISILILLIFIYCCYVGYRRGIVYEGLAAGGYVVGLILATLLYKP
FT                   FSNFLNLWVPYPSASDRSSFAFFDKTTGLTLDKSFYAAIAFSIVLVLVCCIWRLVMLGF
FT                   NQLRYVTVDARLNTWGSIIIAFIVTQISVYLLLFILATIPNNSLQNMLGHSILASGILH
FT                   FSPGISQIFIKLFITTI"
FT   gene            453294..455669
FT                   /locus_tag="LGAS_0426"
FT                   /note="LactoCOG number LaCOG01081"
FT   CDS_pept        453294..455669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0426"
FT                   /product="Mismatch repair ATPase (MutS family)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59831"
FT                   /db_xref="GOA:Q045P1"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045P1"
FT                   /protein_id="ABJ59831.1"
FT                   /translation="MEDMNSKIIEKLEYNRIIRQLSDLAITAPAKAQALKLMPSSDFDE
FT                   VKKSIDQTRVLSNILRVKGPMPITDFKDVRPSLKRLKVKANLNGEELGNIFLVLSLAKD
FT                   VGQFASDLEEREIDTRPIEKYLKNLAVPEDLFKKLNQAIEYDGTVKDTASSKLMQLRHD
FT                   IQSNETDIKNHMNDYISGKHTQYLSENIVTIRDGRYVLPVKQEYKNKFGGVVHDQSASG
FT                   QTLFVEPQAVLVLNNRQQNLLAQERQEIHRILIELSELAGAYQKEINNNALALTQLDFL
FT                   SAKSKLAKKMKATEPVLNQDHIIKLRKARHPLIDPKKVVPNNIELGTTFDTMLITGPNT
FT                   GGKTITLKTLGLLQLMAQAGLFITAEEGSQLTVFNEIYADIGDEQSIEQSLSTFSSHMD
FT                   QIIKIMNNVTEDDLVLIDELGAGTDPEEGASLAIAILDDLRQTQAKIAITTHYPELKLY
FT                   GYNRKRTTNASMEFDLKKLAPTYRLRIGIPGQSNAFAIAHQLGMNEAVVDKARDLMNDE
FT                   DSDINKMIERLTEQTKAAEQLHETLKQNVDQSITLKRQLQNGLDWYNQQVQKQLEKSQE
FT                   KADEMLAKKRKQAEKIINDLEEQRRAGGQVRTNKVIEAKGALNKLERENQNLANNKVLQ
FT                   REKKRHDVSVGDNVKVLSYGQQGVITKKLGEHEFEVQIGILKVKVTDRDVEKIAAQASQ
FT                   KKPEKSVRSSRGLRSSRASSELDLRGQRYEEALTNLDRYLDASLLAGLNTVTIIHGIGT
FT                   GAIRNGVQQYLKRNRHVKSYNYAPANQGGTGATIVNLQ"
FT   gene            455749..456060
FT                   /locus_tag="LGAS_0427"
FT                   /note="LactoCOG number LaCOG01080"
FT   CDS_pept        455749..456060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0427"
FT                   /product="Thiol-disulfide isomerase or thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59832"
FT                   /protein_id="ABJ59832.1"
FT                   /translation="MVDEITDATFEDETSEGVVLTDFWATWCGPCKMQSPVIDQLSEEM
FT                   DDIKFTKMDVDQNQETARNLGIMAIPTLLIKKDGKIVDRLTGYTPKEKLEQILDQYTD"
FT   gene            complement(456137..456532)
FT                   /locus_tag="LGAS_0428"
FT                   /note="LactoCOG number LaCOG01882"
FT   CDS_pept        complement(456137..456532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0428"
FT                   /product="Predicted hydrocarbon binding protein, V4R
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59833"
FT                   /protein_id="ABJ59833.1"
FT                   /translation="MEHTNEHLYFLNSLYRDFILPTILGSEDKEILYWAGKHVSRKYDL
FT                   SDIDDLIEFFDMAQFGTLKVLKDRKHTAVFELSGQVVTDRLDSQSDEFSLESGIIAECL
FT                   ERQNGTPTEASATITKKHVVQITAQSD"
FT   gene            456578..457429
FT                   /locus_tag="LGAS_0429"
FT                   /note="LactoCOG number LaCOG00871"
FT   CDS_pept        456578..457429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0429"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59834"
FT                   /protein_id="ABJ59834.1"
FT                   /translation="MEEKRDFNHHLFKGVFLMDNRPIGVLDSGLGGLTVLKKVIEKMPN
FT                   ESTIFIGDQANMPYGDRSKEEIISLTRDSVNFLLSKDVKIIIFGCNTATAVAMSTIKKE
FT                   IPLQIIGVVQSGALAAARTTETKNVAVIGTKATVNSHSYLKEIQYRDPKIQVSEFAQPK
FT                   LAPLAEEDPAEEIKQAVVSESLAPLKKADYDTLVLGCTHYPLLRKEIVAVVGQDRKIVD
FT                   PADQVAQYTYNVLRRDGLFAAGNSDTKHEYYTTGEAKKFTEITRQWMNDETIVGHHVDA
FT                   ED"
FT   gene            457432..458055
FT                   /locus_tag="LGAS_0430"
FT                   /note="LactoCOG number LaCOG00870"
FT   CDS_pept        457432..458055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0430"
FT                   /product="Xanthosine triphosphate pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59835"
FT                   /protein_id="ABJ59835.1"
FT                   /translation="MDTLLFATNNKNKAKEVEEALKKNNFPIHVITNQDLTDPPHVLET
FT                   GTTFLANAKLKAHQMAEFSNLPTLADDSGLSVDKLNGAPGVYSARYGGEAHNDALNNAK
FT                   LLAELGGVPKEARKATFHTTMVVSWPGKFEDDLVTEGEIRGEILTYPQGEGNFGYDPLF
FT                   FVSDKGKTFAEMTVDEKNAISHRGQALRKLLAELPAWWKKMENK"
FT   gene            458194..459372
FT                   /locus_tag="LGAS_0431"
FT                   /note="LactoCOG number LaCOG01348"
FT   CDS_pept        458194..459372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0431"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59836"
FT                   /protein_id="ABJ59836.1"
FT                   /translation="MKKVLAINSGSLSFKYKLFSFPDEKVIASGMADRVGMENAVFKIK
FT                   LSNGREYIKNMPIHDQEEAVKLLIEDLKKFHVVEDLREITGIGHRIVNGGEIFKESVRV
FT                   GDKELQEIFDLGELAPLHNIPEANGIKAFMNIVPNVPQVAVFDTSYHQTLDPIHYLYSI
FT                   PYEYYEDYGIRKYGAHGISISYVAPRAAKMLKKNPNLVNLIVCHLGSGASVTAVKRGKS
FT                   YDTSMGISPLTGVTMGTRSGDFDPSALQRLMHKTGMNIDEAIDVLNYKSGLLGISGVSS
FT                   DMRDLIESKDKRAKLARKIFINRVVRYVGAYAAELGRIDAVVFTAGVGEHDPGIRAGIM
FT                   SSLRYLGLEPDFKANRTDGEKFISKPKSRVKAIIVPTNEELMIAREVVRVVQ"
FT   gene            complement(459415..460311)
FT                   /locus_tag="LGAS_0432"
FT                   /note="LactoCOG number LaCOG00878"
FT   CDS_pept        complement(459415..460311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0432"
FT                   /product="Small-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59837"
FT                   /protein_id="ABJ59837.1"
FT                   /translation="MNWSTLLKGTSTTKKTNNIDYLINWDNVLHTLLSRGIQIIITTII
FT                   FFLIWHIGKRLLTKYLLKNPKFQERMTGRKRTLAQLGIALFQYTILLFYLYSILTLMGI
FT                   PVGTLLASVGLVSLALGMGAQGLVSDVITGMNILSEGEYNIGDTVKIGNYTGTVLSFTL
FT                   RNTRLKTTNGAVIYIPNRNITVVENLSHGSHSGWSMDIYLNLSVENNLTEINHAVDTVN
FT                   AALKDKFKKQIKKGPQIIGIINQTGSSITYQIHFQVIANSQSTIKNAYLSAYIKEFNQR
FT                   GLKFSPMPTKQENSSAS"
FT   gene            460438..460869
FT                   /locus_tag="LGAS_0433"
FT                   /note="LactoCOG number LaCOG00415"
FT   CDS_pept        460438..460869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0433"
FT                   /product="Methyl-accepting chemotaxis-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59838"
FT                   /protein_id="ABJ59838.1"
FT                   /translation="MSISYGALAGLIAAVAFLILVLFTLPLIVRVTKTMKKVDSTMDSV
FT                   NTAVDDLTKQTSVLMKQSEDLLEKSNALLADVNGKVTELEPVVKAAADLGESVSDINSS
FT                   SRRMVERFSGMGIRGAGIGIFSSLVSRMFARRKRRRGED"
FT   gene            460892..461233
FT                   /locus_tag="LGAS_0434"
FT                   /note="LactoCOG number LaCOG02167"
FT   CDS_pept        460892..461233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59839"
FT                   /protein_id="ABJ59839.1"
FT                   /translation="MRKLGGFLLGSVVGLGVGLIAGSLLLPEDATDDVKKKLAENEKLQ
FT                   DLKEKYDKGTEAIKNQLASFPKSVEDDSELRDFDDIVIDDTNKDLGEDEKSDKDAVSDL
FT                   NNAEDTENN"
FT   gene            complement(461328..462434)
FT                   /locus_tag="LGAS_0435"
FT                   /note="LactoCOG number LaCOG01085"
FT   CDS_pept        complement(461328..462434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0435"
FT                   /product="Xaa-Pro aminopeptidase, Metallo peptidase, MEROPS
FT                   family M24B"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59840"
FT                   /protein_id="ABJ59840.1"
FT                   /translation="MNLDKLQNWLISTNNDVAYISDPISINYFTGYSMDPHERIFALIA
FT                   FKDKPAFIFAPELNVEEAKNSAWDGDVYGYLDHENPWAKIADLVNQRVGKPNNIAIEKS
FT                   HLSVDRLEQLRIAFPDSSFTNNVSPFVAEARLRKTPEEVEQLKAAGAEADFAFQIGFNA
FT                   LRNGVTERYVAGQIDYQLKLQKGVMHTSFETIVQAGTNAANPHLGPTMNKIEPNELVLF
FT                   DLGTMHNGYASDSSRTVAYGEPTAKEKEIYEVDREAQQAAIEAAKPGITASELDAVARN
FT                   IITKAGYGEYFIHRLGHGIGMNVHEFPQIMEGNDVVLEEGMCFSIEPGIYIPNVAGVRI
FT                   EDCGVVTKNGFETFTKTSKELKYIPVKD"
FT   gene            462533..463573
FT                   /locus_tag="LGAS_0436"
FT                   /note="LactoCOG number LaCOG01084"
FT   CDS_pept        462533..463573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0436"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59841"
FT                   /protein_id="ABJ59841.1"
FT                   /translation="MISYKRVFLQECEKFMQKQEVTIYDVAREAKVSMATVSRVVNGNN
FT                   NVRKETREKVLAVIDRLHYQPNAVAQGLASKRTTTVGLIVPDLTNMHFAELSKGIDDIA
FT                   TMYKYNILLSSVGNTLLNEDQVIQNLLNKQVDGVIYMSNLMNEKAQEIFNRTNTPVVLA
FT                   GTADANQEFSSVTIDYKAAEKEALGLLLKNGKKNLALVVGDGKAYVNKDNRFVAYKDFM
FT                   EEHNLKNVHIYEDAKTYEDGYELFKQIKADNVDGIIATRDVTAAGIVNAAADAGVKIPE
FT                   DLEIISAASTNVAKIVRPQLTTVQQPLYDIGAVAMRMLTKLMNDEELDDSHVILPYTLK
FT                   KSRSTK"
FT   gene            complement(463658..465292)
FT                   /locus_tag="LGAS_0437"
FT                   /note="LactoCOG number LaCOG00993"
FT   CDS_pept        complement(463658..465292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0437"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59842"
FT                   /protein_id="ABJ59842.1"
FT                   /translation="MELLKYFKKLKWEFLLVVFLIIVNAGFLTLAGISSANALSAVAKL
FT                   RADAFFMWVAIMGGAYIIYAIVNCLVNVEQTRLSQNVDKLIRNSIATDLSKANYATFHK
FT                   QTVATYSSWLTNDITTINNFGITDFLMIVRQVSEIVFGMLTLAYFNISLVVTVVVLTVI
FT                   MGIVPNMFSKILAKRSLEYTHANERLVNTINDILNGFNTLFLANLPQTIVKKIDGSSDD
FT                   VKKHTLNYSKTAGITQAITNGLAFISQVIILGQTGWLILHHLTPVGTISGAQFFASTIF
FT                   AELSGISFNWQEFKSIKPIMEKFKSISNTESEPHSISNWHLGKLGLNNISYHYPENDEP
FT                   IFHNLNLDFILQNKYILTGDSAAGKSTILNLIGGLLRDYKGEINLGNMSYDQISDHDLH
FT                   QKISYLQQDPYIFSASLKWNLTLGKEISTQKINKVIKECGLEDLIAKLPKGIDTILDDQ
FT                   GKQLSGGQKQRIAFAREILRDTPIYLLDEATSALDKASSTQLERLILTKQNKTVIMVTH
FT                   HLRNEIKQLADEVVNLNEIKNVTSETT"
FT   gene            complement(465460..468288)
FT                   /locus_tag="LGAS_0438"
FT                   /note="LactoCOG number LaCOG00280"
FT   CDS_pept        complement(465460..468288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0438"
FT                   /product="Membrane carboxypeptidase (penicillin-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59843"
FT                   /protein_id="ABJ59843.1"
FT                   /translation="MKNLKEKIIEFLTAGPEVKTLQSKSDESQWKFYSGIVYLTLRRVF
FT                   HYLILIAVFGLFLLIGFGGGYALGIVRQQPIPTISELNQQINHAQNSATLYYAGNKKIA
FT                   TVRPDTVTKKASESELTPLVKNAVTATEDENFYIHKGVLPKSLVRAVLSELTGVGVQTG
FT                   GSTLTQQLVKMQFLTSQTTWRRKVTEMFYAHKIEKHFSKEDILRSYLNAAPYGKNNRGE
FT                   NIVGIKTAAQGIFGKSISELNLPQAAFIAGLPQSPSVYTPYRLNGKIKKDLDLAMRRKD
FT                   IVLFRMYRNGDISKKDYLAAKKYDLRADFLAPEKASKQKKQSGYLYNLVMNKSTSLLAE
FT                   KLIEQDGLKVSDVKQDTNRYNQYLTSSTELLHQKGYHIKTTIRQPLYQTMQRIVKQNKY
FT                   GQDKTSRDFDSSTNKWVNTTEHVENGSVVIDNATGKVLAFSGGVDFKNSQINHAFDTYR
FT                   SPGSSIKPYLVYGPAIEHKFISSQTALADFPTRFGNYIPTDYNSTVENRFISAQEALSK
FT                   SYNLPAVNLYNKLVNDKNINLRQDMKKLGLNLSKSEFENLGLALGGTDYGFSVADNASA
FT                   FSNFYNNGKRADPYYIEEIQDPSGRVIYKHKQNPQKVFSTGTSYIMQKMLHQVVTKGTA
FT                   SSLTGTLKFNYKNLIGKTGTSNDYRDIWFNGSTPGITISSWMGYDNFYGHSYNLDSNSS
FT                   ETNLNLWANIANALYEEDPSIFKLNDAPSRPSSVYKNKVLARTGTLPGTVSYDGDNIEL
FT                   SGKKTTALSLSPAPAATARFGIGGSTKDYNLFYDYLEGKNNDYGKVLIYTGKTISKKKN
FT                   INSLFAVADGSTSEDAKNYYGKNHEVYRESNNNSSSSTNRTVGANDQQARSTGQGGNGN
FT                   GSSSSTSTRRSRSSSATESSSSTENSNSESNNAANDVNSNISSNEGSAANTNTGSETSE
FT                   GNTATDSGPTAP"
FT   gene            complement(468386..469783)
FT                   /locus_tag="LGAS_0439"
FT                   /note="LactoCOG number LaCOG00583"
FT   CDS_pept        complement(468386..469783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0439"
FT                   /product="peptidase V, Metallo peptidase, MEROPS family
FT                   M20A"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59844"
FT                   /protein_id="ABJ59844.1"
FT                   /translation="MEELNYKKLAQEKKDAILNDLKELIAIDSSEDLNNTSKEYPVGPG
FT                   PVKAMKKFLSFAKRDGFDTENFDNYAGRINMGSGDKRVGIIGHMDVVPAGEGWKTDPFK
FT                   MTIKDGKIYGRGSADDKGPSLAAYYGMLILKEHGFKPKKKIDFVVGTNEETNWVGIDYY
FT                   LKHQPAPDVAFSPDAEFPIINGEQGIVTLKLDFKDDPSQGDVKLWTFQSGIATNVIPQT
FT                   AHAQLEGDIDGIKEKFNLFLKEHKLEGKAEMLSGRLSLTLTGHGAHASAPETGRNAATY
FT                   LALFLDSLNFDGQAKNFLHFLATVEHKDFNGKKLGIFHHDDLMGDLTSSPSMFNFEGQN
FT                   AYLLNNVRYPQGIEPEEMVKNINEKFGDILDARIDGSAEAPHYVPGDDPIVKTLLSVYE
FT                   KQTGKKGHEVIIGGGTYGRLFKHGVAFGAQPEGAPLVMHQPNEYMKVDDLINSIAIYAE
FT                   AIYELTK"
FT   gene            complement(469802..471184)
FT                   /locus_tag="LGAS_0440"
FT                   /note="LactoCOG number LaCOG00035"
FT   CDS_pept        complement(469802..471184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0440"
FT                   /product="Glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59845"
FT                   /protein_id="ABJ59845.1"
FT                   /translation="MKTSRLYFLALFFSLIFIFESGFLVIGHRGNPSKYPEETIQSDNS
FT                   AFADGADYVELDLHVSKDNVLVVSHDRDLSRVVGSSVIVSQNNFSYLNTLKQANGESII
FT                   SLDQLFDYYKDKPNTKFLLETKKTKHNSPKNMEELLAASIKKYHMQDRVMIHSFSAPSL
FT                   KTMSQLLPDVPRIFIVGSLQRINFEVLSYVNGINISSDLVTQNPKLISQLHALHQKVFV
FT                   WAEMNESPKLWNWLINNDVDGVVTNFPARGYKYKLAKTGTKKYVVNKDGIYFGRVPTTI
FT                   SENPYLKVTTSKELNFLDPVHVSSAVIASGQTFYQIGDKEFVPADLVSLDLQPEWILPY
FT                   WNLSIINPTQNPIFTYNKPDKQSGKKNQLMPRKHYKILGVSGGVKDLWLLTDDGWVKSS
FT                   KVLYYGLFNKNTFAYKNYRKLDPAFRQTNVALFPYLPVEKVPNKSFWSTYSDVNAVIFN
FT                   QR"
FT   gene            471286..471612
FT                   /locus_tag="LGAS_0441"
FT                   /note="LactoCOG number LaCOG01677"
FT   CDS_pept        471286..471612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59846"
FT                   /protein_id="ABJ59846.1"
FT                   /translation="MAYEQLDLIEEVTRNDGSKYYEISNIDQNGIAELAVDRGLIKKVR
FT                   ILQLNLARTKALQLYEEYINKTYQLETLTNEDDWKDPQWVEWEKPKGKVLDAFNTVLKA
FT                   NHIG"
FT   gene            471626..472993
FT                   /locus_tag="LGAS_0442"
FT                   /note="LactoCOG number LaCOG00116"
FT   CDS_pept        471626..472993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0442"
FT                   /product="5'-nucleotidase/2',3'-cyclic phosphodiesterase
FT                   related esterase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59847"
FT                   /protein_id="ABJ59847.1"
FT                   /translation="MEKLRIVHTNDLHSHFEQFPKIKRYLHQAQNDKSVDQTFTFDAGD
FT                   FMDRSHPLSDATEGQANIKLMNEFNYDAITIGNNEGISNSHAVLEKLFDHANFPVILAN
FT                   LREEDESMPKWCTSYKIFETKKKTRIAVVGLTAAYPMTYGPNHWHVKLISDTLDKLLPT
FT                   INGQYDMLIIVSHIGLRMDRYIAHHYPEVDLIVGGHSHDYLPKGEKVNKTWITQTGKWG
FT                   QHIGDIAIQLNDDHQVVSIVPNTVKTADLPSSESDQAKIDAWRKQGEQMLQSRQIAKLP
FT                   AKFNDDKMAAIQVSLDAISDFAGTDIAVLNSGLFLTPFHQGILTEADLQAALPHPMHVV
FT                   QTKLFGSDVWRMVMEMEKNRHFLSKFALKGMSFRGKIFGDLVYKGIQVDHASRTVYING
FT                   KEIDPEKEYTIALLDHYVLIPFFPTISIMGKNKFLFPDYLRTVIGNYLKEKYPIDK"
FT   gene            473005..473550
FT                   /locus_tag="LGAS_0443"
FT                   /note="LactoCOG number LaCOG00117"
FT   CDS_pept        473005..473550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59848"
FT                   /protein_id="ABJ59848.1"
FT                   /translation="MEYKEADKEQPLYHPLAHVIVNEDKIMINGRKYEILANVKDALDI
FT                   EMLKEKYDPFLDQYDYLVGDISSEHLRLKGFYDEKDRVAIDKKANAIVDYLEEYCNPGS
FT                   AYFVLRLAQENQIKKVAFGRQNKRKNMSNNRYHSKRPYFKERRVHKTRIGGHKTAVKFQ
FT                   RGKGSHKNKGFVIKKRKG"
FT   gene            473553..474335
FT                   /locus_tag="LGAS_0444"
FT                   /note="LactoCOG number LaCOG00767"
FT   CDS_pept        473553..474335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0444"
FT                   /product="Predicted sugar phosphatase of the HAD
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59849"
FT                   /protein_id="ABJ59849.1"
FT                   /translation="MEHKDYKCYLIDLDGTIYRGSDTIESGVRFIHRLQEKNIPHLFLT
FT                   NNSTRTPRMVVDKLRGHGVNTDIYHIYTPVLATESYLLAQNPDTAKIPVYIIGQTGLVQ
FT                   GLLKNERFYYDDRNPKYVVVGMDTDLTYHKIRVATRSIRNGATFIGTNADKNLPSGDEL
FT                   LPGNGALCTMLEVATGVKPIYIGKPSSIIVASALKMLNAQGRDAILVGDNYDTDIMAGI
FT                   NCNIDSLLTLTGVTTKKQLAERDKQPTYVVENLDEWKL"
FT   gene            474323..474940
FT                   /locus_tag="LGAS_0445"
FT                   /note="LactoCOG number LaCOG00768"
FT   CDS_pept        474323..474940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0445"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59850"
FT                   /protein_id="ABJ59850.1"
FT                   /translation="METMKKKPIVAVVYNCLMALATATLGAVVLSWPLLAVFVKIQKTN
FT                   LIVKTTLATVMKNYTQLLDYLLSPFNDRLQMSNFPTSPSAARHFYECKLLFELAIIVFV
FT                   VGLIILIFLKMRKRMNYIYISRTTALIFMILPVIILPFALMNFDEFFVAFHHLLFNNGD
FT                   WLFNPATDPIINVLTEEFFAGCFATGGIIYELYFSCFILSKK"
FT   gene            complement(474948..475598)
FT                   /locus_tag="LGAS_0446"
FT                   /note="LactoCOG number LaCOG01164"
FT   CDS_pept        complement(474948..475598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0446"
FT                   /product="Uncharacterized membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59851"
FT                   /protein_id="ABJ59851.1"
FT                   /translation="MGLIDFILHIDDHLVTIVNMFGNWTYLILFAIIFIETGLVIFPFL
FT                   PGDSLIFACCAMAATPKYNLHFWVCYLIFIAAAVLGDTINYEIGHWSQAEGTKHSWFNK
FT                   LINQDKRKAAENFFDRHGGITIVIGRFIPFIRTFVPFVSGASKMHYRTFIIYNFIGGFL
FT                   WVTLFSALGFFFGNIPIVQEHFSLIVIAIILISVLPVLIIWLKKKLVLKKELR"
FT   gene            complement(475625..476623)
FT                   /locus_tag="LGAS_0447"
FT                   /note="LactoCOG number LaCOG01083"
FT   CDS_pept        complement(475625..476623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0447"
FT                   /product="Thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59852"
FT                   /db_xref="GOA:Q045M0"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045M0"
FT                   /protein_id="ABJ59852.1"
FT                   /translation="MTSMLNFYGGFLIKMEKYDLAIIGAGPIGLFAASFANLHGLKTIS
FT                   FDALDEIGGQINMLYPQKNIKDIPAFPSIKGKKLVSQLLEQNINTKFILSHKVKEISFL
FT                   ENENILVDKKYEVKSLLIATGLGAFKPKTLPLSTTLDVNQHIHYSMQHPEIFANKKVAI
FT                   LGGGDSALDWALELANTSDVFLIHRRNEFRGLESSVNKLKSLKNVELLTPYLPKDLQLN
FT                   NNRMELVLHKVGASQDFVTKNVDEILVAYGFKSDNRQLRKWGIKLDHNLIAVSQKMHTN
FT                   LPHVYAIGDAITYPGRVPMIALGFGEAQIAISNIMQDLFPEKTMTFHSTSI"
FT   gene            476682..477047
FT                   /locus_tag="LGAS_0448"
FT                   /note="LactoCOG number LaCOG00621"
FT   CDS_pept        476682..477047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0448"
FT                   /product="RNA binding protein (S1 domain)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59853"
FT                   /protein_id="ABJ59853.1"
FT                   /translation="MQVKIGDIVHGKISGIQQYGIFVRLDSKVEGLIHISEIHGGYVKD
FT                   IGREYQVGETIKVQVIDIDPYSNQISLSRRAVLPEVKEARKKRVHFWTSKRVKKGFTPL
FT                   KEVLNTQIKEAKSRYSK"
FT   gene            477570..479148
FT                   /locus_tag="LGAS_r0449"
FT   rRNA            477570..479148
FT                   /locus_tag="LGAS_r0449"
FT                   /product="16S ribosomal RNA"
FT   gene            479701..482332
FT                   /locus_tag="LGAS_r0450"
FT   rRNA            479701..482332
FT                   /locus_tag="LGAS_r0450"
FT                   /product="23S ribosomal RNA"
FT   gene            482332..482450
FT                   /locus_tag="LGAS_r0451"
FT   rRNA            482332..482450
FT                   /locus_tag="LGAS_r0451"
FT                   /product="5S ribosomal RNA"
FT   gene            482463..482535
FT                   /locus_tag="LGAS_t0452"
FT                   /note="tRNA_Asn_GTT"
FT   tRNA            482463..482535
FT                   /locus_tag="LGAS_t0452"
FT                   /product="tRNA-Asn"
FT   gene            482558..482647
FT                   /locus_tag="LGAS_t0453"
FT                   /note="tRNA_Ser_GGA"
FT   tRNA            482558..482647
FT                   /locus_tag="LGAS_t0453"
FT                   /product="tRNA-Ser"
FT   gene            482764..482835
FT                   /locus_tag="LGAS_t0454"
FT                   /note="tRNA_Glu_TTC"
FT   tRNA            482764..482835
FT                   /locus_tag="LGAS_t0454"
FT                   /product="tRNA-Glu"
FT   gene            482859..482931
FT                   /locus_tag="LGAS_t0455"
FT                   /note="tRNA_Val_TAC"
FT   tRNA            482859..482931
FT                   /locus_tag="LGAS_t0455"
FT                   /product="tRNA-Val"
FT   gene            483048..484286
FT                   /locus_tag="LGAS_0456"
FT                   /note="LactoCOG number LaCOG01273"
FT   CDS_pept        483048..484286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0456"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59854"
FT                   /protein_id="ABJ59854.1"
FT                   /translation="MPCNRKMGDSMRKEKRLFTSESVSEGHPDKVADQISDAILDAILA
FT                   KDPNGRVACETTVTTGLVLVVGEISTSAYVDIQSVVRKTILEIGYNRPELGFDGNNCAI
FT                   LVDIDEQSSDIAGGVNESLETRENHEDKDDLDKIGAGDQGLMFGFAIKETPELMPLPIS
FT                   LAHSLMRRVASLRKEGRLDWLRPDAKAQVTVEYDDDNKPKRVDTVVISTQTDPTVTNDE
FT                   IREAMIDMVIKKVIPSQYLDENTKFLINPSGRFVIGGPKGDSGLTGRKIIVDTYGGYAR
FT                   HGGGAFSGKDLTKVDRSASYAARYVAKNIVAADLAYQCEIQLAYAIGVAHPVSIMVDTH
FT                   GTSKVSEDLLVEAVRNVFDLRPAGIIEMLNLRRPIYRQTAAYGHFGRTDIDLPWEHTDK
FT                   VEALKKYVSEHAK"
FT   gene            484270..485733
FT                   /locus_tag="LGAS_0457"
FT                   /note="LactoCOG number LaCOG00162"
FT   CDS_pept        484270..485733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0457"
FT                   /product="Permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59855"
FT                   /protein_id="ABJ59855.1"
FT                   /translation="MSMQNKSNTKIVTIAIFLTTFMTAIEGTIVSTAMPTIVSDLNGLE
FT                   IMNWVVSIFLLMTAVSTPIYGKLADSIGRKPVFLFGIAVFVVGSALCGIAQNMVELILF
FT                   RVIQGLGSGAVQPVAVTIIADLYTLEKRAKMLGLNSGFWGVASVIAPLLGGFIVQHLSW
FT                   HWIFYINVPLGIIAFLLVIFFLKEKKTSSNSTLDLKGTTCLVIFLLALMIFLQELEDGL
FT                   NLVLLGLVAIIIISAIIFFKTEKRAKDPIMPLDMLSSKEFTMINLITLLISGVVIGFEF
FT                   YIPTWMQGINATSASVAGFAVTPSSLMWIVGSFLIGGMLGRWGIKKTYDYMLLILIIAD
FT                   LALILVPIYTSFWVFCLIAAFNGTAFGAITTASQVRSQVLVGRDKIGVATSFNTLMKYL
FT                   GQTMMVSIYGITFNMVVAKHLAHYPNLTQKMMNDIVSADKAKHLAANLIPGLRQVLLSG
FT                   LKSVYVVSLIVIVLSLILNQLYRQKKIAK"
FT   gene            complement(485781..486518)
FT                   /locus_tag="LGAS_0458"
FT                   /note="LactoCOG number LaCOG00700"
FT   CDS_pept        complement(485781..486518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0458"
FT                   /product="Membrane-associated phospholipid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59856"
FT                   /protein_id="ABJ59856.1"
FT                   /translation="MLLLPSLYFFMDNDYNLPHLLEITRGEIFLKKKDNNLVVHDTLVP
FT                   GFIFLILYVIWALLVIYKNPFIHSFDQAIIHLISNNNPVSVAIATKLTVIGNTSTLTIA
FT                   TIVLFIGLLIAKKFSYAFFSAGLMICANGYNWITKHAVERHRPLVHHLVFADGYSFPSG
FT                   HSVGSATFFGILIILTILLVKNKFWRTTLITIWLIFPLFIGYTRIFCHVHYPSDVVGGW
FT                   LEGTTFVLLGFSVLYHSYLKKHK"
FT   misc_binding    486504..486718
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="T-box leader, riboswitch"
FT   gene            486733..489147
FT                   /locus_tag="LGAS_0459"
FT                   /note="LactoCOG number LaCOG00566"
FT   CDS_pept        486733..489147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0459"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59857"
FT                   /db_xref="GOA:Q045L5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045L5"
FT                   /protein_id="ABJ59857.1"
FT                   /translation="MYNHKTVEKKWQKYWAEHDTFKTGNDPKKKNYYALDMFPFPSGKG
FT                   LHVGHPEGYTATDIISRMKRAQGYNVLHPMGWDAFGLPTEQYALKTGEDPEKVTKENIA
FT                   NFKKQLNKLGFSYDWDREVTTSDPNYYKWTQWVFEQMYKKGLAYEAEVPVNWSPDLGTV
FT                   VANEEIVDGKTERGGYPVYRRNMRQWMLKMTAYADRLLEDLDDLDWPEPVKEMQRNWIG
FT                   RSEGAQVTFKVKDSDKTFDVFTTRPDTLFGVSYTVLAPESKLVQEITTPEQKAAVDSYI
FT                   KKIESKSDLERTDLNKDKTGVFTGAYAINPVNGKEVPVWISDYVLASYGTGAVMAVPAH
FT                   DDRDYAFATKFGLPINRVIEGGDLEKEAFTGNGKHINSDFLDGLDNEEAKKRMIEWLED
FT                   HNAGQKKVNYKLRDWDFSRQRYWGEPIPVIHWEDGTTSLVPEDELPLRLPHATDIKPSG
FT                   TPESPLANLTDWVNVVDKNGRKGKRETNTMPNWAGSSWYYLRYIDPHNDKELADYDLLK
FT                   KWLPVDLYIGGAEHAVRHLLYARFWHKVLYDLGVVPTKEPFQRLYNQGLILKNHEKMSK
FT                   SKGNVVNPDDVIDEYGADSLRMYEMFMGPLDASIDWDDNGPASTKKFLDRVWRLFVNDL
FT                   DLKAIPQERIVDKNDGELDKVYAETVKKVTEDFDALHFNTAISQMMVFINAAQKAKTIP
FT                   REYAEGFVKLLAPVAPHMMEEIWQVFGHDESISYAKWPEYDPAKLVESTVEIMVQVNGK
FT                   LRGKFKAAKDSAKDALEKEALSLDHVQKFLDGKDVKKVIVIPNKIVNIVAK"
FT   gene            489249..490907
FT                   /locus_tag="LGAS_0460"
FT                   /note="LactoCOG number LaCOG01199"
FT   CDS_pept        489249..490907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0460"
FT                   /product="Polysaccharide transport membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59858"
FT                   /protein_id="ABJ59858.1"
FT                   /translation="MENNTKNTKETMVKGSAWMTFGSIVSRILGALYIIPWYAWMGSHG
FT                   NIANALTAKSYNIYSLFIIISTAGIPGAVAKQVAKYNALNEYDIGRKLFRRGLILMAIF
FT                   GVICAAIMYFGAPILATDNIIGALLHGAESDPRQVAVMRSLSYAVLIIPILSIMRGYFQ
FT                   GYADMMPPAMSQFVEQLARVLWMLLTAYIIMQVQHGSYVHAVVQSNLAAAIGAVFGILL
FT                   LVWFLYRRRNELNALMEHSNHAIKISTAGIFWEIINQSIPFIIIDSGITLFQLIDQYTF
FT                   HPMIAMFVHASSDQIESWYALFGLNANKLIMIIVSLATAMSVTAIPLLSGAHARRDYAS
FT                   ISSQIENTLELFLFVMIPASLGMAAIATPIYTIFYGYDPLGSNVLYLSSFTAISLGLFT
FT                   VLMAILQGLSENGLAIKYLVLGIIIKFAVQLPMIQLFKVYGPLLATNIGLIITIWLSLK
FT                   HLKVRYKYNSGRTSRRFIGIAIFSMAMFVVVTGVVDFGGKIISPERRPTSFILVILAVA
FT                   IGGILYAFLSLKFGLAQKIIGPKVNRVLARLHIRI"
FT   gene            491013..492146
FT                   /locus_tag="LGAS_0461"
FT                   /note="LactoCOG number LaCOG02320"
FT   CDS_pept        491013..492146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59859"
FT                   /protein_id="ABJ59859.1"
FT                   /translation="MDNMLVYAAKERKSFSEVSLNEIDSMIFSQLAYCNFELLPQVTNL
FT                   RDLTSDDEIKTLTQGNLGGKNTEKLIKIMIKNPRFKNVAWYRAVSKVDAKTQMQFNAVT
FT                   FNIADGEYYVAYRGTTATTIGWKENFNMSFRDWVPAHYFARSYYRQIKDKFPGKFYIGG
FT                   HSKGGNLAFAVALGLKEFDLANIVRIDCFDGPGFHNQARLKSKFLKLKGKIHKYIPQGS
FT                   LIGILQDDLIGEKDYCTIVAASGVNILQHDMFNWRVKNDKFVTLKQLDSTSEISWKAIA
FT                   EWLKNTTDTERRDFIEMLYLTVSDTNQIYFKNILTPKTTYKLATRLIKNSSGQKEVWEP
FT                   VIRKLFQAYVNSGTTTLSEQRRNNLMNFKNILDEQRR"
FT   gene            492219..492965
FT                   /locus_tag="LGAS_0462"
FT                   /note="LactoCOG number LaCOG03233"
FT   CDS_pept        492219..492965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59860"
FT                   /protein_id="ABJ59860.1"
FT                   /translation="MKKDTYMTLLGLRDTCYNNFNFDIDEKDFYLGTDTYKKIDKILKA
FT                   SQDEQLLVQFEEGTHLYQDYDPEYLSVAQKREVQHDINAARDFLDNYDGSVDDKHDNYS
FT                   AYLDDNSLSYSFGADSNLDEVQNNLNDIETAGVIVWQRRKDEYILLPHTIHSLERIKKQ
FT                   ISSNKHVDDKKLRYAMERLFDNITDFLKPFSDSELGKYENSISEELKDNFEHYALGVQT
FT                   DAREVAADKLTKYAVELAEKENNDKL"
FT   gene            492996..493856
FT                   /locus_tag="LGAS_0463"
FT                   /note="LactoCOG number LaCOG00178"
FT   CDS_pept        492996..493856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0463"
FT                   /product="Predicted sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59861"
FT                   /protein_id="ABJ59861.1"
FT                   /translation="MDKIKMKSISKELISEVIKKRKSATHKGNYGRVLLIGGSKKYGGA
FT                   LIMSAEGALNSGAGLTTVATDSVNISALHTRDPEIMALDWKKRDELKNLIVSSDVVVCG
FT                   MGLGLDDQARDILALIRDSITLKQTLILDASALDLISQQKDILPVNSKLVIFTPHQMEW
FT                   QRLSKIKIADQTDQLNQAFLNELVPRKNAILVLKSNHTKVYDQAGNIYQNPFGNPGMAI
FT                   DGMGDTLAGIIGGFCGQFTPNLATVAGAVGLHSITADEIAVKQYIVRPTQLSALIPAMM
FT                   RKYEK"
FT   gene            493853..494539
FT                   /locus_tag="LGAS_0464"
FT                   /note="LactoCOG number LaCOG01765"
FT   CDS_pept        493853..494539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59862"
FT                   /protein_id="ABJ59862.1"
FT                   /translation="MNKMKKINRYQNSVLIIGTILAILVLAIILFPHRNVSLATPNKIV
FT                   NSKVTKKVAPKVKKVTQKNSNLPYSDPEDLQPAGSWKVKSESKAHPDLLSLSNLWIRVS
FT                   IKGNRVYIMDGNKPVYTMLASCGVYHNGKSATPTGTYAVEAERGATFFNQSLQVGARTY
FT                   ISWHGHGTYLFHSVPTDGNNKIMKNEAKKLGKTQASHGCIRLSIPDSKWLYEKLPVGTK
FT                   VVVKDK"
FT   gene            494572..495498
FT                   /locus_tag="LGAS_0465"
FT                   /note="LactoCOG number LaCOG01530"
FT   CDS_pept        494572..495498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0465"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59863"
FT                   /protein_id="ABJ59863.1"
FT                   /translation="MRHAKKKSKKNFLWIIGIVVIAVCFLLWKNNFGPNSMPSNYHANQ
FT                   VDLNVKSAVAIDAKNGNVIYAKNANQSLPIASMTKLLTTYLTLKAIKEKKIFWDTTVSP
FT                   TQEIINLGSNPDYASVPLNLGQKYTVKELYDAALIKSANNAARMLAIAVSGNETNFLNQ
FT                   MRQQANKWKLHNVKFVTVDGLPEKKKNFLGMTTTIENKMSANDMAIIARKLVTDYPEVL
FT                   NTTKVAKTYFRNTLMTNSNKMLNGLSDYDPNYPVDGLKTGTTDGAGSCFTCTVDKNNKR
FT                   VITVILGAQNDNERFSETKKLLNYSFN"
FT   misc_binding    495571..495764
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="T-box leader, riboswitch"
FT   gene            495762..497456
FT                   /locus_tag="LGAS_0466"
FT                   /note="LactoCOG number LaCOG01362"
FT   CDS_pept        495762..497456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0466"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59864"
FT                   /protein_id="ABJ59864.1"
FT                   /translation="MQEVLSVDFKQKVVDLVSEQVDLPKEKIAMLIERPKNAKMGDYAF
FT                   PAFALAKIEHKNPALIAKEIAEKISDDNFTSIEAVGPYVNFAIDHAKLVNATLNDVLTE
FT                   KDHFGDQQLGKGNVPIDMSSPNIAKPMSMGHLRSTVIGNSIAKTLEKVGYTPIKINYLG
FT                   DYGTQFGKLITAYRLWGNEEDVKKDPITNLFHYYVKFHEEAEKDPKLDDEGRAAFKKLE
FT                   NGDEEEIKLWKWFREVSLQEFNRIYKELGVTFDSYNGEAFFNDKMQPVVDELREKGLLE
FT                   ESRGAQVVNLGEDENPALILKSDGSSLYMTRDLAAALYRKKEYDFVMSLYVAGGEQSGH
FT                   FKQLKQVLKKMGYDWADNIHHIPFGLITQGGKKLSTRKGNVVFLDKVLKDAVSLAEQQI
FT                   EEKNPNLANKDQVAHDVGVGAVVFHDLKNDRMDNFDFDLEEVVRFEGDTGPYVQYTNAR
FT                   AQSILRKANKEISMDNLSLNDDWSFAVAKAIADFPAIVAKASEKFEPSIIAKYALDLSK
FT                   KFNKYYANVRILDEDDQLNARLALVQATSIVLTEALRLLGVNAPKEM"
FT   gene            497568..498485
FT                   /locus_tag="LGAS_0467"
FT                   /note="LactoCOG number LaCOG01278"
FT   CDS_pept        497568..498485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0467"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59865"
FT                   /protein_id="ABJ59865.1"
FT                   /translation="MAYLVNGNDIFKAARENHYAVGAYNTNNLEWTRALLRGAKETRTP
FT                   LLIQVSTGAAKYMGGYKTVKDLVLNEMDNMDIDVPVILNLDHGDYESAKECIALGYSSV
FT                   MFDGHNLPTDENLAKTKEIVKLAHERGISVEAEIGKIGENQGADGGELASVEDAKTFVA
FT                   AGVDKLACGIGNIHGVYPEGWKGLNFDRLKEIAEAVPGEPLVLHGGSGIPQDQIEKAIK
FT                   LGIAKININTEFQLAFQAATRKYIEDKMDLDKGNKGYDPRKLLRAGTDAITDSMKEMIS
FT                   WMGTAPIDSKESSVKFDEASLNEE"
FT   gene            498555..498872
FT                   /locus_tag="LGAS_0468"
FT                   /note="LactoCOG number LaCOG03234"
FT   CDS_pept        498555..498872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59866"
FT                   /protein_id="ABJ59866.1"
FT                   /translation="MHVEFYEKGCKSFFKKYNKQKDIIVKLVEAAIDKEVASGMTKVKL
FT                   ATRKRVNDKNIYEFRLNAGTIGSIRIAFSTFDKKTIVYFISKNLQKSAFSKDFDKIIAK
FT                   L"
FT   gene            498921..499346
FT                   /locus_tag="LGAS_0469"
FT                   /note="LactoCOG number LaCOG00384"
FT   CDS_pept        498921..499346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0469"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59867"
FT                   /protein_id="ABJ59867.1"
FT                   /translation="MKILKINALDQETENKLLVIWEISVRATHNFLSDPEINNIKKYVP
FT                   HALRGVSHLIVAYDENEPVAFMGINDQKLEMLFVDANQRGNGIGKALITYGIDNLDINE
FT                   QNPGARGFYEHMGFKAVERSEFDDQGNPYPILVMKGD"
FT   gene            499370..499702
FT                   /locus_tag="LGAS_0470"
FT                   /note="LactoCOG number LaCOG01006"
FT   CDS_pept        499370..499702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59868"
FT                   /protein_id="ABJ59868.1"
FT                   /translation="MSLTVNLYYTGKSGSARRFAEEMESSGVADRIRQEPGNEKYDYFI
FT                   PMNDPETILLIDSWKNQKSLDAHHASPMMKELADLREKYDLHMHVERYVSDENGMPDTD
FT                   QKFIRK"
FT   gene            complement(499790..499897)
FT                   /locus_tag="LGAS_0471"
FT   CDS_pept        complement(499790..499897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59869"
FT                   /protein_id="ABJ59869.1"
FT                   /translation="MKLLLVLGVSAMAVLAANAAIVNKPVPVPVKVRRK"
FT   gene            500109..500675
FT                   /locus_tag="LGAS_0472"
FT                   /note="LactoCOG number LaCOG00014"
FT   CDS_pept        500109..500675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0472"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59870"
FT                   /protein_id="ABJ59870.1"
FT                   /translation="MTILVKRNYRMNNDIERILYTQSDLDSRMDEMAAELNVKYKDEEP
FT                   IVVPVLNGAMIFASDMIKRLNFKLTIDPIKASSYAGTQSTGEVKITQDIKSDVKDRPVI
FT                   FMEDIIDTGRTLQALSEVMKGRGAKSVEVVAMLDKPETRVVDFHADYYGFKAPDEFLVG
FT                   YGLDYNGLYRNLPYVGILKHEVYAN"
FT   gene            500687..501355
FT                   /locus_tag="LGAS_0473"
FT                   /note="LactoCOG number LaCOG01542"
FT   CDS_pept        500687..501355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0473"
FT                   /product="GMP synthase-Glutamine amidotransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59871"
FT                   /protein_id="ABJ59871.1"
FT                   /translation="MRVNVLQHTPNEGPGSIKTWADQHHYEFYVYHPETFGKLPTVEET
FT                   DLLIILGGPMSPNDDLIWIEQERKLIKAMLDAHKPMFGACLGGQQIAKTVGAKVLDAPH
FT                   KEVGWAPVYLKDQTISNIPEKLIALHWHQQMFEIPEGAKLLFSSDLVKNQGFLLGDNVI
FT                   GLQFHFEPEEDNVREIAINDVDYPLENNDLHQTVEEIIAHGVPKENQKVMFKLLDFITK
FT                   "
FT   gene            501431..502063
FT                   /locus_tag="LGAS_0474"
FT                   /note="LactoCOG number LaCOG00745"
FT   CDS_pept        501431..502063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0474"
FT                   /product="Predicted nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59872"
FT                   /protein_id="ABJ59872.1"
FT                   /translation="MAKIFIFGGSGRVATDLIKDLVADGNTITAAARHPENIIQLDGVT
FT                   AEKLDLHADVDNIAKQVKGFDAIYFTAGSRGKDLIQTDAMGAIKTMMAAEKAGVKRYIM
FT                   LSSMLSLDINSWKKIPSLEDYLAAKFFADTYLMDSTDLEYTILQPGSLTEAAGTGKIQL
FT                   DVKATDSNPIPDVAETLAAILKYPNTIGKIIPMSSGKTSIDDALKEI"
FT   gene            complement(502120..502578)
FT                   /locus_tag="LGAS_0475"
FT                   /note="LactoCOG number LaCOG01483"
FT   CDS_pept        complement(502120..502578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0475"
FT                   /product="GAF domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59873"
FT                   /protein_id="ABJ59873.1"
FT                   /translation="MSATTENNYQLLVKQAEALVDGESDWIANTANVSALLFNALNDVN
FT                   FAGVYRYKNHELILGPFQGKPACVHIAIGKGVCGTTAKERQTQIVKNVHEFAGHIACDS
FT                   DSNSEIVIPIFKKNGELWGVFDFDSTKIANFDELDQKYLEAISNIFKF"
FT   gene            502787..503782
FT                   /locus_tag="LGAS_0476"
FT                   /note="LactoCOG number LaCOG03235"
FT   CDS_pept        502787..503782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0476"
FT                   /product="Bacteriocin helveticin"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59874"
FT                   /protein_id="ABJ59874.1"
FT                   /translation="MIGKETQIRLVNKLENIHHVVVQASAIDGNNVFALQLLHKQSDVI
FT                   VYQTPNDSKTVTFNEDHPILYLKGPNSAGTAGGHTQTWVQSGENNKWFVGTKPKRHGNT
FT                   YWTTQIARVAVSGYQTQTFTNNTELPRLSYLNRAGSGYGDGSVAYPGKDLVRVEAAVSP
FT                   NRQYFLIASIDINHTGHFAVYNLDEVNKKLDEAEEKTEDINIQNLNCLGAFNVPHFNDQ
FT                   KIISIQGYGIDDNKNIYISSQPSPYTTFLGFPKQGKPREIVKIPWGISDPSKWSVVNLD
FT                   NSLKLDALNFCTEFEGIQVTGDCLYLTVAYHQRNSDLTTLMNRIYQVEKF"
FT   gene            503821..504411
FT                   /locus_tag="LGAS_0477"
FT                   /note="LactoCOG number LaCOG00752"
FT   CDS_pept        503821..504411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0477"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59875"
FT                   /protein_id="ABJ59875.1"
FT                   /translation="MVKKGMSEIEVIRCSWGNSKNSLYQKYHDQEWGKLNLDSTYLYEM
FT                   LVLESFQSGLSWETILNKRENFRKAFANFDYHKVAKFNKDDFERLMQDEGIVRNRLKIN
FT                   AAINNAKILVKLEKENRTFEEFLTELIPKPIIHHPQKMEDIPASDDLSTQISKEMKKMG
FT                   FKFVGPVTIYSFLQAVGLINDHLDTCSFKNGGL"
FT   gene            504408..505349
FT                   /locus_tag="LGAS_0478"
FT                   /note="LactoCOG number LaCOG00808"
FT   CDS_pept        504408..505349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0478"
FT                   /product="Malate permease related permease"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59876"
FT                   /protein_id="ABJ59876.1"
FT                   /translation="MMSLLLPTKQVVIMFILMIIGWICYQIKFLHEQTVKDLTKILLYV
FT                   VSPCLIINSFRQSFSAARLLQFGLVFSLVVFLFIFKIITSQAIFSKKWVKDRQKRTVLR
FT                   YAGTYTNAGFMGVPLVQAILGTKGVFFAVPYLIVYNIFMWTHGIRMFTQKKQSFRESFQ
FT                   QAVINPNIIAAVIGMILFITQFKLPDVVSDPMNYIANLNTPLSMIVIGTNLGAINLKED
FT                   WHDKLAWSGVFIRNLFFPIVILGILCVLPLPAIAKMTTLIMASCPVAGVVVLFSLLSNF
FT                   DVKFPTKLMCLSTLVAIITIPLVICLATLIGM"
FT   gene            505376..506158
FT                   /locus_tag="LGAS_0479"
FT                   /note="LactoCOG number LaCOG03236"
FT   CDS_pept        505376..506158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0479"
FT                   /product="Predicted metal-dependent membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59877"
FT                   /protein_id="ABJ59877.1"
FT                   /translation="MKKDNYLAISKTNASIKWMLIASIIYLVVYSLAGRLEFQSQSIWM
FT                   QILYLSIVCVLAITFKKFYKTDKVFIKLPKEGKVKIITIIFCALVILLYALLGSVASWA
FT                   EVFESMPEMMWGSICVALAAGIGEEVLCRVLLFNLFAKIFENKKYVLVWASLASSVLFG
FT                   LFHLINLMHGAAINATMQQVFYATAIGLTFSYIHIFTNRIWLCIVMHFLLDLQPNIATM
FT                   DAQPSPWGLILLIFGTAMIVSLLSIYAFNRRANKVFEY"
FT   gene            complement(506198..507067)
FT                   /locus_tag="LGAS_0480"
FT                   /note="LactoCOG number LaCOG00842"
FT   CDS_pept        complement(506198..507067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0480"
FT                   /product="Glycerol uptake facilitator related permease
FT                   (Major Intrinsic protein Family)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59878"
FT                   /protein_id="ABJ59878.1"
FT                   /translation="MLKNARILKNIYAFSKTLGIIISCVYFSLIFSREEKVSMEHSWML
FT                   KYFAEFFGTLILVLFGNGSVANSFLKGTTGNAPDGKANGGWILVAFSFGFGVMLPAMLF
FT                   GSISGNHINPAVTVAQAAAGNFPWSQVAPYIICQLLGAICGQLLVLAVYWPHFKESTNP
FT                   DIVFSCFATSDCTNSKWNGFISEVVGTAVLMFVAIGLYKGMFFKQAVDIANIGVGFLIT
FT                   ALVMALGGPTGPALNPARDFGPRLVYSLLPIPNKKGGAHWSYGWIPVVAPTLGAIIGIF
FT                   LYKIPFGN"
FT   gene            507154..508632
FT                   /locus_tag="LGAS_0481"
FT                   /note="LactoCOG number LaCOG00162"
FT   CDS_pept        507154..508632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0481"
FT                   /product="Permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59879"
FT                   /protein_id="ABJ59879.1"
FT                   /translation="MNKKQIRMVTVALMLGNVMAGLDGTITNTAIPAIVSALHGIQFMG
FT                   WIVAIYLLGMSVSIPIWTKIGEKITNKLAFEIALGLFVLGSTLEGLAPNIYFFLVARMI
FT                   MGIGGGGMGSLPYIIAGYVFPNIKKRTQILGYLTASFNGAAILGPLVGGWLIDALSWHW
FT                   VFYINIPIVLVALLIALIYYKPVTPKSAPVFDLRGAFLLVSGLITFLMGIQLLGLTATW
FT                   IVVGLILLSLVLLIFFFLHEAKAENPIIPLSIFRNRDLNGDLILFATTWGAFIAVNTYL
FT                   PMWAQALLGMSALMGGMTLIPNSVVEIIASQTVATIQEKIRTFTLVMIGIVTMMISSGG
FT                   LFLANNHTPLWVLILVGAFSGIGVGFIFVALQVKVQIDAGMKDMATATSTSYLIRILAQ
FT                   TVMAAVYGVIMNLALASGINSHSNITMKMMNELSDAKSAKLLPQHLLPEMREIFHSGIH
FT                   EIMAVSFILLLIATVFNFYFNFKQPNKKIKNYSK"
FT   gene            508690..510183
FT                   /locus_tag="LGAS_0482"
FT                   /note="LactoCOG number LaCOG00162"
FT   CDS_pept        508690..510183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0482"
FT                   /product="Permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59880"
FT                   /protein_id="ABJ59880.1"
FT                   /translation="MRNNWGFLFFRKVGVDMTKKQVTMVTFAMVLANVMAGLDSTIINT
FT                   AIPAIIADLHGIQFMGWIIAIMLLGMSVSTPIWTKVGEKIGNKATFELSLLFFVLGSLF
FT                   QGLADNMYFFLLARALMGIGAGGMGSLPYIMAGFIFDNIKARTKILGYLGAAFSVATIV
FT                   GPLVGGYLVDSLSWHWVFYINIPIGLLAILLSLVYYHEGKIRKTPKFDILGSFLIIVGL
FT                   TLLLLGIQLLGLTKPWIVASLIIAGLVLLVLFFMHEGGHPNPVVPISMFKNRALVGDFL
FT                   LFIFSWGAFLAINTYLPMWAQGLLGTTALIGGMTLIPNSLVDVVGTLVVNPLKARFNNR
FT                   TLLSMGLICILISSLGLALAPQSTNIWWLAIIGTFYGFGVGFIFVLLQIKVQVDASEKN
FT                   MAPATSLSYLIRILAQTVMAAVYGVIMNVQLAQGVAENSGITMNMLNKLSDAASAKSLP
FT                   QSLLPTMRNIFHLGLQEIMWCATALLVIAIGLNFIFNKK"
FT   gene            complement(510246..510764)
FT                   /locus_tag="LGAS_0483"
FT                   /note="LactoCOG number LaCOG00992"
FT   CDS_pept        complement(510246..510764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0483"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59881"
FT                   /protein_id="ABJ59881.1"
FT                   /translation="MNKKSLKTQHQIENALFSLLKNHPYDSLSISQITKHAGVSRMAFY
FT                   RNYEQKDQILITFLRSQYQNFIDDLSMHKLTDFKDQLAVYFKFFKDHPDLMKLFLNAGL
FT                   EGELLNQQTKFLKELINYSHPNLKLPSYAISYQSGGIYMLLVWWVGHDYQKPVNELLSY
FT                   IESHIVLNN"
FT   gene            510857..512647
FT                   /locus_tag="LGAS_0484"
FT                   /note="LactoCOG number LaCOG00663"
FT   CDS_pept        510857..512647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0484"
FT                   /product="Predicted oxidoreductase; Myosin-crossreactive
FT                   antigen ortholog"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59882"
FT                   /protein_id="ABJ59882.1"
FT                   /translation="MKEVCLMHYSNGNYEAFINAEKPKDVDNKSAYIVGSGLAALAAAV
FT                   FLIRDGHMKGDRIHVLEELALPGGSMDAIYNVADQAYVMRGGREMEPHFETLWDLFRSI
FT                   PSLDYPDQSVLDEFYRENRKDPCYSKTRVIENRGQELPTDGDLLLSPKAVKEILNLVMT
FT                   PEKDLQDKKINEVFDDEFFKSNFWLYWQTMFAFMPWASAMEMRRYLMRFVQHVATLKNL
FT                   SSLRFTKYNQYEDLIMPLISYLKKHGVKFHYDTIVDNIIVNRTEDEKVATEIKMTEKGE
FT                   PKVIKLTPNDLVFVTNGSITESTTYGDNTHPAEQKHELGPSWQLWKNLAAQDEDFGHPE
FT                   KFCENIPAANWVISATVTFTNDDIVPYIEKVNKKDPHSGSIVTSGPTTIKDSNWLLGYS
FT                   ISRQPQFHKQKPNELIVWLYGLYSNTKGNYVKKTMPECDGIELCEEWLYHMGVPESEIK
FT                   KMAIDATTIPNHMPYITSYFMPRALGDRPKVVPKNSKNLAFIGNFAETERDTVFTTEYS
FT                   VRTAMEAVYTLLNVDRGVPEVFASAFDVRMLMNAMYYLNDRKKLTELNLPLPEKLMVKE
FT                   GLKKVKGTYVEELLKKYKLI"
FT   gene            512847..513323
FT                   /locus_tag="LGAS_0485"
FT                   /note="LactoCOG number LaCOG00883"
FT   CDS_pept        512847..513323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0485"
FT                   /product="Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59883"
FT                   /protein_id="ABJ59883.1"
FT                   /translation="MYYSAFPEWERFPWMSMVLMSLRRKLQLNAVYDGEVFCGMVCYYI
FT                   SDNTVYLAYLAVEPELRGNGYGSKILHMLEEKYPHQQIVLDIEPLDPDAENYHQRVSRL
FT                   RFYQKNGWRRTHQMLVDADGEFEALVDQNHFDKKDFAKTLKQMSLGFYRFRIEK"
FT   gene            complement(513562..514350)
FT                   /locus_tag="LGAS_0486"
FT                   /note="LactoCOG number LaCOG00040"
FT   CDS_pept        complement(513562..514350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0486"
FT                   /product="Predicted hydrolase of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59884"
FT                   /protein_id="ABJ59884.1"
FT                   /translation="MTKLIAVDMDGTFLRDDKSYDEEKFANIYQELEKRNIMFTVASGN
FT                   QYYQITTFFKNFPTVIYVAENGALVRTQEKILALHAFSEESVKKIEDFLLKQAELQFLV
FT                   SGVESAYFPVQFTDDYYEISNKYYYRLKKIHDFSEIDDKILKFSISCPDEKTAYYVDFL
FT                   KKSLGDYCNVTSSGHGDIDLILPGIHKAHGLTELGKVLDIPLSEMTAFGDGGNDLEMIK
FT                   EFGDGVAMSNANPVLFKVADHTTTSNNEQGVLTYIENNIL"
FT   gene            514465..515004
FT                   /locus_tag="LGAS_0487"
FT                   /note="LactoCOG number LaCOG01110"
FT   CDS_pept        514465..515004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0487"
FT                   /product="Predicted periplasmic/secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59885"
FT                   /protein_id="ABJ59885.1"
FT                   /translation="MNKSSNNWRVFLKSVWFGIIAGMISGMVKIGWEKILPPRTLARDV
FT                   VNPPQHMLQQMGASYKFTHTYVIYNTDQKVFWVALILHFSFSIFFAWLLIYMVQFKKTA
FT                   WAGLWEGALYGIIIWVAWHLIIMPVLGTTPAPWQMPFAEHFSEFFGHIVWGWSIAAVGY
FT                   YLIAKQKVKTLTNQYW"
FT   gene            complement(515046..515852)
FT                   /locus_tag="LGAS_0488"
FT                   /note="LactoCOG number LaCOG01609"
FT   CDS_pept        complement(515046..515852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0488"
FT                   /product="Predicted hydrolase of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59886"
FT                   /protein_id="ABJ59886.1"
FT                   /translation="MIKLIALDTDGTLLNSENKILPSTKTAIKKALDQGIKVVLCSGRP
FT                   IAGLAHFMKELGIKGSNQYAVTLNGAITRNADGKIMTQDLVSNKLYRELTKFAKEQKVP
FT                   FNIVDPDSRIITADHDVDYFELLQAWENTAPLFIRTPDEMPNDFQISKGCFVGDKALLD
FT                   QFEPILRVKFGQDLYIVRADDHFLECLHPNVNKGSGLKELGKKIGISTDEMMAFGDERN
FT                   DISMFDIVGTAVAMGNGSQEAKDHADFVTASNNDNGIAKALDKFVF"
FT   gene            515943..516359
FT                   /locus_tag="LGAS_0489"
FT                   /note="LactoCOG number LaCOG00348"
FT   CDS_pept        515943..516359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0489"
FT                   /product="AraC-like ligand binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59887"
FT                   /protein_id="ABJ59887.1"
FT                   /translation="MKGITMVEHEEVQNNQRLPFYFYHDNQVNEPEHWHQGIELNYLIK
FT                   GKDLRFALEGKTYHFNSGDIWLVNRRQIHSASGEDEEWEYEGFIIDDDFLLSQYPTSIN
FT                   WNLSLLGKSSTKNQPAYRELRDEVVPLVNCVEKD"
FT   gene            complement(516955..518286)
FT                   /locus_tag="LGAS_0490"
FT                   /note="LactoCOG number LaCOG01049"
FT   CDS_pept        complement(516955..518286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0490"
FT                   /product="Xanthine/uracil permease"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59888"
FT                   /protein_id="ABJ59888.1"
FT                   /translation="MKKMPKDTFHNNDAILDVYEKPELGQGILLSMQHLFAMFGSTVLV
FT                   PILVGINPSIALLSSGVGTLVHMLLTHFKIPAYLGSSFAFVATMQALMRQDGYPAIAQG
FT                   AIAAGLVYVVVALVIAKVGSDWVNKVLPPIVVGPIIIVIGLSLATTAANDAMMKGTKYN
FT                   LTYFGVAIFTLIMTLIFQMCFKGFTSLVSIMLGIICGYALSCVLGIVDFSGVAKAAWFS
FT                   MPALDVPGISYHFKWYPAAILTMAPIAFVTMTEHMGHIMVLNSLTKRNFFKNPGLHRTM
FT                   MGDGLSTIIAGFIGGPPTTSYGENIGVLAMTKVHSVWVLAGAAVFAIIFSFVGKVAAVI
FT                   ESIPMPVIGGISFLLFGTIASNGLKILVDDKIDFGEKRNMLIASVILVIGIGGAYLQLG
FT                   SFQLTSVALCTIFGMLMNWILPKKAASEKALEAEKKEKEQKYFN"
FT   gene            518703..519467
FT                   /locus_tag="LGAS_0491"
FT                   /note="LactoCOG number LaCOG00665"
FT   CDS_pept        518703..519467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0491"
FT                   /product="lactose transport regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59889"
FT                   /protein_id="ABJ59889.1"
FT                   /translation="MLKRERLRNILEIVTDRRFVTVDELARELQVSDMTIRRDLNELNT
FT                   TGKVMRIHGGAQVISQQDSVEKNYMQKREINISEKQAAAEVASKIVQDGETIYVGPGTT
FT                   LEFMVAKLNQRKLRIVTNSLPVFETAKKNPNNYELILIGGAYRRVSGAFIGALANNQLR
FT                   GISFDRGFVGVNGIKDTSMMTANLEEGQTQGLGLNRSRKKYVVADYHKINRNDFYEFYH
FT                   LYDVDGLITSPGLDPDIVKHYSQITTLYQGSE"
FT   gene            519483..519911
FT                   /locus_tag="LGAS_0492"
FT                   /note="LactoCOG number LaCOG03238"
FT   CDS_pept        519483..519911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0492"
FT                   /product="galactose-6-phosphate isomerase lacA subunit"
FT                   /EC_number="5.3.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59890"
FT                   /protein_id="ABJ59890.1"
FT                   /translation="MKVVIGSDKKGFELKEKVKKYLEDGGYEVLDVTPEPAEDFVESSL
FT                   KVTHEVLDHGIKKAIMFDEYGVGSAMASNKVKGMVTADVNEERTGHMTAMHNGAKALAI
FT                   GSGIVGEKLAESIIDYYLHTEYAGGRHQVRLDMLEKMI"
FT   gene            519919..520500
FT                   /locus_tag="LGAS_0493"
FT                   /note="LactoCOG number LaCOG02106"
FT   CDS_pept        519919..520500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0493"
FT                   /product="galactose-6-phosphate isomerase lacB subunit"
FT                   /EC_number="5.3.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59891"
FT                   /protein_id="ABJ59891.1"
FT                   /translation="MKMFDNDRPQPEFVDPKIDKHTVVALGNDHIVTPIKMALSDHLKE
FT                   EGYQVLDFGTYDNTRTHYPMYGKRVAEAVADGRADVGIVMCGTGIGISTAADKNEGIRA
FT                   AMVGDVAQAKYAKRELNANVLGMGGIVLGRDFIFYIADAFLNEKYQPTEENKKLIEKID
FT                   SIAKPNPDQKDNEHFFDEENKKWAEGVYHD"
FT   gene            520519..521199
FT                   /locus_tag="LGAS_0494"
FT                   /note="LactoCOG number LaCOG03239"
FT   CDS_pept        520519..521199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59892"
FT                   /protein_id="ABJ59892.1"
FT                   /translation="MSKLEEFRKANPQYKILTLDDPSFKEYGVLYTNDFNLDDVYKVME
FT                   KVPIPETGMKYIANIPELADTYTMLAVKRDIFGEIPIDAGVTLGHSDTFTAFEYHQCSE
FT                   VNIMLDDVLMVLGKRETLEEKHFVDPNTEARMFYMPKGTIVELYNDTLHYAPIQITKKG
FT                   YKVIVAVIHGTNAVLPEGVKSLNPRVVKCGKFQVVHPSRKDKIEQGYQVGLSGDVIKTT
FT                   PLDE"
FT   gene            521422..521922
FT                   /locus_tag="LGAS_0495"
FT                   /note="LactoCOG number LaCOG02065"
FT   CDS_pept        521422..521922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0495"
FT                   /product="PTS system IIA component, Gat family"
FT                   /note="TC 4.A.5"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59893"
FT                   /protein_id="ABJ59893.1"
FT                   /translation="MVHMTVATSLFAPDAVFTSDKTSKEEVLKEVYGKLLKAGYVKGNF
FT                   LSHIIEREEHYPTGIDTSPISKELPNVAIPHTEGEFVNARLIVPIALKHPIKFQNMIAP
FT                   DESLEVKFLFMILNNDPEGQANVLAQIMGFLSTTPVKDLIRLFNLTSSKEIFDFMSENF
FT                   KQE"
FT   gene            521900..522262
FT                   /locus_tag="LGAS_0496"
FT                   /note="LactoCOG number LaCOG03240"
FT   CDS_pept        521900..522262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0496"
FT                   /product="PTS system IIB component, Gat family"
FT                   /note="TC 4.A.5"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59894"
FT                   /protein_id="ABJ59894.1"
FT                   /translation="MRILSKNRKIFWEVFIMAKEVKLLAACGAGVNSSHQIKDAVEEEM
FT                   KKRGHNVHVDAVMIKDVNEDMLNHYDAYLTIAKTDLAFQPKIPLIEAGPILYRIPAMAQ
FT                   PVYDKVEEVVKKVENE"
FT   gene            522287..523705
FT                   /locus_tag="LGAS_0497"
FT                   /note="LactoCOG number LaCOG02989"
FT   CDS_pept        522287..523705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0497"
FT                   /product="PTS system IIC component, Gat family"
FT                   /note="TC 4.A.5"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59895"
FT                   /protein_id="ABJ59895.1"
FT                   /translation="MNAIIDFANAIFKPLIDMGAPTIMLVVLTIIALCFRVKFSKALEG
FT                   GMKLAIALTAIGDIMNLLTTSFAPAMNQFVKNTGMHKDIMDMGWAPLATITWGSPYTLY
FT                   FLLVLIILNVLMLIFKRTNTLDVDIFDVWHSAFVGLFAVFCGAPLWLATLLILLIGYLK
FT                   IVNSDLMKPTFDDLLDAPSSNPMTTTHMNYMMNPVIMVFNKFFDKCLPWLDKYDFDSAK
FT                   LNEKIGFWGSRFAIGVYLGIFVSLLAGYNFTTEQGWKTMFTLSFTAGACIELFSVIGSW
FT                   FIASVEPLSQGISNFATSKFKGRTFNVGLDWPFIAGRAEIWAAANVLAPIMMVEAMVIP
FT                   GNRLMPLGGIIAMGVTPALLVVTRGKIIRMIIIGTIELPIFLWAGTLVAPFVTQVAHQV
FT                   GANIPAHTLVSDTTMEGPIEKFLGYLVGNAWKHQGMFIVYAILAIAAYILIFWWYSREM
FT                   KKRNAKYAAAAKEA"
FT   gene            523733..523990
FT                   /locus_tag="LGAS_0498"
FT                   /note="LactoCOG number LaCOG03241"
FT   CDS_pept        523733..523990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59896"
FT                   /protein_id="ABJ59896.1"
FT                   /translation="MIFMKTKKVSREEEARRKRVLYWTIFVIAINIPQLFFKNIFIEGF
FT                   AMIGTIYALYRLVVFDNKKNRLSRKYYDWKGRPLDAKNKN"
FT   gene            524294..525133
FT                   /locus_tag="LGAS_0499"
FT                   /note="LactoCOG number LaCOG00950"
FT   CDS_pept        524294..525133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0499"
FT                   /product="transcriptional antiterminator, BglG family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59897"
FT                   /protein_id="ABJ59897.1"
FT                   /translation="MEYRIVQILNNNVAIVHTRNNKQNIVMGRGVAFHKQKGDLIQEEN
FT                   VDKVFEIRDKNTVNDLTTLLSNVPLDFVTTSYDLIDQVQAKYHFAAEPYIYVTLTTHLF
FT                   GAYQRLINGEDDVNYLPDLSDNYPVAYQIADDVIKGFKSSLDISFPESEHKSIALHFIN
FT                   AHTSGSVEEEKSQRENDEIIEVVQNELERNGIYRTPKNANDYDRLLVHLKYFINRLNNH
FT                   EPDSLSVSKGMIGEIEASYSRAWEIVQRIKELMQEKLQIELSLSEQTYLTIHIQRLI"
FT   gene            525146..525502
FT                   /locus_tag="LGAS_0500"
FT                   /note="LactoCOG number LaCOG00304"
FT   CDS_pept        525146..525502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0500"
FT                   /product="cellobiose-specific PTS system IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59898"
FT                   /protein_id="ABJ59898.1"
FT                   /translation="MDAEKQITKEEISMTGFSIVAYSGDARTYLMQAMDKASEGKITEA
FT                   KELVKKAEESINLAHNEQTKLLSKEAGGDDMDVTFIMVHGQDTLMTTMLLKDQMKTIIN
FT                   LYERVNKLEGNSIE"
FT   gene            525553..527250
FT                   /locus_tag="LGAS_0501"
FT                   /note="LactoCOG number LaCOG00113"
FT   CDS_pept        525553..527250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0501"
FT                   /product="PTS system lactose-specific IIB component, Lac
FT                   family / PTS system lactose-specific IIC component, Lac
FT                   family"
FT                   /note="TC 4.A.3.1.1; TC 4.A.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59899"
FT                   /protein_id="ABJ59899.1"
FT                   /translation="MNGFTKAMDKMKPKFEKIAANPYVSAVRDGFIAAMPIILFSSLFT
FT                   LIAYVPNAWGFYWPKAVENALVLPYSYSMGLLALYVTATCAKNLTDYKNLKLPKTNQIN
FT                   PMNVILAAEISFIIIAIKVGKNGLDLTYLGTQGLIASYIVGLIVPNIYYACVKNNVTIK
FT                   MPDVVPQNIAQTFKDIFPTTFSVALFWIVQIILNQLFGANLSECVVKVLSPLFHASDTY
FT                   GGLALVAGAMAFFWFVGVQGPSIVAPAVAAIETTNVGLNQQLVHAGMQASHALTINCQD
FT                   YVMNMGGTGSTFVVPFIFLLLAKSAQNKAAGKAAVIPGCFSVNEPILFGAPIIMNPVFF
FT                   IPFLVTPMFNVCAYKFFVQVLHMNALYNTLPWTVPAPIGIIVSSGFAGLSFVYVILTLV
FT                   VDTLIWIPFFKFYDNDLYKQEQAKLAAEKAAGVATATDDSTASLAATDKEAKEGITKDT
FT                   NVMVICAGGGTSGILAKALNKMAKERNLPLHAAARAYGQHMDIIHDMDLIILAPQMDSM
FT                   KDNLKEIADHDGSKLVTTTGRQYIELTQKPDLAFKFVVDSLEGKNEDK"
FT   gene            527266..528693
FT                   /locus_tag="LGAS_0502"
FT                   /note="LactoCOG number LaCOG00306"
FT   CDS_pept        527266..528693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0502"
FT                   /product="6-phospho-beta-galactosidase"
FT                   /EC_number="3.2.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59900"
FT                   /protein_id="ABJ59900.1"
FT                   /translation="MKEFKFPKGFYFGGATAAYQCEGATKEDGKGEVIWDKYLREQGTI
FT                   NPDPACDFYHRYPEDLELCKEFHINAIRVSIDWARIFPEGEGRIEPRGVEYYHKLFKKC
FT                   HEEGVEPFVTLHHFDTPQALQDKGGWLSQEMLDAFVEYAKFCFKEYAGEVRYWITINEP
FT                   TSMAGQQYVGGTFPPAYKDQFDKCFKAEYNQNLVHARIVNAYKEAGYTGQIGIVHALQT
FT                   VYPATDSEGDKHAAELKDVLENKFYLDGTLAGKYSKHTLALVKEIIDANGQQMIDIKPE
FT                   DEKVLLKAAKQLDFVGVNYYFSKFMKEYHGDTEIIHNGTGEKGTDVNRMKGVGEEIHPK
FT                   DLPATDWDWIIYPQGMYDQLKRVYDDYPLVHSIYITENGMGYKDKFEGEDKIIDDTPRI
FT                   DYLKQHMEEVAKAIEAGIPVNGYFVWSLQDMFSWTNGYSKRYGLFYVDFKTQKRYAKKS
FT                   AYWYKKLAETREIPPVD"
FT   gene            528826..529914
FT                   /locus_tag="LGAS_0503"
FT                   /note="LactoCOG number LaCOG03242"
FT   CDS_pept        528826..529914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59901"
FT                   /protein_id="ABJ59901.1"
FT                   /translation="MKGDMKVNNPFNPTFGDVPKIFLDTDTRINDLISKIKTSDFARSF
FT                   FITGVRGSGKTVFLNAVAQKLDQDDNCYRINLINKDNLVASLTKKLAIKTESAFQKALN
FT                   NVNSITVKGINIDLNSSETEYDIVLEKILEKVKKQNKYVVVTIDEITNTEAVREFAQVF
FT                   NELKGDNLPIFVLMTGLPDLILDIQTQSKLTFLLRSEKIHTLPLKNADIIAAYTSVFNC
FT                   SLSVASRMAKMTGGYAFAFQLLGFLLFDQLNGKIPESADLDKVSIPFQLQLFDNAYQKI
FT                   FIDLSEWDRKYLLAVRGNKRLQDVVKILGKDKVFVAQYRRRAIERKLIIPAGYGLVQYT
FT                   LPYFDEYLKQTEDPDSAYYWGY"
FT   gene            complement(529952..530836)
FT                   /locus_tag="LGAS_0504"
FT                   /note="LactoCOG number LaCOG00606"
FT   CDS_pept        complement(529952..530836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0504"
FT                   /product="malolactic fermentation system transcription
FT                   activator"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59902"
FT                   /protein_id="ABJ59902.1"
FT                   /translation="MNDKDLLYFCKLVETQNYTLTANSFNVTQPTISMAIKRLQNRFDD
FT                   PLIFQKNRKSKITLSPAGELLYQKAKYLLKEMASIDYDVKHANIKKIRVAFSGIAGSIY
FT                   IPEIIEKFYKEDIVNLLDARLERSATAFKDLNNGDVDVAIYSWMVPINDPAYFIRNLDR
FT                   TELVIITGKDDPWKNKKVIDAQELRNRKFVARQKGYLTRECLEEEAKLGDFTPNILYTA
FT                   RTMKLMIDLVKRNVGIALAMENSVKDEKDLHIIRLRSGQKLWAYMQIAMRKSFIPNKYQ
FT                   RQGIDILRRFHLN"
FT   gene            531047..532840
FT                   /locus_tag="LGAS_0505"
FT                   /note="LactoCOG number LaCOG02805"
FT   CDS_pept        531047..532840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0505"
FT                   /product="Succinate dehydrogenase/fumarate reductase,
FT                   flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59903"
FT                   /protein_id="ABJ59903.1"
FT                   /translation="MVYKTKVSWDATYDVIVIGFGGAGAGAARFAADNNAKVLLIDAAP
FT                   EGSEGGNTRYAGGAFAWGSNFDQLKEYYKQTYYPFEYDEEALDTFIKNVMQMKEYSKKY
FT                   FGIEAQPTGRRPNGEYPEYKDAASMQSQSMTKGMYNGGFWKLLRKQVFDRLDKIDIWFE
FT                   SPAEHLIQDPDTNAVIGAVIKRNNREVNVAAKRGVVLSLGGFENNQSMVQDFLGQGSLA
FT                   PIGTLYNRGKGIDLAVEAGARLWHMSNYDSHGLSLRQNEPREKFAYMINWKSLFNGSIF
FT                   VAGDDGTRYFREDEEDRHGYKYNHGNWVMIPNQNHPHIIMDQAQYEQLSNDQSAKADQI
FT                   KELISYAIKADSIEKLSKKIDAPYLKQAVEDFNFLTDVKKRDMFLNRKIETMRSLKEGP
FT                   YYAIPVRHNILHTHGGAQRNSKCEVIGLDGKAIPNLYEAGELGDIFATKYLGANSIADL
FT                   LISGKIAGTNAAKIKNNMTLPDAVTSASQVHEDLKSDAHQVKMHFEAGKNQGIGSSDQG
FT                   INDLPIVVRVTLDENQNLKNIETLQEKESGDLGGQAIPKLTQEMLDHNSADVDSVSGAS
FT                   TTSRAFKDAVKQAIENARKSK"
FT   gene            532843..534282
FT                   /locus_tag="LGAS_0506"
FT                   /note="LactoCOG number LaCOG01717"
FT   CDS_pept        532843..534282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0506"
FT                   /product="Di-and tricarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59904"
FT                   /protein_id="ABJ59904.1"
FT                   /translation="MVRGEDIQMLAKVNWKGFILPVIIGCVLWIITPFRPAAITPIAWH
FT                   LFALFIATIVACITKPLPMVGSTLVAVTIGTLLHIFNIKEVSASFGNTTVWLIAMCLFM
FT                   SAGFIRSGLGKRVAYLFIRSFGKRTIGLAYSLSTVETLMAIAIPSNIARVNGIMYPIID
FT                   ALSRQMGSDPKEGTQRKLGSYLIFNEYEVNIVTSTMFLTGLAGNMVALGIAKTQGITVS
FT                   WMQWFLAAIVPGLISLILVPFILYKIYPPEVKETPNANAWASKKLEEMGKMTPAEKIMA
FT                   CVFVLALLLWLLGSSIGIDATLVGFIAVSILLISGVITVKDMMDQKGAWSLIVWLSIVM
FT                   LMSQKLMKLGFFPWFSKELGLMLHGVNWVWVLVILFLVYFYIHYMFPSITTQSSAVLAG
FT                   FLSIALGAGVPKLMAGLMLGFAGSIFCSTTPYSAGPAALLSTTGYVKSSDWWKLSAIFG
FT                   VFLNIVWLGGGLLWTKIIGFW"
FT   gene            534410..535330
FT                   /locus_tag="LGAS_0507"
FT                   /note="LactoCOG number LaCOG03243"
FT   CDS_pept        534410..535330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0507"
FT                   /product="L-glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59905"
FT                   /protein_id="ABJ59905.1"
FT                   /translation="MIQLEQLVQKNLAKEKEGKVASYIPALAEVNPKQLGVALYDLDDG
FT                   EIGEAGQSEVRFAIESISKVITLMLAIKKMGIQEVFKHVGSRQTGFAFNSILNMEIEKA
FT                   KYPLNPFINAGAIATTSMVVSKTGEGAFEEILSFARDICNDPNLYLDQIIYHSERRTGN
FT                   LDRSLAYYMESKNMMLGDVVTSLDTYFKQCSMMVTAHSLANLGAVLANGGVKPWDNKRI
FT                   ISDEEARCVKSLMMTTGLYNQSGTYSRLIGVPTKSGVGGGLMSAAPHKYGIGIFSPALD
FT                   KAGNSVAGLDLLRDIVEGLELDIFD"
FT   gene            535945..536583
FT                   /locus_tag="LGAS_0508"
FT                   /note="LactoCOG number LaCOG00700"
FT   CDS_pept        535945..536583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0508"
FT                   /product="Membrane-associated phospholipid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59906"
FT                   /protein_id="ABJ59906.1"
FT                   /translation="MEIGVKMKKYSKAIYWGLPISLILAISIILHLGWINAFDNFFEGL
FT                   VHIVPNLKGLMLKITFLADTKVDLVWMVLIAVILWFRKHRPLATNLVLTMITGDAVGWV
FT                   IKHLIQRARPVQHLAVDDGFSFPSGHTLGMGMIVIWIIMVLLPVVLKDRTKRFWIDFLL
FT                   IVWLVIVMISRVYVYAHYPSDVCGSVAIALTWVAVMQFVFEKIKQTVNK"
FT   gene            complement(536780..537991)
FT                   /locus_tag="LGAS_0509"
FT                   /note="LactoCOG number LaCOG00078"
FT   CDS_pept        complement(536780..537991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0509"
FT                   /product="Permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59907"
FT                   /protein_id="ABJ59907.1"
FT                   /translation="MQKKADKPIWKKNLFVLSIAVFIAGISFSEIMPFLPLYIDTLGHF
FT                   THQQLNFWSGFIFSGVYFVSAVISPWWGKLADKKGRKLMILRASLGMAIVLGSMGLVTN
FT                   VWQLFFLRMLQGVFAGFVSNSNALIATETPKEKSGQALGTMSSAFTAGNLLGPFLGGAL
FT                   ASAFSYRVTFFITGGLLLISFLLSLFFVHEEGFKPITEKKLDKASGVIATLRSPALIFG
FT                   LLLTTLIIQAANNSINPIVSLYVKQLMNGNGNVVFVSGIIAALPGIATFLAASRFGALG
FT                   DRIGTHKIIIGGFIGATILFFLTAFVHNTVQLGILRFLVGFTDACLFPQVQTLLTKNSP
FT                   AAVTGRIFSWNQSAMYIGNIVGPLLGSFIAGISSYSMVFIVTAAIVVLNLILFNFNVVR
FT                   NLAK"
FT   gene            complement(537993..538202)
FT                   /locus_tag="LGAS_0510"
FT                   /note="LactoCOG number LaCOG02322"
FT   CDS_pept        complement(537993..538202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59908"
FT                   /protein_id="ABJ59908.1"
FT                   /translation="MSKFNPLCEYIKNNKDSDFQLSFDQIQEIAGLPIDHSFLTYKKEL
FT                   KDYGFEVGKISLKNKTVNFKKLED"
FT   gene            complement(538195..538626)
FT                   /locus_tag="LGAS_0511"
FT                   /note="LactoCOG number LaCOG00965"
FT   CDS_pept        complement(538195..538626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0511"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59909"
FT                   /protein_id="ABJ59909.1"
FT                   /translation="MRKRPLANLLYHIGKLENLLINQRLSSINLRMTHAHALRYIQKHP
FT                   GCIQKEVAEYLFYQPASFTNVVKLLEKKQMIERRPDPKNGLKKQLFLLPAGKDVLDQVN
FT                   QAFEEVNQLVGTVNSDTLTKLEEISNNLEKQVQRRPKNE"
FT   gene            complement(538714..539301)
FT                   /locus_tag="LGAS_0512"
FT                   /note="LactoCOG number LaCOG03244"
FT   CDS_pept        complement(538714..539301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59910"
FT                   /protein_id="ABJ59910.1"
FT                   /translation="MKKLVLVIFSTLLLTACSNTSSNNNENKSSSSKSSITTSKNSTTT
FT                   TPKPNLNKKYPGFKLATIPDNFQGTWYQTDIYSTQARKFIITKHTIMDSVVYQKTDPNL
FT                   NLSHRSEKDNKTYAGNTTMVSFEDKNGSQWLRARGFLDTVDIIYITGTFKGHRCLYLAY
FT                   SSGDIHSAIFKDQKAAIKYRKYDFSKITNPNN"
FT   gene            539609..540694
FT                   /locus_tag="LGAS_0513"
FT                   /note="LactoCOG number LaCOG00281"
FT   CDS_pept        539609..540694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0513"
FT                   /product="glutamyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59911"
FT                   /protein_id="ABJ59911.1"
FT                   /translation="MKKEQEIEMLKEFSDANSTSGFEEEFVKLFSTYAKDTADITVDGM
FT                   LNVYAAKKENKGDRPVIQMDAHSDAVGFITQAVRPNGLIKFVPLGGWVKYNIPALKVKI
FT                   KNRDGEYIPGVVATKPPHFMTAAERNSIPEVADMSIDVGSSSREETIKDYKIDTGCPIF
FT                   VDVKCEYHEKSGLFFGKDFDDRFGAGAMIGVLDNLKGEETNFDVVAALSSQEEVGLRGA
FT                   YVTGRKIKPDLCIVLESCPADDTFEPEWLSQTGLKRGPMLRDMDTTFLPNPKFQQYACD
FT                   LADKNGIPYTRSVRTGGGQDGAAIYYEYGAPTIVIGIPVRYEHSPYCFSAYKDFKASVD
FT                   LATAIIRDMTKEKLDSFKKVI"
FT   gene            541289..541783
FT                   /locus_tag="LGAS_0514"
FT                   /note="LactoCOG number LaCOG02323"
FT   CDS_pept        541289..541783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0514"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIB"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59912"
FT                   /protein_id="ABJ59912.1"
FT                   /translation="MPITLARIDQRLIHGITVNQWNKVLHPKRFMVIDDEVSQNEMVKA
FT                   SMRMSKPTGTGMSIINEEKAITNFKNGKYDSHSVFLIVKEPHYILDLINAGIEIPKVNV
FT                   GALFEEGDRKPYTKRVALDEKELADLKAIADKGIPVFFEYTPDDENEVSLAEVLKNKGE
FT                   N"
FT   gene            541786..542583
FT                   /locus_tag="LGAS_0515"
FT                   /note="LactoCOG number LaCOG02324"
FT   CDS_pept        541786..542583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0515"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIC"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59913"
FT                   /protein_id="ABJ59913.1"
FT                   /translation="MPIILQNILIILLAAYMAWDNGTGNQITGNWPVIIGMLVGLIMGN
FT                   LSVGLVIGGTLQLMSLGVAAIGGSSIPEYGVATIVGVFIAIRTGASTGTAIAVGLPVGM
FT                   LTLQLDVVIKIINNFFAHWSQRLLHEKKFNKMDGVFYLTIFVWMLKYIIPIALVVMFGT
FT                   PIVKLILHVIPAWVTNGLTIAGGMLPVVGIGMLLRYMPVKKYLAYLLAGFVLAGYLKVP
FT                   ILGIAILGLAATYEIYRINSAKKDKEELQTAGTVEDEGDDFDE"
FT   gene            542558..543409
FT                   /locus_tag="LGAS_0516"
FT                   /note="LactoCOG number LaCOG02325"
FT   CDS_pept        542558..543409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0516"
FT                   /product="PTS system IID component, Man family"
FT                   /note="TC 4.A.6"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59914"
FT                   /protein_id="ABJ59914.1"
FT                   /translation="MKETTSMSKEMNQLENGKKLTTHERKDMFRRWIFNAGLGYNFETQ
FT                   QAPAVAFSMRKALRKIYPNDDEYIEAMDNHYKYFNANPLMANIILGATLAMEEKDGIKA
FT                   KDAVQSLKTSLMGPFSGVGDSVFWILIPTIMGSIAGYMALQGNAVGAILWMLLQLSFYW
FT                   LKMWFFKTGYDSGTKLITSLGEKINIFTDAISVMGLMVVGSLIPTVVKVYTPLKFRTGK
FT                   VMLSIQSGVLDKIMPALLPVAVTGLVYWLLGRKKWTPTKIILLIIVICLAGAATGILGV
FT                   AK"
FT   gene            543422..543853
FT                   /locus_tag="LGAS_0517"
FT                   /note="LactoCOG number LaCOG02326"
FT   CDS_pept        543422..543853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0517"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose-specific component IIA"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59915"
FT                   /protein_id="ABJ59915.1"
FT                   /translation="MSNIKRHIVIASHSTLAEGMANALKFFEGDSLKLTVLSAYVDNKP
FT                   IEGQIEEIFNQFDKNDEVVVLTDLLGGSVNQKFFPYISRPHTHVITGMNLSLAMAITME
FT                   PVDGYLTSEKIQSIVSEAQNQVKYVNELAADSSEDDEDE"
FT   gene            543831..545513
FT                   /locus_tag="LGAS_0518"
FT                   /note="LactoCOG number LaCOG01104"
FT   CDS_pept        543831..545513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0518"
FT                   /product="Trehalose-6-phosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59916"
FT                   /protein_id="ABJ59916.1"
FT                   /translation="MRTMKMNDWKKKAIVYEAYVQSFNDSDGDGIGDLPGLIEKLDYIK
FT                   NLGANVIWLTPIFKSPLVDNGYDIADYEAINPIYGSMNDFKKLLQQAHERDLKIVMDLV
FT                   VNHTSDQHKWFKESKKNRNNKYSDYYIWRDPKEDGSAPTNLGSAFGGSAWTYVPERNQY
FT                   YLHLFAKQQPDLNWDNPQVRNDIYQMMKFWLDMGVDGFRMDSISFISKPSKFEDAPLED
FT                   NKEYGAYYYGSANGPHIHEYLREMNQKVLSKYDVISIGETPHTTAREARLFVEPDRHEL
FT                   DMVFQFEHMHVDYGEFGRYSDVTFKMSDLRNSMTSWQNDLSWNSNYLGNHDQPRIVSRF
FT                   GNDSKYRKESAKMLAMVSLLQKGTPFIFQGEEIGMTNLHIKNIDELKDLEAHNIYSFLK
FT                   SKGISDKDALKMVNRKTRDNARTPMQWNKEQNAGFSSGNPWIEVNPNYLEINVKKDLQD
FT                   SNSIYRFYQKLLKLRNNNQVLLDGNYDLITPEDSAIFAYTRSSDKDKVAVICSFVPYKV
FT                   KYELPEDFVNKNKVILSNYDDREDMASNTIYLRPYEGVVIKRE"
FT   gene            545506..546489
FT                   /locus_tag="LGAS_0519"
FT                   /note="LactoCOG number LaCOG03245"
FT   CDS_pept        545506..546489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0519"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59917"
FT                   /protein_id="ABJ59917.1"
FT                   /translation="MSNMKDVAREANVSVATVSNFLNGKKVRPKAAKDIDLAIKKLNYV
FT                   RNNTARFLKTQRSAFVVFVVPSVWSPFFSELTFWVQKYLDNLGYKMVLCVSENDYQKEK
FT                   SYVTMAEEQRVAGILSISYSDLTSHVHSDIPLVSIEKESTGQFSLVSSDNYEGGKIAAK
FT                   ELSERNIDKYIFIGSANHSSVEMNARKAGFIDYCNNHGLKFEIAEVDSRKNDKKKIKNL
FT                   IDEISNNGKKYGIFAHTDEIALILTQEFQDAGLKIPEHVQIIGFDGWKLTPDTHLTISS
FT                   IRQNIEEIAKTAVEQLHKEMEDPDHREISRLMIPVAFRAGDTTENK"
FT   gene            546501..548507
FT                   /locus_tag="LGAS_0520"
FT                   /note="LactoCOG number LaCOG00488"
FT   CDS_pept        546501..548507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0520"
FT                   /product="Alpha-glucosidase, family 31 of glycosyl
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59918"
FT                   /protein_id="ABJ59918.1"
FT                   /translation="MFNTRNTQFLDYFYEGEHLCIYPWGHGLRVHDSFFDGMHNWALTE
FT                   KSDFDSNFRVIYNADEATIVNGKTKAIVNKNGKITFYDKNKIILEEFWRERNFRKIKIN
FT                   NSQFLNQKENEYSSALKIKARDFSPNNKGSYEVAVRFEANDNERIYGMGQYQQSQLNLK
FT                   GCKLELAQRNSQATVPFLISNYGYGLLWNNPGIGEVTFANNITEWKNIDTDCIDYWICA
FT                   EDTPKEIISAYTNVTGHSPKMPQYALGLWQSKLRYRNQNEVISVAKHYHDLHIPLSVIV
FT                   IDYFHWPKQGDFKFDKRYFPNPEKMVKDLKRLNVELMVSVWPNIDCTSENYNEMNEKGY
FT                   LVRVDNGKSITMTFHGNTTFFDTTNPKARRFVWDKIKRNYYQKEVKHFWLDEAEPEYST
FT                   YDFDNYRLHLGRNSQVGNIYPTLYAKGFYEGEKKEGQHNPISLIRSAWAGSQKYGSLVW
FT                   SGDIDSSFRSFKYQYQAGLNIGLAGIPWWTSDIGGFHGGSSTDSEFKELLIRWFEFAVY
FT                   CPILRMHGDREPHEFPIDNQVEGTGAPNEIWSFGKETFDILRKQVNIREALKPYINSCM
FT                   NEAHEKGFPVMRTLFFEFPEDKVSWNIEDEHMLGKKYLVAPIFEFGKRRRQVYLPFGSR
FT                   WKDVNSGSIRSGGIWVNCEASLDQIPVFERIDY"
FT   gene            548612..550108
FT                   /locus_tag="LGAS_0521"
FT                   /note="LactoCOG number LaCOG00471"
FT   CDS_pept        548612..550108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0521"
FT                   /product="Dipeptide/tripeptide permease"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59919"
FT                   /protein_id="ABJ59919.1"
FT                   /translation="MMNNSTTEKTFFGQPRGLSTLFFTEMWERFSYYGMRAILLFYMYY
FT                   AVERGGLGMDETTAASIMSIYGSLVFLSTVAGGWLADRIWGARSTVFFGGVLIMIGHIV
FT                   LALPMAELGLYISIAFIVIGTGLLKPNVSNMVGGLYSLDDRRRDAGFSIFVFGINLGSA
FT                   LAPWLVPWASEGFGFNLFGNHLNFHAGFSLAAVGMFFALVQYVWGGKKYLSDDGMQPTD
FT                   PIDPATRNKLLKRVLLGVLVLAVVLGVMAALGQLNVDNIITLITIVAIALPIYYFVLML
FT                   RSPKVTKEERSKVWAYIPLFIAAAIFWGIEESGSVVLALFAAQRTVLHIGNWHFTAANF
FT                   QTLNPLFIMILTPFFVWLWDNWRKQPSAAGKFAAGLVFAGLSYMWMALPGMLYGTNGRV
FT                   SPFWLVGSWFIVEIAEMLISPIGLSVTTRLAPKAFRSQMMSLWFLADATGQAVNSQIVK
FT                   YYSSKTEVAYFLIVGLVSVLFGVVMFFFTKKIHNLMADAE"
FT   gene            550244..551490
FT                   /pseudo
FT                   /locus_tag="LGAS_0522"
FT   gene            551516..552436
FT                   /locus_tag="LGAS_0523"
FT                   /note="LactoCOG number LaCOG01137"
FT   CDS_pept        551516..552436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0523"
FT                   /product="alpha/beta hydrolase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59920"
FT                   /protein_id="ABJ59920.1"
FT                   /translation="MRINIFQLIIVLVYWRKSVRGKIMKKRKIYLTSFFIALFLLFLAG
FT                   CSQKSQEVPDKKVTVSLNNTKTIPTFFFHGWGSSVNAEKHMANAAKEAGAANTIVQADV
FT                   SKNGTVKLNGTIPKNAKSPIIEVNLEDNQSGKTSYVKDVITAVSNKYHYAKINLVGHSM
FT                   GNLQIANYINENYNNKKLPQINKVVSIAGHYNGYLGEEAGQKAKIKNKETGQPDIYSDG
FT                   FKQLLPLRMHYPRQIEVLNIYGNKEDGSKSDGSVSVASAQSYKYLINGRAKSYHEVEIK
FT                   GKNAQHSKLHENEEVDHLLIDFLWK"
FT   gene            552525..552965
FT                   /locus_tag="LGAS_0524"
FT                   /note="LactoCOG number LaCOG02148"
FT   CDS_pept        552525..552965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0524"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59921"
FT                   /protein_id="ABJ59921.1"
FT                   /translation="MELSETEKLNFAIIRGSKAYEEWDRQQGMPNYLTIILYELLMRQK
FT                   LTQKDLVSLSDLPKQSINKGIHRLLEQNYLELTIDPDDNRVKYCQLTASGKKYAKEKMA
FT                   SLFEIEKEVAQKMGSKKMKQLVALNEEWSDTFWKFLRKKGEK"
FT   gene            552966..554699
FT                   /locus_tag="LGAS_0525"
FT                   /note="LactoCOG number LaCOG00219"
FT   CDS_pept        552966..554699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0525"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59922"
FT                   /protein_id="ABJ59922.1"
FT                   /translation="MQILKPHFKNYRKEIIFAIITILVSAFATLWQPRLLENIQKAILA
FT                   DNHDTVLRDGIGLVVLGLLAIIAGIFNVYYAAKIAQGITSDLREETYAKIQSFSFGNIE
FT                   KFSSGSLVVRLINDMNQVMNMMMILFMQLLRMPIILLGSFVLSIVTIPHYWWAPVLMLA
FT                   LMIGVGLVVIQNMNQLFAKFQKYMDKISTQVKENLQGVRVVKSFNQGENEIRRFNKTSD
FT                   DLNELNIKIGYWISTIMPAFMLIAYLVIALVVFLVGRSANLNPSDVAVVSPYVSYILTL
FT                   LFAILIGGFVIMNFTRGMVSLRRIKEVLDTEPDVQFVSNASAAPKKGSIEFDNVSFTYP
FT                   DGDKPTLKNISFKVKPGEMVGIVGATGSGKSTLAQLIPRLYDPTKGTIKIGGKDLKTIG
FT                   EKALRNTVSMVLQKAILFSGTIASNLRQGKEDATDYELKRASEIAQAQEFVGQYPDEFD
FT                   HAVEERSANFSGGQKQRLSIARGVIGQPPILILDDSTSALDAKSEKLVQEALEHDLKDT
FT                   TTVIIAEKIVSVMNADKILVLDDGKLVAEGTHEELLKISPIYQDIYRTQKAKEKRGEID
FT                   E"
FT   gene            554683..556461
FT                   /locus_tag="LGAS_0526"
FT                   /note="LactoCOG number LaCOG00180"
FT   CDS_pept        554683..556461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0526"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59923"
FT                   /protein_id="ABJ59923.1"
FT                   /translation="MKLMSNTKKALRYFAKYLKNYWKGVTIVVVLSLVSTLSQVLGPLF
FT                   LGNAVQELTKAVSNVARRSHDLSSFYQSLGSMVSVYAAGIIASFIAWMVMSKFTANATN
FT                   DMRENLFAKFQRMLIRYFDTHQDGKLLSLFNSDLDNIFNALNNAIFEIISQGALLIGTI
FT                   IMMFIVNPTMAWFTVATTPFILIISLVIMKKARIYLDKQQDKISDLNGYVNEQINGEKV
FT                   IITNGLQEESVQSFKKYNNDVRNAMFKGQFYSGMLFPLLQGISLLNLAIVIGGGAWLIV
FT                   SGQVSRAVGLGLIVAFVEYSQTYFQPLTQLTSIYSMTQLALTGARRLATVEEQDEENTV
FT                   PNGKVLQGIKKGVKLENVHFGYNADKEILHGVSIDVDKGKSVAVVGPTGSGKTTIMNLI
FT                   NRFYDVNSGKVTFDGVDVRDITLESLRNNVGIVLQDSVLFTGTVEDNIKYGKPTASREE
FT                   VIAAAKEANIHDFIMTLPEGYDTHVSEENSVFSTGQKQLISIARTILTDPEFLILDEAT
FT                   SNVDTVTEAKIQKAMDAVIAGRTSFVIAHRLKTILNSDKIVVLKDGNVIEEGNHDELLK
FT                   KRGFYYGLYTNQMAFE"
FT   gene            556511..557332
FT                   /locus_tag="LGAS_0527"
FT                   /note="LactoCOG number LaCOG01690"
FT   CDS_pept        556511..557332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0527"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59924"
FT                   /protein_id="ABJ59924.1"
FT                   /translation="MKRKLRIFSLFTVLLSVFLLSACRKNTRNVYQEVKRSNEITWGVK
FT                   ADTRLFGLMSIKTGKIEGFEVDLANALTKEMLGKDAKANFVQTTAKTKIPLLKNGNIDA
FT                   VLAAMTITPERKKQIDFSEPYFYAGQSLLVKEDSTIKNVQDLNGKTALAVKGTTAVANV
FT                   KKFAPKAKVLEFDDYGQAFTALKAGQGQAMTTDNGLLAGIATENKGYKLVGGTYTNEPY
FT                   GIAVNKGQKQMKNAINRALNKLKKDGTYNALVKKWFSGIPGFNIKEAEGEK"
FT   misc_binding    557401..557665
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="T-box leader, riboswitch"
FT   gene            557755..558531
FT                   /locus_tag="LGAS_0528"
FT                   /note="LactoCOG number LaCOG01689"
FT   CDS_pept        557755..558531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0528"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59925"
FT                   /protein_id="ABJ59925.1"
FT                   /translation="MSKKERGSTMAAIIDFKHVNKYYGKFHALKDINLSIEEGQVVSII
FT                   GPSGSGKSTLIRTMNGLERINSGTLMVTGYDLADKHTDLNKIRKNVGMVFQHFNLYDNH
FT                   TVLENITLAPKIVLHRPEKENHDIAMDLLKKVGLEEKANMYPRQLSGGQKQRVAIARSL
FT                   AMRPKAILFDEPTSALDPEMIQDVLDVMKYVADQGITMVVVTHEMGFAREVGDRLIFFD
FT                   QGRILEDAKPEEFFEHPKTERARQFLSKVITEKLGG"
FT   gene            558524..559357
FT                   /locus_tag="LGAS_0529"
FT                   /note="LactoCOG number LaCOG01690"
FT   CDS_pept        558524..559357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0529"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59926"
FT                   /protein_id="ABJ59926.1"
FT                   /translation="MAKMKKSIKIFILPLVLVLLITLTGCAKKQKSSNIYEQVKESKTI
FT                   TWGVKADTRLFGLMSIKTGKIEGFEVDLAKALTKQMLGKNAKTEFVQTTPKTRIPLLKN
FT                   GNIDAILATMTITPDRKKQVTFSEPYFTAGQSLLVKDNSTIKNVKDLNGKTALAVKGTT
FT                   AVDNVKKFAPKAKVLEYDDYGQAFTALKAGQGQAMTTDNGLLAGIASENKGYKLVGGTY
FT                   TSEPYGIAVEKGQTDFADRINKALNELKKNGTYHRLLVKWFNGIPGFNIKEVENS"
FT   gene            559354..559992
FT                   /locus_tag="LGAS_0530"
FT                   /note="LactoCOG number LaCOG01691"
FT   CDS_pept        559354..559992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0530"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59927"
FT                   /protein_id="ABJ59927.1"
FT                   /translation="MIGILTNHWSEFLSGFWNTILCSLIALFFSLILGVGFALLEVAPN
FT                   KFGRAVAHVYIEIFRNIPLLVITMIFYLVVPQIWFKVSGFAAGTIGLTLYTSAFIAETV
FT                   RAGINSVGDGQMEGARSNGMTYTQAMRYVILPQALKIVIPPLGNQFINLIKNSSVLAFV
FT                   AGFDLMYQADVIAFSSFETINTYVVVGLFYLILTLPLSYYMRHLEKKLA"
FT   gene            560006..560656
FT                   /locus_tag="LGAS_0531"
FT                   /note="LactoCOG number LaCOG01692"
FT   CDS_pept        560006..560656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0531"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59928"
FT                   /protein_id="ABJ59928.1"
FT                   /translation="MENFIHAYSWINIRFLLQGLWVTIYVSLISIALSFILGLVFGFIR
FT                   YVKIKYLSAVVGFVIDIIRNLPLLLIIFFTYFGLPELGIVTNPTVASIIALVVFEGAML
FT                   AEIVRSGIAAVDPGQMEGARSNGMTYMQAMYHVIIPQALNKMIPSLLSQFVSLVKDTSL
FT                   ATIIVLPELLFHAQIIYSQNTTYLIPMYVIIAIMYFIVCFSLSMIAKHLQSKY"
FT   gene            complement(560703..561527)
FT                   /locus_tag="LGAS_0532"
FT                   /note="LactoCOG number LaCOG03246"
FT   CDS_pept        complement(560703..561527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59929"
FT                   /protein_id="ABJ59929.1"
FT                   /translation="MNRKELEKRVDEADITADPIFSWVMEQGNNCRDLLRAIAPELHIQ
FT                   TAGFETQKRLKFHPAMHGIIPDIYATDDKGRVFDIELQMTLPDFLGKRMRYYFSMMDQS
FT                   LFMQGENYRNLPTTYLILILPTDPLGLDQYRYNTTWSTEGFRHDPLNIGQNLILLNASG
FT                   TKGEITPRLQGFFDLMRGKINTNDSFIQKLQSDVEKYKTNPERRKELMDYQMKLDDMRY
FT                   VAKEEERVDAIKKMIKLSRKLNASNDFILKQLTEDYGSYFSQKELKQFIKNN"
FT   gene            complement(561634..563292)
FT                   /locus_tag="LGAS_0533"
FT                   /note="LactoCOG number LaCOG01583"
FT   CDS_pept        complement(561634..563292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0533"
FT                   /product="alpha, alpha-phosphotrehalase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59930"
FT                   /protein_id="ABJ59930.1"
FT                   /translation="MNNLGNKVIYQIYPKSFYDSNNDGIGDLRGIIEKIDYIKKLNVDF
FT                   IWFNPFFVSPQNDNGYDIADYKKIDPRFGTMDDFEELVTKLKSINVNVMLDMVLNHCST
FT                   EHEWFKKALAGDKKYQKFFYLRKGKDGQLPNNWQSKFGGPAWSKFGDTDYYYLHLYDPT
FT                   QADLDWHNPEVRAALIDVVNFWRNKGVHGFRFDVINVTGKDTTLVNSTDPVQEKSLYTD
FT                   TPVVQQYLKELNAKSFGQDPESVTVGEMSSTTIENSIAYTRPEDHELSMVFTFHHLKVD
FT                   YKNGEKWSKMPFDFKKLKDIMLTWNSKIDQGGGWQALFWNNHDQPWALNRFGDTGKYHN
FT                   KSAEMLALALHLLRGTPYIYMGEEIGMMDPHYTSMKDYVDIEALNAYDALIKKGIDEKE
FT                   AFEIVQSKARDNSRVPMHWDNSQYAGFSDHKPWLMPTDQDRINVEKELLDGEIFNFYQK
FT                   LIKLRKSEKLISEGHIKPFLMEHPQVMAYERYLDDSNEKLLVFANFYGKETEVKIPAEY
FT                   LNKAGHILIQNYDKNLASLPLALQLKPYEALAIKL"
FT   gene            complement(563307..564209)
FT                   /locus_tag="LGAS_0534"
FT                   /note="LactoCOG number LaCOG00312"
FT   CDS_pept        complement(563307..564209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0534"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59931"
FT                   /protein_id="ABJ59931.1"
FT                   /translation="MKVSAFINLDLNTILVCTSCQYYFMKKLTFLLNKHFVDNKVFLYL
FT                   SKQVYIIKDKGGFFMAQSKVSAIAQDLVDKIKHQQYKPGEYLPSEHQLMDLYGASRETI
FT                   RKALTSLTDLGLIQKIRGKGSIVLNLDRYAFPISGISSFAELNNQLGLKAETKVLLLQK
FT                   EEHLPTGFIKYFPEEKNSAGFHLERLRLIEGQADVLDCDYLLSPPINSLPKDAAKTSIY
FT                   NYLENKEKLEISYATKEISVCTVNQRIRDLLQLDNELAVLVASRNYLADTTKFELTLSY
FT                   HRPDKFKFVDFARRKKIKF"
FT   gene            564190..566154
FT                   /locus_tag="LGAS_0535"
FT                   /note="LactoCOG number LaCOG00314"
FT   CDS_pept        564190..566154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0535"
FT                   /product="PTS system IIA component, Glc family / PTS system
FT                   IIC component, Glc family / PTS system IIB component, Glc
FT                   family"
FT                   /note="TC 4.A.1; TC 4.A.1; TC 4.A.1"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59932"
FT                   /protein_id="ABJ59932.1"
FT                   /translation="MKADTFKEENEIMVQDTTNLLAPATGAVIALAKTSDPIFSQGTMG
FT                   DGFGLTPTVGKVVAPVSGKISMVADTKHAVGIVTNEGLEVLVHMGVDTVGLKGAPFTIK
FT                   IENGQEVKAGDEIAEMDLDEIKAKGLDTTIMVLITNSADKISGLDVTEGEAEAGEVVAT
FT                   AYLKTSETEDTSSKKLSYPELAAFIIKNVGGKDNVNNVIHCITRLRFYLKDESKANDDV
FT                   LKNQRGILDVMHASGQYQVVIGNEVTNVFDEVVKQLGPLDSEAAPAPEDDGKNPVSKAF
FT                   GNLIGFITGSMSPIIGVIAAAGIIKGILALLTLPQLGSLLSVKSTAYITTSAIADSAFF
FT                   FLPVLVGYCAAKRLNSDPIIAAVIGGVLVYPQLVEWGKAFKTMFEVGGIKFEFLNYTYS
FT                   IFPMILAAWLAKKCEDWLKKWLPSYLQMIFIPLITVLVVSALTLMVTGPIIQGVANGIA
FT                   VFINWLVHASGWIGGFIIGGFYQVLVIFGLHWGVVPLVAQQIAGTGESALNAIICSSMI
FT                   AQGAAVLAVAIKSKKEDLKELGFASTISAMCGVTEPAVYGISLRYKKVFISGCIGSAFG
FT                   GLVTGLMHGTMYGFTGGLIGFSSFFNPKHPTDLSSFYTFLIASAVTIVVSFIVTWVWGY
FT                   NDSMVQGAKVAKKKRPGSK"
FT   gene            566297..567091
FT                   /locus_tag="LGAS_0536"
FT                   /note="LactoCOG number LaCOG01276"
FT   CDS_pept        566297..567091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59933"
FT                   /protein_id="ABJ59933.1"
FT                   /translation="MIFEKLFSKENKKDEIVDVKLSDKKFNELRIKLSIGDVTVEQGEN
FT                   FSVNFTGKRHYLPLIRLEDGKLRLKQKMNLIEKGEAHLKVVIPTKVTLDSLDIQTSSGD
FT                   IEIVDIKTEKAYLKSTEGRVRVRRVAIAETLLESTDGNVTVRNSDLADGKLATYDGEIK
FT                   VSGSILSRISLNVTDGDMNLTDVTIDEGNANLKAGNFTLDHAVFKSDYEIKNIEGNNTV
FT                   WSANLKYAHVRTANGLNNISFDPQPSGVVLTMTTVDGDNVVE"
FT   gene            complement(567131..567859)
FT                   /locus_tag="LGAS_0537"
FT                   /note="LactoCOG number LaCOG01093"
FT   CDS_pept        complement(567131..567859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0537"
FT                   /product="uridine kinase"
FT                   /EC_number="2.7.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59934"
FT                   /protein_id="ABJ59934.1"
FT                   /translation="MSILLPVNLSQSVILRYYCNSLKKEILIVQSKRPIIIGIAGGSGS
FT                   GKTTIAHEIYDQLQQDDHILIMTQDSYYKNNDDLSMSERKKINYDHPDAFDMPLLVEQL
FT                   RQLMDYKAVEMPVYDFTAHTRSEKTIHTEPADIIILEGILVLGEENLRNLMSIKVFVDT
FT                   DDDIRFIRRLERDTQERGRSVHSVHSVIDQYLKTVKPMYNQFIEPTKRYADIIVPEGGE
FT                   NDVAIDMLTTKIRSVLSNVK"
FT   gene            567937..568827
FT                   /locus_tag="LGAS_0538"
FT   CDS_pept        567937..568827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59935"
FT                   /protein_id="ABJ59935.1"
FT                   /translation="MTAQEKAAIKNWNPRYRRNVYLYLWIYGILGAVTGITNDAALSYF
FT                   DIVAPGLISGLNIFNAITALLMSLMIVWVHELGYRKILLILPPLTSIFLALTTITTNQI
FT                   VIMFAYIISWTAIGVYDLMYPLMWTSYVPKEIRTKMFTVVMVVNLVAQTILTFIGGKAV
FT                   VYFFSKMQSIPYDTASNLSAHTAQLSGSYLANYTNAFRIVLILTALVNVVAFVLAIFIK
FT                   DEPKDYRTVGMKKPQTPEEKKKAFEALINKKTIMWILYIAGIQLGARLVVPYIPIYLND
FT                   YLHIPRGITSTINTF"
FT   gene            568837..569304
FT                   /locus_tag="LGAS_0539"
FT   CDS_pept        568837..569304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59936"
FT                   /protein_id="ABJ59936.1"
FT                   /translation="MFIGYFFAPFLAKKLGAIVSIAAGTLTCAPLMFLMANGRHFGTGI
FT                   TLFVVVGVLLFLRSGLANATMPIQQEVQMIIVDKDMRPAFTAVVQIAYAVIGIIDGLFT
FT                   AFYLLKTPAGYANAYYIATALYVVVSILLIVMFAKQYNWILDEKKSKSNEK"
FT   gene            569445..569618
FT                   /locus_tag="LGAS_0540"
FT                   /note="LactoCOG number LaCOG03247"
FT   CDS_pept        569445..569618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0540"
FT                   /product="Lactacin F two-component system inducer peptide
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59937"
FT                   /protein_id="ABJ59937.1"
FT                   /translation="MMKDIRKENIVKATTLSEEEMIEVVGGKAVNGFVNGNFSSRISLF
FT                   CTFTKNDSKINE"
FT   gene            569648..569977
FT                   /locus_tag="LGAS_0541"
FT                   /note="LactoCOG number LaCOG03248"
FT   CDS_pept        569648..569977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0541"
FT                   /product="Pediocin immunity protein PedB"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59938"
FT                   /protein_id="ABJ59938.1"
FT                   /translation="MEDRNIKNELKQVLNDFISLAKTRYDRKGNEYLLEQLEVALDKLE
FT                   HNVQDEVDEARATYQNINTICLTNHLHLETDEEALLEKIKKISMSKGWLGGLNSWNTTN
FT                   TWPGK"
FT   gene            570113..572914
FT                   /locus_tag="LGAS_0542"
FT                   /note="LactoCOG number LaCOG02327"
FT   CDS_pept        570113..572914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0542"
FT                   /product="Cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59939"
FT                   /protein_id="ABJ59939.1"
FT                   /translation="MITLTKNDENDEIIKVAQLSVEDALKELNTSQSGLTIDEVHTLQQ
FT                   KYGKNIFAKANQEPLWKKFLANFTNLMAILLWVAGIIAFCADLVQLGIAIWAVNIINGI
FT                   FSFWQEFQADKATEALANMLPSYTRVVRNGKEEKILANDLVPGDIVKLEEGDDIPADIR
FT                   VIAATTAQADQSSLTGEVNPVHKGAHAVEDAKKKNHADLNNMIFSGTNMMKGNVTGVVV
FT                   KTGMNTDFGKIAELTQNVAQQKSPLEKELDTLTKQISILAISIGIIFFLIATFFVHYPL
FT                   VKGFVFALGMIVAFIPEGLEPTVTLSLAGAVQRMAKKHALIKRLSSVETLGSTSVICSD
FT                   KTGTLTKNEMTVKELWTLEKSYHVSGEGYAVRGHIKEGPTHVFAKDNDTLKEVLLGGVF
FT                   ADNAKIQAPDKKHLRYQILGDPTEACLEVVARKGKVDVEAELKNTPRVKELPFDSSRKM
FT                   MTVIQSSDGTHRFNTYTKGAPNCVVDKCTSYLEHGEIKPITQEIKDKIMRANDGYAKDG
FT                   LRVLAVAGRNLDQKMMDNLDSATIETVEKDLTFLGLTVMMDPPRAEVYKAARECRKAGI
FT                   KVTMVTGDYGLTAKSIARQIGLNDPDKPLTVITGDALKTMPDDELRHYLEGEVVFARMA
FT                   PEQKYRVVSMYEKMGKIVAATGDGVNDAPALKKANIGIAMGGTGTDVAKEAADMILTDD
FT                   NFASIVGAIKEGRGVYSNIRKFLIYILNSNMPEAVPSVLFLLSGGAIPLALTVMEILFI
FT                   DLGTDMIPALGLGREDPEKGIMDRPPRSPKDHLINKHVLAKAFLWYGLIASIIATAAFF
FT                   GANFYRGHIFPNLPEVGWDYRQATTVTLAAIIFCQIAAVLNIRYSRQSMFNKHFFKNSM
FT                   IFIGIIMEIVLLLCISYVPVFQSFFGTEPLNSHDWIMLVCIPIPLILIDELRKWILRKN
FT                   YKK"
FT   gene            572987..573835
FT                   /locus_tag="LGAS_0543"
FT                   /note="LactoCOG number LaCOG02189"
FT   CDS_pept        572987..573835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0543"
FT                   /product="Predicted esterase of the alpha-beta hydrolase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59940"
FT                   /protein_id="ABJ59940.1"
FT                   /translation="MKKGLVMEGGAMRCMFTAGVIDTLMKEKIKFDGAIGVSAGAAFGC
FT                   NYKSRQIGRVLRYNMKYARDPRLSSWQSWLKTGDLYGADFCYRELPVKLDIFDTSAFQK
FT                   NPMDFWCVATDIDNGEAVYHKLLSGKEADLKWIRASSSIPVFARPVEIGNRKYWDGGIS
FT                   DSIPIKFFEKIGYQKNIVILTQPLSYRKEVSKLYPALELVLHKYPAVLRKLKTRAKDYN
FT                   DVLSYIRKKEVQGKLLVIRPPYHLDIGTMEKDPKELKRVYNIGVKEAQRNLKAIQSYLS
FT                   E"
FT   gene            573929..575434
FT                   /locus_tag="LGAS_0544"
FT                   /note="LactoCOG number LaCOG01165"
FT   CDS_pept        573929..575434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0544"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family / amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59941"
FT                   /protein_id="ABJ59941.1"
FT                   /translation="MSVMKKTKLFSFFFAFLLFFSLGAAFIQPAQAASEKKVAEGSVLK
FT                   KIKKSGELVVGTSADYPPLEFTASENGKTKYVGVDIELAKDIAQDLGVKLVIKNMSFDS
FT                   LLVALETGKVDMVISAMTPTPERKQSVAFSKIYYKPSGEYFLVNKKDKDKYTSIQSLKG
FT                   QAIGAQTGSNQYNLVKSQMKDSKLKGLGKINNLVLALQSGKVSAVVVEELIAKAYAENN
FT                   NSLAAVRSNLKETQSGNAVAIAKGQDELVAQVNKTIDHVQKKDLINKQYLPAAAKYMKT
FT                   EKKSNTFAKYIPYFFKGIWYTIVITVFSVIIGIVLGIILALMRLSKNPILHWLAVCYIE
FT                   FIRGTPQMVQILFVYFGIGYLISNLSALVAGIIAIGLNSGAYVAEDIRSGIDSLPKGQM
FT                   EAARSLGLSRQKAFRYVIIPQAIKNIWPALGNEFITLLKDSSLVSVIGVAELMYQTQLV
FT                   QTSTYKGVLPLFIAMIIYFIMTFSLTRLLNHFEKRMKRNDSND"
FT   gene            575418..576152
FT                   /locus_tag="LGAS_0545"
FT                   /note="LactoCOG number LaCOG01193"
FT   CDS_pept        575418..576152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0545"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59942"
FT                   /protein_id="ABJ59942.1"
FT                   /translation="MTAMIKVEHLKKSFGKKEVLKDISANVDKGKVISIIGPSGSGKST
FT                   FLRCLNVLETPTSGKIVFDGQDLTHINEKELDILREKMGMVFQSFNLFPNMNVIENIKL
FT                   APMKVKGVNEQDAEKQALELLDKVGLKDRAEQYPSSLSGGQQQRVAIARALAMDPEVML
FT                   FDEPTSALDPEMVGEVLKTMQDLADSGMTMVIVTHEMGFAREVSDEVWFMADGYLQEQG
FT                   SPEQIFENPQSPRAQDFLSKVL"
FT   gene            576243..576773
FT                   /locus_tag="LGAS_0546"
FT                   /note="LactoCOG number LaCOG01750"
FT   CDS_pept        576243..576773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0546"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59943"
FT                   /protein_id="ABJ59943.1"
FT                   /translation="MSLMKIRQATMNNYDQIMSILKDGANQLAERGVDQWQGEYPSPDQ
FT                   IKEDIDKGFAYLAVSADGETVGAISIVEAPDHSYDNLKGKWLLNTDKYVVIHRVAIHSK
FT                   HAGHGYATKLLTEVIDYIRDNRKDIDSIRIDTHENNTAMQHLIDKMNFSKVGELHGIYR
FT                   PDEISYVYENVRE"
FT   gene            576858..577760
FT                   /locus_tag="LGAS_0547"
FT                   /note="LactoCOG number LaCOG01129"
FT   CDS_pept        576858..577760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0547"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59944"
FT                   /protein_id="ABJ59944.1"
FT                   /translation="MLNTVNYMEKLMRTNFKFKIAAVLGLLAILIGLTGCANNNSNKIT
FT                   VVGSSAMQLLAEQAGNDYRLSHPDSNIVVQGGGSGTGLSQVQAGAVEIGTSDVFAETQK
FT                   GIDAKKLQNHLVAVVGIVPIVNKSAGVKNLTRQQLSDIFTGKITNWKQVGGKNQNITVI
FT                   NRSKGSGTRGTFEGLILNGKKPIQAQEQDSNGTVRKIVSSTPGTISYISFPYANDENIQ
FT                   KLSIDGIKPTNKNVATNRWHLWSYEHMYTKGKPNKNVQKFIDYMLGSKVQNDLVPKLGY
FT                   ISINKMQVERDSNNHVVQK"
FT   gene            577774..578769
FT                   /locus_tag="LGAS_0548"
FT                   /note="LactoCOG number LaCOG01128"
FT   CDS_pept        577774..578769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0548"
FT                   /product="phosphate ABC transporter membrane protein 1,
FT                   PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59945"
FT                   /protein_id="ABJ59945.1"
FT                   /translation="MMDNKDLKKVVESALDKQKVPHVKLKKIGTSKVDVASLTEPSKET
FT                   RQEYWGKGLTYCAIILIIILVASIIGFIGFHGLETFTKDHVNVFQFLTSSDWDPGEGKS
FT                   HVGAAAMIITSFSVTLLAALVATPFAIAVALFMTEYSSKKGARFLQSVIELLVGIPSVV
FT                   YGFLGLTIIVPFIRNIFGGTGFGILSATLVLFVMVLPTITSLTVDSLKAVPSDYRKASL
FT                   ALGATKWQTIYKVILRVASPRIMTAVIFGMARAFGEALAVQMVIGNAVLMPANLVSPSA
FT                   TLTSQLTSQMGNTVMGTLPNNALWSLALLLLIMSLVFNFLVRLIGKRGQK"
FT   gene            578769..579659
FT                   /locus_tag="LGAS_0549"
FT                   /note="LactoCOG number LaCOG01127"
FT   CDS_pept        578769..579659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0549"
FT                   /product="phosphate ABC transporter membrane protein 2,
FT                   PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59946"
FT                   /protein_id="ABJ59946.1"
FT                   /translation="MNAKTRNKIATAGIYTLVSIVVIILFGILGDILVSGVPHLSWHFL
FT                   SSEASSYQAGGGVRDQLFNSLYLLVLTLIISLPIALGAGIYLAEYAKDNWFTNLIRTTI
FT                   EILSSLPSIVVGLFGYLLFVVQFGFGFSIISGALALTFFNLPTLTSNIEQAIEGVPQAQ
FT                   RDAGLALGLSNWKTIRGIVLPAALPGILTGIILSAGRIFGEAAALIYTAGQSGSTIDYS
FT                   NWNPLSPTSFLNVMRPAETLAVHIWKVNTEGIIPDATIVSAATSALLIIVVILFNLGAR
FT                   ALGNHLYRKLTAAKS"
FT   gene            579670..580470
FT                   /locus_tag="LGAS_0550"
FT                   /note="LactoCOG number LaCOG01126"
FT   CDS_pept        579670..580470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0550"
FT                   /product="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59947"
FT                   /protein_id="ABJ59947.1"
FT                   /translation="MQNVNEAPTFIHQFDQDEQIISTKDLSVFYGGSIQKLFGASLQFK
FT                   KKTITALIGGSGSGKSTFLRCLNRMNDKVARVDGEIWYHGLDINKNNINVYQLRKNIGM
FT                   VFQKPNPFPKSIRENITYALKANGEKDKQKLDQIVEESLRAAALWDEVKDKLDKSALAM
FT                   SGGQQQRLCIARALALKPEILLLDEPASALDPVSTSKLEDTLKQLRTDYTMIMVTHNMQ
FT                   QASRISDYTAFFHLGHVLEYDKTENIFTNPKGEITEDYIRGSFG"
FT   gene            580430..581236
FT                   /locus_tag="LGAS_0551"
FT                   /note="LactoCOG number LaCOG01125"
FT   CDS_pept        580430..581236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0551"
FT                   /product="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59948"
FT                   /protein_id="ABJ59948.1"
FT                   /translation="MKLRKIIFAEVLDKGFTVENIITSRDVHLSYGNVEALHGISLDFE
FT                   EKELTALIGPSGCGKSTFLRCLNRMNDDIPNIHISGDIQFEGQNIYGSKMDLVELRKEV
FT                   GMVFQQPSPFPFSVYDNIAYGLKIAGIKDKELIDQRVEESLKQAAIWKETKDNLDRNAQ
FT                   AFSGGQQQRICIARALAVRPKVVLLDEPTSALDPISSSEIEETLLELKHEYTFIMVTHN
FT                   LQQASRISDYTAFLMSGDLIEYGKTADMFMNPKKQITSDYLNGRFG"
FT   gene            581254..581937
FT                   /locus_tag="LGAS_0552"
FT                   /note="LactoCOG number LaCOG01124"
FT   CDS_pept        581254..581937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0552"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59949"
FT                   /protein_id="ABJ59949.1"
FT                   /translation="MHEVFLDELRKLNTRFMGMGIDVSESIEEATQAFVDHDKKLAQSL
FT                   VKDDQKVSRAATKVEKRTLKLMALQQPVASDFRNVISILKATGDLERIGENALSIAWET
FT                   IRVKGNPRIPEVEAIIKSMSKKVNFMLDQVLKAYVQGDEKLAREVAKKDDEVDEDYVKA
FT                   RKLIIAGIKQDPEAAVASSSYFMVIRLLERIGDHVVNLAQWVVYKMSGELVDLNTKDTD
FT                   EMTEL"
FT   gene            582071..583609
FT                   /locus_tag="LGAS_0553"
FT                   /note="LactoCOG number LaCOG01746"
FT   CDS_pept        582071..583609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0553"
FT                   /product="C4-dicarboxylate anaerobic carrier dcuC"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59950"
FT                   /protein_id="ABJ59950.1"
FT                   /translation="MSNTVQKKKKHQFPTAYTVIIIVLLLVQILTFFIPSGNYATLEYD
FT                   QPNKEFVITKPNGSKHKEAATQKTLDKYKVKIDVKKFTNGTIYKPVAIPDSYEKIDQKK
FT                   PGLGGAIYQFLSSQVNGIAQSIDIIAFVLILGGCIGVVHANGAIDAGMQALSKKIKGKQ
FT                   VLLIVLVMGLIAIGGTTFGLAEETMAFYPILIPVFLLAGFDRMTVVATIFLGTSIGTMA
FT                   STINPFSTVIASNTAGVNFTEALPLRICMWATCVIVGMIYVIAYAKKVQKNPKASYVYN
FT                   DFVKEDQEYLNQDQTTQEQEFTWRQKLTLLVFAIAFIVMIWGVQQKGWYFTEIAVVFLA
FT                   TGYIFAFISGLSEHKFVESFVNGAGDLLGVALTIGLARAVSIVMEESHTSDTIMNFFSQ
FT                   QVSGMPPLVFIWFMFLVYIVLGFFIQSSSGLAVLSMPIMAPLANVVGIDRASIIDAYNW
FT                   GQGFISLVAPTGLILMSLMMVNIGFNKWFKFCWKLLVIEFGICLAFLAIGLVVY"
FT   gene            583689..584156
FT                   /locus_tag="LGAS_0554"
FT                   /note="LactoCOG number LaCOG01353"
FT   CDS_pept        583689..584156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0554"
FT                   /product="DNA-binding ferritin-like protein (oxidative
FT                   damage protectant)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59951"
FT                   /protein_id="ABJ59951.1"
FT                   /translation="MAYPKTKKIMNEIVADLTQTHMVVHQHHWYMLGRGFLKLHPYLDD
FT                   VMDELAEQQDGVAERLIEINGSPISTYEEVLEETNVPDQVGSWDLSMEERFQLIVNAYK
FT                   QLRDDYERGIKISEDEGDNSTNDLLIAYHTAVEKRIWMMSAELGKRPGEGE"
FT   gene            584281..584622
FT                   /locus_tag="LGAS_0555"
FT   CDS_pept        584281..584622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59952"
FT                   /protein_id="ABJ59952.1"
FT                   /translation="MDLFNNQQARDAAIKAMHEYHLAYKTGKNIDTAKVKQSLKKLSQS
FT                   DRTFMFIIGNTSNPLVAIPSINYDIKKNTLNKLIMACFYFKKETENKMDRQILVVQADN
FT                   FYKSVALNK"
FT   gene            584678..585604
FT                   /locus_tag="LGAS_0556"
FT                   /note="LactoCOG number LaCOG01076"
FT   CDS_pept        584678..585604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0556"
FT                   /product="Sugar kinase, ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59953"
FT                   /protein_id="ABJ59953.1"
FT                   /translation="MMNKVTIVGSINVDNIMHIKKLPQPGETIAMSEFSKAAGGKGANQ
FT                   AVASSRAKNETIFVGRVGDDDNGRFMLEQFKDNGVNVEHVTVTPNEQTGQAYILLQESG
FT                   QNSIIIQHGANFDVTAADVRNAKSQIEDSDFVIAQFETPLEATIEAFKIARAAGKTTIL
FT                   NPAPARTDIPKELLELTDLITPNETEAESITGIKVDSEESMKKSSELFHKMGIKGVIIT
FT                   IGERGSYVSYEDIEEIIPAFKVKAVDTTAAGDTFLGALSSELKPDLSNLKESVVYASKS
FT                   SSFTVQKLGAFPSIPTRDVVEQALKEN"
FT   gene            585607..586305
FT                   /locus_tag="LGAS_0557"
FT                   /note="LactoCOG number LaCOG01508"
FT   CDS_pept        585607..586305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0557"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59954"
FT                   /db_xref="GOA:Q045B8"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q045B8"
FT                   /protein_id="ABJ59954.1"
FT                   /translation="MDKSEQDQLKKEAATKAAMMVESGSVLGVGTGSTVAFFIDALGER
FT                   KEKENFSLKHIVTTSNRSKKQLEGLGFQVDELADIDQADLTVDGADRVDDNLDGIKGGG
FT                   GALTLEKNVAINSKKVIWIVDESKLVHHLSGFPLPVEVLPVSAEQNFKRFEEEGLKPQW
FT                   RLDDNGKRYVTHYGNYIIDLAADPTPVPHGLADYLDHTVGVVEHGLFLDMCDEVIIAHS
FT                   DGTIEDKKRK"
FT   gene            586390..587343
FT                   /locus_tag="LGAS_0558"
FT                   /note="LactoCOG number LaCOG01607"
FT   CDS_pept        586390..587343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0558"
FT                   /product="Inosine-uridine nucleoside N-ribohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59955"
FT                   /protein_id="ABJ59955.1"
FT                   /translation="MIRKIERRTFMSKKPLIISTDPGIDDVAAITISLFAADLDVKMIV
FT                   PTWGNVSLEHTLQNTLDLEKFLHTEVPVVKGANQPLVRPAISAASVHGKTGIAGFEFEK
FT                   ANSDLLEEGLAATKMYEEIKSSPEKVTLLGIGPLTDFALLFKQYPDVVDNIAEVYIMGG
FT                   NIGHGNHSPFAEYNIAGDPEAAQIVFHSGLPVYVAPLEVGDKAHLTKDQMDKIKECGEV
FT                   GNMLYSMFSNIHEPDGDTRIKIYDPTAVGIMLHPEFFTLKPANVEIELAGRYTYGASVM
FT                   DFLSEEHNAQIATDVDTKSFATWFVQSIQAANNGRK"
FT   gene            587343..588071
FT                   /locus_tag="LGAS_0559"
FT                   /note="LactoCOG number LaCOG01560"
FT   CDS_pept        587343..588071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0559"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59956"
FT                   /protein_id="ABJ59956.1"
FT                   /translation="MTDLVYRSVMRDIKQKILNNEYEDMRLPDERSLSDYYHVSRSSMK
FT                   RALGLLAQQGIVFKKRGSGTFINPLYLKNQALFKYEGSNLGITDSFSVPGKKQSIELLD
FT                   YQVIKADEDLRQDLFLKESDFVYQIKRLRLLDDQPFLIETGFIPIKITPELNPDILKGS
FT                   LFNYLEDTQNKTVTRSFLTITVEPSTLEDQSKLMLAPNEPVGVMEGIFFLDDGTPFEVS
FT                   NMRIHYKYMKYNTFVNLSQE"
FT   gene            complement(588136..588462)
FT                   /locus_tag="LGAS_0560"
FT                   /note="LactoCOG number LaCOG03249"
FT   CDS_pept        complement(588136..588462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0560"
FT                   /product="Bacteriocin immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59957"
FT                   /protein_id="ABJ59957.1"
FT                   /translation="MLENTITKQNEVVITLKDLYASFNKVQINAYLPLEKAILKVIAKA
FT                   ENHDDAIAWSNKLVMFLQSQIALKQIPITKEQDALINSLSEQCKNTNLNYVYLAPINDS
FT                   LQFD"
FT   gene            588717..589505
FT                   /locus_tag="LGAS_0561"
FT                   /note="LactoCOG number LaCOG00665"
FT   CDS_pept        588717..589505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0561"
FT                   /product="lactose transport regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59958"
FT                   /protein_id="ABJ59958.1"
FT                   /translation="MRKMQSQIERLDLIRQKLDERKTISTREIMKLCHVSFDTARRDVI
FT                   KLTSTGQAIRIHGGLMKIKQGTVPDYNSRAHVLSPIKNKIAKMTAKYLTANQLIYLNAS
FT                   TTISQLCRYLTGLNATIMTNSIDNAGALMMDNLPNVILLGGYLNKENHYTSSLNSLKEI
FT                   DQYEFDVAVIGTSSVNKKGVFVVNHSDAQIEREVVNRTKTVILLAEEYKFKEDRSSPYK
FT                   VMDCKQADILITDNKLAPQYRKYFKKNIKIREVLAEESKN"
FT   gene            589566..592022
FT                   /locus_tag="LGAS_0562"
FT                   /note="LactoCOG number LaCOG00976"
FT   CDS_pept        589566..592022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0562"
FT                   /product="Phosphoketolase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59959"
FT                   /protein_id="ABJ59959.1"
FT                   /translation="MINTVISNENYFKEILAMVINYDSEEYLKSVDAYWRAANYLSVGQ
FT                   LFLMNNPLLKGELKAKDVKPKPIGHWGTIVPQNFIYAHLNRAIKKYDLNMFYIEGSGHG
FT                   GQVMVSNSYLDGSYTERYPEITQDEKGMAKLFKQFSFPGGVASHAAPETPGSIHEGGEL
FT                   GYSLSHGVGAILDNPDVIAAVEIGDGESETGPLATSWFSSKFINPIKDGAVIPILQING
FT                   FKISNPTIVSRMSDEDLTKYFEGMGWKPYFVSAYKDGEFNGYKDHMEVHHEMAKTMDEV
FT                   VEEIKAIQKHARENNDDSLVKWPMIVFRVPKGWTGPKFDLDGNPIENSFRAHQIPIPVS
FT                   QGDMSHKEMLTDWMESYKPEELFNEDGSPKEIVKENTLSGDQRMAMNPVTNGGINPKVL
FT                   NMPDYRDFAVKFDKPGSVEKQDMAEWAKYLDKMAALNPTNFRGFGPDETKSNRLFQLLD
FT                   NQKRQWMENIHTPNDENLAREGRVIDSQLSEHQDEGWLEGYVLTGRHGFFATYEAFGRV
FT                   VDSMLTQHMKWLRKAKEQTWRHDYPALNLVDTSTVFQQDHNGYTHQDPGMLTHLYEKNR
FT                   PDLIHEYLPADTNSLLAVSDKAFRDRECINVLVTSKQPRPQWFSIEEAKKLVDKGLGYI
FT                   DWASTDKGAKPDVVFASTGTEPTIESLAAIDLLHKKFPDLKIRYINVIDVMKLMSPEKN
FT                   PNAISNEEFDRLFPKGTPVIFAWHGFKPMMESIWFDRGRGKNDVHIHGYEENGDITTPF
FT                   DMRVLNHMDRYDLAKDVVESVSDLSEKNADFIDEMDSLLAKHHQYIRDNGKDMPEVTEW
FT                   QWNGLK"
FT   gene            592188..592844
FT                   /locus_tag="LGAS_0563"
FT                   /note="LactoCOG number LaCOG01538"
FT   CDS_pept        592188..592844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0563"
FT                   /product="p-nitrobenzoate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59960"
FT                   /protein_id="ABJ59960.1"
FT                   /translation="MEFKDVLTREHATRKFTDQRVSEKTVRKVIEEAQRTPSLLNSQPW
FT                   RIYVAEGEVAKTIRKEHEEKTLANEEPHEEFDSLLNVEWDTFPSKNMATMSETLDYFLR
FT                   GEADDFDQAQLKLFNAPVIVFLTIPKQSPAWSIFDLGGFSQTLMLAANNRGLSTMPAHA
FT                   FVKYPEVIRKYLDIPEDETIGIGIGLGYPNKKATINNYKSKRVPLDEILKIKKNL"
FT   gene            592959..593663
FT                   /locus_tag="LGAS_0564"
FT                   /note="LactoCOG number LaCOG03250"
FT   CDS_pept        592959..593663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59961"
FT                   /protein_id="ABJ59961.1"
FT                   /translation="MKMMTLLVSPQQWANWDQWYNYTLPGYILILGTIFLFVGLIPFLC
FT                   VKNKLTAVLFGVTTTVLCLFLGASYFKNKESTEYMKENHYLTAMVRVYDAQIFAKKYYD
FT                   PNEIEAFKYVADIKTPSHLPSIYQKIPVKQEVTYLGKNDYYAFVKLDNTVMKFSLADCK
FT                   KVPGNKAYFTGYHFKMKNKKFLKLGFIDLKHDLRDKVELPANSYNKQVSENIEENYNHP
FT                   GLVANWIPDSEK"
FT   gene            593714..595093
FT                   /locus_tag="LGAS_0565"
FT                   /note="LactoCOG number LaCOG01208"
FT   CDS_pept        593714..595093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0565"
FT                   /product="Hemolysin-like protein with CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59962"
FT                   /protein_id="ABJ59962.1"
FT                   /translation="MSTSTITTNLIVIFITFLIAIFFVVAEFALVQTRSSQLEDMLANG
FT                   QGNPKKLKRALHMVHNLNESLSTTQVGTTLVGVILGWIGQGTIEELLTDVFKMTPWFGA
FT                   KTSGVLGATLGVVLLTYLEVVVTEIVPKNIAIDMPVKCLMAVVTPLTVFHTVVYPFVWL
FT                   LNHSANGLLHLLGMQSADEESEVYSQSEILRLSRNAVTGGSLDKDDLLYMERAFELNDK
FT                   VAKDIMTDRTQLQVLNATDNVKTALKKYIEDGFSRFPVVRDNDKDDIVGYVYAYDIVSQ
FT                   DQESPDVPITRIIRAIITVPESMLIQDILKLMIKKHTPIVLVVDEYGGTSGIVTDKDIY
FT                   EELFGSIKDEIDDVSDEYIVRDDHGDIHVSGKTTLYDFERYFHTKLKSFEDSDIITIGG
FT                   YMMEHYPNLKKGESVDLEGFKFKLVNIEQGFMRWFLVSKIARNTDKKAADSDQNKEEKA
FT                   K"
FT   gene            595192..595761
FT                   /locus_tag="LGAS_0566"
FT                   /note="LactoCOG number LaCOG00014"
FT   CDS_pept        595192..595761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0566"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59963"
FT                   /protein_id="ABJ59963.1"
FT                   /translation="MQNSDNIDNIIDRVLFSQDDIEEICQRLGKQLTEDYAGKFPLVIG
FT                   VLKGAVYFMTDLTRHMNVKMQNDFMDVSSYGDGFESSGKVRLDIDVQADVKDRDVLLVE
FT                   DIVDTGHTLKFMKDLLNKRGAKSVKCCALLNKTERREDNVVVDYYGSKVENAFVVGYGL
FT                   DYLNAYRNLPYVGVLKPEVIQANLNR"
FT   gene            complement(595845..597203)
FT                   /locus_tag="LGAS_0567"
FT                   /note="LactoCOG number LaCOG01693"
FT   CDS_pept        complement(595845..597203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0567"
FT                   /product="serine/threonine exchange transporter, LAT
FT                   family"
FT                   /note="TC 2.A.3.8.12"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59964"
FT                   /protein_id="ABJ59964.1"
FT                   /translation="MISILKVINELKGKHILKRQISFGQALATVVGTVIGGGVFFKIGS
FT                   ISHETGTPSLTLFVWILAGIVSIASGLTVSEIAAALPVTGGSIKYIEYTYGKVWGFLFG
FT                   WAQMLVYFPANIAALSVVFGQQFAVLFGFPTKYATLIALLLALFLMSLNFISTKFSTRM
FT                   QSAMTILKAIPIALIVIFGLFNSTKINVNLLPLSSGHNISFWAGLSGGLLAALFAYDGW
FT                   INVTNLAGEVKEPEKNLSRAIIIGLSAITLIYVLVNYAFLTAIPFKEIIGNQNTAYLAS
FT                   LKLFGSLGGKLITIGILISVYGAINGFMLTGMRIPYTLAKDKMLPFSNKIGRTNINTGV
FT                   PTISALIILTVSLIMIFLGTFDLLTNMLVFVMWTFTTLISIAVVILRYREPKLERPYVV
FT                   PWYPIIPIISIGGGLFIVISTVINEFWLSITGIGLTALGLPVYYYMKKHNHQN"
FT   gene            597269..597985
FT                   /locus_tag="LGAS_0568"
FT                   /note="LactoCOG number LaCOG01725"
FT   CDS_pept        597269..597985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0568"
FT                   /product="Lyzozyme M1 (1,4-beta-N-acetylmuramidase)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59965"
FT                   /protein_id="ABJ59965.1"
FT                   /translation="MIVHRYRHKYTFPSIIILLILAFSGLVWGYFNMRQNTTVPRGSNM
FT                   SVLGIELDQTKDYIDLHKLEKNGISFVYLRSTQGKSYFDDNYLLYRDQLQGTNLNFGTI
FT                   IAYSDETSNQDQYQYFVNKVGTNTGSLPVMIVPATNHLTKSYWKRMGEFAQMINNLGKR
FT                   TMIAGDYRYHNYFPEGTRFLYTGASLKDRRHYAFWCYTQNGRVKNIDNLDRDVTMFAYI
FT                   GTNTQYAQLYSQEKTQ"
FT   gene            597924..599231
FT                   /locus_tag="LGAS_0569"
FT                   /note="LactoCOG number LaCOG01727"
FT   CDS_pept        597924..599231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0569"
FT                   /product="Superfamily II DNA and RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59966"
FT                   /protein_id="ABJ59966.1"
FT                   /translation="MLTLVLIRNMRNYIVKRKHNRGSKMYSKAVSQVLERERKTKPTLI
FT                   QERTYDAIHNGASLVGLAKTGTGKTLAYGLPVMERIDEIGGRGVILEPTTELAIQTRNN
FT                   LLPYAKALGLKTIALVGAGNRKRQLERLKKEKPEIIIATPGRFFDFLSENRIKYQDINA
FT                   LVIDEADDILEFAKLDLLSSLGQNLSSTAQILLFGASESEVTKNAEDLFNHTFLLVDVR
FT                   PEQKSEVKHYFLQVSNEYKMQFLQRLAKLDKFKGILFFDSTETEMRFARIFSHSKTKFA
FT                   VLSNETSKQNREKLLSDFKAGRIKFLFATDLAARGLDLPDVSYVINFEIPSEVNTYLHR
FT                   SGRTGRMNKSGTVVTLGDDHDFRNLKKLLAGTYQIERAYFAGYSLTTEKPKSKKVEAVE
FT                   KKEHKKVEKSKPKHKKKRWRNKKNKGYHPRKSRGEK"
FT   gene            599231..600562
FT                   /locus_tag="LGAS_0570"
FT                   /note="LactoCOG number LaCOG00113"
FT   CDS_pept        599231..600562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0570"
FT                   /product="Cellobiose-specific PTS system IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59967"
FT                   /protein_id="ABJ59967.1"
FT                   /translation="MSSLVKWLETYVLPPASRLAQVRWLVAMRDTFISLLPITMAGSIA
FT                   MLFNSIIRAAKVQMHWDTFYSLMQPVVAIDNIIWEGTFALFAVYFAISWGYHLAKTYEV
FT                   NRFAGSVASLVAFAMSISDSVKLHIDGDVVDIKNAFDIKQFSTMGLFTAIIFGCIGTAL
FT                   FIVFYKARIRLKVDTSMPHAEWVAFSTLIPILLSVFIVGFVNYAFQRLTGTYFGNWLLA
FT                   TIQRPLVNLGQGFGVVLLVTFLVQIFWFFGINGISVLTPVMDSLWLTPENINVTAVRNS
FT                   ERVPYIWVRDSFNVFAWFGGAGGTLVLIIAILMFSKRKDYRTIAKMAVAPGIFNINEPI
FT                   IFGLPVVFNPVYLIPFVVAPLVNVSLAYWATTAGLVNPVQIFVPTVMPPLIGPFLACNY
FT                   DWRAIVLALINMVIALLIWMPFVFAADQITKQDNNQRNFYLPQY"
FT   gene            600613..600685
FT                   /locus_tag="LGAS_t0571"
FT                   /note="tRNA_Arg_CCT"
FT   tRNA            600613..600685
FT                   /locus_tag="LGAS_t0571"
FT                   /product="tRNA-Arg"
FT   gene            complement(600763..601881)
FT                   /locus_tag="LGAS_0572"
FT                   /note="LactoCOG number LaCOG00024"
FT   CDS_pept        complement(600763..601881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0572"
FT                   /product="Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59968"
FT                   /protein_id="ABJ59968.1"
FT                   /translation="MSVYKDNKSKTWYIKRSWYDVNGKRHYITRRGFKNKREAEKKDNK
FT                   LAVQVSDGVNVTENPIFADYYDNWVKTYKGTPNGQSNSVAPNTLTEYILQGKRIRNYFG
FT                   ATKIKSIKRTTYQQFINDFGKDHAKTTMRKLHNIIKACIRSAINDGIITRNFTDDISLA
FT                   YNQDKAYKVTYLQDKDIPRLYKYLYDHRKPQYSSSYMLMLMLLTGLRESEVAGLTWDNI
FT                   NLKSNLITVEKSWVYTQKDYGPTKNGSSQRIVSVPSKMMDCIQELKNNHKTKVFWSKTH
FT                   RCLPGSKGLTECLRTALKNLGISADDFHPHSLRHSQVALLLQADISTYDIAQRLGHATT
FT                   KTTEETYAYEFEKHRELVNKKINDVLSKKIED"
FT   gene            complement(602095..602718)
FT                   /locus_tag="LGAS_0573"
FT                   /note="LactoCOG number LaCOG03096"
FT   CDS_pept        complement(602095..602718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59969"
FT                   /protein_id="ABJ59969.1"
FT                   /translation="MKKKYLVAATGLALLGLSMSACSSNSGSKSDSAKTSQKKKKNETI
FT                   SQNKELREKFDQIKVGELSNHGEGGSTIQDVEKLLGKANTTDTTTVDSYKTKSYIWNKG
FT                   AVTVTVQFEPDKAVTKDITGFKWGKRDEKLDLAAFNSIQDGATYDDIVKKYGEPDSLNE
FT                   SLLLGTKTVTGLWYTGIKGKADGAFASLTFENGALTSKTQTDLK"
FT   gene            complement(602783..603265)
FT                   /locus_tag="LGAS_0574"
FT                   /note="LactoCOG number LaCOG02328"
FT   CDS_pept        complement(602783..603265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59970"
FT                   /protein_id="ABJ59970.1"
FT                   /translation="MMETFTTSNAMYNNDLLIYICNLIEDHHLSYILSRLEDRHFRSRY
FT                   LPKQKTIIINTNWWNPPEIPFMAAHELGHYINGDKGVMYYDHTYKWQEHRAFNRNDDAF
FT                   KEDQADLYGLDLIWNYASSQGYTCEDPGEFMLQFGIPERLKKVVAQKFESNNDLLF"
FT   gene            complement(603240..603587)
FT                   /locus_tag="LGAS_0575"
FT                   /note="LactoCOG number LaCOG00006"
FT   CDS_pept        complement(603240..603587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0575"
FT                   /product="Transcriptional regulator, xre family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59971"
FT                   /protein_id="ABJ59971.1"
FT                   /translation="MKSMIGDRIRELRTSHRLSQTELSKLLHVSQQTITKWENGKAEPS
FT                   SGALAKLAEYFDVSADYLLGSDKTSEPKSVDLEKDPVVLSYGGRPVSEEDMDVIKAILE
FT                   RHKNDGDVHYE"
FT   gene            603732..603956
FT                   /locus_tag="LGAS_0576"
FT                   /note="LactoCOG number LaCOG00006"
FT   CDS_pept        603732..603956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0576"
FT                   /product="Transcriptional regulator, xre family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59972"
FT                   /protein_id="ABJ59972.1"
FT                   /translation="MKRELKSLRVGAGLTQTELAKRLGVTNVTVSRWERGEAIPKPKYI
FT                   KAMAKLFNIKGQDIFLNLITTKAYKVATK"
FT   gene            603989..604324
FT                   /locus_tag="LGAS_0577"
FT   CDS_pept        603989..604324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0577"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59973"
FT                   /protein_id="ABJ59973.1"
FT                   /translation="MPELINKDALIVIFKPIIKALFDKEKEEAEGATINIDEFRKKYCG
FT                   GKGQEWVRLYVFDKFKKEIDFENGGFVVNPHNGKKTIIFRKDAKKWIEENYHRIDWNAS
FT                   IKKDFGR"
FT   gene            604293..604607
FT                   /locus_tag="LGAS_0578"
FT   CDS_pept        604293..604607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59974"
FT                   /protein_id="ABJ59974.1"
FT                   /translation="MQVLRKILGGRKMIKVTTGDVIRQLVSRGVFEWKKDAEYQIGIKD
FT                   EQIVVNKDGSAEIAYLGNTLESVIQLADMFKKVGTKEQQEQINAALTDLVTIGDRWNEA
FT                   "
FT   gene            604725..604871
FT                   /locus_tag="LGAS_0579"
FT                   /note="LactoCOG number LaCOG03251"
FT   CDS_pept        604725..604871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59975"
FT                   /protein_id="ABJ59975.1"
FT                   /translation="MTLEARLISNSNAFFARQDKSPLDVDEYQKQFEIALMQQKKPLPT
FT                   ANQ"
FT   gene            604923..605255
FT                   /locus_tag="LGAS_0580"
FT   CDS_pept        604923..605255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59976"
FT                   /protein_id="ABJ59976.1"
FT                   /translation="MVEIMTPVQAATYREQRLKKEQRNLAKQGISSAMEGKSLVTIGDA
FT                   NQDYLSFKHFVTAQIFRLGIDTYMGLTGWDDKRELIEELASVEDPNDDLWKEDVLDYFD
FT                   GFEGNY"
FT   gene            605255..606115
FT                   /locus_tag="LGAS_0581"
FT                   /note="LactoCOG number LaCOG02329"
FT   CDS_pept        605255..606115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59977"
FT                   /protein_id="ABJ59977.1"
FT                   /translation="MKEISTKLDETSPDYKVKFTPASIEFDDYGKLKEETDEIYKRYNG
FT                   YVVVPENLKGDRAIAADLNKKAKALKAAKSTVRKQALKPLDEFNEQMDALIDEITDVSG
FT                   QIHQGLKDYREQGIKLRHEANIKHIDKMAEKFGLTHEDIAYDAKWDNKSNNWKKIEENI
FT                   NQLLEKAAQERDFKNEKITLITEAAEKEQILPDSYINLIDDLTISEILARIKNDGKRQR
FT                   ELSLKKDEPIKQQVKGNSVIDTTTGEVVGETKVAYLKITGSDEQMKKLVEFIKSQGLKV
FT                   EPIER"
FT   gene            606121..606933
FT                   /locus_tag="LGAS_0582"
FT                   /note="LactoCOG number LaCOG03015"
FT   CDS_pept        606121..606933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59978"
FT                   /protein_id="ABJ59978.1"
FT                   /translation="MEFVGEVKDRASWALHFAQVKANIKQPQRSHKVQVSGKTKTGKPY
FT                   TYEYKYADLADVDKSVMEATKKVVDDKGNVQFTYFFDVNNTDQGVDVQTILVDVSGFYA
FT                   VTNKVWFKNFNVGDAQKTASLISYAKRYSLSAAFGIASEDDDDAQDVKNIEEPKVLSKQ
FT                   ELDNYTVYYNGIKANLAELYQEAVDGIADAQDWIRGSHTPQDAQAIYQLNQSYKRREKD
FT                   KQEALKKAEEEAKKEEKLREAQRSEEKPKQEDVSNLFGTLPADGEYIK"
FT   gene            606943..607866
FT                   /locus_tag="LGAS_0583"
FT                   /note="LactoCOG number LaCOG00704"
FT   CDS_pept        606943..607866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59979"
FT                   /protein_id="ABJ59979.1"
FT                   /translation="MGRRMYSDKIVETDKFLDMPVSSQNLYWHLCMHADDDGFLGNPKT
FT                   IVRSIGAQQDDLKILVEKGYVIVFEDGVIAITDWFVHNYIPKDRYHETVYKEDKKQLEL
FT                   SETKQYRLVTRKPIVQDTKSKQVVDNMDTSCIQDDNKVYTEDKLSKDKLSKDNNIYKLS
FT                   SSENIDTDPEQKSQKIPYEKIIDYLNRKTNSHYRPTSKATRRLIKARYNEGFTDIDFKS
FT                   VIDKKCAEWLQDGNMVQYLRPETLFGTKFEAYLNQPDTGPIPRNNFRNKPVRRATNWDK
FT                   VQQQQSQTTLQMTREERNAIFREYGR"
FT   gene            607872..608177
FT                   /locus_tag="LGAS_0584"
FT                   /note="LactoCOG number LaCOG01493"
FT   CDS_pept        607872..608177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0584"
FT                   /product="Transcriptional regulator, xre family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59980"
FT                   /protein_id="ABJ59980.1"
FT                   /translation="MQNRLKKLRLEKRLTLADIQAKTNIDFRILENFEKGLENGIHNSL
FT                   AIWQKLANFLEVPIEYLMGLNDDSKTLTVNDLNPAKEDAYERITDMLCEDEDDEDE"
FT   gene            608155..608955
FT                   /locus_tag="LGAS_0585"
FT                   /note="LactoCOG number LaCOG00322"
FT   CDS_pept        608155..608955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59981"
FT                   /protein_id="ABJ59981.1"
FT                   /translation="MRTMKMNNELIKVTVKNDQQLVSARDLYKGLGIKRRFSAWWEQNS
FT                   NDFKENSDFQRVLISTPRENRGSIELQDYALTIDMAKQLCLLSRTSKGKEYREYLIEVE
FT                   KKWNNPDMIMQRALTIANNRVKLLETEKRELKETNARQAAKIAKDADDVVFAKAIRYSH
FT                   HAIPVGELAEILTQNGFVIGRNQLFQLLREEKYLSSFNHSWNVPMTQMVKRGLFRITHN
FT                   LTRDGRGYSQTWVTPKGQKYIINKALRGKFDDIYQKVMVSTLNV"
FT   gene            608970..609155
FT                   /locus_tag="LGAS_0586"
FT   CDS_pept        608970..609155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59982"
FT                   /protein_id="ABJ59982.1"
FT                   /translation="MNEIENIKAGLTYLLDINDLKNNVTVTKDGKSHSMNVKDLKEANY
FT                   DVLLQIAELLGMDVNN"
FT   gene            609165..609377
FT                   /locus_tag="LGAS_0587"
FT   CDS_pept        609165..609377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59983"
FT                   /protein_id="ABJ59983.1"
FT                   /translation="MLEENHDLEKIIEDAKQYRWYSVPDMYVVEILDTTGRSAGYAKSI
FT                   FIDKKEAAKVAKKLHGVVRQVSQNE"
FT   gene            609570..609833
FT                   /locus_tag="LGAS_0588"
FT   CDS_pept        609570..609833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59984"
FT                   /protein_id="ABJ59984.1"
FT                   /translation="MEIIDNRTKKEEWRLGDVLVSGSAQLTGLIVKDNNGKYCLIDITP
FT                   DESGNYSTMEGCYYGDSCENLAELYCKMGPNWHKVNAKLVIE"
FT   gene            610012..610383
FT                   /locus_tag="LGAS_0589"
FT   CDS_pept        610012..610383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0589"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59985"
FT                   /protein_id="ABJ59985.1"
FT                   /translation="MREETMKKIKVEKDSVEESYRWAYGWRVVDGKCSPPARNFPLPDF
FT                   VQARIDWLSDEVKRGGLTFQGAFRILLDIDDEKALKEDWELGAASDYMPVSDKYREWLQ
FT                   DPILHDIRQVAVMVGFIYA"
FT   gene            610384..610707
FT                   /locus_tag="LGAS_0590"
FT   CDS_pept        610384..610707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59986"
FT                   /protein_id="ABJ59986.1"
FT                   /translation="MGFCSSILNSASYSNFGSRSDVNMIFKLEEDLPFDIQGNLNEYWL
FT                   NILERNNFKVIEINKKTRELEYRIELMSLDDLRKLQKKIGLNLTISFEDDEGTNEVDGI
FT                   ITI"
FT   gene            610720..611181
FT                   /locus_tag="LGAS_0591"
FT                   /note="LactoCOG number LaCOG01643"
FT   CDS_pept        610720..611181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0591"
FT                   /product="Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59987"
FT                   /protein_id="ABJ59987.1"
FT                   /translation="MRVNFTIEGPPIGKARPRVTRTVTYTPAKTARYEDLVRYTAINSF
FT                   KGIFDKDEPLDVKIMAYFEVPKSLSKKRKALCLANQELPTKKPDADNVGKIIMDGMNPK
FT                   MRRDKRLHKMVEVMRGVYHDDKQVTTLLVKKRYAERARVDVRIKRDMGD"
FT   gene            611182..611403
FT                   /locus_tag="LGAS_0592"
FT   CDS_pept        611182..611403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59988"
FT                   /protein_id="ABJ59988.1"
FT                   /translation="MQKIDLSLVSKFVDASIANDKRLALKLAKKIAEQHNCSLSFELDT
FT                   LDWSANWLKSDERVTTQSMVRELRKYEA"
FT   gene            611437..611604
FT                   /locus_tag="LGAS_0593"
FT   CDS_pept        611437..611604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59989"
FT                   /protein_id="ABJ59989.1"
FT                   /translation="MLRCCRICGVLSMSNNLKYQKGKWYHVQEDGSLKPVDYDKEVEEY
FT                   YKKWRDNYGN"
FT   gene            611594..611884
FT                   /locus_tag="LGAS_0594"
FT   CDS_pept        611594..611884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59990"
FT                   /protein_id="ABJ59990.1"
FT                   /translation="MAIELKIGARGTREDFEDTYTRSFLEDNGLFKFDPRKFTVNCVWG
FT                   VHTKYGYMCSFSYDDILTYMGDGVWDLRVAEETKITDEELKRALSEPDKEF"
FT   gene            611887..612105
FT                   /locus_tag="LGAS_0595"
FT   CDS_pept        611887..612105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59991"
FT                   /protein_id="ABJ59991.1"
FT                   /translation="MQLYGHEVNPYTYKDFKTEQLKNFRSMLKSNIKNFENIIEPTIEE
FT                   MIDEDKAEELLPLIEHEIKVRSNDGRN"
FT   gene            612089..612259
FT                   /locus_tag="LGAS_0596"
FT   CDS_pept        612089..612259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59992"
FT                   /protein_id="ABJ59992.1"
FT                   /translation="MMDETRNDLEVGNETAVMMYLNILKYAKHHCPEDEDPYEITDRIF
FT                   TDMFAANKASN"
FT   gene            612289..612819
FT                   /locus_tag="LGAS_0597"
FT                   /note="LactoCOG number LaCOG03252"
FT   CDS_pept        612289..612819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0597"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59993"
FT                   /protein_id="ABJ59993.1"
FT                   /translation="MYQIDLGLQPNLRATAKRVDKFLTINFQSYLNLAGLHRNQLTSPQ
FT                   LSFAPGSTNKNGVEKNFIDEAQDDIDIADPARKVCAAIYRTMDNCTDTSLKPYRRILIG
FT                   TYIDQLRIVDVAATVNLSTRSIDTKKINAQCEFADRWLYWKKYFGVNDLPDLRVFSQKV
FT                   KTVWPDKIKIRKN"
FT   gene            613549..613621
FT                   /locus_tag="LGAS_t0598"
FT                   /note="tRNA_Gln_TTG"
FT   tRNA            613549..613621
FT                   /locus_tag="LGAS_t0598"
FT                   /product="tRNA-Gln"
FT   gene            613677..613961
FT                   /locus_tag="LGAS_0599"
FT                   /note="LactoCOG number LaCOG00053"
FT   CDS_pept        613677..613961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0599"
FT                   /product="ParB-like nuclease domain"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59994"
FT                   /protein_id="ABJ59994.1"
FT                   /translation="MKVETVSINKIKPYENNPRNNDDAVDAVANSIKEFGWQQPIVVDN
FT                   GGVIIAGHTRYKAAKKLGYKEVPIVVADSFDYWQRFNNCEPIVDLHKYK"
FT   gene            614213..614294
FT                   /pseudo
FT                   /locus_tag="LGAS_t0600"
FT                   /note="tRNA_Other"
FT   tRNA            614213..614294
FT                   /pseudo
FT                   /locus_tag="LGAS_t0600"
FT                   /product="tRNA-OTHER"
FT   gene            614402..615019
FT                   /locus_tag="LGAS_0601"
FT   CDS_pept        614402..615019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59995"
FT                   /protein_id="ABJ59995.1"
FT                   /translation="MNVFTNNIIDGYIRWNKNNMISKNFTCGYCGAYVSSDKGMPLVDQ
FT                   GRVNPTESIGVYICTNCYMPTFIYDDIQVPGNRYGVAVSGVPKDVNDVYEEARSCYGAN
FT                   AFTGVVLLCRKLLMHVAVDLGAKDNLKFVEYVNYLNENHFVSVKSHDWVDQIRKYGNEA
FT                   THEIQVNTKEDAQKIIKFCEMILKMNYEYPSEINDSNDGKNN"
FT   gene            615202..615858
FT                   /locus_tag="LGAS_0602"
FT                   /note="LactoCOG number LaCOG03253"
FT   CDS_pept        615202..615858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59996"
FT                   /protein_id="ABJ59996.1"
FT                   /translation="MTALNAEISPNSIILSMDTLASRKNNNGKTIPSYFTQKFEYYPFT
FT                   QSILCGTGDFSIIRLAFDRSRSILSKEVKTFSLIIRDVLKNNIEKVNTDTTIYIFGFDE
FT                   DMNTHAYALRSTNKFGIQEIASYSNPNWILKPQCEEAIDYLLNSDSNNKIHIFKELMKI
FT                   EKNIDDKKTKERVGIGGQNILINLVAKDGEILSSINIIDEFEDYDKQYKFCLENL"
FT   gene            615919..616440
FT                   /locus_tag="LGAS_0603"
FT                   /note="LactoCOG number LaCOG00019"
FT   CDS_pept        615919..616440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0603"
FT                   /product="Phage terminase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59997"
FT                   /protein_id="ABJ59997.1"
FT                   /translation="MERKLTTKQKIFCDEYIKSGNAKEAAIKAGYSPKTAKSIGQENLT
FT                   KPDLKAYIDAKMAEIESHKIADAKEVLEFYTKVLRDEVVEEVPMSTADDVVVIKKKPSF
FT                   KDKITASKEIMKRYPLVDPIEKQKLQKLIADTRISEAKATVAERLGNESDDKLDELMDK
FT                   LIKASEKSQE"
FT   gene            616529..617260
FT                   /locus_tag="LGAS_0604"
FT   CDS_pept        616529..617260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0604"
FT                   /product="Homing nuclease of HNH family with NUMOD4 and
FT                   IENR domains"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59998"
FT                   /protein_id="ABJ59998.1"
FT                   /translation="MNNNIEIWKDVQGYEGLYQVSNLGRVKSLYKNTKILMPRLNNRGY
FT                   QYVMFFKDKKYKHFLVHRLVAQAFIPNPNKLPQVNHIDENKENNCISNLEWCTNIYNNL
FT                   YRGKVKRAGIKNGICVAQYNLKGKLVKVWNSAHEASKEGYNASHIRECCLGQAQTHNNY
FT                   MWRSVSNNHVIKKIEPYQKTSFTNRSDLSENIGQYDIDGNLIKVWPSIREASRKGFDRS
FT                   SISYHIKNKKPYKGYIWNLMK"
FT   gene            617242..618486
FT                   /locus_tag="LGAS_0605"
FT                   /note="LactoCOG number LaCOG01645"
FT   CDS_pept        617242..618486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0605"
FT                   /product="Phage terminase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ59999"
FT                   /protein_id="ABJ59999.1"
FT                   /translation="MEFNEIIMSLNDLFTKKQQKVLQSYLNDDWKYLFLIGAVRSGKTY
FT                   ISNWMFLLELKRVAKLAKTNNVKRPIYILAGYSSNSINTNIIASIENEFGINIPVDRHG
FT                   HYHLFDVEIVPAYTGSIRGIGSIRGATAYGALIDEGTLADQGVFQEIINRCSIEGARIV
FT                   VTSNPDAPTNFIKTEYIDNHDPKARIKVFNFTIFDNTFLSKDYVDALVAATPSGMYTDR
FT                   TIYGKWVSAEGQIFSDFNIETMTITTDQLPEMVKYYASIDWGFGKGHKGVIQLFGDDEN
FT                   GTSYLIKEWAHEHRFIDYWIDVAKEIKQKYGNIVFWADSARVDYVNQMQANGINCINAN
FT                   KNVLSGLEFVDSYFKQGKLIINKDEADNLLNTIFNYVWDDKKEAPLKEDDDSEDCLRYG
FT                   IYSEHYEGGGFVPWN"
FT   gene            618477..619889
FT                   /locus_tag="LGAS_0606"
FT                   /note="LactoCOG number LaCOG01647"
FT   CDS_pept        618477..619889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0606"
FT                   /product="Phage portal protein, SPP1 Gp6-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60000"
FT                   /protein_id="ABJ60000.1"
FT                   /translation="MELDALKKLIQNTSTSRNDLINNYKQAVNYYENKTDITTRNNGKA
FT                   KLNKEGKKDPLRSADNRIPSNFYQLLVDQEAGYVASVFPDIDVGKDADNKKIIDVLGDD
FT                   RALTLNGLLVDSSNAGRAWLHYWIDEDNNFRYGIIQPDQITPIYATTLDNKLLGILRSY
FT                   KQLDPDSGKYFTVHEYWTDKEAQFFRTSATDSTVIEPYNIITSYDLSAGYETGQSNTLK
FT                   HNFGRVPFIEFPKNKYRLPELNKYKGLIDAYDDIYNGFINDLDDVQTVILVLTNYGGAS
FT                   LEQFMNDLREYKSIKINNAGNGDKSGVDKLQIDIPVEARDDALKITRDNIFLFGQGIDP
FT                   ANFESSNASGVAIKMLYSHLELKAAKTQTYFEHAINELVRAIMRYLNFSDADKRHISQH
FT                   WTRTKVEDSLTKAQIVSTVANYSSKEAVAKANPIVDDWQQELKDLAKDREENDPYSKQA
FT                   DELNGKGVDDEE"
FT   gene            619879..621411
FT                   /locus_tag="LGAS_0607"
FT                   /note="LactoCOG number LaCOG02094"
FT   CDS_pept        619879..621411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0607"
FT                   /product="Phage Mu protein F like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60001"
FT                   /protein_id="ABJ60001.1"
FT                   /translation="MKSSDYWRQRAIAEKKKQLEASADYEAAMQVRLRRLEHEFEKEAL
FT                   VYLQRYANENNVGLKQAASVLGSINTTKWSMTLEEFERKAKAGGYDKELNAEYYKSRIY
FT                   RLQQLHDQMVEFSKKYGMAEQLKMQKGLAKQYQNSYYLHAYDKYRATGQLDIKLNHFNE
FT                   QQLENIVYSPWKGSDFSKRIWKEYTEILPDELTDTMLRATLFGYSPSKVVSMMRDRFKK
FT                   VSDRDLHRLVTTEMGHAAEEATAQFYKDSDIEQYQYLATLESHTCDQCTHLDERIFNVK
FT                   DKKEGINYPLIHPYCRCTTVPYDKDLPDVETRWSRDPKTGKGRYVYRNALDYSEWKKLS
FT                   NVKILNLSLPTPKLTWDEEAAIHKYNSFESYGLNADLRAGNTLSPAEEKLKHDLDTALD
FT                   KIPYYSEDEPLSRSLYFESRDDIMVDYVNKALTQGYIQEPSYTSSSAGMVYNPEDDLRV
FT                   VILKSHSGHDIRKFNDVEGEVLFKRNTRFDVLRLNIIDGKPYIEVVEHEEND"
FT   gene            621380..621592
FT                   /locus_tag="LGAS_0608"
FT   CDS_pept        621380..621592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60002"
FT                   /protein_id="ABJ60002.1"
FT                   /translation="MRWLNMKKMTKYNLSNEEFLNYIKSIPKSQFNNKSHIEYFKKVYE
FT                   AKKKSGSDYSKEEKYLKENGVKLDD"
FT   gene            621710..622270
FT                   /locus_tag="LGAS_0609"
FT   CDS_pept        621710..622270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0609"
FT                   /product="Phage minor structural protein GP20"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60003"
FT                   /protein_id="ABJ60003.1"
FT                   /translation="MKRKQLEELGLQEEQIKKIMDLNGEDIQNAKDKASASNAEILEEN
FT                   KALKSQMSERDKDLKKLRAQVKDNEDLTKQFNDLKSKYDKDTADLTQKLATNRLNSAID
FT                   QSLSKANVRNNKAIRGLLNMDEIKLDDDGNLTGLDDQIKSLQKSDGYLFDEGSKQDYQP
FT                   NNGKPANADPVQAMVDIFKGEHK"
FT   gene            622270..623352
FT                   /locus_tag="LGAS_0610"
FT                   /note="LactoCOG number LaCOG03254"
FT   CDS_pept        622270..623352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0610"
FT                   /product="Major capsid protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60004"
FT                   /protein_id="ABJ60004.1"
FT                   /translation="MAINYADKYQKAVIDGFYPDVLYSSALWQSPSNNTINFLDAKHIK
FT                   VPRLSILSGRQDRERRTITQPAANYSLDYDVYELTNERYWSTLVDPSDIDESNQLLSIA
FT                   NITRQYNLDSKMPEKDREMFSKLFSQRQAVNTSEGLDQNAGIHSESLDAKNVLKAYDQM
FT                   MRNFDRARIPAQGRILYVDTGTYYMLKDAEAINRTIIVSDAQNINRSVRSLDEVTIVPV
FT                   PEDLFQTKFDFTNGSKTVDDAKQIKMMLIFNGVQISPEKYDFVGLDAPAAANSGNWLYY
FT                   EQSYDDVLLLKPKFKGIEFFVAEKDADGDSNPAGRKKTTEEDAKPNENNTVDEIKAYLD
FT                   KNHIDYTGKTKKDELLTLVK"
FT   gene            623361..623750
FT                   /locus_tag="LGAS_0611"
FT   CDS_pept        623361..623750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60005"
FT                   /protein_id="ABJ60005.1"
FT                   /translation="MDKYPRFEEVKKHLADFLPNTDNAPNYDSVLEFTLEKVISDVSIY
FT                   TNIPILELPEELEPTILGLAVQTIDTHQWLVPKDQQVGNVQSLSEGDTSVSFRSPSDIY
FT                   SALQATNTITDNYVMLLNNFRRLAQ"
FT   gene            623747..624109
FT                   /locus_tag="LGAS_0612"
FT   CDS_pept        623747..624109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0612"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60006"
FT                   /protein_id="ABJ60006.1"
FT                   /translation="MSYFNGLKNALPKLWNDRVKIVGTLPTKHGYITNNEDVTIVEDEP
FT                   AKVVLKGQSASEQSFFGTDEYDAKLIIRNGIKIPAGADIYVTDVNGQVTKYKRASKGYS
FT                   GYFSHQEVAMVRSEKA"
FT   gene            624106..624540
FT                   /locus_tag="LGAS_0613"
FT   CDS_pept        624106..624540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0613"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60007"
FT                   /protein_id="ABJ60007.1"
FT                   /translation="MSLGHVDDAQFQQFASRVRQKIDSGYVKQELGKSSRRIGTQSLRI
FT                   LETNTPVKQGNLRRSWTAEGPTYGCGGWTIKLINNAEYASYVESGHRQTPGRYVPLLKK
FT                   RLVRDWVPGQFYMKKSIPQIQRQLPQLVTEGLWGLKDLFE"
FT   gene            624537..624944
FT                   /locus_tag="LGAS_0614"
FT   CDS_pept        624537..624944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60008"
FT                   /protein_id="ABJ60008.1"
FT                   /translation="MTIVERIAKRISEIFPDVTIYSEKQKSGFQVPSFYISKIMTVTKS
FT                   RFFDIQDRSLSYSITYFANPDRPNADMEEVEQKLLNNFTRLDDYATVRNREATINQDDE
FT                   TLVMSFDLRLEMYPVQDGGKLERIEFNGGIQ"
FT   gene            624919..625146
FT                   /locus_tag="LGAS_0615"
FT   CDS_pept        624919..625146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60009"
FT                   /protein_id="ABJ60009.1"
FT                   /translation="MSLMEESNKTETETPMGEIKAPIQVEDVKFTKQALISSPKFSVIE
FT                   RDILKLALDDDKEYTIAEVKKAIDKFKEGF"
FT   gene            625146..626501
FT                   /locus_tag="LGAS_0616"
FT   CDS_pept        625146..626501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0616"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60010"
FT                   /protein_id="ABJ60010.1"
FT                   /translation="MAGGTWKAQDKRRPGAYINVVGNGQREAASSLGRVLLIRDKGLGW
FT                   GKNGVIEVEANSDFTKKLGTTLDDPSLTALKETLKGASKVLVLNPNEGTAATLTKEGLP
FT                   WTVTANYPGEKGNQITVSVEVSPADQNAATVSTIFGTKLVDEQSIKFNELDKFKGNDYI
FT                   TAKVVEEGSSKPVAFTNVSGALTGGTTTESNKVESLLNDALENEEYAVVTTAGFEPSSN
FT                   MNKLVVEAVKRLRENEGRKVRGVIPTDADTTYNYEGISTVVNGYTLSDGTNVDVKDATG
FT                   YFAGISASADVATSLTYFEVEDAVSAYPKLDNEKTIKALDAGQIVFTTRPGQRVVIEQD
FT                   INSLHKFTAEKPQSFSKNRVMRTLDEIATDTENTFERTYLGKAGNNAAGRDLFKADRIA
FT                   YLMGLQNRNIIQSFKNTDVTIEAGNDTDSIVVNLAVTPVDAMEKLYMTMVVR"
FT   gene            626513..626983
FT                   /locus_tag="LGAS_0617"
FT   CDS_pept        626513..626983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0617"
FT                   /product="Sheath tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60011"
FT                   /protein_id="ABJ60011.1"
FT                   /translation="MAAIDEFLNGRDTISTKDATLSIKINGNIIKMIECDKFTAKLEKN
FT                   KEDVQTLGSHWKRKKTTSVEGTGTLGGYLVNSNWIKYGIPYTQDGGDLYFDATLTIHDP
FT                   TSRAGKQVVQLTDVNLDDIPIADFEADDGVMEWESDFTFEGVNLVQAFNGIN"
FT   gene            626995..627414
FT                   /locus_tag="LGAS_0618"
FT   CDS_pept        626995..627414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0618"
FT                   /product="Core tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60012"
FT                   /protein_id="ABJ60012.1"
FT                   /translation="MAESVEDFLFENVGSPVEEKEVKLERFKSPFKIKSLTADEVSHIR
FT                   KQATKRVLNRKTHRYEQETDENQFQGLVVAEAVVSPNLNNEKLQTSWGCIAKPEEVLKK
FT                   MLKVGEYTELSQAIMDLSGLNDDDSSEDLVEEAKN"
FT   gene            627651..631061
FT                   /locus_tag="LGAS_0619"
FT                   /note="LactoCOG number LaCOG02100"
FT   CDS_pept        627651..631061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0619"
FT                   /product="Minor tail protein gp26-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60013"
FT                   /protein_id="ABJ60013.1"
FT                   /translation="MSTISTTVKINDAFSNPLDRLSSGLQKAQSGMSKLKEAISGGSSG
FT                   GSMFKSMVGGTVVGGAINKGMELASTGIRSMYGELDEASKAWQTFDGNMHQLGKSPAEI
FT                   ATAKKSMQQFAQQTIYGASDMASTYSQLAAVGTKNVDQLVRGFGGLAAASSNPQQAMKT
FT                   LSEQATQMAAKPMVQWQDFKLMLEQTPAGISAVAKTMGVSTQQLIKNVQDGKVKTEDFL
FT                   NAIAKTGTNANFTKMATQFKTVGQAIDGLKETMANKLQGAFDRVGKVGIKFVSDLTDQL
FT                   SNVNFDGFVDGLFKAVADMEPIFDDLKTGFDDFKKGFADSGAFNSLKDTFDSITDSVGK
FT                   LVNTMDQTNGGDSLFKQLGKLAGGALGGAAKSISGIAEALGELDPGTLQMLAQAFIILK
FT                   GGLKGLVFEAVIWGLKELNKLDPGTINNIAQALTALAIAFTMLKAMGKIAGYMKEVSKF
FT                   FKGFKNAKKIKAPEIDSPKMTKPGKILSNAGAYMKLGAAFALVGAGALALGAGFKLLAD
FT                   AATQISSAGGGAIATFFGMIAAIAALVVLVRFLGPDLIGGAVGFAIFAAALLLIGAAVL
FT                   VASAGIALLATQLPTISEYGTSAAVGLLALAGAIAVFGLAAIVGAVGVLLLGVALAVLA
FT                   VGLVAAGVGALIFAVGLALVGITALIAAVGVLLLGVAIALVAVMVIIAAVGMLLLGVTL
FT                   VLVAAMGIVAAVGLLLMGVALMLIVVSAMVAAVGLILLSVALLLIGPMSLIAAVGLLLL
FT                   GVALTLVMAMGLVAAVGILLLGVGLVLVAAMAMVAAVGLMMMSVALMMIMVTAMVSAVG
FT                   LMLLAVALMMVGPMAMIAAVGLMLLAAAAIMLGAGLMVVAAAAMAVAAALVAVGASVMV
FT                   MASLFVAAGSMMVSAITSAMSGVVSAVRSGISSAVNAARSFGSALVSVGRQLIQGLVNG
FT                   IKSMIGAAVSAVQGVASKVVSAAKSVLHIGSPSRLFRQYGRWVDQGLIIGLNRDAGAAA
FT                   DASASMAQGVVDAASGMSPTLDPIGLSGINPGDLLAAGFDRALDAISNVAGAITGLDGS
FT                   RANIGIFGQGAVSSAVGSDTVTSGSIAPNSVLTNNNSSSQTDNSTQVQIDKGAIVINAS
FT                   GNPDADVDKILDKIDQKIIDRRNKALGGG"
FT   gene            631054..631743
FT                   /locus_tag="LGAS_0620"
FT   CDS_pept        631054..631743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0620"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60014"
FT                   /protein_id="ABJ60014.1"
FT                   /translation="MVNMPVNGFGVYITDYSTNRTVELPVNPSELTLKYETDDKSETIV
FT                   NLGEINRVGNMKLVSLTIDSVFPKKHSSWISSDKLLKPDEYINWLKNIQANKHHVQLVV
FT                   SSTQISVTMTISSFEYGFKSGFADEYAYTLGLKQYREVKYHKVNVPAPPKPKPRPAPPK
FT                   KLGIGSIVIVNGRLRLDSYGSAPGVYENNVRRRITYLAPGHPFPIHVALVNGGPRGWVR
FT                   QSEVRLA"
FT   gene            631740..632786
FT                   /locus_tag="LGAS_0621"
FT   CDS_pept        631740..632786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0621"
FT                   /product="Phage late control gene D protein GPD"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60015"
FT                   /protein_id="ABJ60015.1"
FT                   /translation="MITKLQILKHDNGGARIGVEIKDMVKNLKWVTDLNYSAGELTFDI
FT                   VNGKDPIIPAMGAIVDFAWDNKDIFWGFVFSAECTSDTTVSVKAYDFERYLKSEGSVVF
FT                   QSGTLGDRYSNVCRRFGVPFHIKEQPTYRVPAEVCDGKTGFDMIKSAIDKTYSATGEMY
FT                   CIVANHMYIELRRAPIPTRTLLVIDTQNTMSDYTYSESIDNAANVVQVVQKNTDNSQTK
FT                   TATATSETGDDPATTSFTIASARGNTIRTWGQIVKVVNAKNKANWAQMVQQANDELKKR
FT                   NVSERKLTLDCMGDTSLIAGAGANVKIKDFGKTWTNCPILKATHNFGTDYTCSLEMKVG
FT                   TKWQENSL"
FT   gene            632765..633127
FT                   /locus_tag="LGAS_0622"
FT   CDS_pept        632765..633127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0622"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60016"
FT                   /protein_id="ABJ60016.1"
FT                   /translation="MAGEQLIKMLTERGGSDSEYSDVIYGRVISISPLKVQISNSMIID
FT                   DNFIVLGKHIGSFSMSGSLTTTEEKKGKDGEKPKTEKTTKPATFTFDNSLKVGDRVTMI
FT                   RADGGQQFYLFEREGG"
FT   gene            633108..633500
FT                   /locus_tag="LGAS_0623"
FT   CDS_pept        633108..633500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0623"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60017"
FT                   /protein_id="ABJ60017.1"
FT                   /translation="MRERVVNLDNEENQNPTLTFQIANGRIRNKFDGLGAMVQAVDKIL
FT                   KTERFVFPIYTDQYGNDLNDLLGKDLGYSKVEAERMVKEALLADERVIKVDITSINETS
FT                   PNTLTLTGECQTSYGNIPIESEVSIK"
FT   gene            633497..634648
FT                   /locus_tag="LGAS_0624"
FT   CDS_pept        633497..634648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0624"
FT                   /product="Phage Mu gp47 related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60018"
FT                   /protein_id="ABJ60018.1"
FT                   /translation="MSPNELITEFQNKDYDYFLRKMLDAVPDNIDKREGSIIYDALAPA
FT                   ALVMGQQSLDMANVIKETYIKTASGEFLDYRAIEHGTSRYPATQTEAKAKVLNDKKEPL
FT                   DNVQIGDKFASIGDSPIFYAVTKVNDDLTVELTAEVKGSSANSYIGQILPVTPNDLLSW
FT                   AEITEITAPARDVESDDHLRARLLSSQSWIAYGGNVADYLDMTSKIDEVGAAQIYPTWN
FT                   GGGTVKVVILNNDLMPASASLVQKVKNILDPEDKQAEGYGLAPIDHAVTVTAPEELIVN
FT                   VDISVKLDDTKVTRYVKDSITKAVEGYFQSLRKDWADINQKLGRGYEETIYRSKILSQV
FT                   MLTEGVVNAKLPSLNGRDADIDLVFNNSKSQLPVVGTVTINEQ"
FT   gene            634638..635198
FT                   /locus_tag="LGAS_0625"
FT   CDS_pept        634638..635198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0625"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60019"
FT                   /protein_id="ABJ60019.1"
FT                   /translation="MSNKYELLNYMPDYYEGVYEMKELLKSESVTLKDLESSHLRTLLN
FT                   EFVSTADAKGISLFESQLGIVPDENDTLEMRRNKVLMYVLPPRPITIRFFRDMLNNVNL
FT                   PVKIDVNYGARAVVVTAKSAEMTSNQINYLKYLLNVYLPANLLYQVKILLNAAKVFDDL
FT                   NLGIGNVVKAASMAKASPNQVFN"
FT   gene            635211..637379
FT                   /locus_tag="LGAS_0626"
FT                   /note="LactoCOG number LaCOG03255"
FT   CDS_pept        635211..637379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60020"
FT                   /protein_id="ABJ60020.1"
FT                   /translation="MSEYNKTIITNEGIDLARRANKGTATFSLTRGVSSTDNLSEKTVE
FT                   ELQNLTQLPSIQQSVKLSDVGDTSDNSDTVLGVRMTFDNQNLKTGYNVHTVGIYAKEPD
FT                   KNEILYGIATAKTPEYIPDFSEQTLFKFDFLMYLVIGRTDKVTVEVSPDDVYRKKEVYS
FT                   KSEVDTAVAKLDKKNAEIVKSLSDYKLENSTYHTNFEKSVTDRLGTKADKTTVEQQLGT
FT                   KADKSNTYTKDEVNSKVAPKADKGYVDSELNKKADKATTYTKTEVDNKIAGQVKSVNGH
FT                   TANASGAVTLPTLTANVLTGYDVKNKAATFDNNAHFDANGLFSRWTVDQGVIGQLADAI
FT                   NAKLPIEAGDPNGDLLDYAGNKIVYWNGNGDGVKNLPPMNNKKWFFAVKLFYLGWGSVT
FT                   VVDQDGSYWLNTKNDDIWTGWRSVITNEHLKKLKFVKQSLDQNGNIFQDTKFVTQEADG
FT                   TYKINIFDSDWTANKVSWLLNNTKSYSIQNNTDLNNVKNTGFYNAAGPSGLKNSPVSAW
FT                   FSMSVNANQWNGQQTLYDTNSGQLYVRTWNSTRFTDWQRIANAGDLTNQSITSITDYDV
FT                   ASEGWHNTQVGKFDPSGHFANLLVDAGALKPIAEAINNLNTNLTTMRTELMNLKKRTDY
FT                   NTPQGEFNNTTVNLNNLRSTGMYRLSNCHVQSGPYPTDNAHWVYVKVTVFDANTVYQTL
FT                   YEGDNMYGRKSSSPTNWDQWHQYLNKTV"
FT   gene            637419..637928
FT                   /locus_tag="LGAS_0627"
FT   CDS_pept        637419..637928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0627"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60021"
FT                   /protein_id="ABJ60021.1"
FT                   /translation="MEAENFLDLLKQVVADGKISFYYFSDPTSPITALHHLEIPYPGEL
FT                   SPVDLPYRWHAEKPSEDLIDAVWDDDSHSWIENSDKSQPALIAKLQASNAAMQKKMENY
FT                   EAAKIKDAQNNDKIVQALSGVQKGQAQTTAVLAQLVPMVQQLSKSVNTPDKPNAADETK
FT                   KKEGAE"
FT   gene            637928..638122
FT                   /locus_tag="LGAS_0628"
FT   CDS_pept        637928..638122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60022"
FT                   /protein_id="ABJ60022.1"
FT                   /translation="MFDFDFSSIYSNLESLCKSSLDNGYFTDNTIAGFVQQGTFDADGY
FT                   KRITGDDYVAGDQNTVANG"
FT   gene            638139..638498
FT                   /locus_tag="LGAS_0629"
FT                   /note="LactoCOG number LaCOG03256"
FT   CDS_pept        638139..638498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60023"
FT                   /protein_id="ABJ60023.1"
FT                   /translation="MILGSLLTAFGIVLLVNDSFFYWPPEWQWLFNNDLVDAFAIIVGI
FT                   GLIAFVFAGGRSQLANAVLLACSAFFLMMLTVLQLGHVLVMHDYSRLLSIIALIGWLLV
FT                   IQYLAVFSKTVRRRK"
FT   gene            638509..638787
FT                   /locus_tag="LGAS_0630"
FT                   /note="LactoCOG number LaCOG03257"
FT   CDS_pept        638509..638787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60024"
FT                   /protein_id="ABJ60024.1"
FT                   /translation="MQDWANLIREIALLFSGFVAGLTAWNALRKTSHEVSKDDKEELRA
FT                   DRDLYRNRWLESEKAFDEIDAENDKLRKKVKRLENKIDDFKENEDRK"
FT   gene            638784..639215
FT                   /locus_tag="LGAS_0631"
FT                   /note="LactoCOG number LaCOG03258"
FT   CDS_pept        638784..639215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60025"
FT                   /protein_id="ABJ60025.1"
FT                   /translation="MSFEQIGDMLVVAVSVVIAIIFYVYSKNKIAIDKKAMQGDALAKA
FT                   EKMIANSANAIVYQTEKEGGSGKDKLLAAFNYLIAILDLAHLPHPSTAYIKGEIEKSVT
FT                   TMKQTKNFVDSMQTLTKEDDAAKQLKSKTIVGELKEVKK"
FT   gene            639225..640157
FT                   /locus_tag="LGAS_0632"
FT                   /note="LactoCOG number LaCOG01653"
FT   CDS_pept        639225..640157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0632"
FT                   /product="Lyzozyme M1 (1,4-beta-N-acetylmuramidase)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60026"
FT                   /protein_id="ABJ60026.1"
FT                   /translation="MVEVAKRSYGVDVSSHNNGNYSGSKFAVVKVSEGLDYRNPKAQSQ
FT                   VSTARANSMLPMAYHYARFSGNSNVAIQEGNYAVTSAKAVGLEAGTYLACDYEQGSGNE
FT                   TRGDRETNTTAILSFLDTIVGAGYKPLLYSGAYLMRDKINTSRILAKYPNCLWVAAYPS
FT                   GNGTAVSEPNFGYFPSMNGVAIWQFTDNWRGLNVDGNISLIDLKNDSKPVAQPSVAQSA
FT                   SEKTWTDVQGMTWHEEHGTFITGGAINLRWGANTQSTLITTLPAGSEVKYNAWARDSAG
FT                   RVWLQQPRENGKNGYLVGRVGSEPWGTFK"
FT   gene            640240..640371
FT                   /locus_tag="LGAS_0633"
FT   CDS_pept        640240..640371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60027"
FT                   /protein_id="ABJ60027.1"
FT                   /translation="MFSCYNFTYNMLYLTCNKLGILKFNELKKHYLIATKGNAFFIA"
FT   gene            complement(640849..641967)
FT                   /locus_tag="LGAS_0634"
FT                   /note="LactoCOG number LaCOG00024"
FT   CDS_pept        complement(640849..641967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0634"
FT                   /product="Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60028"
FT                   /protein_id="ABJ60028.1"
FT                   /translation="MSVYKDNKSKTWYIKRSWYDVNGKRHYITRRGFKNKREAEKKDNK
FT                   LAVQVSDGVNVTENPIFADYYDNWVKTYKGTPNGQSNSVAPNTLTEYILQGKRIRNYFG
FT                   ATKIKSIKRTTYQQFINDFGKDHAKTTMRKLHNIIKACIRSAINDGIITRNFTDDISLA
FT                   YNQDKAYKVTYLQDKDIPRLYKYLYDHRKPQYSSSYMLMLMLLTGLRESEVAGLTWDNI
FT                   NLKSNLITVEKSWVYTQKDYGPTKNGSSQRIVSVPSKMMDCIQELKNNHKTKVFWSKTH
FT                   RCLPGSKGLTECLRTALKNLGISADDFHPHSLRHSQVALLLQADISTYDIAQRLGHATT
FT                   KTTEETYAYEFEKHRELVNKKINDVLSKKIED"
FT   gene            complement(642181..642804)
FT                   /locus_tag="LGAS_0635"
FT                   /note="LactoCOG number LaCOG03096"
FT   CDS_pept        complement(642181..642804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60029"
FT                   /protein_id="ABJ60029.1"
FT                   /translation="MKKKYLVAATGLALLGLSMSACSSNSGSKSDSAKTSQKKKKNETI
FT                   SQNKELREKFDQIKVGELSNHGEGGSTIQDVEKLLGKANTTDTTTVDSYKTKSYIWNKG
FT                   AVTVTVQFEPDKAVTKDITGFKWGKRDEKLDLAAFNSIQDGATYDDIVKKYGEPDSLNE
FT                   SLLLGTKTVTGLWYTGIKGKADGAFASLTFENGALTSKTQTDLK"
FT   gene            complement(642869..643351)
FT                   /locus_tag="LGAS_0636"
FT                   /note="LactoCOG number LaCOG02328"
FT   CDS_pept        complement(642869..643351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0636"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60030"
FT                   /protein_id="ABJ60030.1"
FT                   /translation="MMETFTTSNAMYNNDLLIYICNLIEDHHLSYILSRLEDRHFRSRY
FT                   LPKQKTIIINTNWWNPPEIPFMAAHELGHYINGDKGVMYYDHTYKWQEHRAFNRNDDAF
FT                   KEDQADLYGLDLIWNYASSQGYTCEDPGEFMLQFGIPERLKKVVAQKFESNNDLLF"
FT   gene            complement(643326..643673)
FT                   /locus_tag="LGAS_0637"
FT                   /note="LactoCOG number LaCOG00006"
FT   CDS_pept        complement(643326..643673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0637"
FT                   /product="Transcriptional regulator, xre family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60031"
FT                   /protein_id="ABJ60031.1"
FT                   /translation="MKSMIGDRIRELRTSHRLSQTELSKLLHVSQQTITKWENGKAEPS
FT                   SGALAKLAEYFDVSADYLLGSDKTSEPKSVDLEKDPVVLSYGGRPVSEEDMDVIKAILE
FT                   RHKNDGDVHYE"
FT   gene            643818..644042
FT                   /locus_tag="LGAS_0638"
FT                   /note="LactoCOG number LaCOG00006"
FT   CDS_pept        643818..644042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0638"
FT                   /product="Transcriptional regulator, xre family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60032"
FT                   /protein_id="ABJ60032.1"
FT                   /translation="MKRELKSLRVGAGLTQTELAKRLGVTNVTVSRWERGEAIPKPKYI
FT                   KAMAKLFNIKGQDIFLNLITTKAYKVATK"
FT   gene            644075..644410
FT                   /locus_tag="LGAS_0639"
FT   CDS_pept        644075..644410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0639"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60033"
FT                   /protein_id="ABJ60033.1"
FT                   /translation="MPELINKDALIVIFKPIIKALFDKEKEEAEGATINIDEFRKKYCG
FT                   GKGQEWVRLYVFDKFKKEIDFENGGFVVNPHNGKKTIIFRKDAKKWIEENYHRIDWNAS
FT                   IKKDFGR"
FT   gene            644379..644693
FT                   /locus_tag="LGAS_0640"
FT   CDS_pept        644379..644693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60034"
FT                   /protein_id="ABJ60034.1"
FT                   /translation="MQVLRKILGGRKMIKVTTGDVIRQLVSRGVFEWKKDAEYQIGIKD
FT                   EQIVVNKDGSAEIAYLGNTLESVIQLADMFKKVGTKEQQEQINAALTDLVTIGDRWNEA
FT                   "
FT   gene            644811..644957
FT                   /locus_tag="LGAS_0641"
FT                   /note="LactoCOG number LaCOG03251"
FT   CDS_pept        644811..644957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60035"
FT                   /protein_id="ABJ60035.1"
FT                   /translation="MTLEARLISNSNAFFARQDKSPLDVDEYQKQFEIALMQQKKPLPT
FT                   ANQ"
FT   gene            645009..645341
FT                   /locus_tag="LGAS_0642"
FT   CDS_pept        645009..645341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60036"
FT                   /protein_id="ABJ60036.1"
FT                   /translation="MVEIMTPVQAATYREQRLKKEQRNLAKQGISSAMEGKSLVTIGDA
FT                   NQDYLSFKHFVTAQIFRLGIDTYMGLTGWDDKRELIEELASVEDPNDDLWKEDVLDYFD
FT                   GFEGNY"
FT   gene            645341..646201
FT                   /locus_tag="LGAS_0643"
FT                   /note="LactoCOG number LaCOG02329"
FT   CDS_pept        645341..646201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0643"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60037"
FT                   /protein_id="ABJ60037.1"
FT                   /translation="MKEISTKLDETSPDYKVKFTPASIEFDDYGKLKEETDEIYKRYNG
FT                   YVVVPENLKGDRAIAADLNKKAKALKAAKSTVRKQALKPLDEFNEQMDALIDEITDVSG
FT                   QIHQGLKDYREQGIKLRHEANIKHIDKMAEKFGLTHEDIAYDAKWDNKSNNWKKIEENI
FT                   NQLLEKAAQERDFKNEKITLITEAAEKEQILPDSYINLIDDLTISEILARIKNDGKRQR
FT                   ELSLKKDEPIKQQVKGNSVIDTTTGEVVGETKVAYLKITGSDEQMKKLVEFIKSQGLKV
FT                   EPIER"
FT   gene            646207..647019
FT                   /locus_tag="LGAS_0644"
FT                   /note="LactoCOG number LaCOG03015"
FT   CDS_pept        646207..647019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60038"
FT                   /protein_id="ABJ60038.1"
FT                   /translation="MEFVGEVKDRASWALHFAQVKANIKQPQRSHKVQVSGKTKTGKPY
FT                   TYEYKYADLADVDKSVMEATKKVVDDKGNVQFTYFFDVNNTDQGVDVQTILVDVSGFYA
FT                   VTNKVWFKNFNVGDAQKTASLISYAKRYSLSAAFGIASEDDDDAQDVKNIEEPKVLSKQ
FT                   ELDNYTVYYNGIKANLAELYQEAVDGIADAQDWIRGSHTPQDAQAIYQLNQSYKRREKD
FT                   KQEALKKAEEEAKKEEKLREAQRSEEKPKQEDVSNLFGTLPADGEYIK"
FT   gene            647029..647952
FT                   /locus_tag="LGAS_0645"
FT                   /note="LactoCOG number LaCOG00704"
FT   CDS_pept        647029..647952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60039"
FT                   /protein_id="ABJ60039.1"
FT                   /translation="MGRRMYSDKIVETDKFLDMPVSSQNLYWHLCMHADDDGFLGNPKT
FT                   IVRSIGAQQDDLKILVEKGYVIVFEDGVIAITDWFVHNYIPKDRYHETVYKEDKKQLEL
FT                   SETKQYRLVTRKPIVQDTKSKQVVDNMDTSCIQDDNKVYTEDKLSKDKLSKDNNIYKLS
FT                   SSENIDTDPEQKSQKIPYEKIIDYLNRKTNSHYRPTSKATRRLIKARYNEGFTDIDFKS
FT                   VIDKKCAEWLQDGNMVQYLRPETLFGTKFEAYLNQPDTGPIPRNNFRNKPVRRATNWDK
FT                   VQQQQSQTTLQMTREERNAIFREYGR"
FT   gene            647958..648263
FT                   /locus_tag="LGAS_0646"
FT                   /note="LactoCOG number LaCOG01493"
FT   CDS_pept        647958..648263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0646"
FT                   /product="Transcriptional regulator, xre family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60040"
FT                   /protein_id="ABJ60040.1"
FT                   /translation="MQNRLKKLRLEKRLTLADIQAKTNIDFRILENFEKGLENGIHNSL
FT                   AIWQKLANFLEVPIEYLMGLNDDSKTLTVNDLNPAKEDAYERITDMLCEDEDDEDE"
FT   gene            648241..649041
FT                   /locus_tag="LGAS_0647"
FT                   /note="LactoCOG number LaCOG00322"
FT   CDS_pept        648241..649041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0647"
FT                   /product="Uncharacterized phage-encoded protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60041"
FT                   /protein_id="ABJ60041.1"
FT                   /translation="MRTMKMNNELIKVTVKNDQQLVSARDLYKGLGIKRRFSAWWEQNS
FT                   NDFKENSDFQRVLISTPRENRGSIELQDYALTIDMAKQLCLLSRTSKGKEYREYLIEVE
FT                   KKWNNPDMIMQRALTIANNRVKLLETEKRELKETNARQAAKIAKDADDVVFAKAIRYSH
FT                   HAIPVGELAEILTQNGFVIGRNQLFQLLREEKYLSSFNHSWNVPMTQMVKRGLFRITHN
FT                   LTRDGRGYSQTWVTPKGQKYIINKALRGKFDDIYQKVMVSTLNV"
FT   gene            649056..649241
FT                   /locus_tag="LGAS_0648"
FT   CDS_pept        649056..649241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60042"
FT                   /protein_id="ABJ60042.1"
FT                   /translation="MNEIENIKAGLTYLLDINDLKNNVTVTKDGKSHSMNVKDLKEANY
FT                   DVLLQIAELLGMDVNN"
FT   gene            649251..649463
FT                   /locus_tag="LGAS_0649"
FT   CDS_pept        649251..649463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60043"
FT                   /protein_id="ABJ60043.1"
FT                   /translation="MLEENHDLEKIIEDAKQYRWYSVPDMYVVEILDTTGRSAGYAKSI
FT                   FIDKKEAAKVAKKLHGVVRQVSQNE"
FT   gene            649656..649919
FT                   /locus_tag="LGAS_0650"
FT   CDS_pept        649656..649919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60044"
FT                   /protein_id="ABJ60044.1"
FT                   /translation="MEIIDNRTKKEEWRLGDVLVSGSAQLTGLIVKDNNGKYCLIDITP
FT                   DESGNYSTMEGCYYGDSCENLAELYCKMGPNWHKVNAKLVIE"
FT   gene            650098..650469
FT                   /locus_tag="LGAS_0651"
FT   CDS_pept        650098..650469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0651"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60045"
FT                   /protein_id="ABJ60045.1"
FT                   /translation="MREETMKKIKVEKDSVEESYRWAYGWRVVDGKCSPPARNFPLPDF
FT                   VQARIDWLSDEVKRGGLTFQGAFRILLDIDDEKALKEDWELGAASDYMPVSDKYREWLQ
FT                   DPILHDIRQVAVMVGFIYA"
FT   gene            650470..650793
FT                   /locus_tag="LGAS_0652"
FT   CDS_pept        650470..650793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60046"
FT                   /protein_id="ABJ60046.1"
FT                   /translation="MGFCSSILNSASYSNFGSRSDVNMIFKLEEDLPFDIQGNLNEYWL
FT                   NILERNNFKVIEINKKTRELEYRIELMSLDDLRKLQKKIGLNLTISFEDDEGTNEVDGI
FT                   ITI"
FT   gene            650806..651267
FT                   /locus_tag="LGAS_0653"
FT                   /note="LactoCOG number LaCOG01643"
FT   CDS_pept        650806..651267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0653"
FT                   /product="Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60047"
FT                   /protein_id="ABJ60047.1"
FT                   /translation="MRVNFTIEGPPIGKARPRVTRTVTYTPAKTARYEDLVRYTAINSF
FT                   KGIFDKDEPLDVKIMAYFEVPKSLSKKRKALCLANQELPTKKPDADNVGKIIMDGMNPK
FT                   MRRDKRLHKMVEVMRGVYHDDKQVTTLLVKKRYAERARVDVRIKRDMGD"
FT   gene            651268..651489
FT                   /locus_tag="LGAS_0654"
FT   CDS_pept        651268..651489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60048"
FT                   /protein_id="ABJ60048.1"
FT                   /translation="MQKIDLSLVSKFVDASIANDKRLALKLAKKIAEQHNCSLSFELDT
FT                   LDWSANWLKSDERVTTQSMVRELRKYEA"
FT   gene            651523..651690
FT                   /locus_tag="LGAS_0655"
FT   CDS_pept        651523..651690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60049"
FT                   /protein_id="ABJ60049.1"
FT                   /translation="MLRCCRICGVLSMSNNLKYQKGKWYHVQEDGSLKPVDYDKEVEEY
FT                   YKKWRDNYGN"
FT   gene            651680..651970
FT                   /locus_tag="LGAS_0656"
FT   CDS_pept        651680..651970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60050"
FT                   /protein_id="ABJ60050.1"
FT                   /translation="MAIELKIGARGTREDFEDTYTRSFLEDNGLFKFDPRKFTVNCVWG
FT                   VHTKYGYMCSFSYDDILTYMGDGVWDLRVAEETKITDEELKRALSEPDKEF"
FT   gene            651973..652191
FT                   /locus_tag="LGAS_0657"
FT   CDS_pept        651973..652191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0657"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60051"
FT                   /protein_id="ABJ60051.1"
FT                   /translation="MQLYGHEVNPYTYKDFKTEQLKNFRSMLKSNIKNFENIIEPTIEE
FT                   MIDEDKAEELLPLIEHEIKVRSNDGRN"
FT   gene            652175..652345
FT                   /locus_tag="LGAS_0658"
FT   CDS_pept        652175..652345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60052"
FT                   /protein_id="ABJ60052.1"
FT                   /translation="MMDETRNDLEVGNETAVMMYLNILKYAKHHCPEDEDPYEITDRIF
FT                   TDMFAANKASN"
FT   gene            652375..652905
FT                   /locus_tag="LGAS_0659"
FT                   /note="LactoCOG number LaCOG03252"
FT   CDS_pept        652375..652905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0659"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60053"
FT                   /protein_id="ABJ60053.1"
FT                   /translation="MYQIDLGLQPNLRATAKRVDKFLTINFQSYLNLAGLHRNQLTSPQ
FT                   LSFAPGSTNKNGVEKNFIDEAQDDIDIADPARKVCAAIYRTMDNCTDTSLKPYRRILIG
FT                   TYIDQLRIVDVAATVNLSTRSIDTKKINAQCEFADRWLYWKKYFGVNDLPDLRVFSQKV
FT                   KTVWPDKIKIRKN"
FT   gene            653635..653707
FT                   /locus_tag="LGAS_t0660"
FT                   /note="tRNA_Gln_TTG"
FT   tRNA            653635..653707
FT                   /locus_tag="LGAS_t0660"
FT                   /product="tRNA-Gln"
FT   gene            653763..654047
FT                   /locus_tag="LGAS_0661"
FT                   /note="LactoCOG number LaCOG00053"
FT   CDS_pept        653763..654047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0661"
FT                   /product="ParB-like nuclease domain"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60054"
FT                   /protein_id="ABJ60054.1"
FT                   /translation="MKVETVSINKIKPYENNPRNNDDAVDAVANSIKEFGWQQPIVVDN
FT                   GGVIIAGHTRYKAAKKLGYKEVPIVVADSFDYWQRFNNCEPIVDLHKYK"
FT   gene            654299..654380
FT                   /pseudo
FT                   /locus_tag="LGAS_t0662"
FT                   /note="tRNA_Other"
FT   tRNA            654299..654380
FT                   /pseudo
FT                   /locus_tag="LGAS_t0662"
FT                   /product="tRNA-OTHER"
FT   gene            654488..655105
FT                   /locus_tag="LGAS_0663"
FT   CDS_pept        654488..655105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60055"
FT                   /protein_id="ABJ60055.1"
FT                   /translation="MNVFTNNIIDGYIRWNKNNMISKNFTCGYCGAYVSSDKGMPLVDQ
FT                   GRVNPTESIGVYICTNCYMPTFIYDDIQVPGNRYGVAVSGVPKDVNDVYEEARSCYGAN
FT                   AFTGVVLLCRKLLMHVAVDLGAKDNLKFVEYVNYLNENHFVSVKSHDWVDQIRKYGNEA
FT                   THEIQVNTKEDAQKIIKFCEMILKMNYEYPSEINDSNDGKNN"
FT   gene            655288..655944
FT                   /locus_tag="LGAS_0664"
FT                   /note="LactoCOG number LaCOG03253"
FT   CDS_pept        655288..655944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0664"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60056"
FT                   /protein_id="ABJ60056.1"
FT                   /translation="MTALNAEISPNSIILSMDTLASRKNNNGKTIPSYFTQKFEYYPFT
FT                   QSILCGTGDFSIIRLAFDRSRSILSKEVKTFSLIIRDVLKNNIEKVNTDTTIYIFGFDE
FT                   DMNTHAYALRSTNKFGIQEIASYSNPNWILKPQCEEAIDYLLNSDSNNKIHIFKELMKI
FT                   EKNIDDKKTKERVGIGGQNILINLVAKDGEILSSINIIDEFEDYDKQYKFCLENL"
FT   gene            656005..656526
FT                   /locus_tag="LGAS_0665"
FT                   /note="LactoCOG number LaCOG00019"
FT   CDS_pept        656005..656526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0665"
FT                   /product="Phage terminase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60057"
FT                   /protein_id="ABJ60057.1"
FT                   /translation="MERKLTTKQKIFCDEYIKSGNAKEAAIKAGYSPKTAKSIGQENLT
FT                   KPDLKAYIDAKMAEIESHKIADAKEVLEFYTKVLRDEVVEEVPMSTADDVVVIKKKPSF
FT                   KDKITASKEIMKRYPLVDPIEKQKLQKLIADTRISEAKATVAERLGNESDDKLDELMDK
FT                   LIKASEKSQE"
FT   gene            656615..657346
FT                   /locus_tag="LGAS_0666"
FT   CDS_pept        656615..657346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0666"
FT                   /product="Homing nuclease of HNH family with NUMOD4 and
FT                   IENR domains"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60058"
FT                   /protein_id="ABJ60058.1"
FT                   /translation="MNNNIEIWKDVQGYEGLYQVSNLGRVKSLYKNTKILMPRLNNRGY
FT                   QYVMFFKDKKYKHFLVHRLVAQAFIPNPNKLPQVNHIDENKENNCISNLEWCTNIYNNL
FT                   YRGKVKRAGIKNGICVAQYNLKGKLVKVWNSAHEASKEGYNASHIRECCLGQAQTHNNY
FT                   MWRSVSNNHVIKKIEPYQKTSFTNRSDLSENIGQYDIDGNLIKVWPSIREASRKGFDRS
FT                   SISYHIKNKKPYKGYIWNLMK"
FT   gene            657328..658572
FT                   /locus_tag="LGAS_0667"
FT                   /note="LactoCOG number LaCOG01645"
FT   CDS_pept        657328..658572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0667"
FT                   /product="Phage terminase large subunit, ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60059"
FT                   /protein_id="ABJ60059.1"
FT                   /translation="MEFNEIIMSLNDLFTKKQQKVLQSYLNDDWKYLFLIGAVRSGKTY
FT                   ISNWMFLLELKRVAKLAKTNNVKRPIYILAGYSSNSINTNIIASIENEFGINIPVDRHG
FT                   HYHLFDVEIVPAYTGSIRGIGSIRGATAYGALIDEGTLADQGVFQEIINRCSIEGARIV
FT                   VTSNPDAPTNFIKTEYIDNHDPKARIKVFNFTIFDNTFLSKDYVDALVAATPSGMYTDR
FT                   TIYGKWVSAEGQIFSDFNIETMTITTDQLPEMVKYYASIDWGFGKGHKGVIQLFGDDEN
FT                   GTSYLIKEWAHEHRFIDYWIDVAKEIKQKYGNIVFWADSARVDYVNQMQANGINCINAN
FT                   KNVLSGLEFVDSYFKQGKLIINKDEADNLLNTIFNYVWDDKKEAPLKEDDDSEDCLRYG
FT                   IYSEHYEGGGFVPWN"
FT   gene            658563..659975
FT                   /locus_tag="LGAS_0668"
FT                   /note="LactoCOG number LaCOG01647"
FT   CDS_pept        658563..659975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0668"
FT                   /product="Phage portal protein, SPP1 Gp6-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60060"
FT                   /protein_id="ABJ60060.1"
FT                   /translation="MELDALKKLIQNTSTSRNDLINNYKQAVNYYENKTDITTRNNGKA
FT                   KLNKEGKKDPLRSADNRIPSNFYQLLVDQEAGYVASVFPDIDVGKDADNKKIIDVLGDD
FT                   RALTLNGLLVDSSNAGRAWLHYWIDEDNNFRYGIIQPDQITPIYATTLDNKLLGILRSY
FT                   KQLDPDSGKYFTVHEYWTDKEAQFFRTSATDSTVIEPYNIITSYDLSAGYETGQSNTLK
FT                   HNFGRVPFIEFPKNKYRLPELNKYKGLIDAYDDIYNGFINDLDDVQTVILVLTNYGGAS
FT                   LEQFMNDLREYKSIKINNAGNGDKSGVDKLQIDIPVEARDDALKITRDNIFLFGQGIDP
FT                   ANFESSNASGVAIKMLYSHLELKAAKTQTYFEHAINELVRAIMRYLNFSDADKRHISQH
FT                   WTRTKVEDSLTKAQIVSTVANYSSKEAVAKANPIVDDWQQELKDLAKDREENDPYSKQA
FT                   DELNGKGVDDEE"
FT   gene            659965..661497
FT                   /locus_tag="LGAS_0669"
FT                   /note="LactoCOG number LaCOG02094"
FT   CDS_pept        659965..661497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0669"
FT                   /product="Phage Mu protein F like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60061"
FT                   /protein_id="ABJ60061.1"
FT                   /translation="MKSSDYWRQRAIAEKKKQLEASADYEAAMQVRLRRLEHEFEKEAL
FT                   VYLQRYANENNVGLKQAASVLGSINTTKWSMTLEEFERKAKAGGYDKELNAEYYKSRIY
FT                   RLQQLHDQMVEFSKKYGMAEQLKMQKGLAKQYQNSYYLHAYDKYRATGQLDIKLNHFNE
FT                   QQLENIVYSPWKGSDFSKRIWKEYTEILPDELTDTMLRATLFGYSPSKVVSMMRDRFKK
FT                   VSDRDLHRLVTTEMGHAAEEATAQFYKDSDIEQYQYLATLESHTCDQCTHLDERIFNVK
FT                   DKKEGINYPLIHPYCRCTTVPYDKDLPDVETRWSRDPKTGKGRYVYRNALDYSEWKKLS
FT                   NVKILNLSLPTPKLTWDEEAAIHKYNSFESYGLNADLRAGNTLSPAEEKLKHDLDTALD
FT                   KIPYYSEDEPLSRSLYFESRDDIMVDYVNKALTQGYIQEPSYTSSSAGMVYNPEDDLRV
FT                   VILKSHSGHDIRKFNDVEGEVLFKRNTRFDVLRLNIIDGKPYIEVVEHEEND"
FT   gene            661466..661678
FT                   /locus_tag="LGAS_0670"
FT   CDS_pept        661466..661678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60062"
FT                   /protein_id="ABJ60062.1"
FT                   /translation="MRWLNMKKMTKYNLSNEEFLNYIKSIPKSQFNNKSHIEYFKKVYE
FT                   AKKKSGSDYSKEEKYLKENGVKLDD"
FT   gene            661796..662356
FT                   /locus_tag="LGAS_0671"
FT   CDS_pept        661796..662356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0671"
FT                   /product="Phage minor structural protein GP20"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60063"
FT                   /protein_id="ABJ60063.1"
FT                   /translation="MKRKQLEELGLQEEQIKKIMDLNGEDIQNAKDKASASNAEILEEN
FT                   KALKSQMSERDKDLKKLRAQVKDNEDLTKQFNDLKSKYDKDTADLTQKLATNRLNSAID
FT                   QSLSKANVRNNKAIRGLLNMDEIKLDDDGNLTGLDDQIKSLQKSDGYLFDEGSKQDYQP
FT                   NNGKPANADPVQAMVDIFKGEHK"
FT   gene            662356..663438
FT                   /locus_tag="LGAS_0672"
FT                   /note="LactoCOG number LaCOG03254"
FT   CDS_pept        662356..663438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0672"
FT                   /product="Major capsid protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60064"
FT                   /protein_id="ABJ60064.1"
FT                   /translation="MAINYADKYQKAVIDGFYPDVLYSSALWQSPSNNTINFLDAKHIK
FT                   VPRLSILSGRQDRERRTITQPAANYSLDYDVYELTNERYWSTLVDPSDIDESNQLLSIA
FT                   NITRQYNLDSKMPEKDREMFSKLFSQRQAVNTSEGLDQNAGIHSESLDAKNVLKAYDQM
FT                   MRNFDRARIPAQGRILYVDTGTYYMLKDAEAINRTIIVSDAQNINRSVRSLDEVTIVPV
FT                   PEDLFQTKFDFTNGSKTVDDAKQIKMMLIFNGVQISPEKYDFVGLDAPAAANSGNWLYY
FT                   EQSYDDVLLLKPKFKGIEFFVAEKDADGDSNPAGRKKTTEEDAKPNENNTVDEIKAYLD
FT                   KNHIDYTGKTKKDELLTLVK"
FT   gene            663447..663836
FT                   /locus_tag="LGAS_0673"
FT   CDS_pept        663447..663836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0673"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60065"
FT                   /protein_id="ABJ60065.1"
FT                   /translation="MDKYPRFEEVKKHLADFLPNTDNAPNYDSVLEFTLEKVISDVSIY
FT                   TNIPILELPEELEPTILGLAVQTIDTHQWLVPKDQQVGNVQSLSEGDTSVSFRSPSDIY
FT                   SALQATNTITDNYVMLLNNFRRLAQ"
FT   gene            663833..664195
FT                   /locus_tag="LGAS_0674"
FT   CDS_pept        663833..664195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0674"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60066"
FT                   /protein_id="ABJ60066.1"
FT                   /translation="MSYFNGLKNALPKLWNDRVKIVGTLPTKHGYITNNEDVTIVEDEP
FT                   AKVVLKGQSASEQSFFGTDEYDAKLIIRNGIKIPAGADIYVTDVNGQVTKYKRASKGYS
FT                   GYFSHQEVAMVRSEKA"
FT   gene            664192..664626
FT                   /locus_tag="LGAS_0675"
FT   CDS_pept        664192..664626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60067"
FT                   /protein_id="ABJ60067.1"
FT                   /translation="MSLGHVDDAQFQQFASRVRQKIDSGYVKQELGKSSRRIGTQSLRI
FT                   LETNTPVKQGNLRRSWTAEGPTYGCGGWTIKLINNAEYASYVESGHRQTPGRYVPLLKK
FT                   RLVRDWVPGQFYMKKSIPQIQRQLPQLVTEGLWGLKDLFE"
FT   gene            664623..665030
FT                   /locus_tag="LGAS_0676"
FT   CDS_pept        664623..665030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0676"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60068"
FT                   /protein_id="ABJ60068.1"
FT                   /translation="MTIVERIAKRISEIFPDVTIYSEKQKSGFQVPSFYISKIMTVTKS
FT                   RFFDIQDRSLSYSITYFANPDRPNADMEEVEQKLLNNFTRLDDYATVRNREATINQDDE
FT                   TLVMSFDLRLEMYPVQDGGKLERIEFNGGIQ"
FT   gene            665005..665232
FT                   /locus_tag="LGAS_0677"
FT   CDS_pept        665005..665232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60069"
FT                   /protein_id="ABJ60069.1"
FT                   /translation="MSLMEESNKTETETPMGEIKAPIQVEDVKFTKQALISSPKFSVIE
FT                   RDILKLALDDDKEYTIAEVKKAIDKFKEGF"
FT   gene            665232..666587
FT                   /locus_tag="LGAS_0678"
FT   CDS_pept        665232..666587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0678"
FT                   /product="Sheath tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60070"
FT                   /protein_id="ABJ60070.1"
FT                   /translation="MAGGTWKAQDKRRPGAYINVVGNGQREAASSLGRVLLIRDKGLGW
FT                   GKNGVIEVEANSDFTKKLGTTLDDPSLTALKETLKGASKVLVLNPNEGTAATLTKEGLP
FT                   WTVTANYPGEKGNQITVSVEVSPADQNAATVSTIFGTKLVDEQSIKFNELDKFKGNDYI
FT                   TAKVVEEGSSKPVAFTNVSGALTGGTTTESNKVESLLNDALENEEYAVVTTAGFEPSSN
FT                   MNKLVVEAVKRLRENEGRKVRGVIPTDADTTYNYEGISTVVNGYTLSDGTNVDVKDATG
FT                   YFAGISASADVATSLTYFEVEDAVSAYPKLDNEKTIKALDAGQIVFTTRPGQRVVIEQD
FT                   INSLHKFTAEKPQSFSKNRVMRTLDEIATDTENTFERTYLGKAGNNAAGRDLFKADRIA
FT                   YLMGLQNRNIIQSFKNTDVTIEAGNDTDSIVVNLAVTPVDAMEKLYMTMVVR"
FT   gene            666599..667069
FT                   /locus_tag="LGAS_0679"
FT   CDS_pept        666599..667069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0679"
FT                   /product="Core tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60071"
FT                   /protein_id="ABJ60071.1"
FT                   /translation="MAAIDEFLNGRDTISTKDATLSIKINGNIIKMIECDKFTAKLEKN
FT                   KEDVQTLGSHWKRKKTTSVEGTGTLGGYLVNSNWIKYGIPYTQDGGDLYFDATLTIHDP
FT                   TSRAGKQVVQLTDVNLDDIPIADFEADDGVMEWESDFTFEGVNLVQAFNGIN"
FT   gene            667081..667500
FT                   /locus_tag="LGAS_0680"
FT   CDS_pept        667081..667500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0680"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60072"
FT                   /protein_id="ABJ60072.1"
FT                   /translation="MAESVEDFLFENVGSPVEEKEVKLERFKSPFKIKSLTADEVSHIR
FT                   KQATKRVLNRKTHRYEQETDENQFQGLVVAEAVVSPNLNNEKLQTSWGCIAKPEEVLKK
FT                   MLKVGEYTELSQAIMDLSGLNDDDSSEDLVEEAKN"
FT   gene            667581..667691
FT                   /locus_tag="LGAS_0681"
FT   CDS_pept        667581..667691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60073"
FT                   /protein_id="ABJ60073.1"
FT                   /translation="MSRREQALVVASIEVRQKYEKEEERKAKRKARSKHI"
FT   gene            667737..671147
FT                   /locus_tag="LGAS_0682"
FT                   /note="LactoCOG number LaCOG02100"
FT   CDS_pept        667737..671147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0682"
FT                   /product="Minor tail protein gp26-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60074"
FT                   /protein_id="ABJ60074.1"
FT                   /translation="MSTISTTVKINDAFSNPLDRLSSGLQKAQSGMSKLKEAISGGSSG
FT                   GSMFKSMVGGTVVGGAINKGMELASTGIRSMYGELDEASKAWQTFDGNMHQLGKSPAEI
FT                   ATAKKSMQQFAQQTIYGASDMASTYSQLAAVGTKNVDQLVRGFGGLAAASSNPQQAMKT
FT                   LSEQATQMAAKPMVQWQDFKLMLEQTPAGISAVAKTMGVSTQQLIKNVQDGKVKTEDFL
FT                   NAIAKTGTNANFTKMATQFKTVGQAIDGLKETMANKLQGAFDRVGKVGIKFVSDLTDQL
FT                   SNVNFDGFVDGLFKAVADMEPIFDDLKTGFDDFKKGFADSGAFNSLKDTFDSITDSVGK
FT                   LVNTMDQTNGGDSLFKQLGKLAGGALGGAAKSISGIAEALGELDPGTLQMLAQAFIILK
FT                   GGLKGLVFEAVIWGLKELNKLDPGTINNIAQALTALAIAFTMLKAMGKIAGYMKEVSKF
FT                   FKGFKNAKKIKAPEIDSPKMTKPGKILSNAGAYMKLGAAFALVGAGALALGAGFKLLAD
FT                   AATQISSAGGGAIATFFGMIAAIAALVVLVRFLGPDLIGGAVGFAIFAAALLLIGAAVL
FT                   VASAGIALLATQLPTISEYGTSAAVGLLALAGAIAVFGLAAIVGAVGVLLLGVALAVLA
FT                   VGLVAAGVGALIFAVGLALVGITALIAAVGVLLLGVAIALVAVMVIIAAVGMLLLGVTL
FT                   VLVAAMGIVAAVGLLLMGVALMLIVVSAMVAAVGLILLSVALLLIGPMSLIAAVGLLLL
FT                   GVALTLVMAMGLVAAVGILLLGVGLVLVAAMAMVAAVGLMMMSVALMMIMVTAMVSAVG
FT                   LMLLAVALMMVGPMAMIAAVGLMLLAAAAIMLGAGLMVVAAAAMAVAAALVAVGASVMV
FT                   MASLFVAAGSMMVSAITSAMSGVVSAVRSGISSAVNAARSFGSALVSVGRQLIQGLVNG
FT                   IKSMIGAAVSAVQGVASKVVSAAKSVLHIGSPSRLFRQYGRWVDQGLIIGLNRDAGAAA
FT                   DASASMAQGVVDAASGMSPTLDPIGLSGINPGDLLAAGFDRALDAISNVAGAITGLDGS
FT                   RANIGIFGQGAVSSAVGSDTVTSGSIAPNSVLTNNNSSSQTDNSTQVQIDKGAIVINAS
FT                   GNPDADVDKILDKIDQKIIDRRNKALGGG"
FT   gene            671140..671829
FT                   /locus_tag="LGAS_0683"
FT   CDS_pept        671140..671829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0683"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60075"
FT                   /protein_id="ABJ60075.1"
FT                   /translation="MVNMPVNGFGVYITDYSTNRTVELPVNPSELTLKYETDDKSETIV
FT                   NLGEINRVGNMKLVSLTIDSVFPKKHSSWISSDKLLKPDEYINWLKNIQANKHHVQLVV
FT                   SSTQISVTMTISSFEYGFKSGFADEYAYTLGLKQYREVKYHKVNVPAPPKPKPRPAPPK
FT                   KLGIGSIVIVNGRLRLDSYGSAPGVYENNVRRRITYLAPGHPFPIHVALVNGGPRGWVR
FT                   QSEVRLA"
FT   gene            671826..672872
FT                   /locus_tag="LGAS_0684"
FT   CDS_pept        671826..672872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0684"
FT                   /product="Phage late control gene D protein GPD"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60076"
FT                   /protein_id="ABJ60076.1"
FT                   /translation="MITKLQILKHDNGGARIGVEIKDMVKNLKWVTDLNYSAGELTFDI
FT                   VNGKDPIIPAMGAIVDFAWDNKDIFWGFVFSAECTSDTTVSVKAYDFERYLKSEGSVVF
FT                   QSGTLGDRYSNVCRRFGVPFHIKEQPTYRVPAEVCDGKTGFDMIKSAIDKTYSATGEMY
FT                   CIVANHMYIELRRAPIPTRTLLVIDTQNTMSDYTYSESIDNAANVVQVVQKNTDNSQTK
FT                   TATATSETGDDPATTSFTIASARGNTIRTWGQIVKVVNAKNKANWAQMVQQANDELKKR
FT                   NVSERKLTLDCMGDTSLIAGAGANVKIKDFGKTWTNCPILKATHNFGTDYTCSLEMKVG
FT                   TKWQENSL"
FT   gene            672851..673213
FT                   /locus_tag="LGAS_0685"
FT   CDS_pept        672851..673213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0685"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60077"
FT                   /protein_id="ABJ60077.1"
FT                   /translation="MAGEQLIKMLTERGGSDSEYSDVIYGRVISISPLKVQISNSMIID
FT                   DNFIVLGKHIGSFSMSGSLTTTEEKKGKDGEKPKTEKTTKPATFTFDNSLKVGDRVTMI
FT                   RADGGQQFYLFEREGG"
FT   gene            673194..673586
FT                   /locus_tag="LGAS_0686"
FT   CDS_pept        673194..673586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0686"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60078"
FT                   /protein_id="ABJ60078.1"
FT                   /translation="MRERVVNLDNEENQNPTLTFQIANGRIRNKFDGLGAMVQAVDKIL
FT                   KTERFVFPIYTDQYGNDLNDLLGKDLGYSKVEAERMVKEALLADERVIKVDITSINETS
FT                   PNTLTLTGECQTSYGNIPIESEVSIK"
FT   gene            673583..674734
FT                   /locus_tag="LGAS_0687"
FT   CDS_pept        673583..674734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0687"
FT                   /product="Phage Mu gp47 related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60079"
FT                   /protein_id="ABJ60079.1"
FT                   /translation="MSPNELITEFQNKDYDYFLRKMLDAVPDNIDKREGSIIYDALAPA
FT                   ALVMGQQSLDMANVIKETYIKTASGEFLDYRAIEHGTSRYPATQTEAKAKVLNDKKEPL
FT                   DNVQIGDKFASIGDSPIFYAVTKVNDDLTVELTAEVKGSSANSYIGQILPVTPNDLLSW
FT                   AEITEITAPARDVESDDHLRARLLSSQSWIAYGGNVADYLDMTSKIDEVGAAQIYPTWN
FT                   GGGTVKVVILNNDLMPASASLVQKVKNILDPEDKQAEGYGLAPIDHAVTVTAPEELIVN
FT                   VDISVKLDDTKVTRYVKDSITKAVEGYFQSLRKDWADINQKLGRGYEETIYRSKILSQV
FT                   MLTEGVVNAKLPSLNGRDADIDLVFNNSKSQLPVVGTVTINEQ"
FT   gene            674724..675284
FT                   /locus_tag="LGAS_0688"
FT   CDS_pept        674724..675284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0688"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60080"
FT                   /protein_id="ABJ60080.1"
FT                   /translation="MSNKYELLNYMPDYYEGVYEMKELLKSESVTLKDLESSHLRTLLN
FT                   EFVSTADAKGISLFESQLGIVPDENDTLEMRRNKVLMYVLPPRPITIRFFRDMLNNVNL
FT                   PVKIDVNYGARAVVVTAKSAEMTSNQINYLKYLLNVYLPANLLYQVKILLNAAKVFDDL
FT                   NLGIGNVVKAASMAKASPNQVFN"
FT   gene            675297..677465
FT                   /locus_tag="LGAS_0689"
FT                   /note="LactoCOG number LaCOG03255"
FT   CDS_pept        675297..677465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0689"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60081"
FT                   /protein_id="ABJ60081.1"
FT                   /translation="MSEYNKTIITNEGIDLARRANKGTATFSLTRGVSSTDNLSEKTVE
FT                   ELQNLTQLPSIQQSVKLSDVGDTSDNSDTVLGVRMTFDNQNLKTGYNVHTVGIYAKEPD
FT                   KNEILYGIATAKTPEYIPDFSEQTLFKFDFLMYLVIGRTDKVTVEVSPDDVYRKKEVYS
FT                   KSEVDTAVAKLDKKNAEIVKSLSDYKLENSTYHTNFEKSVTDRLGTKADKTTVEQQLGT
FT                   KADKSNTYTKDEVNSKVAPKADKGYVDSELNKKADKATTYTKTEVDNKIAGQVKSVNGH
FT                   TANASGAVTLPTLTANVLTGYDVKNKAATFDNNAHFDANGLFSRWTVDQGVIGQLADAI
FT                   NAKLPIEAGDPNGDLLDYAGNKIVYWNGNGDGVKNLPPMNNKKWFFAVKLFYLGWGSVT
FT                   VVDQDGSYWLNTKNDDIWTGWRSVITNEHLKKLKFVKQSLDQNGNIFQDTKFVTQEADG
FT                   TYKINIFDSDWTANKVSWLLNNTKSYSIQNNTDLNNVKNTGFYNAAGPSGLKNSPVSAW
FT                   FSMSVNANQWNGQQTLYDTNSGQLYVRTWNSTRFTDWQRIANAGDLTNQSITSITDYDV
FT                   ASEGWHNTQVGKFDPSGHFANLLVDAGALKPIAEAINNLNTNLTTMRTELMNLKKRTDY
FT                   NTPQGEFNNTTVNLNNLRSTGMYRLSNCHVQSGPYPTDNAHWVYVKVTVFDANTVYQTL
FT                   YEGDNMYGRKSSSPTNWDQWHQYLNKTV"
FT   gene            677505..678014
FT                   /locus_tag="LGAS_0690"
FT   CDS_pept        677505..678014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0690"
FT                   /product="Phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60082"
FT                   /protein_id="ABJ60082.1"
FT                   /translation="MEAENFLDLLKQVVADGKISFYYFSDPTSPITALHHLEIPYPGEL
FT                   SPVDLPYRWHAEKPSEDLIDAVWDDDSHSWIENSDKSQPALIAKLQASNAAMQKKMENY
FT                   EAAKIKDAQNNDKIVQALSGVQKGQAQTTAVLAQLVPMVQQLSKSVNTPDKPNAADETK
FT                   KKEGAE"
FT   gene            678014..678208
FT                   /locus_tag="LGAS_0691"
FT   CDS_pept        678014..678208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60083"
FT                   /protein_id="ABJ60083.1"
FT                   /translation="MFDFDFSSIYSNLESLCKSSLDNGYFTDNTIAGFVQQGTFDADGY
FT                   KRITGDDYVAGDQNTVANG"
FT   gene            678225..678584
FT                   /locus_tag="LGAS_0692"
FT                   /note="LactoCOG number LaCOG03256"
FT   CDS_pept        678225..678584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0692"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60084"
FT                   /protein_id="ABJ60084.1"
FT                   /translation="MILGSLLTAFGIVLLVNDSFFYWPPEWQWLFNNDLVDAFAIIVGI
FT                   GLIAFVFAGGRSQLANAVLLACSAFFLMMLTVLQLGHVLVMHDYSRLLSIIALIGWLLV
FT                   IQYLAVFSKTVRRRK"
FT   gene            678595..678873
FT                   /locus_tag="LGAS_0693"
FT                   /note="LactoCOG number LaCOG03257"
FT   CDS_pept        678595..678873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0693"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60085"
FT                   /protein_id="ABJ60085.1"
FT                   /translation="MQDWANLIREIALLFSGFVAGLTAWNALRKTSHEVSKDDKEELRA
FT                   DRDLYRNRWLESEKAFDEIDAENDKLRKKVKRLENKIDDFKENEDRK"
FT   gene            678870..679301
FT                   /locus_tag="LGAS_0694"
FT                   /note="LactoCOG number LaCOG03258"
FT   CDS_pept        678870..679301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0694"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60086"
FT                   /protein_id="ABJ60086.1"
FT                   /translation="MSFEQIGDMLVVAVSVVIAIIFYVYSKNKIAIDKKAMQGDALAKA
FT                   EKMIANSANAIVYQTEKEGGSGKDKLLAAFNYLIAILDLAHLPHPSTAYIKGEIEKSVT
FT                   TMKQTKNFVDSMQTLTKEDDAAKQLKSKTIVGELKEVKK"
FT   gene            679311..680243
FT                   /locus_tag="LGAS_0695"
FT                   /note="LactoCOG number LaCOG01653"
FT   CDS_pept        679311..680243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0695"
FT                   /product="Lyzozyme M1 (1,4-beta-N-acetylmuramidase)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60087"
FT                   /protein_id="ABJ60087.1"
FT                   /translation="MVEVAKRSYGVDVSSHNNGNYSGSKFAVVKVSEGLDYRNPKAQSQ
FT                   VSTARANSMLPMAYHYARFSGNSNVAIQEGNYAVTSAKAVGLEAGTYLACDYEQGSGNE
FT                   TRGDRETNTTAILSFLDTIVGAGYKPLLYSGAYLMRDKINTSRILAKYPNCLWVAAYPS
FT                   GNGTAVSEPNFGYFPSMNGVAIWQFTDNWRGLNVDGNISLIDLKNDSKPVAQPSVAQSA
FT                   SEKTWTDVQGMTWHEEHGTFITGGAINLRWGANTQSTLITTLPAGSEVKYNAWARDSAG
FT                   RVWLQQPRENGKNGYLVGRVGSEPWGTFK"
FT   gene            680326..680457
FT                   /locus_tag="LGAS_0696"
FT   CDS_pept        680326..680457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0696"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60088"
FT                   /protein_id="ABJ60088.1"
FT                   /translation="MFSCYNFTYNMLYLTCNKLGILKFNELKKHYLIATKGNAFFIA"
FT   gene            681055..682353
FT                   /locus_tag="LGAS_0697"
FT                   /note="LactoCOG number LaCOG00857"
FT   CDS_pept        681055..682353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0697"
FT                   /product="UDP-N-Acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60089"
FT                   /protein_id="ABJ60089.1"
FT                   /translation="MVIKIAAKDKKLNIMYFTFLIIYKYKLVWLIVPKKIELGYSIRDK
FT                   LKGKEIFMKKIKVMTVFGTRPEAIKMAPLVLKLKQDERFEEITVVSAQHREMLDQVLDI
FT                   FKIKPDYDFNIMHKNQTLEDITSKVLMDMAKVIKTEHPDIVLVHGDTTTSFAAGLATFY
FT                   EQTTLGHVEAGLRTWNKYSPFPEEMNRQMTDDLADLYFAPTELSKKNLIKENHPSDNIY
FT                   VTGNTAIDALEQTVKKDYHHDVLDEIKPGNRAILVTMHRRENQGEPMRRVFKVMKQVVD
FT                   SYDDVEIIYPVHLSPRVQAVAKEVLGGDPRIHLIKPLDVVDFHNLAKRSYFIMTDSGGV
FT                   QEEAPSLGKPVLVLRDTTERPEGVEAGTLKLVGTEVDKVHDEMIRLLEDKKAYDEMANA
FT                   KNPYGDGKASDRIMNAIAYYFDKEHNQKPADFR"
FT   gene            complement(682387..682911)
FT                   /locus_tag="LGAS_0698"
FT                   /note="LactoCOG number LaCOG00411"
FT   CDS_pept        complement(682387..682911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0698"
FT                   /product="Conserved membrane protein, GtcA family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60090"
FT                   /protein_id="ABJ60090.1"
FT                   /translation="MRHLMTKRHHKRKGQKITQEQLRELGGRLVARHRNFYVYVIFCFL
FT                   AAVINIVCFLLFHNVWKIPVIYANTIAFIISNLASFSFNKHSVFIQNVDKQHGVVYQLC
FT                   LFFIYRIISLIPDNLIMLVGISWLHWNALFVKIVDQILVGIFNYLTTKSIFLNTSSKFA
FT                   KRFKDHFNKKY"
FT   gene            complement(682892..683338)
FT                   /locus_tag="LGAS_0699"
FT                   /note="LactoCOG number LaCOG00407"
FT   CDS_pept        complement(682892..683338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0699"
FT                   /product="Flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60091"
FT                   /protein_id="ABJ60091.1"
FT                   /translation="MKAQIVFASMTGNDEDMAEILEENLQDAGFDVKNIDVSFADATSY
FT                   LDADLCVMVTYTYGEGVMTDELKDFYDQLITLDLSGKKFAVMGSGDKTYKDHYCENVDD
FT                   FEKAFIKCGAVEVAKPVKIENAVDDEDIDLIDQATEEIVEAFND"
FT   gene            683523..684347
FT                   /locus_tag="LGAS_0700"
FT                   /note="LactoCOG number LaCOG00409"
FT   CDS_pept        683523..684347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0700"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60092"
FT                   /protein_id="ABJ60092.1"
FT                   /translation="MITIKSKRELQGMQKSGRVLAAMFEGLRDVIKPGISTWEIEEFAQ
FT                   DFMKKHGGRLSEQGFEGYKYGTCISVNDEIAHAIPRKDKILKEGDLVSVDVTCNVDGYE
FT                   TDSCTTYGVGEISAEDQKLMDVTKKAMYMGIDQAVVGNRIGDIGSVIQNYVENENGYGD
FT                   VRELVGHGIQPSIHEDPEVPHWGKAGHGLRLREGMTITVEPMVEAGGDWRIEQKTVSDP
FT                   NDDWVYYATPDGSKAAQFEHTFAITPDGPKILTLQKPYDGYEKYLPHFLDED"
FT   gene            684363..685286
FT                   /locus_tag="LGAS_0701"
FT                   /note="LactoCOG number LaCOG00410"
FT   CDS_pept        684363..685286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0701"
FT                   /product="Ribonuclease BN-like family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60093"
FT                   /protein_id="ABJ60093.1"
FT                   /translation="MKSFLNQTKNRITEFFQLLSKYISQGEINQTSIIIAYYVLLSIFP
FT                   IIIIIGNVLPLFSIDTKPIARYLELIFPSQVSSLIMPIINALLKKHSSGFISLGIVIAI
FT                   WSLSCLVNSVRLAANKIYGVDKKEKGKSWWNYLLARTFTFALSVILVAGFSIIIFVFTF
FT                   GRQIMEFLAPIFNLSLWWVYKLENYRWPIIILMTVIINLYINYVIPNISVQKRVVWPGV
FT                   CFTVASWGALSYFFGLYLRQFGTRWQNYGIVGSFIIFMLWLNIGSFLLLLGICINATGD
FT                   ELKDRKIEYSRSPILRIFRKNKKLPK"
FT   gene            685345..686253
FT                   /locus_tag="LGAS_0702"
FT                   /note="LactoCOG number LaCOG00906"
FT   CDS_pept        685345..686253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0702"
FT                   /product="UDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.9"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60094"
FT                   /protein_id="ABJ60094.1"
FT                   /translation="MKVRKAVIPAAGLGTRFLPATKAMPKEMVPIVDKPTIQFIVEEAK
FT                   KSGIEDILIVTGKNKRSIEDHFDANPELEQDLEEKGKTELLHLTQSITNLGVNLYYTRQ
FT                   PHPAGLGDAILRARSFVGDEPFAVMLGDDLMDDKVPLTKQLIDRYDKTHASTIAVMPVP
FT                   HEEVSKYGVIDPDNEIEPGLINVKAFVEKPDVDKAPSDYAIIGRYLLTPEIFDILAHQK
FT                   PGRGGEIQLTDAIDTMNKTQRVFAHVFNGERHDVGNKEGYLETSIEYGLSHPQIKDDLR
FT                   KYIIAMGQKLQNEDKKTNKKK"
FT   gene            686373..687206
FT                   /locus_tag="LGAS_0703"
FT                   /note="LactoCOG number LaCOG03246"
FT   CDS_pept        686373..687206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0703"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60095"
FT                   /protein_id="ABJ60095.1"
FT                   /translation="MRKNENELVAKIIDDPVFSWVMEQDDNCCKLLQAILPELNITRVE
FT                   FETQKRLKFHPEKRGTILDILAYDQKGRVYDIELQVLQNKFLAQRIRYYFSMIDQNLLM
FT                   SGGKYRDLPETYVIFILPNDPYDQDEKYYEFAFQQLKRKNPLVLDTKQHAIILNASGSI
FT                   GEVTPRLQGFFDLIHDKISTKDEFIEKLNREVKKFGTDPGRRKELMDYQMRLDDEREFG
FT                   KELGREQEEINAIQKLIKITRQLKASDDFILKQLIANYGDDFSKEELQEFIKKNK"
FT   gene            687330..688292
FT                   /locus_tag="LGAS_0704"
FT                   /note="LactoCOG number LaCOG00587"
FT   CDS_pept        687330..688292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0704"
FT                   /product="ABC-type proline/glycine betaine transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60096"
FT                   /protein_id="ABJ60096.1"
FT                   /translation="MMIEYKNISKKYQDQTILKDVSFTVKKGDIFVLVGPSGSGKTTLL
FT                   KMFNRLIEPTKGEILLDDKSIKEYDLRKLREKTGYVLQTASLFPNLTVGENITIVLEQE
FT                   GVSRTERRKRQKELLKSVDLDPKLYCDRMPNELSGGEQQRVGIIRALAANPEVVLMDEP
FT                   FSALDPVVRKQLQDLLLNLHDELNKTVIFVTHDMQEAIRLGNTIGVLHEGILEQVGKPR
FT                   EILRHPATKFVREFFAGNRINQKLDLETLLKSELGVDPRFYPKVDTLVRYHVYSVQDLI
FT                   KDCSNYPDSLFIAETEFGEFLIEPKRVWNFFLKWVAGND"
FT   gene            688285..689835
FT                   /locus_tag="LGAS_0705"
FT                   /note="LactoCOG number LaCOG00588"
FT   CDS_pept        688285..689835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0705"
FT                   /product="ABC-type proline/glycine betaine transport
FT                   system, permease and substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60097"
FT                   /protein_id="ABJ60097.1"
FT                   /translation="MIKSLWQMLLTEHDQIWATTLVHIKISLIALLIAMVIAIPLAFIL
FT                   KGHKKVAEFTLQIAGIIQTIPSLAILGLLLPFVGIGTTPAIIALVLYAIMPIFQNTYSG
FT                   LTDIPDNLEEAATAFGLTKWKKLQRLEIPMAMPMIFAGVRIALVMIIGTATLAALIGGG
FT                   GLGTYIYVGINSNNNTEVLMGAILSALLALVFSGVLKFIAKNNKRLKWGSIIIAVILLI
FT                   WGGSSLYTHFTSTSKNNIAEPKQTITIAGKMGSEPAILINMYKDLIEKNDPNTKVVLKP
FT                   NFGGTTFLFKALQTDKVDIYPEFTGTVLQTLVKTGKKTGNDPNQVYVEARSDLKKQFDM
FT                   EYLKPMAYQNGYALATTQKFAKDNHLTKMSDLNRVNKKVHAAFDPDFTSLKDGYPGLKK
FT                   IYKLDFASIKSTESSIRYHAIANNQANIVDGYTTDAEIKKYNLVMLDDDKKFFPPYQGA
FT                   PLMKAKFAERNPQIVKALNKLAGKITTQEMQEMNYQVNVKHEKPAKVAHDYLVKHGLI"
FT   gene            689849..690259
FT                   /locus_tag="LGAS_0706"
FT                   /note="LactoCOG number LaCOG03260"
FT   CDS_pept        689849..690259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0706"
FT                   /product="Predicted redox protein, regulator of disulfide
FT                   bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60098"
FT                   /protein_id="ABJ60098.1"
FT                   /translation="MTKYTVKSKLTDTPWQIENRTKKHKFMADESASGKNVAPNPVEYL
FT                   AGAVNSCISISAGMIANVHHLDVKNFKVTTQAITTKLGHGKSVVSEMLITVSFDSSMSQ
FT                   EEKQDFLAHTLHVSTVYQTVSQSVKTYVELED"
FT   gene            690360..690533
FT                   /locus_tag="LGAS_0707"
FT                   /note="LactoCOG number LaCOG02345"
FT   CDS_pept        690360..690533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0707"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60099"
FT                   /protein_id="ABJ60099.1"
FT                   /translation="MKKIIAKLVGMFELFYDLVFVYAISSITAMIHHPVNGSIPLITFL
FT                   QFLLVVIVVMQI"
FT   gene            complement(690985..691080)
FT                   /locus_tag="LGAS_0708"
FT   CDS_pept        complement(690985..691080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0708"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60100"
FT                   /protein_id="ABJ60100.1"
FT                   /translation="MLFIRKIKKNAKFQINKQIAIPNSDLITNHK"
FT   gene            691164..691775
FT                   /locus_tag="LGAS_0709"
FT                   /note="LactoCOG number LaCOG00607"
FT   CDS_pept        691164..691775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0709"
FT                   /product="RelA / SpoT (ppGpp synthetase/hydrolase)
FT                   catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60101"
FT                   /protein_id="ABJ60101.1"
FT                   /translation="MDIYGGYTPVLNKLLNQMLEYFRKENKIHQEQTGDSLYEHLIGRV
FT                   KRPESMIEKCQRKELPVTPESAMKKIRDSVGIRVVCNFIDDIYTCINLIQNWDDVAIVK
FT                   QKDYITNAKPNGYRSYHMILDVERPEKDIEGNIPGHYYVEVQLRTIAMDTWASLEHEMK
FT                   YKHKIKNPEMIGKELKRVADELASCDVSMQTLRHLIREED"
FT   gene            691780..692445
FT                   /locus_tag="LGAS_0710"
FT                   /note="LactoCOG number LaCOG02180"
FT   CDS_pept        691780..692445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0710"
FT                   /product="DNA-binding response regulator, OmpR family
FT                   (Rec-wHTH domains)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60102"
FT                   /protein_id="ABJ60102.1"
FT                   /translation="MKILLAEDEEQLSRVLVAAMQSVNYDVDAVFNGRDAVELAKKNSY
FT                   DVIILDIMMPIMDGITALKQIRKSGDKTYVLMLTAKAEIDDRVTGLDSGADDYLTKPFS
FT                   LKELLARLRSKERRDDQYTPNEVEVGDLALNVSEQELVSHNSIRLGSKETQLLNYLMLN
FT                   EGKEFSTSDLLAHVWKDEDDANEEVVWIYISYLRQKLQSIQSSVQIVGEKGGSFSLIR"
FT   gene            692446..693729
FT                   /locus_tag="LGAS_0711"
FT                   /note="LactoCOG number LaCOG02179"
FT   CDS_pept        692446..693729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0711"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60103"
FT                   /protein_id="ABJ60103.1"
FT                   /translation="MRLMIQKFRWKFIGMSITALFIVLVITLGTLLGISYTQSHNEVDR
FT                   VLTTLVNNQGQLTPRNAKPVFGNQKDPINKNFLAGEYNPEAIFQYRYFTVASTKNNTPK
FT                   IINDDNVYDVARKQIIGTSKQVFKDKVTSGSVNIGSNQYAYRVGKDSKGNQFIVYLNES
FT                   LIYHRFSLLFRVSILLGLIALIVFALILILVSKKAIGPIITTYHKQREFITNAGHELKT
FT                   PLAIISANTEMEEMLGNNSEWNKSTKEQVDRLTRLINRLIALARTGETGEVVLNKVNFS
FT                   EIVKKNVTSFKSVMQKNDLKYNAMIMPDLYVKAERNILSELTNILLDNARKYCDRDGEV
FT                   RVSLTKGKLGTNAILRVANTYKEGKGKDYSHFFERFYREDESHNSKKSGFGIGLAMAQE
FT                   IVQTFHGKIHVSHKDDMIVFTVILKLAK"
FT   gene            complement(693788..696172)
FT                   /locus_tag="LGAS_0712"
FT                   /note="LactoCOG number LaCOG01371"
FT   CDS_pept        complement(693788..696172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0712"
FT                   /product="dipeptidyl-peptidase IV, Serine peptidase, MEROPS
FT                   family S15"
FT                   /EC_number="3.4.14.11"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60104"
FT                   /protein_id="ABJ60104.1"
FT                   /translation="MKYNQYGYLQTDFDQMVKELESINFLPGNWKENSFSDLLATLVEN
FT                   SIAEAKTYGAKEAKLAEFAVSANENLKDFLAKNPASISRNSFYNIALQLLGYHVGYDYD
FT                   LKDPLVRMKANALPYTDQEKIDRDELIKVFYRLLNTRTKNGQTFIDNMAGKGYFTQFYG
FT                   NNKFMYFNGKSLPVFDMSKVIREVVYVESDLDTDEDGKPDLLQVTVFRPYQSNNFKFPA
FT                   LYTADPYFGGIIANEKRNHNVDVNLEDATKSTYPKYEAMPTAKAKKPASEDQAATEEAV
FT                   HKAAYSLNEYLLARGFANVYAGAIGTRGSDGLRITGAPEETESAKEIIEWLHGDRIAYT
FT                   DRTRKHETKASWCNGNIGMTGRSYLGTLQIAIATTGVAGLKTVVSEAAISSWYDYYREH
FT                   GLVIAPEACQGEDLDMLAETCQSNLWDAGDYLKIKPKFDAMQKRLLEKSDRETGQYSDF
FT                   WEARNYRHHTDNIKCSWISVHGLNDWNVKPKNVYKVWQKVSKLPIAHKLFLHQGPHYNM
FT                   NNLLSIDFSDLMNLWFCHELLGIKNNAYKQWEDVMIQDNLQPDVWHEEPTWNNELGRKE
FT                   IYFPDKKGNLLKDGGEDNDKLSFTDQGGKVFKEAKISESKWQYDFISGEEKWLDQQLRF
FT                   VTDEFIHTVTLVGRPKIKISVASSLPKGQISVALVDLGSRKRLTPVPKSFNDQIQELGY
FT                   RFGTEVMKEFVPDKETKAKLITKAHMNVQNYADMKHAEKIEAGKFYDLEFELQPTFYRL
FT                   PAGARLGLIIYSTDQGMTKRPLEDETYTIDLDKTQLTFHEM"
FT   gene            complement(696297..696710)
FT                   /locus_tag="LGAS_0713"
FT   CDS_pept        complement(696297..696710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0713"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60105"
FT                   /protein_id="ABJ60105.1"
FT                   /translation="MLREKYVNSKYRVKSLKQYLDRNYYKAMVKEIELKRNSGTVDETV
FT                   IDSMIFEEVTHLDKSLLLAKLTVLGKDKEIQFNQDFDTSFSRNKWTDYVLFGLEDNRNP
FT                   KIINLVYGEHFHLNGEDFNDYQSGNDYTENKIN"
FT   gene            complement(696726..697220)
FT                   /locus_tag="LGAS_0714"
FT   CDS_pept        complement(696726..697220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0714"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60106"
FT                   /protein_id="ABJ60106.1"
FT                   /translation="MGDFMKKKVKIIILVCLLFLGISVTTTNPHFSQPAFASMGSTGGG
FT                   HSTGGSSGGGGTSYTSSDSSDGSNSSIGGILGGCAILVFIFFGSYIIAALYDFIFKIRL
FT                   RFEYHSNYLIKNSGDNNYKLFYPNQRLDKYQKLLHRLNIKFIKPNPKDDFTAYKEVYIH
FT                   A"
FT   gene            697403..699937
FT                   /locus_tag="LGAS_0715"
FT                   /note="LactoCOG number LaCOG00215"
FT   CDS_pept        697403..699937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0715"
FT                   /product="lysyl aminopeptidase, Metallo peptidase, MEROPS
FT                   family M01"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60107"
FT                   /protein_id="ABJ60107.1"
FT                   /translation="MAEVKRFYETFHPDHYDIYLDISREKKSFHGKTIVVGDAQEELVK
FT                   LNQKYLKITSVRVDQKKADFDYNDKEEVVNIKAGKVGEMKIEVDFEGKLTDSMMGIYPS
FT                   YYEVDGEKKQLVGTQFETTFARQAFPCVDEPEAKATFALAIKFDEKPGETIISNQPEEK
FT                   FKDGVHYFKPTLRMSSYLVAFVFGDMQKKLTKTKSGVEIGVFATKAHKAKELDFALDIA
FT                   KRSIEFYEDFYETPYPLEHSYQVALPDFSAGAMENWGCVTYREAYLLLDPDNTSLDMKQ
FT                   LVATVIAHELAHQWFGDLVTMKWWDNLWLNESFANMMEYVAVDALEPNWKIWEMFQTSE
FT                   VPAALQRDATDGVQSVHVMVNDPAEIDALFDSAIVYAKGSRMLVMVRALLGDKALREGL
FT                   KNYFAAHQYSNATGDDLWKALGEASGLDIGAIMHSWLEQPGYPVVNAKVEDGKLVLTQK
FT                   QFFIGEGKDVGRKWQIPLNANYAAVPKIMKDEKLVVGDYKDLLANNGTPFRLNVGNNSD
FT                   FIVKYDQTLLDDILSHVDELDAVDKLQLLQDFRLLAEGGQMSYADIVPLLPKFADSTSP
FT                   IVNNALYRIMATLRNFVTPGSDEEKQLKRLYDLLSERQVKRLGLIPKAGESNDDNLTRP
FT                   YVVSASLYAENDDTINGLHAIYSENSDNLEGISADIRSAVLANEVKNFGNMTLFDKLIK
FT                   KYQETSDASLKQDLCAGITSTKMPEIIDAIVDDFENAQVVKPQDLRAWYRNVLANPFGQ
FT                   EQAWNWIRLEWPWLEATVGGDMEFATFITVTANIFHTEERLNQFKDFFEPKINTPGLTR
FT                   EIKMDTKVIETKVNLVKKEQAAVNAAIAKAVD"
FT   gene            700026..700796
FT                   /locus_tag="LGAS_0716"
FT                   /note="LactoCOG number LaCOG02083"
FT   CDS_pept        700026..700796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0716"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60108"
FT                   /protein_id="ABJ60108.1"
FT                   /translation="MIKTIFFDVDGTLVSHKTDSVPKSTREALELLRKNGIKLVLATGR
FT                   DMSQLKKLPVKDIKFDGYLTMNGQLCLDENDNELFGNPINEQDTKKLVKLIKEKTVPIT
FT                   TIGKEGPYINFVTDQVVAAQKAVSSKVAPVGKYHGENVYQFITYGNRDDLRKLVDDLPN
FT                   CKLSWWNEYAVDIISKDGGKLAGVEKYLKLQGQTLADAMAFGDGENDLEMLKAVQTGVA
FT                   MGNGEEQVKQIADYVTSDINEDGIYNACKHYKLI"
FT   gene            700839..701537
FT                   /locus_tag="LGAS_0717"
FT                   /note="LactoCOG number LaCOG01370"
FT   CDS_pept        700839..701537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0717"
FT                   /product="Predicted metal-dependent membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60109"
FT                   /protein_id="ABJ60109.1"
FT                   /translation="MMKIIKCVFKWIGIAICLFLIFAFMQVPILESTPVYSIDSQQQFI
FT                   EAFKHVNMFHNIFMIIIFTIITFIMEWYVCKWLNNKLDFSKKLSRKNLILSLGAGVFCF
FT                   ILQLLTMFSVFVNAKPDVFTETLKTGLAVPLILSLAVIGPTLEELLFQAGIQKGIFKRL
FT                   NPWIAIILTAIIFAGAHNVTLNWSFLNRFLSGVAFGYVYQKTDDIKMAILSHSISNLLP
FT                   LIICCMQAWS"
FT   gene            701626..701699
FT                   /locus_tag="LGAS_t0718"
FT                   /note="tRNA_Arg_TCT"
FT   tRNA            701626..701699
FT                   /locus_tag="LGAS_t0718"
FT                   /product="tRNA-Arg"
FT   gene            701919..703757
FT                   /locus_tag="LGAS_0719"
FT                   /note="LactoCOG number LaCOG00701"
FT   CDS_pept        701919..703757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0719"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="2.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60110"
FT                   /protein_id="ABJ60110.1"
FT                   /translation="MNYTKGEKCMCGIVGVVGKPARDIILNGLTNLEYRGYDSAGMYLN
FT                   DLNGNEYLTKAVGRISNLKEKLTPDEQGLVGIGHTRWATHGKPTVDNAHPHFDETKRFY
FT                   LVHNGVIENYVELKEKYLQGVKFHSNTDTEVVVQLIGKIAREKNLDGFSAFKEALKLVK
FT                   GSYAFLLVDNTEPDHVFIAKNKSPMMLGLGDGFNIIASDAISVLDQTKTFVDLQDGDVG
FT                   DITKDSYTIETVDGKKVERKPHVLDIDPNAASKGTYEFYMLKEIDEQPSVMRKISQTYF
FT                   DENGDVKVEPQIIDALSKADRIYIYAAGTSYHAGLVGKTLLEHYTGIPTEVGLASEAGY
FT                   HFPMMSKKPFFIFLTQSGETADSRVVLKEVNKRNIPSLTITNVEGSTLSREADYTMLLE
FT                   AGPEIAVASTKAYTAQIAVQAVLAKALGEALNNQDAKDWNLKHDLAIAAEGMQQLVDSK
FT                   ESLKEIADKYLIKSRNAFYIGRGIDYAVALEGALKLKEVSYIQTEGFAAAELKHGTISL
FT                   IEKGTPVIALINDPATADLTRGNIQEVVSRGANIITIVGKDFAKEGDDIVLPEINYYMS
FT                   ALLTVVPAQLLAYYASKDKGLDVDKPRNLAKSVTVE"
FT   gene            703884..704315
FT                   /locus_tag="LGAS_0720"
FT                   /note="LactoCOG number LaCOG03261"
FT   CDS_pept        703884..704315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60111"
FT                   /protein_id="ABJ60111.1"
FT                   /translation="MRIIMLSKISILLTNHQLTLKDISQNQHLAEQDLKKELNENPDNW
FT                   SSSVLSALSSSLNMRPGDLLELLDPVYSLKINDHHQMIQGIYIEDPEVYEQIRFVVESE
FT                   HLEGWQPDEEDILRLLDEAINPSPKFQTEISRIWGEKDE"
FT   gene            704299..704898
FT                   /locus_tag="LGAS_0721"
FT                   /note="LactoCOG number LaCOG02053"
FT   CDS_pept        704299..704898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0721"
FT                   /product="Cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60112"
FT                   /protein_id="ABJ60112.1"
FT                   /translation="MRKMSEEPKDTEWYRRKFLYPNGTLKNKLNIKDAAELAQKEYLGS
FT                   AVRALAFLRKNKKITSVEDLKKIHKIMFGWLYDWAGQIRDYELIKGDTEFLEYTRIKFG
FT                   IEEIDEKMRQLASRKEIANTDYAFLLDRLNYLHPFREGNGRSSKLFLQAFAANHGQVID
FT                   YPRSNKELIIAQNNADINQIAKLIKIKPKAKKMNAR"
FT   gene            complement(704942..706072)
FT                   /locus_tag="LGAS_0722"
FT                   /note="LactoCOG number LaCOG01834"
FT   CDS_pept        complement(704942..706072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0722"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60113"
FT                   /protein_id="ABJ60113.1"
FT                   /translation="MKKYQFLSFKTADIGDYLKVFACTAVMSQPIMSLVMDIRQPAHTQ
FT                   DIFGLLYNLVKYTAPAFIFGILYTTTRTYDLENHFLYNKYLRNNWSNLFVPTIWWTLIY
FT                   LLGMPWEQQVNKYYNFPTFCWQFINGNAAPHLWYNTMMLQFIILMPLFWAISRYVGTNI
FT                   KRGIIIAIVTFILYFTWLWFYDTYVFHGIHQNDWYLLDRAFISFFIYGVYGVLAWQLRD
FT                   YVNAFFTKFWWLLSIIFIICFIWTNLELQSFGHPINFNNAPYYKPSMTLYSLAVIALIA
FT                   AFCLHQVKKNSQTSLKIFHFLAIYAYRAYLSNVFWNQLVWRGLNMSFHAHYHPFLTFFG
FT                   TWIFTWCLSFASAYLLHLCWTWFKENKLVKISFLFN"
FT   gene            706362..707027
FT                   /locus_tag="LGAS_0723"
FT                   /note="LactoCOG number LaCOG01538"
FT   CDS_pept        706362..707027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0723"
FT                   /product="p-nitrobenzoate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60114"
FT                   /protein_id="ABJ60114.1"
FT                   /translation="MMNVEEAILTRHAVRLFNPDDKISKGSLEKIVELAQHAPSWVDSQ
FT                   PWKVYIATGNTLAAIKKRHAENVKNGVKANPDWPTTHREDWAKFPRENMLKHNEATAHF
FT                   WENPELSDMTRQDLQTRLYDAPAICYLTIPKDSNQWSDYDLGAFGQTLMLAARGMGIDS
FT                   MPAYEIVKFPESVKQIMNIPDSEWLAMGIALGYADMATRVNEYRAPRVPLDEMLKIKD"
FT   gene            complement(707069..707629)
FT                   /locus_tag="LGAS_0724"
FT                   /note="LactoCOG number LaCOG00635"
FT   CDS_pept        complement(707069..707629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0724"
FT                   /product="Uncharacterized conserved secreted or membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60115"
FT                   /protein_id="ABJ60115.1"
FT                   /translation="MIIVILILAAILFIYFNVIPGKGHTLVSWISLIITLLCVLGIVAH
FT                   DYNHWGMKTETQTKTQHLVSSASPNLPLLLYQPLGNGTEKVYLYKTNNNQKKPRAIKLD
FT                   KVSTKINHGKQPSLKIRTTRYVYKDNFSRMMFNIFNHNNELKHREYTFTLPSNWKIIST
FT                   KDMQKLQKQMQEKMHAQKAASLH"
FT   gene            complement(707629..709101)
FT                   /locus_tag="LGAS_0725"
FT                   /note="LactoCOG number LaCOG00634"
FT   CDS_pept        complement(707629..709101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0725"
FT                   /product="Permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60116"
FT                   /protein_id="ABJ60116.1"
FT                   /translation="MDQQPTDIHGKAYNRNLLVLVLIIGSFCTVLNGTLLATALPSIMR
FT                   SFHISTATAEWLSTAFLLVNGVMIPVSAWLINRFGSRKMYLTAMSVFFIGTVTAALAPN
FT                   FGTLLTGRIIQGLGVGVTMPLLQTIMLSIFPANKRGAAMGTVGIVIGLAPAIGPTLSGW
FT                   IVDNLSWRYLFSIIAPIAGIVIILAFFLIKDVLPTKKEKIDVWSVTTSTVGFGSLLYGF
FT                   SEAGNKGWTNPEILGFIGVGIVFVILFGIRQLKMADPFLDITVFKHFEFSLAAALSGIT
FT                   NLAMVGIEMVLPLYIQNLRGVSAFHSGLILLPGALMIGIMSPITGRLFDKYGARKMAIT
FT                   GMTLLTLGTIPFVFLTAESSYTMIIVLYAIRMVGVALVMMNVTTSGMNSLPLNKIAHGT
FT                   AVNNTFRQVLSSIGTAILVSILTTTTNNNMPNKDLLHTLPLQYKNQAINATLDGFRASF
FT                   AMSILFALVALVLAFFLKKGNRARENQEEVNG"
FT   gene            709086..709205
FT                   /locus_tag="LGAS_0726"
FT   CDS_pept        709086..709205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0726"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60117"
FT                   /protein_id="ABJ60117.1"
FT                   /translation="MVVDPFELSFLLLKNLTNYKNYMLKSKHCQIFLHKSNRI"
FT   gene            709275..709712
FT                   /locus_tag="LGAS_0727"
FT                   /note="LactoCOG number LaCOG01710"
FT   CDS_pept        709275..709712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0727"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60118"
FT                   /protein_id="ABJ60118.1"
FT                   /translation="MESKKILHNVFQNIEVGIGEVSKVVGVSQRQLRYWEKKGYIEPIS
FT                   DDNSGVRRYNLSTLYLIVFIKEQLDNGFTLAAAFERSKDIKLKSKIVRTFFEHTFSDVE
FT                   ITDAEKGYGEIDLGDFRTEDGEKYHFKGVLDAHGRYVKIDK"
FT   gene            complement(709796..711571)
FT                   /locus_tag="LGAS_0728"
FT                   /note="LactoCOG number LaCOG00248"
FT   CDS_pept        complement(709796..711571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0728"
FT                   /product="ABC-type oligopeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60119"
FT                   /protein_id="ABJ60119.1"
FT                   /translation="MTKGEFYMKMSKSKLLYVTLASSLAILSTACGAKKTDSSNQPIKF
FT                   SQAVPHKPIKKGGTLTYALENESPFTGIFSAEIADTSPDSEAAAPGDEALFDINDHYQF
FT                   TNKGAASLKLNHSNNTAEIKVKKKVRWSDGKPVTAKDLEYAYEILANPKVQTTQYTSSL
FT                   ENIKGMAEYHRGKANNISGLEMPDGPNGKTLILHFKELKPAMMNSANGFFWEHAAPYHY
FT                   LKSVPFEKLVSSPQIRKHPLYFGPYKMDKTVQGQSTSWSRNPYYWRGKPNFEHIYMSNI
FT                   TNSNVSQAIKSKKFDVANVLSSQWEQVKNTKGVNFVGKKTLSYDYLAFKVGKWDAKLGK
FT                   NVENPHAKMNNPALRKAMAYAMNVDVINKRFYHGLEFRINSLIPSQFTPYYDKNIPVYS
FT                   YNLDKANKLLDKAGYKKAPGALYRSQPNGKPLVINLAVRGSGENSEAIWRNYIQQWKKA
FT                   GLNVKFLGGRPMEFNRWVAAVKASDPKIDVLEGAWGAAGDPSPSVFYGEKMPYNFARFV
FT                   SPTNTKLLNEIDSAKSFDKKYRVQKFHEWQKWMYNKAYVVPTSGAYSVTAVNSKVSGWS
FT                   LKPSANVWYEAGFTK"
FT   misc_binding    complement(711596..711845)
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="T-box leader, riboswitch"
FT   gene            712206..712601
FT                   /locus_tag="LGAS_0729"
FT                   /note="LactoCOG number LaCOG02211"
FT   CDS_pept        712206..712601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0729"
FT                   /product="Pyridoxine 5'-phosphate oxidase V related
FT                   favin-nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60120"
FT                   /protein_id="ABJ60120.1"
FT                   /translation="MISDRKELYTMKKLDTNKLTDKQADLFKNNLVYIATVDENGNPQV
FT                   GPKGSMTVLDPSHMQYLEKTKGAAYENIKRGSKVALVAADVPSHTAVQVLATAHVHEDD
FT                   EYAKKVVSGTDTPNAFVVVLDIDEIFE"
FT   gene            712767..714089
FT                   /locus_tag="LGAS_0730"
FT                   /note="LactoCOG number LaCOG02080"
FT   CDS_pept        712767..714089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0730"
FT                   /product="Cysteine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60121"
FT                   /protein_id="ABJ60121.1"
FT                   /translation="MKMGALSEQELAAFSADFNKNDKNKVASRAARRNGLFEASFNDEV
FT                   SKRLNHTFSTELDIGGVTDQKHSGRCWEFATLNVLRHHFGKKYHVKDFTFSQAYNFFWD
FT                   KIERANAFYDSMIRLADKPVDDREVETWLYFAGQDGGLWQMAINLVKKYGVVPSYAMPE
FT                   NATSNNTTALIDSLARKERKDALVLRKLVQEGKLEEAEKAKKEFLNEVYRMAAVALGEP
FT                   PKKFDLEYRDDDKKYHLEKDLTPRQFAEKYLKDFNWDDYVVLLNSPNYDYNKRYHQGLY
FT                   DNVAGGQPITGLNVPIEVLARAAAAQLKDGKAVIFGNDVLKQMERKTGFLDTDLYKTDD
FT                   LFSVDTQMSKADRLATGEGSATHDMTLVGVDEDNGEIRKWKVENSWGDKYGHKGFYEMS
FT                   QKWFEEYVYDVVVDKKYLPEDLVKLWEEPAVDLKPWEHIGL"
FT   gene            714224..715132
FT                   /locus_tag="LGAS_0731"
FT                   /note="LactoCOG number LaCOG00969"
FT   CDS_pept        714224..715132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0731"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60122"
FT                   /protein_id="ABJ60122.1"
FT                   /translation="MMKKNYLSIDIGGTNVKYAELNNAGNIIEQGKIKTSHDKEQFLKN
FT                   IDRIVAKYVKKGIKGIAFCAPGKIAHTKIHFGGALPFLDGIDFAVRYKKYDIPVTVIND
FT                   GKASVLAENWLGSLKDMRNCAAITLGTGVGGGIIVNGKLLNGAHFQAGELSFLQLNMKE
FT                   PGFDGFAGGYASAVQMIKNVNEAIENDDETDGLAAFEAINNGNEKAKKIFDEYCKRIAA
FT                   IIIDIQAVVDLDAIAIGGGISAQPIVIQGINQAYDQVLADNELIRKTFTRPKIVEAKFK
FT                   NGANLYGALYNLFIHVNGEKL"
FT   gene            715132..716010
FT                   /locus_tag="LGAS_0732"
FT                   /note="LactoCOG number LaCOG00348"
FT   CDS_pept        715132..716010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0732"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60123"
FT                   /protein_id="ABJ60123.1"
FT                   /translation="MTYGKKIKQHEIVIPTDPLPVWYFVFHDHNSEKYIAPHWHRGIEL
FT                   SYVENGRIDDFLINKKHYSSQSGTILVVNTQEIHSIHDFRNTDSLALSIIFPYDYIANL
FT                   YPDIAHQVIKINDPTMFSNKQKLAYLHLQGLLSQFIKVYFLKIPTKHLEQQRLIDEILC
FT                   LLLANFTEDKKDQEQVSERKVYIINRLQYITQYVNNHYQEELNLAFLAEKCNISKEYLA
FT                   RFFKKEMELTVETYINNVRAEHAYGELKKSKKNLTQIAISCGFSSIRTMNRAFKKLYGK
FT                   SASEMKKKLTK"
FT   gene            716039..717004
FT                   /locus_tag="LGAS_0733"
FT                   /note="LactoCOG number LaCOG02296"
FT   CDS_pept        716039..717004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0733"
FT                   /product="Esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60124"
FT                   /protein_id="ABJ60124.1"
FT                   /translation="MAYFLDPFLVIMKANSMREGNIMKEQKILNAVKEMRISWKENDDK
FT                   RDSGLPHDIPEVTRVDDLQYGEDPKWNLLDLYLPKNVKGKIPVIINIHGGGWVYGTKET
FT                   YQFYGLGMAKRGFAFVNPNYKLGPEVKFPKELDQVNEYIHWVADHADEYNLDKNNVFLI
FT                   GDSAGGQMAEQYTAILTNPKYREKFGYTLTDLKFRAVALNSPATFIKDPGMIGNGTLAY
FT                   FDPEVMKSAKNQDLIDVEKYITEDFLPTFISTANEDFIHDCAVRLDGFLRAKGIEVIQK
FT                   SWGDEKHPEPHVFLINQKDELAKEANDEEAEFFRKHLVKD"
FT   gene            717010..718215
FT                   /locus_tag="LGAS_0734"
FT                   /note="LactoCOG number LaCOG01608"
FT   CDS_pept        717010..718215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0734"
FT                   /product="Permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60125"
FT                   /protein_id="ABJ60125.1"
FT                   /translation="MKWEENKMNEKNPQDHVIFKISLLSISIFLMMAPAIAPALPLMYH
FT                   AFPGIDKAGVEMLSTIPNIGIVIGLLISPFLIKLMGEKPTTITGLVITLLAGTFPMYAT
FT                   AYTPILISRFLIGAGIGLFNSLAVSLIPQFYSSNEEKLATMVGYQNVMGSLGAALASFL
FT                   ISWLLTISWHAAFAIYFLVIPVLILFILFVPLPSSRQKKADKAKKAKEKQTINGKVILI
FT                   SVLMFFIFLFYMPMSFKIPALVVQEKLGTVSEVSALTGVLNLVGIPVGASFGFFFKKLH
FT                   DKIFPLGFALVAIGFFIIALAGNFIMLSIGCLILGIGFGLGVPYMYNWLDWSAPANSVN
FT                   LATTIVLVLVNVGCAISPMIINAVTPSAKMGLLISAIFFACFLVYAIIHYLRVHKKQSA
FT                   TA"
FT   gene            718319..720115
FT                   /locus_tag="LGAS_0735"
FT                   /note="LactoCOG number LaCOG01959"
FT   CDS_pept        718319..720115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0735"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60126"
FT                   /protein_id="ABJ60126.1"
FT                   /translation="MKKFFHLIIGMIMLVTLTIIFTKPASADVDYDITNVDVTAHVNIN
FT                   GSLLMERRITYKFDDDAHGVFYQQNLTNNQELKNQQVRIISGKNSQPVVQSDSHANNTY
FT                   ELSHSDHGYRFKVWHNVTDGDKFTVIYTYEITNAIINWKDTAELNFKIIGDGWDTDLDN
FT                   VRVGIFFPGPVKDLKAWAHGDLSGQITVNPEKGNIIMTAANVSGNEGIEVHSLFPTAVT
FT                   SQNKNIRDQNHKKYVLNQEAKFAREANERRQRSRIFGLGALALSGLFSLFIIIKSFTLK
FT                   KSGVKPKKEKQLPRNYDLPRVSPVMAEILDIDNKPSSRSLTAYLMELAVQKRIEIDPVK
FT                   VRRKTYYKISLTDKDLKDEVPLIRYLFNKVGDGKSFTTYELKKHRSSKLSKIFASWQKQ
FT                   KKQEAVSAGFLDKQIESKKDTNLVLMIILLVLSGAGIIAAFFSSEGAAGLFIAAVILIG
FT                   VAILATIYSNKKLSPYTDKGAEATNQVRGFKKMLDEIGNFKMREVGELPLWEKIMPYAV
FT                   ALGVSKKVLKQLKIEFADEIDDANILFWGPFYSSGQDGFASNFNSSFNSGANLNSSASG
FT                   GSGGFSGGSSGGFGGGSGGGAF"
FT   gene            720226..720558
FT                   /locus_tag="LGAS_0736"
FT                   /note="LactoCOG number LaCOG00384"
FT   CDS_pept        720226..720558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0736"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60127"
FT                   /protein_id="ABJ60127.1"
FT                   /translation="MKIAAIEEDLFSYNIYVAAIDEKIVAFVAFSDDELAWLYVDPSFQ
FT                   KQGIGSKLIEFSLTKMKRPTYLEVLTGNPAKSLYLHKGFKFLQHESGKMPGNETFHVEV
FT                   DLLIYK"
FT   gene            720600..721082
FT                   /locus_tag="LGAS_0737"
FT                   /note="LactoCOG number LaCOG02330"
FT   CDS_pept        720600..721082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0737"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60128"
FT                   /protein_id="ABJ60128.1"
FT                   /translation="MRKRQEYIWCLIALPDGNKEWYCLSKVLRRALFIEKKNNQFWKQT
FT                   MIGNYITVARSKYIKGRARLTVGRIEKIRIRKNGAADWHWSRNQFITAEHLLNLKDSYN
FT                   YLRHDYCWYNRLAIKMALIYWHNKLLQIKLNSIRYAVKKKRLKLERTLKNGRKDFS"
FT   gene            721060..721887
FT                   /locus_tag="LGAS_0738"
FT                   /note="LactoCOG number LaCOG01682"
FT   CDS_pept        721060..721887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0738"
FT                   /product="Pyridoxal/pyridoxine/pyridoxamine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60129"
FT                   /protein_id="ABJ60129.1"
FT                   /translation="MEEKILVSQDLSCLGQVSLSVALPILGACGYQPDVLPTAILSTHT
FT                   GGFGDNTFLNLNSEMSKIIAHWRDQKIDFKNLYLGYLGKEAIDFWLSHISDFKDSNVLL
FT                   DPAMADSGKLYHGLDTDYVTKMRILAKSATILTPNLTEACLLLGKNYRDFSINEIKKLA
FT                   LELKERFKLKEVVITGILMKEKIKMVGVSANDQVFVIENEKVGRSFFGTGDMFASSLLV
FT                   AILAGYSLKEGVEIAATFIKMAIEVTDLTQDKRLGPNYAGALPWLMNKSRERG"
FT   gene            721891..722448
FT                   /locus_tag="LGAS_0739"
FT                   /note="LactoCOG number LaCOG01908"
FT   CDS_pept        721891..722448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0739"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60130"
FT                   /protein_id="ABJ60130.1"
FT                   /translation="MRTKENSLVSIIMTGLFAAIIYLGVWVLRIPVPALVGRPFIHFGN
FT                   TLTAVAILYLGYRNGMLAGIIGLGGFDLLNGYAATSWLTMLEVVIVASVLTAVYKGMHY
FT                   QDSKRNIIILGIIAGITKIFTTYCVSIVEALMVGTSLNVALVSSFVSLPATVINSISTA
FT                   ICTPILYFAVRDGAKRVLRKSV"
FT   gene            722496..722675
FT                   /locus_tag="LGAS_0740"
FT                   /note="LactoCOG number LaCOG00382"
FT   CDS_pept        722496..722675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0740"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60131"
FT                   /protein_id="ABJ60131.1"
FT                   /translation="MPFVHVELIKGRSDEQLTQMMKDITEAVHKNTGAPKEHIHVIINE
FT                   LDKHTYGQGGEWRA"
FT   gene            complement(722741..722854)
FT                   /locus_tag="LGAS_0741"
FT   CDS_pept        complement(722741..722854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0741"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60132"
FT                   /protein_id="ABJ60132.1"
FT                   /translation="MTKYTVKLSEEDYQMLKDCHSKNPSIMKALDEAKKED"
FT   gene            722972..724303
FT                   /locus_tag="LGAS_0742"
FT                   /note="LactoCOG number LaCOG02026"
FT   CDS_pept        722972..724303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0742"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60133"
FT                   /protein_id="ABJ60133.1"
FT                   /translation="MIKMFDYRNNLKRILNNTAGDEKSLQNSLNAIKVVLGMTGEGEST
FT                   PSSNKMDAKVVAQINTFLQGITKLIERPGDKNAKSTALGALHKLTFDHDIAANFGKQLG
FT                   LLDQAIQNSEETSTTVNRKIFEAALKPKKAKARDYRKGRRYTVIRALKGADLINDNGEV
FT                   VFEVNEGQIHDLNLKSGDIVEALPLANSLNEAEVLRVVGYRKLRSRDYDKIDDFKYGVV
FT                   QGSPGNLSVSRNIHGEKLIINRKPVIVALDSSYYQNRNIHLEDGAIVDLAWYTGDVRLK
FT                   KDPASAVQVRWIYETEQPRRVSKTKKEKTKAAVSTQELAKLDMNLHYQRVGIAVGDNQN
FT                   EAILEGIVNRYNGIPIPIDAFEGKKKVIENQIKDLDIVILVTAFAAHDSTWNISEFASK
FT                   YNVKFAVSSSKGYQAFERALYRAENGMPAYEGSQQLEYKMLKNN"
FT   gene            724381..725220
FT                   /locus_tag="LGAS_0743"
FT                   /note="LactoCOG number LaCOG02287"
FT   CDS_pept        724381..725220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0743"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60134"
FT                   /protein_id="ABJ60134.1"
FT                   /translation="MTKNIKKKSWMSWLVFLAGLEIIAISINFFYGPINIAAGGSTGIS
FT                   ILVDAVWGINRSITVLIVNILMLILAAIFLGKKTTKNVVLGSLLLPILMEITPSFKITN
FT                   NQLLAVIYGGALMGLGVSLLYRVNASSGGTTIPPMILKKYFYINPAIGLLAIDMIIIFL
FT                   NIFVDGWSAFLLAALSQVVTAMTMNYAEAGFDRKYQVRVMSNEHFEELKTMLLDNYNGL
FT                   TIYDVVGGYSDDDKKQLLLVVDTREYGPLINKIHEIDSDAFIITDTVARVHGGQWGL"
FT   gene            complement(725215..725571)
FT                   /locus_tag="LGAS_0744"
FT                   /note="LactoCOG number LaCOG00542"
FT   CDS_pept        complement(725215..725571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0744"
FT                   /product="Arsenate reductase related protein, glutaredoxin
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60135"
FT                   /protein_id="ABJ60135.1"
FT                   /translation="MLKFYGYKRCSTSKKAQNWLDDHQIAYQYQDLVEKPPKQEELLKW
FT                   LTDFQDRGLRYFFNTSGQVYRQMHLKDQINKMTLEEAAKLLSQNGKLIKRPLVTDGKKL
FT                   ACGFKEDIYEKTWL"
FT   gene            725629..726099
FT                   /locus_tag="LGAS_0745"
FT                   /note="LactoCOG number LaCOG00719"
FT   CDS_pept        725629..726099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0745"
FT                   /product="LSU ribosomal protein L21P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60136"
FT                   /protein_id="ABJ60136.1"
FT                   /translation="MILNCFKRGMRVYCKSCICGNLTSATARLWGKKRINVNSTSYGES
FT                   KYFFGGVQMYAVIKTGGKQYKVAKGDSVFVEKLEVKPGDEVTFDEVILVNDGKSTKIGT
FT                   PVVEGAKVVAKVEKQGKEKKVVTFKYKPKKHSHTKYGHRQPYTKVTIESIEA"
FT   gene            726107..726418
FT                   /locus_tag="LGAS_0746"
FT                   /note="LactoCOG number LaCOG00721"
FT   CDS_pept        726107..726418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0746"
FT                   /product="LSU ribosomal protein L27P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60137"
FT                   /protein_id="ABJ60137.1"
FT                   /translation="MKQIMMINNLEALKLFAHHKGGGSTANGRNSAGRRLGAKRADGQK
FT                   INAGSIIFRQRGTKIHPGKNVGIGGDDTLFALTSGVVKFERLGRDRKQVSVYPVEEAK"
FT   gene            726491..727588
FT                   /locus_tag="LGAS_0747"
FT                   /note="LactoCOG number LaCOG00461"
FT   CDS_pept        726491..727588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0747"
FT                   /product="aminopeptidase P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60138"
FT                   /protein_id="ABJ60138.1"
FT                   /translation="MSSDQELLTLINNRIDKTTKLIKEEQADALIIFNQANYRFLTNFS
FT                   GEEAELILTANGDRVLLSDSRFKDQIRHQAPGEMKVVMQTMDVVKEIAKQLKQLDVKNV
FT                   LVEGEFISATQFEALKEACPDLNFVLSAELVEKVRNVKDDLELATLQKAIDISAQSFKE
FT                   ILPLIKPGVSERTIGAKLDYLFKMNGGDGPSFETIVASGYRGSWAHGVASDKKIQQGEL
FT                   IVIDFGSFYHGYTADITRTVALGQVEPELEKIYYIVLEAQKRGIAGNTGKDIDQAARNY
FT                   IKEQGYGEYFGHGIGHGIGLEVHELCTPAMPYGKEVMKNNMAITVEPGIYLPDRGGVRI
FT                   EDDVLIKDDHPYVMSQLPKDELLIL"
FT   gene            727673..728242
FT                   /locus_tag="LGAS_0748"
FT                   /note="LactoCOG number LaCOG00462"
FT   CDS_pept        727673..728242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0748"
FT                   /product="translation elongation factor P (EF-P)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60139"
FT                   /protein_id="ABJ60139.1"
FT                   /translation="MTMISVNEFKNGLTIEYNNDLWRIVEFQHVKPGKGSAFVRSKLKS
FT                   LRTGAVQEYTFRSTAKVNTADIQTKAMQYLYNDGTSFVFMDTTTYEQLEIPEAQVERES
FT                   KFLKENMVVNVIMHDGETLGVDLPNTVDLEVAETEPNIKGDTSSGGGKPATMETGLVVN
FT                   VPFFINQGDVLTINTADGTYVSRANK"
FT   gene            728259..728705
FT                   /locus_tag="LGAS_0749"
FT                   /note="LactoCOG number LaCOG00463"
FT   CDS_pept        728259..728705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0749"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60140"
FT                   /protein_id="ABJ60140.1"
FT                   /translation="MADNSTILLSSNDKGDETRVDLGVLEVILGIAARKVDGVSEMRGT
FT                   LKTGINTLFGRSNQGKGVSLSVEDDKLTADVYAYLDYGVNVPKVCVELQKNLTLQLKQM
FT                   TDLDLTQINVHVVGLVSETEETESEVKADTEALFPDDKEDEAKD"
FT   gene            728706..729107
FT                   /locus_tag="LGAS_0750"
FT                   /note="LactoCOG number LaCOG00464"
FT   CDS_pept        728706..729107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0750"
FT                   /product="Transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60141"
FT                   /protein_id="ABJ60141.1"
FT                   /translation="MTQHEMRRIAMQAIYLANQGNLTNAEEVCQKALKALELKSFPDYS
FT                   TEIVNGVLANKKALDEQLSKYLKKGWRLNRINEIDLAILEVALYEMQNSKVIEPVAALN
FT                   EALNLCDEFSSKESKKFVNGLLANFIKKD"
FT   gene            729155..730003
FT                   /locus_tag="LGAS_0751"
FT                   /note="LactoCOG number LaCOG00591"
FT   CDS_pept        729155..730003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0751"
FT                   /product="5,10-methylenetetrahydrofolate dehydrogenase
FT                   (NADP+) / methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /EC_number="1.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60142"
FT                   /db_xref="GOA:Q044I0"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q044I0"
FT                   /protein_id="ABJ60142.1"
FT                   /translation="MKKLLEGKTPANEITENLKKEIKNLKNDGINPTLCVIEVGDDPAS
FT                   KIYLRVKRNLAKKVGINEVGLHFPADTSQAELLGKIKELNQDPNINGIMVQLPVPPQID
FT                   PRAIFETIAPEKDADGFSPLNLGRLWEGQSDIIPATVRSILTLIDYYGIKMAGKNTVII
FT                   GRSVIVGKPLAAVLLERDATVTIAHSKTKNLADLTRNADVIISDVGKAHLVTEDMVKDG
FT                   AVLIDVGMNRENGKLMGDVDFDTVAPKANAITPVPGGVGPLTVASLMKQAVILTRKQHG
FT                   R"
FT   gene            729993..731363
FT                   /locus_tag="LGAS_0752"
FT                   /note="LactoCOG number LaCOG00592"
FT   CDS_pept        729993..731363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0752"
FT                   /product="Exodeoxyribonuclease VII large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60143"
FT                   /db_xref="GOA:Q044H9"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q044H9"
FT                   /protein_id="ABJ60143.1"
FT                   /translation="MADNPVYLSVSDLNFYISQKFKNDPYLHKVFLQGELSNFRFRMHS
FT                   HQYFSLKDDKSKINVVMFRSFFEKLKFKPEEGMKVYVSGYVDVYGPQGSYQFYAQTMEP
FT                   AGLGALYEQLRQLQEKLAKEGLFNEDHKKRLPLFPDRIAVVTSASGAVIHDIMVTANRR
FT                   FPHAEIDLYPAKVQGDEAADTIVASLKQIQAQGDKYDVVIIGRGGGSLEDLWPFNEEKV
FT                   VRQIYAMQMPVISSVGHETDTTLADLVADARAATPTAAAEYATPNLADVLTKIVQLRAR
FT                   LYAAMQANIRAKRQILDRLRKAPVLQEPTRIYDQQIQQVDMLSHRLNQAISNQLQHDRS
FT                   SVRLLQERLKALNPGRRLEQLERERTFIVANLFSTMTAYLKDQRNKLNRTMQQLDDISP
FT                   LKTIGRGYVYTTDQEGNTVTSVDKLEIDEKLKLHFKDGQVQVNVENIRREKDGNQEK"
FT   gene            731344..731589
FT                   /locus_tag="LGAS_0753"
FT                   /note="LactoCOG number LaCOG00593"
FT   CDS_pept        731344..731589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0753"
FT                   /product="Exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60144"
FT                   /db_xref="GOA:Q044H8"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q044H8"
FT                   /protein_id="ABJ60144.1"
FT                   /translation="MATKKNNFEEQLNELQEIVNKLESGNVPLEDALNEFQAGVKLSRE
FT                   LEKKLNDAEQTVAKLVDKDGNEKTLDPQNASAPEEE"
FT   gene            731590..732456
FT                   /locus_tag="LGAS_0754"
FT                   /note="LactoCOG number LaCOG00595"
FT   CDS_pept        731590..732456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0754"
FT                   /product="farnesyl-diphosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60145"
FT                   /protein_id="ABJ60145.1"
FT                   /translation="MNLKDFQKKYTPQIDKFLEDHLASEVDNPIFSKIMSYSVMAGGKR
FT                   LRPLLFLATLETLNYKISESELRIACGIELIHTYSLIHDDLPAMDNDDYRRGKLTSHKK
FT                   WGEAEAILAGDALLPLGIQWITEGSNSAALAIIISQAVGPNGMVGGQYLDIDSTNNDLV
FT                   KENAKVIDQMEWLKTGCLIEASVKMAAVYAGASTDEVDRLDNFSKQFGRSYQIYDDLVD
FT                   VVETEQEAGKATHKDADEGKNNTLTLLGIEASRKQLLKMIEAGRAAVKIFKQPLLGEFF
FT                   NLYQKVL"
FT   gene            732460..733272
FT                   /locus_tag="LGAS_0755"
FT                   /note="LactoCOG number LaCOG00596"
FT   CDS_pept        732460..733272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0755"
FT                   /product="Predicted rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60146"
FT                   /protein_id="ABJ60146.1"
FT                   /translation="MVKKRADVLLFEQGLFNSRSQAQRAIMAGLVNDHNHQRIDKSGEK
FT                   FPEDETFHIKDDGKKYVSRGGFKLEKALQVFNINLKDKICLDIGASTGGFTDVALQNGA
FT                   KLVYALDVGYNQLAWKLRDNPQVVVMEKQNFRYSKPADFTDGLPDFAMTDVSFISLDLI
FT                   MPPMYEILKDHCDAVCLIKPQFEAGPENVGKHGIVHDHEVHANVIKHTMQMAQKIGFNV
FT                   LGVDYSPIKGGKGNIEFLIHLGKDLANPGQDLWQGNPADVVQRAVSGL"
FT   gene            733273..734961
FT                   /locus_tag="LGAS_0756"
FT                   /note="LactoCOG number LaCOG00598"
FT   CDS_pept        733273..734961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0756"
FT                   /product="DNA replication and repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60147"
FT                   /protein_id="ABJ60147.1"
FT                   /translation="MRKMLVELDIKNFAIIKTLKVRFQEKMTVLIGETGAGKSIIIDAV
FT                   SLLLGSRAQSEMIRSGEEKAVITGLFVLSEQKELIEKLYEKYGLPFEDDQLIISRELTH
FT                   KGRNVVRINGQLTTINVLREIGKNLVDIHGQNDQQILMDPERQIDLIDNYAKPEFKDEL
FT                   QDYAADFETWRHLTSQLRKLREDAQEIAQKQDILEFQNNELESADLTDPDEDEKLEEEF
FT                   NELNNYQKIADTANYFIQLYDDDEHGLATLLGDAQNAAEDLSNYGKKFENFATSFNDGV
FT                   YSLNDARSELSSLMDQMDFDEERYQYVSNRLDTLNTLKKKYGPTLEDVFKFAQKVKSEL
FT                   GEFETGDLDEEKIQKELADVEKRLSKKAKRLHKQREQIARELEEKIKKELADLYMEKAR
FT                   FSIRINETNSFTKLGTDQVIFMIAPNPGESLMPLVKIVSGGEQSRLILALKAIFSRVEP
FT                   VGTMIFDEIDTGVSGRVSAAIGKKMHAIGQEKQVITITHSPQVAAAGDQRYSVVKQVKD
FT                   GATYTQVGPLTQEEAITAIAQMMAGSDVTDAAKRNAADLMESFKK"
FT   gene            complement(735021..735314)
FT                   /locus_tag="LGAS_0757"
FT                   /note="LactoCOG number LaCOG02165"
FT   CDS_pept        complement(735021..735314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0757"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60148"
FT                   /protein_id="ABJ60148.1"
FT                   /translation="MNLLKSLNNYSKQIYNYFFTYNINKLTTFAQDPGKIIRILEHALF
FT                   HKEYILLTYQNGKTEIGQLIKRTSAGRFVLDSYDNNIIRIIDLNDIFNVETA"
FT   gene            735474..736088
FT                   /locus_tag="LGAS_0758"
FT                   /note="LactoCOG number LaCOG01271"
FT   CDS_pept        735474..736088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0758"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60149"
FT                   /protein_id="ABJ60149.1"
FT                   /translation="MAHQGLLLVLSGPSGVGKGTVKSAMVKQKAFSFEYSVSMTTRKPR
FT                   PGEVDGKDYYFVSEDRFQEAIKDNELLEYNEYVGNHYGTPLAPVQKMLKEGKDVLLEID
FT                   VNGAKQVRKLMPDGVFIFLTPPDLHELKHRIVNRGTDSDKVIAMRMKQARKEILMMEDY
FT                   DYAVVNDTVANVVDHIKSIVEAEHVRVPRVINDYRNMVKED"
FT   gene            736092..736310
FT                   /locus_tag="LGAS_0759"
FT                   /note="LactoCOG number LaCOG01270"
FT   CDS_pept        736092..736310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0759"
FT                   /product="DNA-directed RNA polymerase subunit omega"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60150"
FT                   /db_xref="GOA:Q044H2"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q044H2"
FT                   /protein_id="ABJ60150.1"
FT                   /translation="MKITYPSIDKLLSRVNSRYSLSVLAAKRAHEIQAGAPLALKHYKS
FT                   DKAVGKALEEIAAGKVTIDPEHREDIG"
FT   gene            736365..738761
FT                   /locus_tag="LGAS_0760"
FT                   /note="LactoCOG number LaCOG01269"
FT   CDS_pept        736365..738761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0760"
FT                   /product="replication restart DNA helicase PriA"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60151"
FT                   /protein_id="ABJ60151.1"
FT                   /translation="MIAQVSVDVAAKQTDRVFEYHIPQELTDVAVGSRVVVPFGRRKVQ
FT                   GFVVGISKTTSYTGKLKDLLVVVDELPPLTPELITLSKTLADKIFAYRITILQSMLPRV
FT                   MRANYRKILVPITEEAKKLKIFKGEPLDLNEVSNLNTIIEIKKLIKNNQAKIEYLVENK
FT                   AKKKQIAIYLLTKTKAEYQQILKGLRKTAKKQQVLLDNIVKNYHEYPKLGSKIVSELDV
FT                   SSSVLRAAVKKGWLVKKEQEMYRDPLKDFEPRKKKIQIKLNSEQTHALNSIGKSIQKRE
FT                   AKTFLLEGITGSGKTEVYLHAISIALEQKRNALMLVPEISLTPQMVKQVKERFGDNVAV
FT                   LHSGLSEGEKYDEWRRIRRGEAQVVVGARSAIFAPLKNIGLIVIDEEHESSYKQNDTPR
FT                   YHARDVALLRSKFHKCPVVLGSATPSLASRARAQKGRYELLLLTKRANQKALPKVDLID
FT                   LKTVEFAGAQFDLSIPLVDAIKEKIAKKEQVILLLNRRGFASFMLCRNCGFVLKCPNCD
FT                   ISLTLHKDTQQMQCHYCGHKEPIPRRCPNCQSEKIRFLGTGTQKVQEELENLLPEAKIL
FT                   RMDVDTTRRKGSYKKILDSFGDHQADILLGTQMIAKGLDFPNVTLVGVINADTALSLPD
FT                   FNSSEKTFDLLTQVSGRAGRAEKTGRVMIQTYNPDNYAIKLAQSQDYESFYQKEMRVRF
FT                   QGNYPPFFYTTLITITSKNEQSAAKEAFVIKRKLMRHLHAPTIILGPTPSSVAKIKNQY
FT                   YYQILVKYKHEPKLHDLLHQIQDDAQLAQKRGLNIYIDNEPERIM"
FT   gene            738782..739726
FT                   /locus_tag="LGAS_0761"
FT                   /note="LactoCOG number LaCOG01266"
FT   CDS_pept        738782..739726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0761"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60152"
FT                   /db_xref="GOA:Q044H0"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q044H0"
FT                   /protein_id="ABJ60152.1"
FT                   /translation="MSSVIFLGTPNFGSVVLQGLIDQGYDVKAVVTQPDKRVGRKQVVH
FT                   QSAVKQTALKHNLPVYQPAKLSGSDELAELMKIEPDFIVTAAYGQFLPTKFLKSAKIAP
FT                   VNVHGSLLPKYRGGAPIQYSVLNGDKETGVTIMEMVKKMDAGDIFSQKALPIEDDDTSG
FT                   TLFDKLSILGRDLLLETLPKFIDGTVTRTPQNEDKVVFSPNISKEQEQIKLTMTAEQAN
FT                   NLIRALNPDPGAYVMLDGKRFKIWKAKPLAEKTSFPAGTLVTNKKKFVISMAGGSELEL
FT                   LEVQPTGKKKMNIKDYLNGQGSHFTSGEKIIDE"
FT   gene            739719..741035
FT                   /locus_tag="LGAS_0762"
FT                   /note="LactoCOG number LaCOG01264"
FT   CDS_pept        739719..741035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0762"
FT                   /product="tRNA and rRNA cytosine-C5-methylase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60153"
FT                   /protein_id="ABJ60153.1"
FT                   /translation="MSNARTVALETLIKVFNQKSYSNIALNNELVKHELKPADKALATR
FT                   IVYGTIQYKIFLEYQLKPLIKTKLRDKFLMPLLLMSAYQYFFLEKVPANAIFDEANKLA
FT                   KKFAKKNSGSYKLVNGILRALERQGKVLPAPDNLVDYLSIKESFPKWLVEYLLDNFGED
FT                   QTKEILVRSNQPAANSIRMAVEEDKFEEIKEALKKDGFDFKESCLTAHNLNLNKGGVAQ
FT                   TNLFKDGKITIQDAAASLAVDAFKFTGDEQVLDACSAPGGKTVQIAEKLTTGNVIALDI
FT                   HENKLRLVKNAAKRLHVSDKVKTKALDARKAQEYFTAGQFDKILVDAPCSGLGLIRRKP
FT                   EIRCEKSLNDIKNLARIQLSILENISGLLTAGGELVYSTCTISLEEDEGVVNQFLKLHP
FT                   DFELVPVQVGKLPKQNMVRIFPSADGSDGFFIAKLKKRG"
FT   gene            741042..741794
FT                   /locus_tag="LGAS_0763"
FT                   /note="LactoCOG number LaCOG01263"
FT   CDS_pept        741042..741794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0763"
FT                   /product="Serine/threonine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60154"
FT                   /protein_id="ABJ60154.1"
FT                   /translation="MIKTAFASSIGRVRETNQDFVKVFKNQNNIIMGIVCDGMGGHQGG
FT                   DVASTMAVSHLGHNFEKTDFTDPDLAQKWLTVQLRLENETILSTADRFADLNGMGTTIV
FT                   LAIAFTEKILIAHLGDSRCYLYGGNEFKQITEDHSLVHELVKMGQITEQQARNHPQKNI
FT                   ITETLGVSSTVNPEFDILEVHAGDIFLLCTDGLTNSLTDPQIQQILATKNLNLKERCNK
FT                   LINEANRLGGGDNITVCLLAYVEKDGDK"
FT   gene            741797..743785
FT                   /locus_tag="LGAS_0764"
FT                   /note="LactoCOG number LaCOG01262"
FT   CDS_pept        741797..743785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0764"
FT                   /product="Serine/threonine protein kinase with beta-lactam
FT                   (PASTA) domains"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0764"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60155"
FT                   /protein_id="ABJ60155.1"
FT                   /translation="MEKGHLLGGRYKIISVLGEGGMANVYLAEDIILQRKVAVKVLRLN
FT                   LQKDPQTIQRFQREALSTSELSHPHIVSILDVGTEGDCHYLVMDYVDGPDLEEYIQRNN
FT                   PIPLPKVINIMDQILSAVALAHKHNVIHRDLKPQNILMDKKGNIKIVDFGIAIALNQST
FT                   MTQTNTAMGSVHYMSPEQARGSMATKQSDIYSLGIILYKLLTGTVPFTGENAVAVALKH
FT                   FQEKTPSLRAKNPSIPQALENVVFKATAKDPRDRYKTVLDMKEDLDTCLDPKRKNEPVY
FT                   KPQHDPAADETIVIPPLEGSVHNKDHEVQEKSEPKEEKKNFLDNLKGHKWWWIGALIAF
FT                   CVIMVILFFALGRKDMVDIPNLNKMTQTEAKNTLNSSGLELGKISYEYSDTVPKGKVIR
FT                   TKPPIGSQIKDGQKVNLIISKGPHLVEMPNVIGESYTVAKKQLVKLGFSVAKTEEYSSS
FT                   PKNQVNAQDVEPGQQINPDKATVTLLVSKGPSSASSTRSRRHTVKLRDIVGYSLKGAQD
FT                   YARENHLTLKVEEEDSDDKNDGTVLRQSPESGTDVSSGSTLTVVVAKSKKADASSSSSS
FT                   STTTTTVTKSYTINYPADSSQANSQKTPDHIQVYVSDDDHSINNIYRDMNITSEQSFTV
FT                   PFKLTKKNGHIKILRNGNTILDEDVNK"
FT   gene            743785..744678
FT                   /locus_tag="LGAS_0765"
FT                   /note="LactoCOG number LaCOG01292"
FT   CDS_pept        743785..744678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0765"
FT                   /product="Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60156"
FT                   /db_xref="GOA:Q044G6"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="InterPro:IPR031944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q044G6"
FT                   /protein_id="ABJ60156.1"
FT                   /translation="MNKAQGTIVSAISGYYDVEIENEVVRTRARGVFRDRKQKPLVGDR
FT                   VVVQLDNQGMNYLIEILPRTNEIGRPAVANVSKVLLVISAVEPDFSLELLDRYLTFFAW
FT                   KNVGVVIYLSKADITPTEKLKAIKCKLDYYQKIGYSVFEDAEELERQLPTMIQKDQIWT
FT                   LAGQSGAGKSTLLNKLENEANQETGAISTALNRGKHTTRQVKLFKYSSGFIADTPGFSA
FT                   IDLFKIKVDELENYFYDLKDASVKCKFRRCQHIKEPGCEVKKLIEEGKIAKSRYDSYLK
FT                   IRQEISENRMPEYLKK"
FT   gene            744687..745337
FT                   /locus_tag="LGAS_0766"
FT                   /note="LactoCOG number LaCOG01291"
FT   CDS_pept        744687..745337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0766"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60157"
FT                   /protein_id="ABJ60157.1"
FT                   /translation="MIAPSILNADNMHLSRDIKAAIESGIERFHIDIMDGHFVPNLSYG
FT                   PELVKDFKRSFPFTKAEIHLMSNNLDTTLPLFVEAGADILEFHYEATNKPDYWLDYLKD
FT                   HNVRCGMAINPSTPVNKLKPFLNKLDQVLLMTVKPGFGGQKFEEAAVERLAELQDMIKD
FT                   ENLDLPIEVDGGLDRETLKLTRDAGAKIFVAGSYIFKNGSIEDQVIKLKKEDK"
FT   gene            745334..746002
FT                   /locus_tag="LGAS_0767"
FT                   /note="LactoCOG number LaCOG01214"
FT   CDS_pept        745334..746002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0767"
FT                   /product="thiamine diphosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60158"
FT                   /protein_id="ABJ60158.1"
FT                   /translation="MKAIALLGGPKEEWPQNLANKIKLAQKKGALIMASDRGSLFLLEL
FT                   GIVPDVALGDYDSLTNHERQLVESKVKDMRYSNPVKDFTDSEMLYYAAFIDYRVDDLIV
FT                   YGATGGRLDHFLVNMYAVLKAPFDQFKEQIKFVDKQNIVRFFGKGRHLISYNSDYKYLG
FT                   IGTLTEVKDFSIRDAKYDLAPVDLKVPTMYSSNEYLRQQAVTVSCKLGVLIVINSRDKK
FT                   "
FT   gene            complement(746049..746234)
FT                   /locus_tag="LGAS_0768"
FT                   /note="LactoCOG number LaCOG00128"
FT   CDS_pept        complement(746049..746234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0768"
FT                   /product="LSU ribosomal protein L28P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60159"
FT                   /db_xref="GOA:Q044G3"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q044G3"
FT                   /protein_id="ABJ60159.1"
FT                   /translation="MAKDIITGRKTVFGNKRSKALNSVRRSWKPNLQKVRILVDGKPKR
FT                   VWVSARALKSGKVKRA"
FT   gene            746406..746768
FT                   /locus_tag="LGAS_0769"
FT                   /note="LactoCOG number LaCOG00127"
FT   CDS_pept        746406..746768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0769"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0769"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60160"
FT                   /protein_id="ABJ60160.1"
FT                   /translation="MAVKIKTKYGLIDISNSVIATVVGGAATSNYGVVGMASKNALRDG
FT                   AYTILNRENYRRGVVIKTNDNQIVVDVYIIVGYGLKISEVSHNVQDSVKYNLENLLGIK
FT                   TKSVNVIVQGVKILDD"
FT   gene            746790..748454
FT                   /locus_tag="LGAS_0770"
FT                   /note="LactoCOG number LaCOG00126"
FT   CDS_pept        746790..748454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0770"
FT                   /product="Dihydroxyacetone kinase related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60161"
FT                   /protein_id="ABJ60161.1"
FT                   /translation="MVLTEINSDQFRDMVRAATHRMGKNAEFVNKLNVFPVPDGDTGTN
FT                   MNLTIESGAKAVNENLSESVGDLTESLSKGMLMGARGNSGVITSQLFRGFYKATEGKKT
FT                   LTAQDLADAFANGVSTAYKAVMKPVEGTILTVARVAAEEGKNKANETDDVSEVMRAVVD
FT                   GAKKALKTTPDLLPVLKQVGVVDSGGQGLVFIYQGFLEGVLGEKDNDDYQLDEGEMDEL
FT                   INAAHHQAESAQVQLSTSDIKNGYCTEIMVDLTADIPNKEKFDLDQFREHLSNLGDSLL
FT                   AVSDGEVAKVHVHTEHPGDVFTYGKKFGQLGKIKIDNMRIQHETILENNEEQEENVDFA
FT                   VIAVASGHGIRELFKSEGVNRIISGGQTMNPSTKDIMDAITKSGAKKAIILPNNGNIIM
FT                   AAKQAAEVSDIPVGIVPTKTISQGLTAMLSFDPDASVEENVEAMSEDLDTVKSGEVTKA
FT                   IRDTKIDDIQVKKDDYLGIVDGTIKVDNPDLVDTTVSMIEKMLDEDSEIITIMYGSDAT
FT                   REEADAVVKKLEASHDDLEFEIHDGGQPVYYFLVSVE"
FT   gene            748458..750497
FT                   /locus_tag="LGAS_0771"
FT                   /note="LactoCOG number LaCOG01514"
FT   CDS_pept        748458..750497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0771"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60162"
FT                   /protein_id="ABJ60162.1"
FT                   /translation="MNNKQSKLFEPVTELKGVGAKTATALAGLGINTIYDLLFYFPFRY
FT                   DDLETIPLDQIEDGQKVLLKGIVVTDPFVSRFGYRKTRLSFKMKIDHDIIMVNFFNQPW
FT                   LKDKVESGKEVAVYGKYQVARQSLSGFKLVAEKKESGFAPIYSVNRHLKQNKLQKLIDL
FT                   ALEEVLPEVGETIPAALREKYRLLSDQILVEKMHHPKNGNEAKLARRSAIFREFFLFQV
FT                   QLAQLLSQRDEDVPGVEKRYDLAAVKELIQAIPFELSDDQKKVVNEIFADLHSPRQMKR
FT                   LLQGDVGSGKTVVAVFAIYATITAGFQAALMVPTEILAQQHFAKVDELLRPLGVRVALL
FT                   TGDTKELEKKEIYRELADGTINVVIGTHALIQKDVHFKNLGLVIIDEQHRFGVNQRNTL
FT                   IKKGVAPDVLAMTATPIPRTLALTVYGDMAVSEIRHLPKGRKPVVSSWATSSKLKEVLE
FT                   LMRSQLEKGFQIYVVTPLISESEKSDLKNAEDLQARLAHYFKDENVVLLHGQMKGDQKN
FT                   EIMDSFAAGKIDILVTTSVIEVGVDVPNANMMVIFNADRFGLSQLHQLRGRIGRGQTQS
FT                   FCVFVSDPKTEIGKKRMNIITSTSNGFKLAEEDLKLRGEGDVFGKAQSGLPQFQVGDVV
FT                   NDYNTLVTAQKEARALVKADPNLERPENKFLLEVLKYKKDLNND"
FT   gene            750494..751516
FT                   /locus_tag="LGAS_0772"
FT                   /note="LactoCOG number LaCOG00039"
FT   CDS_pept        750494..751516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0772"
FT                   /product="phosphate:acyl-[acyl carrier protein]
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60163"
FT                   /db_xref="GOA:Q044F9"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q044F9"
FT                   /protein_id="ABJ60163.1"
FT                   /translation="MKLNGVSMKKIAIDAMGGENAPKAIIDAVLKAKPKLKDIEFILFG
FT                   DAEKINQLIPNEQKERIEVVATSEVIVDSDEPVRAIRRKKDSSMVVAANYVKAGKADAL
FT                   FSLGNTGALLACGIFIIGRIKGVERPALMPTLPSAKSEQGFNIIDVGANAQSKPEYLVQ
FT                   WAQMANFYAQKVRNIQNPTVALLNNGAEDDKGDPLHQEAYKLLKETKLNFIGNVEGNDL
FT                   MEGKADVIVTDGFTGNATLKAIEGTASVILRLLKDSLLNNGLRPKVGALLAKPGLTALK
FT                   KRFDTARYGGAVLLGVNAPVVKTHGRSNIRPIYYTLLQIDKMLSQDLVGEYKKYFSESR
FT                   "
FT   gene            751557..751814
FT                   /locus_tag="LGAS_0773"
FT                   /note="LactoCOG number LaCOG00528"
FT   CDS_pept        751557..751814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0773"
FT                   /product="Acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60164"
FT                   /protein_id="ABJ60164.1"
FT                   /translation="MEVKEMTEEEIFNKIADMISERFSIDRDKITKDLNFQNDLDADSI
FT                   DFVELVMDLEDTFGAEIPDDDAEKLQTVGEAVEYIKNHQN"
FT   gene            751954..752982
FT                   /locus_tag="LGAS_0774"
FT                   /note="LactoCOG number LaCOG00251"
FT   CDS_pept        751954..752982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0774"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60165"
FT                   /protein_id="ABJ60165.1"
FT                   /translation="MRGEWPLEKQSDLLLDIEHLHTAYRLHGKFYDAADDINLTLKRNE
FT                   ILAVVGESGCGKSTIASSIIGLYDHKNTRVTGDILYNELNLVNLNESLFNKIRGNNIGM
FT                   IFQDPLASLNPLMKVGDQVAETLYYHTDMDEKARHARVIELFNQVGMPRPEEMYEMYPH
FT                   ELSGGLRQRVVIAIAIACKPEIIIADEPTTALDVTIQAQILDLLKEIQKESRSGIILIT
FT                   HDLGVVAETADQVAVMYAGQIVEKADVKTIFENPLHPYTRSLLHSMPQTDDESQDLHVI
FT                   HGTVPSLINMPRTGDRFAARIPWIPASAHEENPKIHEVEPGHFVRCTCWQSFHFQDEEK
FT                   KG"
FT   gene            752989..753957
FT                   /locus_tag="LGAS_0775"
FT                   /note="LactoCOG number LaCOG00252"
FT   CDS_pept        752989..753957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0775"
FT                   /product="ABC-type oligopeptide transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60166"
FT                   /protein_id="ABJ60166.1"
FT                   /translation="MADEIIEIKNLKVHYPIRSGFWNRVTGYVKAVDGINLSIKEGETY
FT                   GLIGESGSGKSTTGKAIVGVEKVTSGQILYKGVDVTKASNRKRLNYNKDVQMIFQDSMS
FT                   SLNPRKRIEDIIAEPIRNFENLTTDEERKRVQELLDIVGMPSDAIYKYPHEFSGGQRQR
FT                   IGVARAVATHPKLIVADEPTSALDLSVQAQVLNFMKHIQQEYNIAYLFISHDLGVVKHM
FT                   SEDIAIMHRGRFVEIGKRDQIYKNPMHIYTKRLLSAIPVVDVEHREQHKEERQRVEKEF
FT                   LQDQDKWYEKDGRVLPLQKVGDRHFVALPKEMIKQELKEGE"
FT   gene            753960..754922
FT                   /locus_tag="LGAS_0776"
FT                   /note="LactoCOG number LaCOG00249"
FT   CDS_pept        753960..754922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0776"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60167"
FT                   /protein_id="ABJ60167.1"
FT                   /translation="MWKTVLRRILIMIPQLLILSLLVFILAKMMPGDPFTGMINPNSDP
FT                   KEIARLRQEYGLNDPVWVQYTRWLGNMFHGDLGQSYIQKVPVTSLIWDRAVNTFWLSLM
FT                   TVVLTYLIAIPLGVTAGRHQDEWQDHGVQIFNYITYAVPPFVFYILGIWLFGFTLGWFP
FT                   ISGSVSADVNPGTLAYFWSRFYHLILPSILCALISTTAIVQYLRTGIVDNKVEDYVRTA
FT                   RSKGVPENVVFNKHILRNSLLPIAAFFGNTITGLLSGSMVIESVFSYPGMGKLFLDSIG
FT                   QRDYTTLTALILLFGVLTLIGNLLSDIIMSIIDPRIRIK"
FT   gene            754939..755853
FT                   /locus_tag="LGAS_0777"
FT                   /note="LactoCOG number LaCOG00250"
FT   CDS_pept        754939..755853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0777"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60168"
FT                   /protein_id="ABJ60168.1"
FT                   /translation="MAKDKNTSKKDQNAKTSLPPSGFKIIVREVWRDKVAFASFCIIVA
FT                   ILLFTFVGSLFLNKSQVTEINIAEAYYGWGESGHIFGTDDGGRDILKLLMMGGRNSILI
FT                   GLSVTVLCEGVGLLVGLFSGYFGGVTDAVIMRIVDFIQILPQFPIIIVLTTVIPNYNAG
FT                   TLVLLISMFGWTSTARYFRAFVLSQREREYVLASKTSGSSNLTIIFREVLPNITSALVI
FT                   DVVLMIAGNIGIETTLSFLGYGLPTTTPSLGTLIGFANDPVNVTTRPWLWMPATFLLLI
FT                   ISLSINYVGRALQRAGDARQREN"
FT   gene            756104..757921
FT                   /locus_tag="LGAS_0778"
FT                   /note="LactoCOG number LaCOG00248"
FT   CDS_pept        756104..757921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0778"
FT                   /product="ABC-type oligopeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60169"
FT                   /protein_id="ABJ60169.1"
FT                   /translation="MSLMMILLNHQLVPNRWRNITMKKAKLFGSLTLLSGVALTLAACG
FT                   NNSNSKVDNPTKSFKEATPKKAVKKGGTVSVALETDTPITGIFLNELSDTQTDSDAMAP
FT                   GNEALFDTNDTYQINDKGPATLKLDNKNKTATITVKKGVKWSDGKQVTAKDIEYSYEII
FT                   ANKATKSSRYTESLQNIVGLSEYHDGKSNTISGIEMPDGENGRTVVLHFKEMKPGMKFS
FT                   GNGYFWEAAAPYHYLKDVPFNKLQSSDQVRKNPLFFGPYKMSKVVRGQAVTFVPNKYYW
FT                   RGTPKLDKVTIQVLNPNSASQAIKSHKYDIAGVVNSQWKNVANTNNVNWIANIPLAYSY
FT                   LGFKVGKWDGAKGENVMNKDAKMNNKSLRQAIAYGMNVSAVTKRYTNGLTFHIPTLIPK
FT                   QFGKYYDKNVKGYDYNIKKGNEILDKAGYKKKGKYRVQPNGKPLTIRLAAMTGNSTQEP
FT                   IIQNYIQQWKKLGLNVKLTGGRLMEMNSFYNKVQNDSKDVDMFMGAWSLSSEPSPNDLY
FT                   SVKAPYNFTRFVTAKNTKLLQEMDSEKSFNTNYRVKKFHEWQKYMNDEAYVVPVSNSYN
FT                   VNAVNSKITGYSLKPSAANSLWYNVGIAK"
FT   gene            758030..759802
FT                   /locus_tag="LGAS_0779"
FT                   /note="LactoCOG number LaCOG00248"
FT   CDS_pept        758030..759802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0779"
FT                   /product="ABC-type oligopeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60170"
FT                   /protein_id="ABJ60170.1"
FT                   /translation="MEENLMKKGKLISTLTLLSGVALTLAACGNNNQDTSHPNFKEYTP
FT                   KKAIKNGGSVSVAVVTDTPFTGIFNDELSTNNTDSEVMQYGDESLFATNDTYKYIKGGA
FT                   ADIKINKNAKTATITINPKVKWSDGQPLVAKDYEYAYEIIANKATHSQRYTSSLAELEG
FT                   LEEYHEGKSDTISGIEMPEGENGRTVVLHFKEMKPGMNQSGNGYIWEAAAPYHYLKDVP
FT                   FDKLISSNKVRKNPLFYGPYKVNKVVRGQSVSWVPNEHYYKGKPHLNKITASVITPASV
FT                   AQSIKSNKFDVTQVSNSQWPNIKGTKGVNFIANIPLSYSYLGFKVGKWDSAKGENVMNK
FT                   DAKMNNKALRQAIAYGMNVDQVYKRYSYGLSFRIPTLIPKQFGDYFDKDVKGYTYNIKK
FT                   GNELLDKAGYKKKGTYRVQPNGKPLTIRLAAMTGSKVQEPIIQNYIQQWKKLGLNVKLT
FT                   SGRLMEMNSFYDKVQNDSKDVDMFIGAWSLSSEPSPQDLYGTKAPFNYSRFVTKENTDL
FT                   LNDIDSQKAFNNSYRVKKFHQWQAYMDKEAYVVPVSNSYSIYAVNNKLTGYSLAPSKSM
FT                   GGGFPNWYYVGYAK"
FT   gene            759905..760585
FT                   /locus_tag="LGAS_0780"
FT                   /note="LactoCOG number LaCOG00557"
FT   CDS_pept        759905..760585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0780"
FT                   /product="RNAse III"
FT                   /EC_number="3.1.26.3"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60171"
FT                   /protein_id="ABJ60171.1"
FT                   /translation="MVSVAFKKNLKEKYGIKFNNENLLEDAFTHSSYANEHPGRKDYEK
FT                   LEFLGDAVLELAVSDYLYRHFPRLNEGELTRMRSNIVRTEGFSEFAIECGFPAEINLGK
FT                   GEEKAGARKRKTLLEDVFEAFNGALFLDQGMPAVQHFLHLTVYPLIAEGDFNASRDYKT
FT                   ELQERLQVNGPVKIEYQVIAEDESKPSFKVQLLVNDKKISEGQGRNKKAAEQQAAQAAL
FT                   DKNK"
FT   gene            760600..764160
FT                   /locus_tag="LGAS_0781"
FT                   /note="LactoCOG number LaCOG00558"
FT   CDS_pept        760600..764160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0781"
FT                   /product="condensin subunit Smc"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0781"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60172"
FT                   /protein_id="ABJ60172.1"
FT                   /translation="MPLQQLVLNGFKSFADKTTIRFNNGITGIVGPNGSGKSNITEAIR
FT                   WVMGEGSAKSLRGENMKDVIFAGSQMRAPMNHAEVELVFDNRDHQLASDDEEVVVTRKI
FT                   LRNGESDYLLNHHPVRLKDVRTLFIESGMSSDSLGIISQGKVDEILNSKPQQRRGIFEE
FT                   AAGVLHFKQQKETALKQLDKTNANLIRINDLVKELEGRIEPLHEQSSLAKEYKFQKEQL
FT                   DHKLKQLLGLEIESLNEEKKDVAKKAKANQAILDKLDDEVKQSQADLEEKRKQSNERHA
FT                   EKDEKQQELLSLTQKLAALNTDLQMHQQSREYDVATQKEYNAQAEELKERQKHLSKQLT
FT                   ANEEDLKSQNQVLAEFLKKQKELKQELKQGPEQLNNQLEKVRSDYIQTLQDQTSNNNEI
FT                   VYLKNELTRSQNSSNNRQQEVEEQLAATQKVLAELKKQGHDLVLKRQQLNETIASLDQK
FT                   IAQASKLKDQNEQTYLSVRNKLQQISAQVEGLKRIRDRHEGYYYGVKYVLNHQSDFHGI
FT                   VGVIGELISFPAELEAALSTALGGGAQDLVTIDQNSARDAINLLKQTRSGRATFLPLDG
FT                   LRHNEIATSTLNSLQSIEGFKGVAADLVTAKTKVNISNAISYLLGNVLVVDTIDTALRV
FT                   QRRIGRYYRIVTLDGDIISPGGSMTGGTRNTRNNSPLATNAEIDKLTKQVKVGKEKFAE
FT                   LEVTLNELNHKLSDLQTELAAKNTELSSLNQKISEQTIKYENEEKEVKRLKQLNDLQQK
FT                   AELEKKQEEAELTGRLEKEQTKKVQLEELAQKQRSKMDQLKHDLHDFDEAYQKLQTKLS
FT                   NLNSDLAVVKNKLENLNAKKAELAEQLVNTNSRLKDIDEKIKALALSQNGQSESEIEEQ
FT                   VAKLSKKKKQMQQALAEINQDLGKFDAQINNLDQVATRNYNLRKNTAAEQEEYSAKLGE
FT                   LKSQINQKLGTLSEEYSLTFEAALQLSKGQNTTELRKKLEREVHLHKMSLADIGEVNLN
FT                   AIEEYEDVKTRYDFLNGQQTDLLKARKDIEESMSKLDDEVKNRFSTTFHQIEKSFSKIF
FT                   PIMFDGGHARLELTDPKNLLETGIEIIAQPPGKKSQKLTLLSGGERALTAITLLFAMLQ
FT                   VNPVPFCILDEVEAALDETNVDRFAQFLNHYDMKTQFIVITHRRGTMQKADNLYGIVMQ
FT                   ESGISKVLSVSLNEIKKEVN"
FT   gene            764163..765512
FT                   /locus_tag="LGAS_0782"
FT                   /note="LactoCOG number LaCOG00563"
FT   CDS_pept        764163..765512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0782"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60173"
FT                   /protein_id="ABJ60173.1"
FT                   /translation="MGLFDKIKKSLFGHKDEDQEEKEEHKVDEEATKETQDSEINTETE
FT                   VSENESDLASKETNKTDKEETESSDETPGWSDAGSAFEESQNEVAEKTAEAEDTSSEEE
FT                   QKSEEYEDKISESETGTELAANTEEESDEKVAEKEDEQERYDKGLEKTNHSFGARLNAF
FT                   FAKFRTVDEDFFDDLEDLLIESDVGFETAEELTDSLRDEAKLQNAKSHDDLKQVIVEKL
FT                   VDIYDKGGEGEDSKLADDPDAKPNVYLFVGVNGAGKTTTIGKLAKRIKDSGKSVMMVAA
FT                   DTFRAGAVEQLVEWGRRDGVEVVTGPEKADPASVVYDGVKKAKDRGIDFLLVDTAGRLQ
FT                   NKVNLMSELDKIKRTIKKILPDQPNEVLLVLDGSTGQNALLQAKDFDKTTKLTGLVLTK
FT                   LDGSSKGGVVLAIRNEMDLPVKLVGLGEKVDDLANFDAEKFAIGLFQGLI"
FT   gene            765552..766976
FT                   /locus_tag="LGAS_0783"
FT                   /note="LactoCOG number LaCOG01600"
FT   CDS_pept        765552..766976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0783"
FT                   /product="dipeptidase A, Cysteine peptidase, MEROPS family
FT                   C69"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60174"
FT                   /protein_id="ABJ60174.1"
FT                   /translation="MKHLSACTTILVGKKASIDGSVMISRNDDTAGAITPQKFIIEPAA
FT                   HGEKGRKIKSWLNKFEMDLPEDAQRVPAVPNVDYKKLGYYDESGINQKNVAMSCTESTY
FT                   GNERTLAFDPLVKDGLDEDCMQTVVLPYIDSARDGVKRLGVLIKKYGSPAGNSVLFGDK
FT                   DEIWYMEIVTGHHWVAQRIPDDCYAATGNRVAIQQVNFDDPDNFMWSEGIQEFVEKHHL
FT                   NPDHEGWNFRHIFGTYTEQDRHYNTSRQWYIQKLFNPEIEQDPEDPDIPFIRKASKKLA
FT                   KEDIEFALGSHYQDTPFDPFGHGTEEEKHRYRPIGLNRTQNSHILQIRSDVPEEMAGIM
FT                   WLCIGGPTFTPYIPFFANMNETDPSFNNTSMTYNKEDAWWYYKSLAALVESHYPQFVQL
FT                   DTKYLEELNRYYRGRVEEIIENAQGLNGEKLTDYLTRENQKTVAHTKKDSEELMGQMFT
FT                   DAIKMSKLTFKMDPNL"
FT   gene            767125..767466
FT                   /locus_tag="LGAS_0784"
FT                   /note="LactoCOG number LaCOG00932"
FT   CDS_pept        767125..767466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0784"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60175"
FT                   /protein_id="ABJ60175.1"
FT                   /translation="MDELEKNERLGDLFAYYGPLLTKGQQDYFEDYYYNDLSLGEIADN
FT                   HHVSRQAVYDNLKRSSKALEKYEDKLHMKRDYTRIEEKITEAVYELEHGKINRAQIELL
FT                   KLLKQMGVE"
FT   gene            767468..768898
FT                   /locus_tag="LGAS_0785"
FT                   /note="LactoCOG number LaCOG01059"
FT   CDS_pept        767468..768898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0785"
FT                   /product="signal recognition particle subunit FFH/SRP54
FT                   (srp54)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60176"
FT                   /protein_id="ABJ60176.1"
FT                   /translation="MAFENLSERLQKALKNLTGKGKISEADINDASREIRLALLEADVN
FT                   FKVVKDFIKKIKKEALGKEVQESLNPGQQIIKIVDDELTKMMGEEAVSLNKSQHIPTII
FT                   MMVGLQGTGKTTTVGKLANYLMKNEKARPLLIAGDIYRPAAIDQLKQIGQQLNVPVYSE
FT                   DNQDVAEIVKHGLEEADKNKNDYVLIDTAGRLEIDEQLMDELKRVTAVAHPDNTLLVVD
FT                   AMTGQAATQVAEGFNNDLDLTGIILTKLDGDTRGGAALSIRAVTGLPIIFTGQGEKLTD
FT                   LSTFHPDRMASRILGMGDMLTLIEKAQQDYDAKEAEKMAEKMRENTFDFNDFIDQMDQV
FT                   QKMGPLDQIIKMIPGLGNNPALKNIQIPEKQISHIKAIVYSMTPEERENPDILNPSRRR
FT                   RIAAGSGRSIAEVNRMIKQFKQSKEMMQKMTKGDMGEFANLPGMNSPMGKMAMRSMNKR
FT                   FKKNKKKRMKKIKRYRSK"
FT   gene            768985..769257
FT                   /locus_tag="LGAS_0786"
FT                   /note="LactoCOG number LaCOG01026"
FT   CDS_pept        768985..769257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0786"
FT                   /product="SSU ribosomal protein S16P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60177"
FT                   /db_xref="GOA:Q044E5"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q044E5"
FT                   /protein_id="ABJ60177.1"
FT                   /translation="MSVKIRMRRMGSKRKPFYRIVVADSRMPRDGRFIEEVGYYNPLTN
FT                   PDEVKLEEDKIFEWLEKGAQPSDTVRSLLSKAGLMTRYHDAKYGK"
FT   gene            769327..769848
FT                   /locus_tag="LGAS_0787"
FT                   /note="LactoCOG number LaCOG01023"
FT   CDS_pept        769327..769848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0787"
FT                   /product="16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60178"
FT                   /db_xref="GOA:Q044E4"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q044E4"
FT                   /protein_id="ABJ60178.1"
FT                   /translation="MTEYFEVGKILSPHGLKGEVKVNATTDFPEERLANGSRLFIKNSD
FT                   QYQELIVDGARRHKQFYLVKFEEIDGIDQAEKVCGKELYVAETDQQELPEGSYYFKDIL
FT                   NCPVYDAETGEKLGVLANIETPGANDIWEIKPEHGKSFWIPNIESVVNKVDLANKRIEV
FT                   TLLEGLRDEN"
FT   gene            769823..770560
FT                   /locus_tag="LGAS_0788"
FT                   /note="LactoCOG number LaCOG01022"
FT   CDS_pept        769823..770560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0788"
FT                   /product="tRNA (Guanine37-N(1)-) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60179"
FT                   /protein_id="ABJ60179.1"
FT                   /translation="MRDYEMKINVLTLFPDMFTPLQVSMLGRGLEDKKWELNLVNFRNF
FT                   TTDVHHHVDDTPYGGGAGMVLQIMPIKKALDSLTNKGKVIITAPQGKTFNEKMAQDWSK
FT                   EENLTFICGHYEGFDQRVYDLADETVSIGDYVLTGGELPTMSMIDATVRLLPGILGNAA
FT                   SPVEESFSHGLLEYPQYTRPADFEGQKVPEVLTSGNHQKIAEWRHKEALRATYLHRPDM
FT                   LAERILTDEEKKMLEEIKLEKEN"
FT   gene            770641..771024
FT                   /locus_tag="LGAS_0789"
FT                   /note="LactoCOG number LaCOG00608"
FT   CDS_pept        770641..771024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0789"
FT                   /product="LSU ribosomal protein L19P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60180"
FT                   /db_xref="GOA:Q044E2"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q044E2"
FT                   /protein_id="ABJ60180.1"
FT                   /translation="MLMNAVEGEKIMDPLIQELTKEQLRDDMPDFRAGDTVRVHVRVVE
FT                   GTHERIQMFEGVVIKRKGAGISATYTVRKMSSGIGVERTFPVNDPRVAKVEVLRHGRVR
FT                   RAKLYYLRERHGKAARIAEKRRG"
FT   gene            complement(771118..771768)
FT                   /locus_tag="LGAS_0790"
FT                   /note="LactoCOG number LaCOG01525"
FT   CDS_pept        complement(771118..771768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0790"
FT                   /product="Signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0790"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60181"
FT                   /protein_id="ABJ60181.1"
FT                   /translation="MKKLKKQEQTESWGQWILQVLILVAIFFGIFFVLNKFVFANLTVS
FT                   GISMQPTFENNDRVIALRHAKIKQGDIVIVDAPDEPGALYIKRVIGLPGDTVVSKNNQI
FT                   YINGKKINQPWLKAGQKLIDNGEDGISGTKYTNTQNFTLSSLAKTQDYRQFYTSKQLKE
FT                   MQKTNKVPANTYFVMGDHRSVSKDSRYIGTIPRSKIVGVVKMRYWPLNHITFY"
FT   gene            771933..772361
FT                   /locus_tag="LGAS_0791"
FT                   /note="LactoCOG number LaCOG01683"
FT   CDS_pept        771933..772361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0791"
FT                   /product="NUDIX family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60182"
FT                   /protein_id="ABJ60182.1"
FT                   /translation="MKTVHEYSAGSIIYRINKNEIEFLLVQSMLNRTWGFPKGHLEAGE
FT                   NNVQAAKREVYEEVGLRPNYDFSFEESLTYKIARDRLKTVTLFLSEFIPSQKIKLQKSE
FT                   IGAFKWVNLEAASSCLHYEELNELLRKAQDYIKNEISR"
FT   gene            772345..772980
FT                   /locus_tag="LGAS_0792"
FT                   /note="LactoCOG number LaCOG03264"
FT   CDS_pept        772345..772980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0792"
FT                   /product="Uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60183"
FT                   /protein_id="ABJ60183.1"
FT                   /translation="MKYPDKLLAEVKERSKGMRLEGINFGAGPAHPKLMIIGEAPGREE
FT                   IESLIPFHGASGKELMKSLASIGLKREDVYITSAVRSRPYSVKKVFSKKENKEVTKYPN
FT                   RKPTKKEILAHAPLLDFELRYAQPKVIVTVGTTALSRLLDHKYEISKVHGKIIKNTSIL
FT                   ELNDKKDGYVWSKEKYTVVPQYHPAAVFYNRKLTDIIAQDWLNVKPLI"
FT   gene            complement(773029..773652)
FT                   /locus_tag="LGAS_0793"
FT                   /note="LactoCOG number LaCOG00321"
FT   CDS_pept        complement(773029..773652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0793"
FT                   /product="Transcriptional regulator, xre family"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0793"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60184"
FT                   /db_xref="GOA:Q044D8"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q044D8"
FT                   /protein_id="ABJ60184.1"
FT                   /translation="MTEPHANKQLEILRFIYDTVEERAFPPTVREICSAVDLSSTSTVH
FT                   GHLARLEKKGYILKDATKPRAIEVTEKGREALGIKPKDIPIVGVVTAGQPILAVQDIDE
FT                   YFPLPPDLENDAGELFMLRVHGESMINAGILNGDHVIVRKQSSANNGEIVVAMTEDNEA
FT                   TVKRFFKEDGYYRLQPENDTMDPIILPVVQILGKVVGLYRNNID"
FT   gene            773776..774039
FT                   /locus_tag="LGAS_0794"
FT                   /note="LactoCOG number LaCOG00734"
FT   CDS_pept        773776..774039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0794"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0794"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60185"
FT                   /protein_id="ABJ60185.1"
FT                   /translation="MRCLFMDKKEEEKLIKRINELTKISRERELTPGEVEERKKLRSAF
FT                   LENFRAGFRQQLEDTVVIDENGKEVTSEKAKEAQRRKGLRKD"
FT   gene            774112..774333
FT                   /locus_tag="LGAS_0795"
FT                   /note="LactoCOG number LaCOG00872"
FT   CDS_pept        774112..774333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0795"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0795"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60186"
FT                   /db_xref="GOA:Q044D6"
FT                   /db_xref="InterPro:IPR005359"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q044D6"
FT                   /protein_id="ABJ60186.1"
FT                   /translation="MNLGLAIFLIIIALLIGLVGGFYGARAYMKKYFQDNPPISEDMIA
FT                   AMMAQMGQKPSTKKLNQVMNMMKHQQQK"
FT   gene            774411..776177
FT                   /locus_tag="LGAS_0796"
FT                   /note="LactoCOG number LaCOG00862"
FT   CDS_pept        774411..776177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0796"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0796"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60187"
FT                   /protein_id="ABJ60187.1"
FT                   /translation="MNIFSKLGWFFKQEKKRYIIGISFLALTSIANLVPPRILGLMADQ
FT                   LDKGSISWGEYGALILAVVAAAIVLYLLRYFWRKQIWGGAAELERQMRSRLFKHFMVMD
FT                   RTFYQRHRTGDLMAHATNDINSIQNVAGDGILTLVDSLVTGGTTMIAMIIFTDFRLTII
FT                   ALLPLPFLALGAWKLGDKLHYSFDKSQAAFSRLNNKTQESVSGIKVLKAFGESKQDSAA
FT                   FNKMVDETIQINKKVFKWDSMFDPLGTLIIGATYVITIIYGGLLVTNHTLSVGQLVSFI
FT                   AYISNMVWPMFAIGYLFNILERGSASYDRVERLLYERPQITDENADQSLTAKDIQGDLK
FT                   YDIQSFSYPDEKEIPVLQNIDFTLKPGQTLGLVGKVGAGKTTIIELLLREFDRYQGKIT
FT                   LGGHDIRNIPLKLLLNEISYVPQNNFLFSTSIEKNIAFSDQDAAKSKIESAAQKSDLHD
FT                   DIMQMPAGYQTLVGENGVSLSGGQKQRLSIARALLKESPILILDDALSAVDAKTETAIL
FT                   DSLRSERKGKKTLIAAHRLTSVMDADLILVLKNGKIVERGKHDELLAQDGWYAEMWRKQ
FT                   ELQAKVGEVDGQ"
FT   gene            776167..777960
FT                   /locus_tag="LGAS_0797"
FT                   /note="LactoCOG number LaCOG00861"
FT   CDS_pept        776167..777960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0797"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0797"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60188"
FT                   /protein_id="ABJ60188.1"
FT                   /translation="MGNNEETKSVWSKAIPFKEQVQIFKRVLKYVKPFKVEMGIAVFGA
FT                   FLVSVINMLLPRGLQFFLDNYLIKQKATVQIIIWAGLLYGLGTIIKALLQFVYQYLYAL
FT                   GAEKTLESVRKDLYHKLHSLGMRYFDQTPAGSIVSRVTNDTMTLSDFLGVLCQVVIGVF
FT                   SLVTAFVAMYVTNKVAALIVLLFLPILGFVFWIYTQKSSKLYRGFRERLSRINTNLNES
FT                   IEGVSLIQQFKQEKRMTNHFENENGTLMKTRFNMIRVNSLLLSPMTSLLYSLALALVLM
FT                   YFGFPLQKTFVPAGIVYAFSQYVQQFFNPISTMMDRMTFFQDGIVAGKRIFRIMDETEY
FT                   EPKQEDDKNAVISKGKIEFKNVSFSYDGKHEILHNVSFVVNPGETLGIVGHTGSGKSSI
FT                   INVMMRFYEFGSGQVLIDDIDIRKFSKKELRKKLGLVLQEPFMFYGDISSNIRLYNDQI
FT                   TDQQIKKAAKAVQADSFIEKMPGRYHAKVIEGGSELSQGQRQLISFARTLVTDPKILVL
FT                   DEATANVDTETENLIQEGLKKLRQGRTTLAIAHRLSTIADADQIIVLDKGRIVERGTHT
FT                   ELLEKKGYYYNLYKLQQNSNK"
FT   gene            complement(778068..779192)
FT                   /locus_tag="LGAS_0798"
FT                   /note="LactoCOG number LaCOG01798"
FT   CDS_pept        complement(778068..779192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0798"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60189"
FT                   /protein_id="ABJ60189.1"
FT                   /translation="MLEKPLYKMMLSHSFNIPVKVTYWDGKSEVYGNGTPEVEVIFNKK
FT                   IPFKDITSNASLALGEAYMNKDLEIKGSIQQLIEAAYESSESFMRASKFRKFLPKQKHT
FT                   EKQSQEDIQSHYDIGNNFYKLWLDPTMTYSCAYFTNGNTDDLEAAQIAKVHHILQKLDP
FT                   KPGKTLLDIGCGWGTLMLTAAKEYGLKVTGVTLSQEQFDLVNKKIKDMGLEDQAEVLLE
FT                   DYRELGNRNFDYVTSVGMFEHVGSENLGEYFKDVAKYLKPHGVALIHGITRQQGGATNA
FT                   WINKYIFPGGYIPGLVEIVSRIEEANLQIADMEMLRRHYQRTLEIWDKNFNDHRSEVEG
FT                   MMGERFARMWDMYLQACAASFESGNIDVIQYLFN"
FT   gene            complement(779259..779909)
FT                   /locus_tag="LGAS_0799"
FT                   /note="LactoCOG number LaCOG00066"
FT   CDS_pept        complement(779259..779909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0799"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0799"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60190"
FT                   /protein_id="ABJ60190.1"
FT                   /translation="MYNTIHKIGGNNMFYKIIRPIARFIVWVLNGHLHVHHKDRIPKGN
FT                   YILVAPHRTWWEPILFALAASPMEFMFMAKKELFKNPVLRFILVHAHAFSVDRDNPGPS
FT                   AIKIPVKGLRKSDLSLIIFPSGTRHSEELKSGAFVIAKMANKPLVPVVYQGPLTFKGLL
FT                   KRQPLEVCFGDPIYIPRKEKVNKETTPALYQQLEDAWDKLDKEQNPSFHYIAK"
FT   gene            779942..780958
FT                   /locus_tag="LGAS_0800"
FT                   /note="LactoCOG number LaCOG01444"
FT   CDS_pept        779942..780958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0800"
FT                   /product="Predicted O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0800"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60191"
FT                   /protein_id="ABJ60191.1"
FT                   /translation="MDLLKPNERIDYMYNDDLRIIQEKDAFSFSLDTLLLGYFAQIKIH
FT                   DNYKVVDLCSGNAAASIYMSYFNRAHYDAVEIQADMADQASRSIKLNKLENRIEVHCLN
FT                   ALEAPKKLGKDKYDMVVVNPPYFKVPKGHVINPDEKKALARHELAINLEQIIKVSSDML
FT                   KMKGKMFMVHRPERLGEIMHYCLENHLSVKWVQPFVSKRNADANLVVVEAIRNTASDGL
FT                   TLRDAIVVHNPDGSFTPEIEQIISENKKQKKERYYFYCLLCNDGSFYGGFTNDLKHRLK
FT                   MHNEGRGAKYTKARRPVKMIYHEEFADKRLALKREYWFKHHSRKWKEEFLKEHNVKF"
FT   gene            781083..781898
FT                   /locus_tag="LGAS_0801"
FT                   /note="LactoCOG number LaCOG01450"
FT   CDS_pept        781083..781898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0801"
FT                   /product="SSU ribosomal protein S2P"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0801"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60192"
FT                   /db_xref="GOA:Q044D0"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q044D0"
FT                   /protein_id="ABJ60192.1"
FT                   /translation="MRGINQEEFFMTVVTMKQLLEAGVHFGHQTRRWDPKMAPYIFTQR
FT                   NGIYIIDLQKTIRMLDDAYNYVKAVAQDGGVFLFVGTKKQAQDAVKEEATRAGQYYVNQ
FT                   RWLGGTLTNWTTIQSRVKRLKQLKEMSEDGTFDVLPKKEVALLTKEMEKLERFLGGIED
FT                   MPRIPDVMFVVDPKKEKIAVHEANILGIPVVAMVDTNTDPDPIDVVIPANDDAIRAIRL
FT                   ISGAMADAIIEGKQGQDDSEDVEKEMADKAAAENDDEESIEEVVEKSED"
FT   gene            781936..782961
FT                   /locus_tag="LGAS_0802"
FT                   /note="LactoCOG number LaCOG01449"
FT   CDS_pept        781936..782961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0802"
FT                   /product="translation elongation factor Ts (EF-Ts)"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0802"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60193"
FT                   /db_xref="GOA:Q044C9"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q044C9"
FT                   /protein_id="ABJ60193.1"
FT                   /translation="MAKITAQLVKELRERTGAGVMDAKKALVEVDGDMDKAVQYLRDKG
FT                   MAKAAKKADRVAAEGLTGVYVDGNVAAITEVNSETDFVSSNDKFVNLVNAATKTIAEGK
FT                   PANMEAAEELKMADGTTLAQSFVDATATIGEKIVLRRFALEEKTDDQEFGAYQHNGGQI
FT                   GVITVLEGADAATAKHLAMHIAAMSPKVISPEELDDDFITDQLAVMNHKIDQDNESRAL
FT                   VNKKPLPYLVYGSEKQLSDEILAKAKEDIKAELKEEGKPEKIWDKIIPGKMQRFIDDNT
FT                   QVDKQFAVLSQNYIMDDSKTVGEFLKEKGAKLVAFQRYEVGEGIEKKQEDFAAEVREQM
FT                   K"
FT   gene            783071..783796
FT                   /locus_tag="LGAS_0803"
FT                   /note="LactoCOG number LaCOG01346"
FT   CDS_pept        783071..783796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0803"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.22"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0803"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60194"
FT                   /db_xref="GOA:Q044C8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q044C8"
FT                   /protein_id="ABJ60194.1"
FT                   /translation="MSQIKYKRIILKVSGEALAGEKGTGINPEVIKHLAEEIKSVHDMG
FT                   VEIGIVCGGGNMWRGETGANLGMERAQADYMGMLATIMNGLALQDGLENLGVPTRVQTS
FT                   IEMRQIAEPYIRRKAMRHLEKGRVVIFGGGTGNPYFSTDTTAALRAAEIDADVILMAKN
FT                   GVDGVYSADPKVDPNAKKYSELTQLDLISKNLKVMDSTASSLSMDNNIPLVVFNVNKPG
FT                   NIKKVVMGENIGTVIKGDK"
FT   gene            783796..784353
FT                   /locus_tag="LGAS_0804"
FT                   /note="LactoCOG number LaCOG01345"
FT   CDS_pept        783796..784353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0804"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0804"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60195"
FT                   /db_xref="GOA:Q044C7"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q044C7"
FT                   /protein_id="ABJ60195.1"
FT                   /translation="MANEVIEKAKDNMKKSIAVFQKELGGIRAGVANASLLEGIKVDYY
FT                   GVPTPLTQMSSVSIPEARVLMVTPYDKSSLDDIEHAILASDLGITPANDGTVIRIVIPQ
FT                   LTGERRQEIAKQVGKLAEKGKIAVRNVRRDAMDTLKRQEKNGDITEDEQRSLEKQVQKV
FT                   TDDATKEIDKLADQKSQEITQG"
FT   gene            784372..785091
FT                   /locus_tag="LGAS_0805"
FT                   /note="LactoCOG number LaCOG01436"
FT   CDS_pept        784372..785091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0805"
FT                   /product="Undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0805"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60196"
FT                   /protein_id="ABJ60196.1"
FT                   /translation="MSESKKSLNHLAIIMDGNGRWAKKRNLLRFVGHRHGMDNIRNIAL
FT                   AANEMGIKVLTLYAFSTENWARPTDEVNYLMRLPIDFFDKFMPELMENNVRVNIMGFLD
FT                   ELPEKTYLVTQKAMAETANNTGMVLNFAFNYGSRREITAGVQEIARQVKAGKINPSDID
FT                   EKMVSDHLLTHSLTPYDDPDLLIRTSGEERLSNFLLWQMAYTEFSFSNKLWPDFDKNDL
FT                   ENLVKDYYGRNRRFGKL"
FT   gene            785117..785908
FT                   /locus_tag="LGAS_0806"
FT                   /note="LactoCOG number LaCOG01435"
FT   CDS_pept        785117..785908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0806"
FT                   /product="CDP-diglyceride synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0806"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60197"
FT                   /protein_id="ABJ60197.1"
FT                   /translation="MKQRVITAIVALILFIPIVLMGGIWIDVLACAFAAVGISEIFIMK
FT                   KQIIVSWDFILALLATLTMAVPDSFFKFLPAFLNKYNVFYIFVMLMLVRTVLSKNRVTF
FT                   DDAGVYTIAALYIGTGFHFMAAIRNAHLGLAILGYVFAVVWSTDIAAYMVGRKIGKHKL
FT                   WPVISPNKTWEGSIGAVICAVIVAAVYVALVPTGRNNVLMIILAFFLSIIGQMGDLVES
FT                   AYKRFYGVKDSGKILPGHGGILDRFDSMLFVLPVVAFMGIL"
FT   gene            785921..787177
FT                   /locus_tag="LGAS_0807"
FT                   /note="LactoCOG number LaCOG01434"
FT   CDS_pept        785921..787177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0807"
FT                   /product="site-2 protease, Metallo peptidase, MEROPS family
FT                   M50B"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0807"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60198"
FT                   /protein_id="ABJ60198.1"
FT                   /translation="MKGILIFLVVFGILVFVHEFGHFIVAKKCGILVREFSIGMGPKLF
FT                   QKMRAKTTYTIRWLPLGGYVRLAGPDDAAKIDPGTTVVLQLDKQNKVKRIDASGSQMPI
FT                   EGIPVQVNSADLVDDLTIQGYENGNEDQLKTYAVDHDATIIEQNGTELLIAPRDTQFQE
FT                   ASVGKKLATNFADPFMNIILGFIVFIIWSLAAPGAPTTTVGNTIANQPAQIAGIKANDQ
FT                   IIAINDKKISNFNQIASELAKSKGKTVEVTVKRENKVKDFSVKPKARKINGQRIYQLGF
FT                   YGKPDNSLGAKLKRGWDTSISTTGLIFNAVGNLFRHFSLNKLSGPVGIYSQTVQVSNMG
FT                   FTYLLAFLAMISINLGIVNLIPIPGLDGGKLLLNLIQLIIGKPIPEDKEAIVDVIGFVI
FT                   LLLLIVAVTGNDIYRYFIK"
FT   gene            787194..788891
FT                   /locus_tag="LGAS_0808"
FT                   /note="LactoCOG number LaCOG01433"
FT   CDS_pept        787194..788891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0808"
FT                   /product="Prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0808"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60199"
FT                   /db_xref="GOA:Q044C3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q044C3"
FT                   /protein_id="ABJ60199.1"
FT                   /translation="MRQSKFFMPTLKEAPSDAVAKSHQLMLRGGYIRQVTAGVYAYLPL
FT                   GYRVLRKAENIIEEEMNNINVPEMIMPHLLPATLWQESGRYKKYGAEMFKLQDRHGRES
FT                   LLGPTHEETFTEIVAKNLKSYKQMPLALYQIQTKFRDENRPRFGLLRGREFVMLDGYSF
FT                   AATREQLDEQFDDQKSAYLKIFNRAGVTVHPVIADSGTMGGKNSTEFQAPAAIGEDTIA
FT                   TNEKGTYAANLEMAKSIDTFKQDPEDAKELTKVATPGMDTIDKLAEFLKVPATRIVKSI
FT                   LYIADDQKVLVLIRGDKEINEVKLGHVLDADEVRTANADELVEITGSEKGGVGPIGADW
FT                   ADKIVADETVKGLYNVVVGANETDYQYQNANLDRDFKVDEFADIRTANEGELDPVDHLP
FT                   LKFTTSIEVGHIFKLGTYYTKTMGADFLDNNGKAKPVIMGSYGIGVTRMLSAAVEQHLT
FT                   ENGIAWPKEIAPFDVHLIQMKMKDEAQTELAEKLEKELSTKYDVLYDDRNERPGVKFND
FT                   ADLVGAPLRITIGRKAKDGIVEVKRPTDEKAMEVNISDLDAMITKELG"
FT   gene            788897..793195
FT                   /locus_tag="LGAS_0809"
FT                   /note="LactoCOG number LaCOG01432"
FT   CDS_pept        788897..793195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0809"
FT                   /product="DNA polymerase III catalytic subunit, PolC type"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0809"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60200"
FT                   /protein_id="ABJ60200.1"
FT                   /translation="MANKNELFKKLLDQIKFPDKFEDNDIVQNGEIENVDVYANERKWK
FT                   IHVFFDTPLDFETYRSLNELIHQTFEPFVNVELIVRTKDGSSKNLPEYWTYAIQNSTNL
FT                   KPAVREFLQGQAPYLEKEKWLIPTQNNVVNGLLSEQVLAELNSEFRRYGFFNIKFTTKV
FT                   DETNIDENLKSLEQVQAQHESAMQEFYEKQPAEPKKKMPVKSTRMGSNKVDKKAKFIQI
FT                   KDLEDGSGNVAIEGHIFNTDIHELKSGSVIFTGEITDYTDSISFKKFVSDKEQIDYLKE
FT                   IKPGVWARMQGYAADDQYQHDVVFNIRNLELIEHKGREEKYEGEEKRVELHLHTNMSQL
FT                   DATSTASDFIKTAKKFGQKAIAITDHADVQAFPEAYHTGASEKMKILYGYEANMIDDHA
FT                   LLVLNPTEMDYRDREYVIFDVETTGLSSVYDTIIEIGAVKMKNGEVLERFDEFINPHHP
FT                   LSDTTINLTSITDEMVGAADDEKDVIKKFKDFYGDRPLCGHNVQFDVGFVNAALRRAGL
FT                   DEISQPVVDTLEVSRLLHPEQTRHTLDSLAKKYNVVLEHHHRANQDAEATGYLMFKLLD
FT                   AFNARFHEADLGKMNDYAKYGQVYKRAKPSHMSVLALNQEGLKNMYKLVSLASTKYFYR
FT                   IPRTPKSELRKYHKGLLFGSGCWQGDVFISMMQKGYDEAREKARFYDYLEVQPPAAYQT
FT                   LIDDDLIKDEDELHEIIQNIYKLGKELNKPVVATGDSHYVEPHEAIYRKILLAAQKSNP
FT                   NRNKKLPDLHFYSTQEMLDAFSFLGEDVAKEIVIENTNKLADQIEEIAPIKSGLYPPHI
FT                   ENADQEMKDLTYNKAYELYGKPLPKIVEDRIELELNSIISNGYAVIYLISQRLVAKSNK
FT                   DGYLVGSRGSVGSSLVATMSGITEVNPLAPHYRCPKCKYSKFFENGEYGSGYDLPDKNC
FT                   PKCGTPLVKDGQDIPFATFLGFHGDKVPDIDLNFSGDYQPVAHNYIRVMFGPDNSFRAG
FT                   TIATVADKTAYGYVKHYEDENELHLRNAELDRLAAGASGVKRTTGQHPAGIVVVPDDMD
FT                   IYDFTPVQYPADDLSAAWLTTHFDFHSIHDNILKFDILGHDDPTMIRMLQDLSGIDPLT
FT                   IPPDDPGVMSLFSSPKILGVTPEQIQSKTGTLGVPEFGTKFVRGMLEETKPTTFSELLQ
FT                   ISGLSHGTDVWLGNAEDLINNGTCKLKNVIGCRDNIMMDLIHWGVKPEVAFFTMESVRH
FT                   GKGISDENMEILKKNDKIPDWYIPSCLKIKYMFPKAHATAYILMALRIAWFKVYYPVIY
FT                   YASYFSVRADLFDLVAMSHGKNTVKAAMKEIQDKGMDVSAKDKSLLTVLEIANECLERG
FT                   IKIKMVDVNESEAMDFKIIDDHTILAPFNAVPGLGDNAAKQIVAARAEQKFLSKEDLAT
FT                   RGKVSQTIMEYFENNGVLEGMPDQNQLSLF"
FT   gene            793261..793779
FT                   /locus_tag="LGAS_0810"
FT                   /note="LactoCOG number LaCOG00520"
FT   CDS_pept        793261..793779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0810"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60201"
FT                   /db_xref="GOA:Q044C1"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q044C1"
FT                   /protein_id="ABJ60201.1"
FT                   /translation="MSSNAHSFYYGGRDLTKVTELVADVVTPLAEARGDELVDVEYVKE
FT                   KKQYYLRIYVDRRPGGIDIEEIANLSELVSEKLDELDPDPFPEPYILELSSPGLERPIK
FT                   NEKDWERAKGSYIHVSLYQKIDGEKTYEGTLKDLNQNQIVLEVKIKTRRKEITIPRKVI
FT                   ASSRFAVEF"
FT   gene            793748..795019
FT                   /locus_tag="LGAS_0811"
FT                   /note="LactoCOG number LaCOG00521"
FT   CDS_pept        793748..795019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0811"
FT                   /product="Transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0811"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60202"
FT                   /protein_id="ABJ60202.1"
FT                   /translation="MLLVALQLNFRKDDQKLMSKEMVEAFATLEKEKGIKQEIIVDAIK
FT                   AALVAAYKKNYNQAQNVEVVFDEKKGNFKVNAIKTVVDEVQDSRLEVSLKDALEINRAY
FT                   EVGDEIRFEVTPKDFGRLAAQTAKQVIMQRLREAEREHIISEYSQYKDEIVTGTVERRD
FT                   NRFVYVKIGNVEAVMTHNDQLPGENYNPQDKVRVLVTRVGSDSKGAQITVSRTAPDLVK
FT                   RLFEQEVPEVYDGTVEIVSIAREAGDRTKIAVKSNDPDIDPVGTLVGPKGTRVQNIVNE
FT                   LGGENIDVVKYEENPSDFIANALNPAEVIAVQFSGDDDDKNALVIVPDYQLSLAIGKRG
FT                   QNVRLAARLTGYKIDIKPESQVEFVDSEGDDVETDQDIDDSNVSNEEATESTAEQLEED
FT                   SSEDFPNGEDVDSALDDDADKDEE"
FT   gene            795030..795326
FT                   /locus_tag="LGAS_0812"
FT                   /note="LactoCOG number LaCOG00522"
FT   CDS_pept        795030..795326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0812"
FT                   /product="Predicted nucleic-acid-binding protein implicated
FT                   in transcription termination"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0812"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60203"
FT                   /protein_id="ABJ60203.1"
FT                   /translation="MKKRKIPMRKDLLTNTMQPKKELVRVVVDKDKNISVDPTGKKSGR
FT                   GAYVSLEPDKIAEAKKNQVLEKSLGVKVSADFYDDLYAYVDHQKARKELFGDK"
FT   gene            795329..795640
FT                   /locus_tag="LGAS_0813"
FT                   /note="LactoCOG number LaCOG00523"
FT   CDS_pept        795329..795640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0813"
FT                   /product="LSU ribosomal protein L7AE"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0813"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60204"
FT                   /protein_id="ABJ60204.1"
FT                   /translation="MHNKQKTLNLLGLAQKAGKLATGFDAVKISLSKNQAKLIFVGSDV
FT                   SQNTKDKLAFLMRKKDVKLVDVFSSAEITQALGKERKLVSVTDAGFSKAMIKNLNEGV"
FT   gene            795642..798290
FT                   /locus_tag="LGAS_0814"
FT                   /note="LactoCOG number LaCOG00524"
FT   CDS_pept        795642..798290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0814"
FT                   /product="bacterial translation initiation factor 2
FT                   (bIF-2)"
FT                   /note="IF-2; GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0814"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60205"
FT                   /db_xref="GOA:Q044B7"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q044B7"
FT                   /protein_id="ABJ60205.1"
FT                   /translation="MMAKKRIYEVAKELGIENKIVVKKAQDLGFDVKSHMSSLDDKQVS
FT                   KLVDSFKSANTTKPSTEKDSKNSSRKEKTKIKVSVGAIRRRDNKNDHDNRHGNNKRRNN
FT                   KFKKQQNDRRAERNKPQTEAKSAARDLLNKFKKKQRAEASELNAQTEASRRKWHQEQNP
FT                   QRSKVKKVENTRKPKEEKLEGAAAVKARVQASQKPVGPKIIKPSPARNKAKRPTVKKVE
FT                   PIAPVVPAPQKEETKPTRKKDFTRKKREVPDYERERSEHSDKARRRRNKKNKRINQSKE
FT                   IKKQPTQRKERPLPETLVYEEGMNAQDLGKLLHREPAEIVKKLFMLGVMTNQNQSLDKD
FT                   TIELLAAEYGIEAQEKVHEDISDIDTLYTKEMEESKASKHQEKRPPVVTIMGHVDHGKT
FT                   TLLDRLRHTNVSEHEAGGITQKIGAYQVRIDDRLITFLDTPGHAAFSNMRARGAEITDI
FT                   VVLVVAADDGVMPQTIEAIDHAKSAGVPIIVAVNKIDKPGANPDHVMEQLMKYGLVPED
FT                   WGGDTIFVKISAKTGKNVEELLQMILLQADVMELKADPDQKAIGTVIEARLDKGRGSVA
FT                   DVLVQQGTLKVGDPIVVGDTFGRVRVMTNDKGRRVKKATPSAPVEITGLNDVPEAADKL
FT                   VVFEDEKTARSVGEQRAKNALEKQRENVQHVTLDNLFDTMKKENMKEVDIVLKADVQGS
FT                   AEALQQSLEKIEVEGVRVNIIHSGVGAINESDVTLAGASNAFIVGFNVRPTNTAKSQAD
FT                   AEGVDIRLYNIIYKVMDDVEAAMKGMLEPTYEEKVTGNLTVRETWKVSKIGTIAGAFVD
FT                   NGYVTRDSGIRVIRDGIVKYDGKVASLKRFKDDVKEVKQGFDCGITIENFNDIKVDDQL
FT                   EAYEMQEVPVK"
FT   gene            798321..798692
FT                   /locus_tag="LGAS_0815"
FT                   /note="LactoCOG number LaCOG00525"
FT   CDS_pept        798321..798692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0815"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0815"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60206"
FT                   /db_xref="GOA:Q044B6"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q044B6"
FT                   /protein_id="ABJ60206.1"
FT                   /translation="MKHRIGRVEGEILRELTKILRKDIRDPRLSDITITAVECTNDLSY
FT                   ATIYYSLLTEDPAKEKEVAEGLDKAKGMMRHLLGQTLTVYKVPELIFKRDTSVAYGSKI
FT                   DNLINQVKKQDQERENKNK"
FT   gene            798733..799626
FT                   /locus_tag="LGAS_0816"
FT                   /note="LactoCOG number LaCOG00755"
FT   CDS_pept        798733..799626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0816"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0816"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60207"
FT                   /db_xref="GOA:Q044B5"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q044B5"
FT                   /protein_id="ABJ60207.1"
FT                   /translation="MLNGIVVVNKPRGVTSSDCVYKLRKILQIRKIGHAGTLDPEVNGV
FT                   LPIAIGQATKLIELMHEKPKSYIGSGMFGRATDSYDLDGKTIAEEKINTPFTSNEIIAG
FT                   MEKLTGKLEQVPPIYSAVRVNGKRLYEYARENIPVERPKRKVNVYSYELTQDPEYDPLE
FT                   KTESFNFAIRCSKGTYVRSLVNDLGEELGVPAVMTSLTRTSSSGYDLNQAVDLETIEAE
FT                   IDTPGKWLQPIDSFFAELPQLQLSPDQFKRVSNGASISLNTSYAKVALVYNGHIKAIYR
FT                   RQGKIYRPEMMLLKNE"
FT   gene            799639..800577
FT                   /locus_tag="LGAS_0817"
FT                   /note="LactoCOG number LaCOG00756"
FT   CDS_pept        799639..800577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0817"
FT                   /product="riboflavin kinase / FMN adenylyltransferase"
FT                   /EC_number="2.7.1.26"
FT                   /EC_number="2.7.7.2"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0817"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60208"
FT                   /protein_id="ABJ60208.1"
FT                   /translation="MKVITLDYPISAPITKQKVILTLGFFDGVHIGHQKLIKDAKLIAK
FT                   EKKLPLMVMTFDKHPKEIYKNDHKFVYLETAREKEQKMEKLGVDYLVIIKFTKKFSQLK
FT                   PQDFVDQVIMKLKADTVVVGFDYTYGPKDIANVENLPKFAQGRFQIMVEPKQSIDKIKV
FT                   GSTYIRKAIQHGNVELAAALLGQPYETSGIIVHGFRRGHKIGFPTANLEISGAKVLPAE
FT                   GVYATRAKINGKWHDAMTSVGYNETFKTNHGLTIETNIFNFDEEAYGKPLTLSWYKFIR
FT                   SNKKFSGIEELSRQLDQDKRNIKQYFYDLEK"
FT   gene            800829..802334
FT                   /locus_tag="LGAS_0818"
FT                   /note="LactoCOG number LaCOG00626"
FT   CDS_pept        800829..802334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0818"
FT                   /product="ATPase component of ABC transporter with
FT                   duplicated ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0818"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60209"
FT                   /protein_id="ABJ60209.1"
FT                   /translation="MSNIKISNLSFKYSDSIENIFNNLNLDLDSSWKLGLVGRNGRGKT
FT                   TFLNLLQGKLQGTGAIQSKLEFNYFPLNVKNKEQLTLYALEEHVQFDQWELERELNLMQ
FT                   VDTNLIWQPFNTLSGGEQTKVLLALSFINKDAFPLIDEPTNHLDEKSRIQVVRYLQKHS
FT                   QGYIVVSHDRDFLNQITNHILAIEHTEIHLYQGNYASYEDTKEKRDKFNQEKNEKLRGQ
FT                   IKALNESRQRIKGYSLQSENNKKASAHKNEIHADINKGFFGHKAAKIMKRSKNIERRMD
FT                   KDIQDRKGLMTNVESVPELEMNFQPNYHSTLLETRHLDLKVKDKKLFKDLNLIIRNRGI
FT                   VSLEGKNGAGKSTFLKSILNKSTDVTYQGILNLTNGLRVSYLPQDFVEYSGTLAEFSQK
FT                   EHLSYEKILNVLRKMGFPRSSFETRIEEMSIGQQKRVSIAKSLVEEADFYLWDEPANYL
FT                   DVFNQDQLIDVLRKTKPAMLLVEHDEYFISQVASKRIELKIVD"
FT   gene            802358..802984
FT                   /locus_tag="LGAS_0819"
FT                   /note="LactoCOG number LaCOG00159"
FT   CDS_pept        802358..802984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0819"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0819"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60210"
FT                   /protein_id="ABJ60210.1"
FT                   /translation="MAFDYKKEYKNLYHPKKQPEIIRVPKMNYIAVSGSGDPNQEDGTY
FT                   QKALGLLYGLAYTIKMSKKGEHKIPGYFDYVVPPLEGLWWSKDQQKIDYAHKENFAWIS
FT                   MIRLPDFVTKKEFDWAIKTATEKKKQDFSQAKFFTYDEGLCVQIMHTGSYDNEPATIEE
FT                   MHQFVKKENYQIDIQNPRYHHEIYLSDPRRTKTERLKTVIRLPIK"
FT   gene            803124..804182
FT                   /locus_tag="LGAS_0820"
FT                   /note="LactoCOG number LaCOG00660"
FT   CDS_pept        803124..804182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LGAS_0820"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:LGAS_0820"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ60211"
FT                   /db_xref="GOA:Q044B1"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q044B1"
FT                   /protein_id="ABJ60211.1"
FT                   /translation="MLTERQELILKTIIMDFTQSHEPVGSKTVMNQLPVKVSSATVRNE
FT                   MAALEEKGLLEKTHSSSGRIPSTAGYRYYLDHLINPVKIPASVYNRIIYQLDQPFQQVN
FT                   EIVQEAAKILSDLTNYTAFAAGPETRSVKVTGFRIVPLSSHQVMAILVTDDGNVKNQIY
FT                   TLPHHTNGEEIEKAVRLINDQLVGKPLSSVNEVLLKRIADHLVAGGSAPEILDLLQDVI
FT                   KDAASEQMYVDGQINLLSNYESDDLAKVKSLYKLIDQNDAISSLIGFNPKDEIKNDSKS
FT                   KVQVKLGSELQSDLLEDYSLLTAQYSVGKYGKGTIALLGPTNMPYSQMIGLLEYFRNEL
FT                   AKKLLDYYGRFK"
FT   gene            804194..804772
FT                   /locus_tag="LGAS_0821"
FT                   /note="LactoCOG number LaCOG00661"
FT   CDS_