(data stored in ACNUC1104 zone)

EMBL: CP000414

ID   CP000414; SV 1; circular; genomic DNA; STD; PRO; 2038396 BP.
XX
AC   CP000414; AABH02000000-AABH02000327;
XX
PR   Project:PRJNA315;
XX
DT   15-OCT-2006 (Rel. 89, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 12)
XX
DE   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293, complete genome.
XX
KW   .
XX
OS   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Leuconostocaceae;
OC   Leuconostoc.
XX
RN   [1]
RP   1-2038396
RX   DOI; 10.1073/pnas.0607117103.
RX   PUBMED; 17030793.
RA   Makarova K., Slesarev A., Wolf Y., Sorokin A., Mirkin B., Koonin E.,
RA   Pavlov A., Pavlova N., Karamychev V., Polouchine N., Shakhova V.,
RA   Grigoriev I., Lou Y., Rohksar D., Lucas S., Huang K., Goodstein D.M.,
RA   Hawkins T., Plengvidhya V., Welker D., Hughes J., Goh Y., Benson A.,
RA   Baldwin K., Lee J.H., Diaz-Muniz I., Dosti B., Smeianov V., Wechter W.,
RA   Barabote R., Lorca G., Altermann E., Barrangou R., Ganesan B., Xie Y.,
RA   Rawsthorne H., Tamir D., Parker C., Breidt F., Broadbent J., Hutkins R.,
RA   O'Sullivan D., Steele J., Unlu G., Saier M., Klaenhammer T., Richardson P.,
RA   Kozyavkin S., Weimer B., Mills D.;
RT   "Comparative genomics of the lactic acid bacteria";
RL   Proc. Natl. Acad. Sci. U.S.A. 103(42):15611-15616(2006).
XX
RN   [2]
RP   1-2038396
RG   US DOE Joint Genome Institute (JGI), The Lactic Acid Bacteria Genome
RG   Consortium and Fidelity Systems Inc.
RA   Lucas S., Copeland A., Detter J.C., Glavina del Rio T., Pitluck S.,
RA   Grigoriev I., Rokhsar D., Slesarev A., Pavlov A., Pavlova N.,
RA   Karamychev V., Polouchine N., Shakhova V., Kozyavkin S., Makarova K.,
RA   Koonin E., Mills D.A., Richardson P.;
RT   ;
RL   Submitted (22-MAY-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 4f435556b61fa0a474e83c9243a301b6.
DR   BioSample; SAMN02598482.
DR   EnsemblGenomes-Gn; EBG00001177426.
DR   EnsemblGenomes-Gn; EBG00001177427.
DR   EnsemblGenomes-Gn; EBG00001177428.
DR   EnsemblGenomes-Gn; EBG00001177429.
DR   EnsemblGenomes-Gn; EBG00001177430.
DR   EnsemblGenomes-Gn; EBG00001177431.
DR   EnsemblGenomes-Gn; EBG00001177432.
DR   EnsemblGenomes-Gn; EBG00001177433.
DR   EnsemblGenomes-Gn; EBG00001177434.
DR   EnsemblGenomes-Gn; EBG00001177435.
DR   EnsemblGenomes-Gn; EBG00001177436.
DR   EnsemblGenomes-Gn; EBG00001177437.
DR   EnsemblGenomes-Gn; EBG00001177438.
DR   EnsemblGenomes-Gn; EBG00001177439.
DR   EnsemblGenomes-Gn; EBG00001177440.
DR   EnsemblGenomes-Gn; EBG00001177441.
DR   EnsemblGenomes-Gn; EBG00001177442.
DR   EnsemblGenomes-Gn; EBG00001177443.
DR   EnsemblGenomes-Gn; EBG00001177444.
DR   EnsemblGenomes-Gn; EBG00001177445.
DR   EnsemblGenomes-Gn; EBG00001177446.
DR   EnsemblGenomes-Gn; EBG00001177447.
DR   EnsemblGenomes-Gn; EBG00001177448.
DR   EnsemblGenomes-Gn; EBG00001177449.
DR   EnsemblGenomes-Gn; EBG00001177450.
DR   EnsemblGenomes-Gn; EBG00001177451.
DR   EnsemblGenomes-Gn; EBG00001177452.
DR   EnsemblGenomes-Gn; EBG00001177453.
DR   EnsemblGenomes-Gn; EBG00001177454.
DR   EnsemblGenomes-Gn; EBG00001177455.
DR   EnsemblGenomes-Gn; EBG00001177456.
DR   EnsemblGenomes-Gn; EBG00001177457.
DR   EnsemblGenomes-Gn; EBG00001177458.
DR   EnsemblGenomes-Gn; EBG00001177459.
DR   EnsemblGenomes-Gn; EBG00001177460.
DR   EnsemblGenomes-Gn; EBG00001177461.
DR   EnsemblGenomes-Gn; EBG00001177462.
DR   EnsemblGenomes-Gn; EBG00001177463.
DR   EnsemblGenomes-Gn; EBG00001177464.
DR   EnsemblGenomes-Gn; EBG00001177465.
DR   EnsemblGenomes-Gn; EBG00001177466.
DR   EnsemblGenomes-Gn; EBG00001177467.
DR   EnsemblGenomes-Gn; EBG00001177468.
DR   EnsemblGenomes-Gn; EBG00001177469.
DR   EnsemblGenomes-Gn; EBG00001177470.
DR   EnsemblGenomes-Gn; EBG00001177471.
DR   EnsemblGenomes-Gn; EBG00001177472.
DR   EnsemblGenomes-Gn; EBG00001177473.
DR   EnsemblGenomes-Gn; EBG00001177474.
DR   EnsemblGenomes-Gn; EBG00001177475.
DR   EnsemblGenomes-Gn; EBG00001177476.
DR   EnsemblGenomes-Gn; EBG00001177477.
DR   EnsemblGenomes-Gn; EBG00001177478.
DR   EnsemblGenomes-Gn; EBG00001177479.
DR   EnsemblGenomes-Gn; EBG00001177480.
DR   EnsemblGenomes-Gn; EBG00001177481.
DR   EnsemblGenomes-Gn; EBG00001177482.
DR   EnsemblGenomes-Gn; EBG00001177483.
DR   EnsemblGenomes-Gn; EBG00001177484.
DR   EnsemblGenomes-Gn; EBG00001177485.
DR   EnsemblGenomes-Gn; EBG00001177486.
DR   EnsemblGenomes-Gn; EBG00001177487.
DR   EnsemblGenomes-Gn; EBG00001177488.
DR   EnsemblGenomes-Gn; EBG00001177489.
DR   EnsemblGenomes-Gn; EBG00001177490.
DR   EnsemblGenomes-Gn; EBG00001177491.
DR   EnsemblGenomes-Gn; EBG00001177492.
DR   EnsemblGenomes-Gn; EBG00001177493.
DR   EnsemblGenomes-Gn; EBG00001177494.
DR   EnsemblGenomes-Gn; EBG00001177495.
DR   EnsemblGenomes-Gn; EBG00001177496.
DR   EnsemblGenomes-Gn; EBG00001177497.
DR   EnsemblGenomes-Gn; EBG00001177498.
DR   EnsemblGenomes-Gn; EBG00001177499.
DR   EnsemblGenomes-Gn; EBG00001177500.
DR   EnsemblGenomes-Gn; EBG00001177501.
DR   EnsemblGenomes-Gn; EBG00001177502.
DR   EnsemblGenomes-Gn; EBG00001177503.
DR   EnsemblGenomes-Gn; EBG00001177504.
DR   EnsemblGenomes-Gn; EBG00001177505.
DR   EnsemblGenomes-Gn; EBG00001177506.
DR   EnsemblGenomes-Gn; EBG00001177507.
DR   EnsemblGenomes-Gn; EBG00001177508.
DR   EnsemblGenomes-Gn; EBG00001177509.
DR   EnsemblGenomes-Gn; EBG00001177510.
DR   EnsemblGenomes-Gn; EBG00001177511.
DR   EnsemblGenomes-Gn; EBG00001177512.
DR   EnsemblGenomes-Gn; EBG00001177513.
DR   EnsemblGenomes-Gn; EBG00001177514.
DR   EnsemblGenomes-Gn; EBG00001177515.
DR   EnsemblGenomes-Gn; EBG00001177516.
DR   EnsemblGenomes-Gn; EBG00001177517.
DR   EnsemblGenomes-Gn; EBG00001177518.
DR   EnsemblGenomes-Gn; EBG00001177519.
DR   EnsemblGenomes-Gn; EBG00001177520.
DR   EnsemblGenomes-Gn; LEUM_r0019.
DR   EnsemblGenomes-Gn; LEUM_r0021.
DR   EnsemblGenomes-Gn; LEUM_r0022.
DR   EnsemblGenomes-Gn; LEUM_r0163.
DR   EnsemblGenomes-Gn; LEUM_r0165.
DR   EnsemblGenomes-Gn; LEUM_r0166.
DR   EnsemblGenomes-Gn; LEUM_r1705.
DR   EnsemblGenomes-Gn; LEUM_r1706.
DR   EnsemblGenomes-Gn; LEUM_r1708.
DR   EnsemblGenomes-Gn; LEUM_r1832.
DR   EnsemblGenomes-Gn; LEUM_r1833.
DR   EnsemblGenomes-Gn; LEUM_r1835.
DR   EnsemblGenomes-Gn; LEUM_s0320.
DR   EnsemblGenomes-Gn; LEUM_t0020.
DR   EnsemblGenomes-Gn; LEUM_t0023.
DR   EnsemblGenomes-Gn; LEUM_t0024.
DR   EnsemblGenomes-Gn; LEUM_t0025.
DR   EnsemblGenomes-Gn; LEUM_t0026.
DR   EnsemblGenomes-Gn; LEUM_t0027.
DR   EnsemblGenomes-Gn; LEUM_t0028.
DR   EnsemblGenomes-Gn; LEUM_t0029.
DR   EnsemblGenomes-Gn; LEUM_t0030.
DR   EnsemblGenomes-Gn; LEUM_t0031.
DR   EnsemblGenomes-Gn; LEUM_t0032.
DR   EnsemblGenomes-Gn; LEUM_t0033.
DR   EnsemblGenomes-Gn; LEUM_t0034.
DR   EnsemblGenomes-Gn; LEUM_t0035.
DR   EnsemblGenomes-Gn; LEUM_t0036.
DR   EnsemblGenomes-Gn; LEUM_t0037.
DR   EnsemblGenomes-Gn; LEUM_t0056.
DR   EnsemblGenomes-Gn; LEUM_t0132.
DR   EnsemblGenomes-Gn; LEUM_t0164.
DR   EnsemblGenomes-Gn; LEUM_t0167.
DR   EnsemblGenomes-Gn; LEUM_t0168.
DR   EnsemblGenomes-Gn; LEUM_t0169.
DR   EnsemblGenomes-Gn; LEUM_t0170.
DR   EnsemblGenomes-Gn; LEUM_t0171.
DR   EnsemblGenomes-Gn; LEUM_t0172.
DR   EnsemblGenomes-Gn; LEUM_t0173.
DR   EnsemblGenomes-Gn; LEUM_t0174.
DR   EnsemblGenomes-Gn; LEUM_t0175.
DR   EnsemblGenomes-Gn; LEUM_t0176.
DR   EnsemblGenomes-Gn; LEUM_t0177.
DR   EnsemblGenomes-Gn; LEUM_t0178.
DR   EnsemblGenomes-Gn; LEUM_t0179.
DR   EnsemblGenomes-Gn; LEUM_t0180.
DR   EnsemblGenomes-Gn; LEUM_t0181.
DR   EnsemblGenomes-Gn; LEUM_t0235.
DR   EnsemblGenomes-Gn; LEUM_t0236.
DR   EnsemblGenomes-Gn; LEUM_t0237.
DR   EnsemblGenomes-Gn; LEUM_t0245.
DR   EnsemblGenomes-Gn; LEUM_t0291.
DR   EnsemblGenomes-Gn; LEUM_t0342.
DR   EnsemblGenomes-Gn; LEUM_t0365.
DR   EnsemblGenomes-Gn; LEUM_t0407.
DR   EnsemblGenomes-Gn; LEUM_t0408.
DR   EnsemblGenomes-Gn; LEUM_t0409.
DR   EnsemblGenomes-Gn; LEUM_t0413.
DR   EnsemblGenomes-Gn; LEUM_t0423.
DR   EnsemblGenomes-Gn; LEUM_t0514.
DR   EnsemblGenomes-Gn; LEUM_t0535.
DR   EnsemblGenomes-Gn; LEUM_t0622.
DR   EnsemblGenomes-Gn; LEUM_t0659.
DR   EnsemblGenomes-Gn; LEUM_t0744.
DR   EnsemblGenomes-Gn; LEUM_t1320.
DR   EnsemblGenomes-Gn; LEUM_t1333.
DR   EnsemblGenomes-Gn; LEUM_t1341.
DR   EnsemblGenomes-Gn; LEUM_t1465.
DR   EnsemblGenomes-Gn; LEUM_t1693.
DR   EnsemblGenomes-Gn; LEUM_t1707.
DR   EnsemblGenomes-Gn; LEUM_t1826.
DR   EnsemblGenomes-Gn; LEUM_t1827.
DR   EnsemblGenomes-Gn; LEUM_t1828.
DR   EnsemblGenomes-Gn; LEUM_t1829.
DR   EnsemblGenomes-Gn; LEUM_t1830.
DR   EnsemblGenomes-Gn; LEUM_t1831.
DR   EnsemblGenomes-Gn; LEUM_t1834.
DR   EnsemblGenomes-Gn; LEUM_t1858.
DR   EnsemblGenomes-Gn; LEUM_t1859.
DR   EnsemblGenomes-Gn; LEUM_t1865.
DR   EnsemblGenomes-Gn; LEUM_t1914.
DR   EnsemblGenomes-Gn; LEUM_t1924.
DR   EnsemblGenomes-Gn; LEUM_t1925.
DR   EnsemblGenomes-Gn; LEUM_t2056.
DR   EnsemblGenomes-Tr; EBT00001755469.
DR   EnsemblGenomes-Tr; EBT00001755470.
DR   EnsemblGenomes-Tr; EBT00001755471.
DR   EnsemblGenomes-Tr; EBT00001755472.
DR   EnsemblGenomes-Tr; EBT00001755473.
DR   EnsemblGenomes-Tr; EBT00001755474.
DR   EnsemblGenomes-Tr; EBT00001755475.
DR   EnsemblGenomes-Tr; EBT00001755476.
DR   EnsemblGenomes-Tr; EBT00001755477.
DR   EnsemblGenomes-Tr; EBT00001755478.
DR   EnsemblGenomes-Tr; EBT00001755479.
DR   EnsemblGenomes-Tr; EBT00001755480.
DR   EnsemblGenomes-Tr; EBT00001755481.
DR   EnsemblGenomes-Tr; EBT00001755482.
DR   EnsemblGenomes-Tr; EBT00001755483.
DR   EnsemblGenomes-Tr; EBT00001755484.
DR   EnsemblGenomes-Tr; EBT00001755485.
DR   EnsemblGenomes-Tr; EBT00001755486.
DR   EnsemblGenomes-Tr; EBT00001755487.
DR   EnsemblGenomes-Tr; EBT00001755488.
DR   EnsemblGenomes-Tr; EBT00001755489.
DR   EnsemblGenomes-Tr; EBT00001755490.
DR   EnsemblGenomes-Tr; EBT00001755491.
DR   EnsemblGenomes-Tr; EBT00001755492.
DR   EnsemblGenomes-Tr; EBT00001755493.
DR   EnsemblGenomes-Tr; EBT00001755494.
DR   EnsemblGenomes-Tr; EBT00001755495.
DR   EnsemblGenomes-Tr; EBT00001755496.
DR   EnsemblGenomes-Tr; EBT00001755497.
DR   EnsemblGenomes-Tr; EBT00001755498.
DR   EnsemblGenomes-Tr; EBT00001755499.
DR   EnsemblGenomes-Tr; EBT00001755500.
DR   EnsemblGenomes-Tr; EBT00001755501.
DR   EnsemblGenomes-Tr; EBT00001755502.
DR   EnsemblGenomes-Tr; EBT00001755503.
DR   EnsemblGenomes-Tr; EBT00001755504.
DR   EnsemblGenomes-Tr; EBT00001755505.
DR   EnsemblGenomes-Tr; EBT00001755506.
DR   EnsemblGenomes-Tr; EBT00001755507.
DR   EnsemblGenomes-Tr; EBT00001755508.
DR   EnsemblGenomes-Tr; EBT00001755509.
DR   EnsemblGenomes-Tr; EBT00001755510.
DR   EnsemblGenomes-Tr; EBT00001755511.
DR   EnsemblGenomes-Tr; EBT00001755512.
DR   EnsemblGenomes-Tr; EBT00001755513.
DR   EnsemblGenomes-Tr; EBT00001755514.
DR   EnsemblGenomes-Tr; EBT00001755515.
DR   EnsemblGenomes-Tr; EBT00001755516.
DR   EnsemblGenomes-Tr; EBT00001755517.
DR   EnsemblGenomes-Tr; EBT00001755518.
DR   EnsemblGenomes-Tr; EBT00001755519.
DR   EnsemblGenomes-Tr; EBT00001755520.
DR   EnsemblGenomes-Tr; EBT00001755521.
DR   EnsemblGenomes-Tr; EBT00001755522.
DR   EnsemblGenomes-Tr; EBT00001755523.
DR   EnsemblGenomes-Tr; EBT00001755524.
DR   EnsemblGenomes-Tr; EBT00001755525.
DR   EnsemblGenomes-Tr; EBT00001755526.
DR   EnsemblGenomes-Tr; EBT00001755527.
DR   EnsemblGenomes-Tr; EBT00001755528.
DR   EnsemblGenomes-Tr; EBT00001755529.
DR   EnsemblGenomes-Tr; EBT00001755530.
DR   EnsemblGenomes-Tr; EBT00001755531.
DR   EnsemblGenomes-Tr; EBT00001755532.
DR   EnsemblGenomes-Tr; EBT00001755533.
DR   EnsemblGenomes-Tr; EBT00001755534.
DR   EnsemblGenomes-Tr; EBT00001755535.
DR   EnsemblGenomes-Tr; EBT00001755536.
DR   EnsemblGenomes-Tr; EBT00001755537.
DR   EnsemblGenomes-Tr; EBT00001755538.
DR   EnsemblGenomes-Tr; EBT00001755539.
DR   EnsemblGenomes-Tr; EBT00001755540.
DR   EnsemblGenomes-Tr; EBT00001755541.
DR   EnsemblGenomes-Tr; EBT00001755542.
DR   EnsemblGenomes-Tr; EBT00001755543.
DR   EnsemblGenomes-Tr; EBT00001755544.
DR   EnsemblGenomes-Tr; EBT00001755545.
DR   EnsemblGenomes-Tr; EBT00001755546.
DR   EnsemblGenomes-Tr; EBT00001755547.
DR   EnsemblGenomes-Tr; EBT00001755548.
DR   EnsemblGenomes-Tr; EBT00001755549.
DR   EnsemblGenomes-Tr; EBT00001755550.
DR   EnsemblGenomes-Tr; EBT00001755551.
DR   EnsemblGenomes-Tr; EBT00001755552.
DR   EnsemblGenomes-Tr; EBT00001755553.
DR   EnsemblGenomes-Tr; EBT00001755554.
DR   EnsemblGenomes-Tr; EBT00001755555.
DR   EnsemblGenomes-Tr; EBT00001755556.
DR   EnsemblGenomes-Tr; EBT00001755557.
DR   EnsemblGenomes-Tr; EBT00001755558.
DR   EnsemblGenomes-Tr; EBT00001755559.
DR   EnsemblGenomes-Tr; EBT00001755560.
DR   EnsemblGenomes-Tr; EBT00001755561.
DR   EnsemblGenomes-Tr; EBT00001755562.
DR   EnsemblGenomes-Tr; EBT00001755563.
DR   EnsemblGenomes-Tr; LEUM_r0019-1.
DR   EnsemblGenomes-Tr; LEUM_r0021-1.
DR   EnsemblGenomes-Tr; LEUM_r0022-1.
DR   EnsemblGenomes-Tr; LEUM_r0163-1.
DR   EnsemblGenomes-Tr; LEUM_r0165-1.
DR   EnsemblGenomes-Tr; LEUM_r0166-1.
DR   EnsemblGenomes-Tr; LEUM_r1705-1.
DR   EnsemblGenomes-Tr; LEUM_r1706-1.
DR   EnsemblGenomes-Tr; LEUM_r1708-1.
DR   EnsemblGenomes-Tr; LEUM_r1832-1.
DR   EnsemblGenomes-Tr; LEUM_r1833-1.
DR   EnsemblGenomes-Tr; LEUM_r1835-1.
DR   EnsemblGenomes-Tr; LEUM_s0320-1.
DR   EnsemblGenomes-Tr; LEUM_t0020-1.
DR   EnsemblGenomes-Tr; LEUM_t0023-1.
DR   EnsemblGenomes-Tr; LEUM_t0024-1.
DR   EnsemblGenomes-Tr; LEUM_t0025-1.
DR   EnsemblGenomes-Tr; LEUM_t0026-1.
DR   EnsemblGenomes-Tr; LEUM_t0027-1.
DR   EnsemblGenomes-Tr; LEUM_t0028-1.
DR   EnsemblGenomes-Tr; LEUM_t0029-1.
DR   EnsemblGenomes-Tr; LEUM_t0030-1.
DR   EnsemblGenomes-Tr; LEUM_t0031-1.
DR   EnsemblGenomes-Tr; LEUM_t0032-1.
DR   EnsemblGenomes-Tr; LEUM_t0033-1.
DR   EnsemblGenomes-Tr; LEUM_t0034-1.
DR   EnsemblGenomes-Tr; LEUM_t0035-1.
DR   EnsemblGenomes-Tr; LEUM_t0036-1.
DR   EnsemblGenomes-Tr; LEUM_t0037-1.
DR   EnsemblGenomes-Tr; LEUM_t0056-1.
DR   EnsemblGenomes-Tr; LEUM_t0132-1.
DR   EnsemblGenomes-Tr; LEUM_t0164-1.
DR   EnsemblGenomes-Tr; LEUM_t0167-1.
DR   EnsemblGenomes-Tr; LEUM_t0168-1.
DR   EnsemblGenomes-Tr; LEUM_t0169-1.
DR   EnsemblGenomes-Tr; LEUM_t0170-1.
DR   EnsemblGenomes-Tr; LEUM_t0171-1.
DR   EnsemblGenomes-Tr; LEUM_t0172-1.
DR   EnsemblGenomes-Tr; LEUM_t0173-1.
DR   EnsemblGenomes-Tr; LEUM_t0174-1.
DR   EnsemblGenomes-Tr; LEUM_t0175-1.
DR   EnsemblGenomes-Tr; LEUM_t0176-1.
DR   EnsemblGenomes-Tr; LEUM_t0177-1.
DR   EnsemblGenomes-Tr; LEUM_t0178-1.
DR   EnsemblGenomes-Tr; LEUM_t0179-1.
DR   EnsemblGenomes-Tr; LEUM_t0180-1.
DR   EnsemblGenomes-Tr; LEUM_t0181-1.
DR   EnsemblGenomes-Tr; LEUM_t0235-1.
DR   EnsemblGenomes-Tr; LEUM_t0236-1.
DR   EnsemblGenomes-Tr; LEUM_t0237-1.
DR   EnsemblGenomes-Tr; LEUM_t0245-1.
DR   EnsemblGenomes-Tr; LEUM_t0291-1.
DR   EnsemblGenomes-Tr; LEUM_t0342-1.
DR   EnsemblGenomes-Tr; LEUM_t0365-1.
DR   EnsemblGenomes-Tr; LEUM_t0407-1.
DR   EnsemblGenomes-Tr; LEUM_t0408-1.
DR   EnsemblGenomes-Tr; LEUM_t0409-1.
DR   EnsemblGenomes-Tr; LEUM_t0413-1.
DR   EnsemblGenomes-Tr; LEUM_t0423-1.
DR   EnsemblGenomes-Tr; LEUM_t0514-1.
DR   EnsemblGenomes-Tr; LEUM_t0535-1.
DR   EnsemblGenomes-Tr; LEUM_t0622-1.
DR   EnsemblGenomes-Tr; LEUM_t0659-1.
DR   EnsemblGenomes-Tr; LEUM_t0744-1.
DR   EnsemblGenomes-Tr; LEUM_t1320-1.
DR   EnsemblGenomes-Tr; LEUM_t1333-1.
DR   EnsemblGenomes-Tr; LEUM_t1341-1.
DR   EnsemblGenomes-Tr; LEUM_t1465-1.
DR   EnsemblGenomes-Tr; LEUM_t1693-1.
DR   EnsemblGenomes-Tr; LEUM_t1707-1.
DR   EnsemblGenomes-Tr; LEUM_t1826-1.
DR   EnsemblGenomes-Tr; LEUM_t1827-1.
DR   EnsemblGenomes-Tr; LEUM_t1828-1.
DR   EnsemblGenomes-Tr; LEUM_t1829-1.
DR   EnsemblGenomes-Tr; LEUM_t1830-1.
DR   EnsemblGenomes-Tr; LEUM_t1831-1.
DR   EnsemblGenomes-Tr; LEUM_t1834-1.
DR   EnsemblGenomes-Tr; LEUM_t1858-1.
DR   EnsemblGenomes-Tr; LEUM_t1859-1.
DR   EnsemblGenomes-Tr; LEUM_t1865-1.
DR   EnsemblGenomes-Tr; LEUM_t1914-1.
DR   EnsemblGenomes-Tr; LEUM_t1924-1.
DR   EnsemblGenomes-Tr; LEUM_t1925-1.
DR   EnsemblGenomes-Tr; LEUM_t2056-1.
DR   EuropePMC; PMC2223689; 17993526.
DR   EuropePMC; PMC2519355; 18539796.
DR   EuropePMC; PMC2827410; 20078865.
DR   EuropePMC; PMC4696137; 26715526.
DR   EuropePMC; PMC4726968; 26877648.
DR   EuropePMC; PMC4735033; 26858930.
DR   EuropePMC; PMC5599536; 28912444.
DR   EuropePMC; PMC5691038; 29147021.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01492; rli28.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000414.
DR   SILVA-SSU; CP000414.
DR   StrainInfo; 505624; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2662187
CC   Source DNA and bacteria available from Fred Breidt
CC   (breidt@ncsu.edu)
CC   Bacteria also available from ATCC: ATCC 8293
CC   Contacts: Fred Breidt (breidt@ncsu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Annotation done by Kira Makarova and Eugene Koonin
CC   Finishing done by Fidelity Systems Inc. (Gaithersburg)
CC   http://www.fidelitysystems.com
CC   Project Information available at:
CC   http://genome.jgi-psf.org/mic_home.html
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2038396
FT                   /organism="Leuconostoc mesenteroides subsp. mesenteroides
FT                   ATCC 8293"
FT                   /sub_species="mesenteroides"
FT                   /strain="ATCC 8293"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:203120"
FT                   /culture_collection="ATCC:8293"
FT   gene            116..1462
FT                   /locus_tag="LEUM_0001"
FT                   /note="LactoCOG number LaCOG00001"
FT   CDS_pept        116..1462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0001"
FT                   /product="DNA replication ATPase initiation"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61173"
FT                   /db_xref="GOA:Q040E9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:Q040E9"
FT                   /protein_id="ABJ61173.1"
FT                   /translation="MTKPITKEELWSKVQAEFFTKLGRVTFSTYIEPLKPLTLGDTSLT
FT                   LAVPSDMAQDIIDQWDSEYSMDFVQFAMSIADGFIKPDLQVAEAKPTTIPTFSDNLSFT
FT                   RESDLNPDFTFEKFVIGSGNENAYAVARAVADEPGQVYNPYLIYGGVGLGKTHLMQAIG
FT                   NAYAVSTPSAHIKYATAEDFLNDFTESLRAGDGATAAFKQEYRSVDLLLVDDIQFWSGK
FT                   EKVQEEFFNTFNVLTKNGKQIVMTSDKLPTEIVDLQTRLTSRFEAGIMMDIQKPDLPTR
FT                   VAILQNLSESDGLDIPNDVLELIAEKIDSNVRSLEGAFHKFEASLRYMNKPATKETAQQ
FT                   ILGDLNINQGFKITVERIQQVVADYYMQTIDDLKSSSRKKDLVTARHVAMYLTRTLTNE
FT                   SLPDIGRSFGGRDHSSVLHATTKITEKSESDSRTKEMLDALTDEIKHGK"
FT   gene            1675..2811
FT                   /locus_tag="LEUM_0002"
FT                   /note="LactoCOG number LaCOG00002"
FT   CDS_pept        1675..2811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61174"
FT                   /db_xref="GOA:Q040E8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q040E8"
FT                   /protein_id="ABJ61174.1"
FT                   /translation="MQFTINRSAFIKALNDVSRAISSRTTIPILTNIKLVLNDEELVLT
FT                   GSNADISIETTVPQSDTSAQLIITTPGGITLPATFFINIVKRLPNDAMTLNIEGLRATI
FT                   TSGASSFTINGQDVQNYPQLPEMDDVQSLSVSAAQLVDIISQTKISASTQESRPILTGI
FT                   HLQLTGNSVKAVTTDSHRLSQRIVQLTGTDANNVDANVIIPAKSFNELQALLEGQDRVE
FT                   IKFSTNQAVFDLGHTTFYSRLLEGNYPETDRLIPTESTTQITIEASSLLGAIDRASLLS
FT                   HESRNNVVQLSLKAGRAVLTGTSQEVGQVTEELNANSIEGEDLEISFNPDYVRDALRIF
FT                   NGKRVDVKFTSNLRPFTLTPEGETDNKQLQLITPVRTF"
FT   gene            3004..3450
FT                   /locus_tag="LEUM_0003"
FT                   /note="LactoCOG number LaCOG01316"
FT   CDS_pept        3004..3450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0003"
FT                   /product="S4-like RNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61175"
FT                   /db_xref="GOA:Q040E7"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q040E7"
FT                   /protein_id="ABJ61175.1"
FT                   /translation="MTTSVRITTEYITLTQLLKEENIISSGGQAKYYLMDFPVLLNGET
FT                   ENRRGKKLYDHDEIVIDGETYTIELAENAEELIAEAETQRAERAMNAKKTVRDDRIKAQ
FT                   KAAAAKARKEARFAELRKKNRTRAGGFGRSTNKPKGPGSWNSNR"
FT   gene            3432..4556
FT                   /locus_tag="LEUM_0004"
FT                   /note="LactoCOG number LaCOG01317"
FT   CDS_pept        3432..4556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61176"
FT                   /db_xref="GOA:Q040E6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q040E6"
FT                   /protein_id="ABJ61176.1"
FT                   /translation="MELESLKLDHYRNYSDLTLEFSSGVNVFLGENAQGKTNLLESIYV
FT                   LALARSHRTSSDKDLVQWQAKEATISGRVKRSISETPLSLHFSNKGKKARVNHLEQSKL
FT                   SHYIGQLNVILFAPEDLELVKGAPSVRRRFIDMEFGQMNPLYLYNTTQYKRILKERNAY
FT                   LKRLQLKQTTDTVFLDVLSEQLVDVGSQILIARQEFLNKLELAAQPIHAEISDQREALK
FT                   LRYMSSVDFASDASLEEVKSVFADALSRQRSREIMQGSTMVGPHRDELQFDVNGNNVAI
FT                   FGSQGQQRTTALAIKLAEIDLMQQETGEYPVLLLDDVLSELDASRQTHLLLAIQDKVQT
FT                   FITAPTLSDIARQLIRKPRVFHVKQGVITLENDT"
FT   gene            4618..6636
FT                   /locus_tag="LEUM_0005"
FT                   /note="LactoCOG number LaCOG00631"
FT   CDS_pept        4618..6636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0005"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61177"
FT                   /db_xref="GOA:Q040E5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q040E5"
FT                   /protein_id="ABJ61177.1"
FT                   /translation="MAENNENIDQELESVDDIITDDEEIRHASTVDAKAGDYNADQIQV
FT                   LEGLEAVRKRPGMYIGTTTAQGLHHLVWEIVDNGIDEALAGFASHITVTIEKDNSITVT
FT                   DDGRGIPVDIQTKTGKPALETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTDLD
FT                   VKVVRDNKVYYMDFKVGRVHTTMRTLDEEPTIERGTIVHFKPDTDIFRETTTYNYKTLL
FT                   TRVRELAFLNKGLRISIADKRLEEPIKESFHFEGGIKEYVQYLNEDKQVIFPEPVYVEG
FT                   EENGIVVEAALQYTTDIKDSLRTFANNINTYEGGTHETGFKTALTRVINDYARKSGQIK
FT                   DGAESLTGEDVREGMTAIVSIKHPDPQFEGQTKTKLGNSDARQATDRMFSETFSRFMME
FT                   NPNVAKQIVEKGVLAQKARLAAKRAREMTRKQSGLEIGNLPGKLADNTSNDPAISELFI
FT                   VEGDSAGGSAKQGRNRVTQAILPIRGKILNVGKASLERVLANEEIRSLFTAMGTGFGDD
FT                   FNVEKANYHKVIIMTDADVDGAHIRTLLLTLFYRYMRPLVDAGYIYIAQPPLYGVALGN
FT                   NKSMTYLDSDEELESYLSQLPSNVKPKVQRYKGLGEMDYDQLADTTMDAQNRRLLRVDP
FT                   ADAEEAEAVIDMLMGGDVPPRRKFIEDNAVFVENLDI"
FT   gene            6711..9257
FT                   /locus_tag="LEUM_0006"
FT                   /note="LactoCOG number LaCOG00747"
FT   CDS_pept        6711..9257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0006"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61178"
FT                   /db_xref="GOA:Q040E4"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q040E4"
FT                   /protein_id="ABJ61178.1"
FT                   /translation="MSELNDSRIKNANLSEQMKTSFLSYAMSVIVARALPDVRDGMKPV
FT                   HRRILYSMIEQGNTPDKPHKKSARIVGDVMGKYHPHGDSAIYESMVRMAQPFSYRHMLI
FT                   DGHGNFGSVDGDGAAAMRYTEARLSKVAMEMVRDLNKDTVNFIPNYDGEEREPEVLPAR
FT                   FPNLLVNGATGIAVGMTTNIPTHNLAEVISALHILMNNPEATTADLMEALPGPDFPTGG
FT                   IVMGKSGIRRAYETGRGTVTVRAKVDIEQLKSGKEQIVVTELPYAVNKARLIERISELA
FT                   RDKKIEGITGIRDESDREGLRISIDVRRDASASVILNNLYKQTLLQTSFSFNMLAIDHG
FT                   APKTMSLKEILVAYLAHQREVIRRRTVFELQKAQARAHILEGLRIALDHIDEIITIIRS
FT                   SKTSEEAKTRLINGYALSDKQAQAILDMRLVRLTGLERDKIEEEYQKLVALIADLKDIL
FT                   AHEERVDEIIYNELLEIQTKFGDKRRTELQVGDVLSIEDEDLIEEEDVIVTLTNSGYIK
FT                   RVATGEFKAQNRGGRGVQGMNVHDEDFVDQMISTSTHDTLLFFTNKGKVYRMKGYEVPE
FT                   YGRQAKGIPVVNLLNFEGNEKIQTVINVRGEAGESNDYLFFVTRLGVVKRTAVKEFANI
FT                   RTNGLKALTLHDDDEVLSVQITDGTQNIIIATHNGYSVSFAENDVRVMGRSAAGVRGIR
FT                   LREGDLVVGSDVLEKDHNVLIITEKGYGKQTPVSEYPIKGRGGKGIKTANITEKNGPLA
FT                   GMTIVSGQEDIMVTTTQGVMIRFNVDSVSQTGRATLGVRLIRLEGNAKVATLAKVEHEE
FT                   VLEDVSRETSDKAPLDEQQIDQVSELLDRAQDDTDK"
FT   gene            9403..9876
FT                   /locus_tag="LEUM_0007"
FT                   /note="LactoCOG number LaCOG00917"
FT   CDS_pept        9403..9876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0007"
FT                   /product="Glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61179"
FT                   /db_xref="GOA:Q040E3"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q040E3"
FT                   /protein_id="ABJ61179.1"
FT                   /translation="MSIYDYFATLENGETYSLNKLANHPVVIVNTATKCGYAPQFGELE
FT                   KLYKKYKDKGLVILGFPSNQFKQELETASQAAQACQLTYGVTFPMHQLVAVNGKNTDPL
FT                   FKYLKENSKGMLGSSTIKWNFTKFLVDKEGNVVKRYAPKTEPKDLEEDIEDVL"
FT   gene            complement(9901..10614)
FT                   /locus_tag="LEUM_0008"
FT                   /note="LactoCOG number LaCOG01759"
FT   CDS_pept        complement(9901..10614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0008"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61180"
FT                   /db_xref="GOA:Q040E2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q040E2"
FT                   /protein_id="ABJ61180.1"
FT                   /translation="MIYLLEDDITQQKRIKQYIQHIHTFTSPANLLSAVLKDKTPKIIL
FT                   LDLEIKDVIYAGLQTAQLIRKNDIISPIIIVTTHCELSWHTFQHHISALDFIDKSQPES
FT                   AFAQQLKSAIYTADQVLKRYDKKSPNLITIRNGAHLVQFDLNHLSYVSSNKGTHYINVF
FT                   TKNGVSKIRNTIKTIASSHENFIQIHASFCINRDFIKQYLKSEKIIELTDGTLLPVTRK
FT                   FQHHLIQFKTPTIHT"
FT   gene            complement(10568..11401)
FT                   /locus_tag="LEUM_0009"
FT                   /note="LactoCOG number LaCOG01758"
FT   CDS_pept        complement(10568..11401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0009"
FT                   /product="Predicted signal transduction protein with a
FT                   C-terminal ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61181"
FT                   /db_xref="GOA:Q040E1"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q040E1"
FT                   /protein_id="ABJ61181.1"
FT                   /translation="MNPTLNLSITIPINMFLDSIWLVELTFIFLLIIMIYPLCRYFQQL
FT                   RTQHEYESRATQTYVTKLEQICSSYRHFQHDYKNILASLALAIDTKNLCEIEEVYHSFL
FT                   SESTSALPLSPTLNLQLITDLNLRSLLVVKNQYAIDSGLFFKVDIAEKFNMTVTLDLYR
FT                   TIGILLDNAIEGAINSIERKVILSILSDNDYHIVSITNTINQNVTLSNMNKNGFSTKPG
FT                   HSGIGLTFVEQYMARMPTISMHATLMNRNFTQTLTIGELHNDLSARRRHYTTKAY"
FT   gene            11667..13292
FT                   /locus_tag="LEUM_0010"
FT                   /note="LactoCOG number LaCOG00946"
FT   CDS_pept        11667..13292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0010"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61182"
FT                   /db_xref="GOA:Q040E0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q040E0"
FT                   /protein_id="ABJ61182.1"
FT                   /translation="MIFFLNATMQPQKSGIEHAQLKRADLFRAHGEQFKIVLREWDPLL
FT                   HENMKATSLKSFEVINMFDYFQEATEVSDQTITVDNLDFGVANTHRVEELKKNRYLIYD
FT                   INQQLIARVNYRTDQKQVASTELFDGFGNLYCVNMYDSRGFVSLSQWYTPDNKIGSETW
FT                   QSPEGRTVLEAFNKINSDGSVEKVCWRLISRVGEIHIFDTLEQVTLHFLNLLNDEYWSK
FT                   NEPNIFILDRAHLAQTVLRYLDKPSYNVLFLHNSHASDASHPEKGILNNNYEYSLFNIN
FT                   VYDAVVSATERQKNDIRSRFKPTTKLFTIPVGVIPMKQLQQQRVPMAERTFGKVVALAR
FT                   KAPEKQLDQLVKAVAYARQQVPQITLDLYGYKDPTNNFLAERLIESAIRENNLENIVTL
FT                   HDYTNQVALVEQDAQVFGVTSSMEGFNLSLMEALAQGDIGVTYDVNYGPNAIINEGKNG
FT                   YIVPLNDYKSMGEALIHIFKEPRLMQQLSDTSYEMSYRYSSDTVWAQWCLLLVDAKKMW
FT                   PVKQANYFHMTINDLKGADEESES"
FT   gene            13289..14761
FT                   /locus_tag="LEUM_0011"
FT                   /note="LactoCOG number LaCOG00947"
FT   CDS_pept        13289..14761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0011"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61183"
FT                   /db_xref="GOA:Q040D9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q040D9"
FT                   /protein_id="ABJ61183.1"
FT                   /translation="MNYFISENAFEFNSGTEFSQAARTSMYNSFGNLTLFVTRNYTPVF
FT                   HRTIKTLGLNDHQVLNMYDFFQEATRVSRAKQNLRESVTIPKKRYVIESPNPDQSLILN
FT                   EGRTVAKVNVMPATVALMGNVEYFDRFDHIVARDEWDYRGFKSSTAYFHPNGEVSLQKF
FT                   YTPVGKVVLEITHMNVQGHLMPTMYKLINYCGANYRFNTENELFTFFMNEQLKQNPGTI
FT                   ILERASMLNTIPGIKSTKGKYFYLHSSHTNLKGQLLTTLVELMRGALDFTGIIVATKQQ
FT                   QQDMQPLTTLPVLAAPDTIVKENKTNLLANCKSHKILVLGRIAKEKQPQDALYILKSVQ
FT                   ASVADATLEFRGYSTDRQLLNELDLLIEQLGLKNTVTFGNYVVGKMLDDVIEGAQVLLS
FT                   TVPTEGNGMQNIEAMSHGLPVIAYNVNYGPNTYMSNEQLVPIGNYDQAANRIVSLFQDD
FT                   KQWQEASILASQQAQLFTKDSVYKQWQDLNLQ"
FT   gene            14838..16286
FT                   /locus_tag="LEUM_0012"
FT                   /note="LactoCOG number LaCOG03121"
FT   CDS_pept        14838..16286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61184"
FT                   /db_xref="GOA:Q040D8"
FT                   /db_xref="InterPro:IPR022372"
FT                   /db_xref="UniProtKB/TrEMBL:Q040D8"
FT                   /protein_id="ABJ61184.1"
FT                   /translation="MPNWSELGVEIPQFNDSIHQAQLFLEQGQEVAFILCDYLPKLRGI
FT                   LSNKNIDKATVWSAFDVLQHIDLSAPRPVALNDFTWPDYAEFMTLTDRILVNVSGQHYA
FT                   TIWSDQLSFDHIDLFADDMMTQQLIIDDRGFVSKVIVFDEGNQVRTDYLTPSGDIALQE
FT                   DELTGLVTTQQLWTEQTQFSNMTVLIHELVSYYLNKIPDDENIIISPSVTTGEILEDIA
FT                   IKQPIIVSVQNNFVEVGKELGKISDFIVTDNERHQQQVIAFDGETKEVAIVPPYATDMV
FT                   ENEHLQSPLVSLFISAHNLSVAQQTIVIAALINIINEYDTTTVVFETSDKTSAMQKQIH
FT                   EASLKAKNEHGLVDQDSQMAFKSRFHFLETQNEEQLVRYMKHTQILIDLDNEPNQFLQT
FT                   VAINFSIPQINSAETVYLEPDKNGKVLADFAELDKAISFFLDNKKHFEIAQEVSADIQA
FT                   EYTSEMLWIKWQQVFNKIKSKMNN"
FT   gene            16314..17834
FT                   /locus_tag="LEUM_0013"
FT                   /note="LactoCOG number LaCOG02242"
FT   CDS_pept        16314..17834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0013"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61185"
FT                   /db_xref="GOA:Q040D7"
FT                   /db_xref="InterPro:IPR022267"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q040D7"
FT                   /protein_id="ABJ61185.1"
FT                   /translation="MTISILQIGAENWAPYITDKLDWHHTSVLDLPTFLAMQRDPYVLE
FT                   QTYVLLTDDHLESTLLSSQINEWPALRVIYFAHEVASDFQKILDERRAFRIEENTPENV
FT                   EKRIVTDMDTSQYGFSTRFSAEQFIPYVPEGIHLQRQGDFSTQFEGEFGEDWQQLGTLK
FT                   AGTSDFQSGRANEVWLEYNHTEKAEPALLFVFYKNGEVLTQQLIAGQSLRQLTTVAPPE
FT                   DYENYEILVLGKGQGTIDFYVIHQRASRHGLGHLLPGGTWQLTKENEEVLSYFNPGDRQ
FT                   KPLIVSFADTRLHVDGFEMQEALNRLGTPYLLFTDARVQGGAFDIGTAEYEATIIRIIK
FT                   QKMKTLGLRAEDLILMGASMGSYPALYYAADLNPAAVVIAKPIVNLGTFTAGSTISRGF
FT                   DYGWRLDVRRYLSGYVRPDDNVAMNEKLWEHIENTNWTNIKVALFSMSQDEYDGQSLGQ
FT                   LLDFFAKHNVPVKHESEEGQHTEKLDEMVDFMMTNLNVLQNTMRAEGE"
FT   gene            17834..18871
FT                   /locus_tag="LEUM_0014"
FT                   /note="LactoCOG number LaCOG03122"
FT   CDS_pept        17834..18871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61186"
FT                   /db_xref="GOA:Q040D6"
FT                   /db_xref="InterPro:IPR022259"
FT                   /db_xref="UniProtKB/TrEMBL:Q040D6"
FT                   /protein_id="ABJ61186.1"
FT                   /translation="MQYQIYWTPNTELLGLQGATVDFRSLNEVYYENYFLPSGEVVARW
FT                   HSTYNRMSGQPVVKADLPQLSHGETYVIERHIDASDRMFAYLVVTFFDQQYQPIATFSE
FT                   NTERLLINTPDEYAFYVIDLVSAGSGHFTFHNFDIRIKRAGILREDDQEIAPQLYNYLH
FT                   QPEKVTSKVLRVIFSEPEEAVTDYVTKKIKTTQQAVLFVASGTLKAGYYRQLELISGIK
FT                   TARKQAKAHSLEFVGYGPISSYAALYYQQQIKKSVAIISEDILLSPGKSEWTIERSVDG
FT                   VSYLTSSIMPNTQLDLIISHPKYERLETLTYETPTPEEYEQQLLYEAAHPKPGAFSKLF
FT                   GQKNK"
FT   gene            complement(18916..19290)
FT                   /locus_tag="LEUM_0015"
FT                   /note="LactoCOG number LaCOG00490"
FT   CDS_pept        complement(18916..19290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0015"
FT                   /product="Aromatic compounds catabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61187"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q040D5"
FT                   /protein_id="ABJ61187.1"
FT                   /translation="MNIIELLELKTTILSADKTVVELAVTDKIMQPYGIVHGGINALLA
FT                   ETAASLGAKEALSDNQFPVGVDIQTHHLKPVSKGILIATATPVNIGHSLQVWHVKITEN
FT                   ITNQLTSIATVTLKNQQKKS"
FT   gene            19326..20159
FT                   /locus_tag="LEUM_0016"
FT                   /note="LactoCOG number LaCOG00493"
FT   CDS_pept        19326..20159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0016"
FT                   /product="1,4-Dihydroxy-2-naphthoate synthase"
FT                   /EC_number="4.1.3.36"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61188"
FT                   /db_xref="GOA:Q040D4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q040D4"
FT                   /protein_id="ABJ61188.1"
FT                   /translation="MTTWSAIKKYDEILFEKNSDGKNPGKIAKITMNDVATHNAFTPGM
FT                   VSEMIDAFTIARDNAQIGVIILTGAGDKAFSSGGNQKVRGNGGYVGSDGIPRLNVLDLQ
FT                   RLMRIIPKPIIAMVKGWSVGGGNVLQLVADLTIAADNAKFGQTGPMVGSFDAGYGSGYL
FT                   ARVIGHKRAKEVWFLNHFYTAEEAYQMNWINKVVPINGVEDATIEWADELLTKSPTALR
FT                   FIKAAMNADTDGLAGLQQFAGDATMLYYTSDEAKEGRDSFKEKRDPDFDQFPKFP"
FT   gene            20180..20974
FT                   /locus_tag="LEUM_0017"
FT                   /note="LactoCOG number LaCOG01611"
FT   CDS_pept        20180..20974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0017"
FT                   /product="Predicted amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61189"
FT                   /db_xref="GOA:Q040D3"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q040D3"
FT                   /protein_id="ABJ61189.1"
FT                   /translation="MTLKIAIAQIDIALGKPAINEQTVIEYAQKAAAVEADILVYPEMW
FT                   NTGYDLLNLETVSDPQGQRSVNLLRDLAKKYHLNIVGGSVATAQAENKFYNTMFVFNDK
FT                   GEQVSEYNKLHLFGLMNEEKFMSAGNKTNLFNLADVPSAGAICYDIRFPEWLRTMMSQG
FT                   PQEILYIVAEWPIQRIKQWQLLLQARAIENQTFVVAANRVGRDNDNTFGGRSLIIDPLG
FT                   NIVQQASDDKVELLVAEININDEKAIRGEIPVFSDRRPELYR"
FT   gene            20987..22171
FT                   /locus_tag="LEUM_0018"
FT                   /note="LactoCOG number LaCOG01602"
FT   CDS_pept        20987..22171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0018"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61190"
FT                   /db_xref="GOA:Q040D2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q040D2"
FT                   /protein_id="ABJ61190.1"
FT                   /translation="MHFEESDLLKTLPKQFFATLVAKVNAKIAAGKDVINLGQGNPDQP
FT                   TPEYIVESLQAAAENPADHKYSLFRGEERFKKAIAEFYADEYGVSIDPETEVAILAGSK
FT                   IGLVELPWALMNPGETLLLPDPGYPDYLSAAALGRVNYEAVPLKQENNFLVDYEAIPNS
FT                   VAEAAKFLYLNYPNNPTGAIATSEFYQQTVRFAEENQVGIVSDFAYGAIGYDGHKPLSF
FT                   LQTENSKSVGIETYTFSKTFNMAGWRVGFAVGNAEMIEALNLIQDHLFVSLFPAVQDAA
FT                   IEALTNRAAREKAVTDLTNLYQRRRDVFINAVREFGWEPYVPRGAFYVLMPVPKGYTSS
FT                   EFADLLLEEANVAVADASGFGKGGQGYIRVGLTIVEERLAEAAKRISKLPIFSK"
FT   gene            22669..24217
FT                   /locus_tag="LEUM_r0019"
FT   rRNA            22669..24217
FT                   /locus_tag="LEUM_r0019"
FT                   /product="16S ribosomal RNA"
FT   gene            24330..24402
FT                   /locus_tag="LEUM_t0020"
FT                   /note="tRNA_Ala_TGC"
FT   tRNA            24330..24402
FT                   /locus_tag="LEUM_t0020"
FT                   /product="tRNA-Ala"
FT   gene            24593..27506
FT                   /locus_tag="LEUM_r0021"
FT   rRNA            24593..27506
FT                   /locus_tag="LEUM_r0021"
FT                   /product="23S ribosomal RNA"
FT   gene            27624..27712
FT                   /locus_tag="LEUM_r0022"
FT   rRNA            27624..27712
FT                   /locus_tag="LEUM_r0022"
FT                   /product="5S ribosomal RNA"
FT   gene            27762..27855
FT                   /locus_tag="LEUM_t0023"
FT                   /note="tRNA_Ser_GGA"
FT   tRNA            27762..27855
FT                   /locus_tag="LEUM_t0023"
FT                   /product="tRNA-Ser"
FT   gene            27857..27929
FT                   /locus_tag="LEUM_t0024"
FT                   /note="tRNA_Val_TAC"
FT   tRNA            27857..27929
FT                   /locus_tag="LEUM_t0024"
FT                   /product="tRNA-Val"
FT   gene            27970..28042
FT                   /locus_tag="LEUM_t0025"
FT                   /note="tRNA_Thr_TGT"
FT   tRNA            27970..28042
FT                   /locus_tag="LEUM_t0025"
FT                   /product="tRNA-Thr"
FT   gene            28051..28122
FT                   /locus_tag="LEUM_t0026"
FT                   /note="tRNA_Gly_GCC"
FT   tRNA            28051..28122
FT                   /locus_tag="LEUM_t0026"
FT                   /product="tRNA-Gly"
FT   gene            28128..28211
FT                   /locus_tag="LEUM_t0027"
FT                   /note="tRNA_Leu_TAA"
FT   tRNA            28128..28211
FT                   /locus_tag="LEUM_t0027"
FT                   /product="tRNA-Leu"
FT   gene            28217..28290
FT                   /locus_tag="LEUM_t0028"
FT                   /note="tRNA_Arg_ACG"
FT   tRNA            28217..28290
FT                   /locus_tag="LEUM_t0028"
FT                   /product="tRNA-Arg"
FT   gene            28359..28432
FT                   /locus_tag="LEUM_t0029"
FT                   /note="tRNA_Pro_TGG"
FT   tRNA            28359..28432
FT                   /locus_tag="LEUM_t0029"
FT                   /product="tRNA-Pro"
FT   gene            28461..28534
FT                   /locus_tag="LEUM_t0030"
FT                   /note="tRNA_Met_CAT"
FT   tRNA            28461..28534
FT                   /locus_tag="LEUM_t0030"
FT                   /product="tRNA-Met"
FT   gene            28548..28621
FT                   /locus_tag="LEUM_t0031"
FT                   /note="tRNA_Met_CAT"
FT   tRNA            28548..28621
FT                   /locus_tag="LEUM_t0031"
FT                   /product="tRNA-Met"
FT   gene            28646..28735
FT                   /locus_tag="LEUM_t0032"
FT                   /note="tRNA_Ser_TGA"
FT   tRNA            28646..28735
FT                   /locus_tag="LEUM_t0032"
FT                   /product="tRNA-Ser"
FT   gene            28767..28840
FT                   /locus_tag="LEUM_t0033"
FT                   /note="tRNA_Met_CAT"
FT   tRNA            28767..28840
FT                   /locus_tag="LEUM_t0033"
FT                   /product="tRNA-Met"
FT   gene            28843..28916
FT                   /locus_tag="LEUM_t0034"
FT                   /note="tRNA_Asp_GTC"
FT   tRNA            28843..28916
FT                   /locus_tag="LEUM_t0034"
FT                   /product="tRNA-Asp"
FT   gene            28937..29009
FT                   /locus_tag="LEUM_t0035"
FT                   /note="tRNA_Phe_GAA"
FT   tRNA            28937..29009
FT                   /locus_tag="LEUM_t0035"
FT                   /product="tRNA-Phe"
FT   gene            29037..29107
FT                   /locus_tag="LEUM_t0036"
FT                   /note="tRNA_Gly_TCC"
FT   tRNA            29037..29107
FT                   /locus_tag="LEUM_t0036"
FT                   /product="tRNA-Gly"
FT   gene            29140..29213
FT                   /locus_tag="LEUM_t0037"
FT                   /note="tRNA_Ile_GAT"
FT   tRNA            29140..29213
FT                   /locus_tag="LEUM_t0037"
FT                   /product="tRNA-Ile"
FT   gene            29609..30814
FT                   /locus_tag="LEUM_0038"
FT                   /note="LactoCOG number LaCOG00095"
FT   CDS_pept        29609..30814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0038"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61191"
FT                   /db_xref="GOA:Q040D1"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q040D1"
FT                   /protein_id="ABJ61191.1"
FT                   /translation="MEEKLFNKGFLTITIINFIVYLVYYLMMVIIAVVAHNQLHASFGQ
FT                   AGLASGIYIIGTLIARLIVGKELELIGRKKIVRWGAILYLITTIAYLFVPTVAILDAVR
FT                   LFNGFAYGMTSTALNAIVTEFIPEKRKGEGINYYGLSTSLAAAIGPFIGLLLLNATSFR
FT                   FIVILSVILIGISMVALFAIKINNVTLSPEHLSELKSWKVSSFIEFKVLLIAGVGFLMG
FT                   LSYSSVLSFLASYAETLNLVSISSFFFVVYAGIVTLTRPMSGRIFDRFGENYVMYPSYF
FT                   FLALGLVVLALTHNGFTLLLSGAFIGLGYGTFMSNGQAVSLKLVSSHRVGIALSTYFIG
FT                   LDLGLGVGPYALGALHAVLTFRELYLVSAVIPVISAILYLVFYHPDRIKKNVATIPSEE
FT                   LA"
FT   gene            complement(30860..31636)
FT                   /locus_tag="LEUM_0039"
FT                   /note="LactoCOG number LaCOG00767"
FT   CDS_pept        complement(30860..31636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0039"
FT                   /product="Predicted sugar phosphatase of the HAD
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61192"
FT                   /db_xref="GOA:Q040D0"
FT                   /db_xref="InterPro:IPR006354"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q040D0"
FT                   /protein_id="ABJ61192.1"
FT                   /translation="MSKYKAYFIDLDGTIYQGNKKMPSGKRFIDRLKAANIPYLFVTNN
FT                   STKNPEDVADNLTKNHDIETSADQVYTSSMATADFLKTIASPDKKRVYIIGESGLRDAL
FT                   INADFTITSDENADFVVAGLDRAFNYEKLTTATLAIQQGAQFIATNRDTNLPNERGMLP
FT                   GAGSLISAIQTATQVEPTVIAKPEIPIMDGALNKLHINQQDVVMVGDNYNTDILAGINS
FT                   QIDTLLVYSGVSTPKQISQMVQKPTHEVETLDNWTI"
FT   gene            31872..32315
FT                   /locus_tag="LEUM_0040"
FT                   /note="LactoCOG number LaCOG01686"
FT   CDS_pept        31872..32315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61193"
FT                   /db_xref="UniProtKB/TrEMBL:Q040C9"
FT                   /protein_id="ABJ61193.1"
FT                   /translation="MPKKYRTPPFLTPSAIVSLIVAISAANLAVNVATGTSEGGKVSSS
FT                   ASSAMSTSMITSSTTSKSTSSDDKSSSSSTSSSDDESSSTSDDTSGEDTSSAATTSAAD
FT                   TTTSSAATSSSGTSSSATSSSDNNATSSSSNATRTTSSSEDTQ"
FT   gene            32315..33106
FT                   /locus_tag="LEUM_0041"
FT                   /note="LactoCOG number LaCOG01687"
FT   CDS_pept        32315..33106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61194"
FT                   /db_xref="GOA:Q040C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q040C8"
FT                   /protein_id="ABJ61194.1"
FT                   /translation="MLTVLDLINHYLGYFTTNSKTKGRIYTVVGAGGVWYLLYLAYRFF
FT                   VNGRWLRGALIAAVFLLLLYFVILNIIYYFTKHTSKWDVSPRIEKLLGGPHEEKSERES
FT                   ETVIMPANGLYSRQNVMSGTVVSDAQQQANLDTLALEMRQLDLIANDYGHLGEQAQRQI
FT                   IAQQGVIYANHPGTLLPYFAMRENNGTLQIFGGINQLQARELGNVSMVGLTPTAQALTN
FT                   YRLAIASVVLIGGPSHLATRSELVDDVQPYKIKIEIAYDHI"
FT   gene            complement(33142..33582)
FT                   /locus_tag="LEUM_0042"
FT                   /note="LactoCOG number LaCOG00687"
FT   CDS_pept        complement(33142..33582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0042"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61195"
FT                   /db_xref="GOA:Q040C7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:Q040C7"
FT                   /protein_id="ABJ61195.1"
FT                   /translation="MKIQIKHEQGLGPIHEDALAIRKAVFIVEQGVDIKDELNDQAAEE
FT                   NAIHIVIYVDNKLAATARVLAESDDTWHIQRVATLFPLRGQGLGRKLMEYIETLAPSYG
FT                   IQNLVLGAQVQARGFYESLGFAAIGATFFEAGIQHIHMKKEL"
FT   gene            33684..35882
FT                   /locus_tag="LEUM_0043"
FT                   /note="LactoCOG number LaCOG00559"
FT   CDS_pept        33684..35882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0043"
FT                   /product="Phosphoglycerol transferase related protein,
FT                   alkaline phosphatase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61196"
FT                   /db_xref="GOA:Q040C6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q040C6"
FT                   /protein_id="ABJ61196.1"
FT                   /translation="MIVMKKYLKNIWHETLAPKNWIKQLNTRTGFFTWTVVLFTLKTIL
FT                   AYGADFYWLHVSDPLQIFLMLVNPIGFTIIIFSIALFIKPKQLYYGALILLDAAMTGLL
FT                   YLNVIYFREFSDFMSVNTMLGYSSVNQGGKAAGAIAFGIHDVFFWIDIIILIGLFLARK
FT                   IHFDSRPMMRLQPFKILTIGVFIFMANLLLADLNRPQLLVRQFDREYMVKYLGIGPFTI
FT                   YDAINTYQTSQIRKTATPSELTAVQNYIKKNYAAINPKFYGKAKGKNVIVIHLESFQQM
FT                   SIDRKINGQEVTPFLNSLYHSKSTIAFDNFFNQVGQGKTSDAENMLETSTFGLPQGSLF
FT                   TKLGDDQTFQAMPAILNQRAGYSSAVFHGNMGSFWNRSTVYKRMGYQNWVSGDYFDITG
FT                   KKATSWGLKDKLLFHNSVPYLERLQQPFYAKYLTVTNHTPFTLDKQDQDPNFQTSNTGS
FT                   KLVDNYFITNHYLDQSVKEFFAYLKKSGLYKNTAVVLYGDHYGISNTDASYLASILGKD
FT                   SDDWTDLDNANLQRVPFIVHIPGMKNGYVDHTYGGEIDVAPTIEHLLGISTKRYIQFGQ
FT                   DLLSKNHKQIVVFRNKDWITPEYASLSGRIWNTKTGQEITTPGKALQAKVDKIQAYVNK
FT                   KLSMSDNLNQKNLLKFYTPEGFKTVKANSFDYSKEATIKRLKKQNKKLGTKSTSLFAQN
FT                   GNKSTLSDYITDAPEVDDETTDTTRLLPRNADDWSNDE"
FT   gene            35936..36997
FT                   /locus_tag="LEUM_0044"
FT                   /note="LactoCOG number LaCOG01935"
FT   CDS_pept        35936..36997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0044"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61197"
FT                   /db_xref="GOA:Q040C5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q040C5"
FT                   /protein_id="ABJ61197.1"
FT                   /translation="MAKILIALENIELGGMKRATTVVGNALAASHEVTYYSFSDLPPFY
FT                   GLSAPLVVASPALRLTSESHPFKRYAQAIENFSLLAQRYDVVILAGGLLSSFAAVLKPK
FT                   LPRTKLLGWMHNNITTYRDQYYAMMREEFIAGLRVLDAVVVLTDFDLGGFKKYNERTVK
FT                   IWNPLTIAPKGPSKLEKHIISFTARIAIQHKGIDFAVQLATKLPDDWQLAIAGGGMQED
FT                   METFEQLINEYGAHEKIIYRGPLKDNELRDHYRNSSLFLQTSRWEGLPLVLVEAMSFGL
FT                   PIIAMRQTGSAEVLKEGEFGVLIENGDIDGAAIAIQRLINSRQQQLDLAEKSLNRVRDF
FT                   QIEPILKQWEALF"
FT   gene            37065..37505
FT                   /locus_tag="LEUM_0045"
FT                   /note="LactoCOG number LaCOG01710"
FT   CDS_pept        37065..37505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0045"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61198"
FT                   /db_xref="GOA:Q040C4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q040C4"
FT                   /protein_id="ABJ61198.1"
FT                   /translation="MDNRSTIHKKTAFDKLQFGIGDLARMTGVSTRQLRYWEKQGYVKA
FT                   LDRNDDQESRLYGFRAFLKVSIIKQHIDDGDTLRTAVIHANEHIDSAMITKHIMKQAFQ
FT                   GLEDFQGTVAVNMGYFDDDETQLLYVFLEDGKAKYRVVDSKK"
FT   gene            37588..38481
FT                   /locus_tag="LEUM_0046"
FT                   /note="LactoCOG number LaCOG01423"
FT   CDS_pept        37588..38481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0046"
FT                   /product="Pseudouridylate synthase, 23S RNA-specific"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61199"
FT                   /db_xref="GOA:Q040C3"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q040C3"
FT                   /protein_id="ABJ61199.1"
FT                   /translation="MKKWQYNFIITSQNSGQTVKELLIKWYVPQRIRGALRIKKHFSVN
FT                   NIIVPTNYELRTGDQLQLNFDADDFRTSESNYLPNHQKSVNIIFENKDLVVIDKPAGMK
FT                   MHPHSPTETDTLLNYLAGEFIQRKVSDQPYMVHRIDRATSGLVIVAKNPVVVPILDRML
FT                   ADKRIVRTYVTWVSGVVQDNHGTIAKPIGIDARDDRKRAVDGKEAQVAMTHWWRMHTVF
FT                   CSSLLRVQLSTGRMHQIRVHLASIGHPIVGDELYGGVYNGRMLLHSATIKIPLPFDEGV
FT                   RMITGPLPSDFPRQLR"
FT   gene            complement(38555..39307)
FT                   /locus_tag="LEUM_0047"
FT                   /note="LactoCOG number LaCOG00842"
FT   CDS_pept        complement(38555..39307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0047"
FT                   /product="Glycerol uptake facilitator related permease"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61200"
FT                   /db_xref="GOA:Q040C2"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:Q040C2"
FT                   /protein_id="ABJ61200.1"
FT                   /translation="MRKYIAEFLGTFMLVFFGTGSVVYSAATTQSAITVGLAFGLSLAV
FT                   AIYAFGHISGGHFNPAVSLAMAIQKRLPWVTFIGYVIAQLLGAIVASAAVYGGVTAYLK
FT                   SSTVTTALSGQSMTVKQFVSLAGLGQTNFSDGSGWYAFAFELVLTFLFVLVIAIVTKLN
FT                   NVPAPFIIGIWLAVLIVVVLPITGGAFNPARALAPAIFVQGKALTHVWVYLVADLLGGA
FT                   LAAFAANFLDKKEEVASTPKEVKETKKA"
FT   gene            complement(39400..41451)
FT                   /locus_tag="LEUM_0048"
FT                   /note="LactoCOG number LaCOG00575"
FT   CDS_pept        complement(39400..41451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0048"
FT                   /product="Cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61201"
FT                   /db_xref="GOA:Q040C1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q040C1"
FT                   /protein_id="ABJ61201.1"
FT                   /translation="MTMNHDHMNMTNKNTSHEHHDMSSMNHDHMEMSSHEHTSHAGMDS
FT                   MDMSDMKRRFWWAFFLMLPIIIITPFMGIHLPFTFTFPGSSWVSALLSTLLYFIGSKPF
FT                   WDGARAEFRTKKPAMMSLITVGLNVTFWYSIYAVLSTQLFHVHVMDFFWEFATLNVIML
FT                   LGHRIEMSVTMQAGDATAKLRELMPNIAHVKHNDMLMDMPIDTLKSNMIVRVLAGESFP
FT                   ADGTVVEGVSQVDESLMTGESRLVEKKIGSQVVGGTINGNGTLDVKLTTVGDDSFIGQL
FT                   KETLLSSQDKKSRAETLADKVAAWLFWVALLFAIGSLLIWTPLRGLGFAVNIAATVLVI
FT                   ACPHALGLAVPLVINRTKAIAAKEGILIKNRKALVAANHLKFALMDKTGTLTTGKFTVQ
FT                   HFSVYDFDQSKALGIMSALDQQSTHPLAQSIVNYAKEQHAPKIQASHVENIAGYGVRGK
FT                   IDDQLYTLASAKYLKQNHITFTPLQTEGSISYLLEEGRVIAAIAQGDHLKESAPAFIRT
FT                   LLNQGITPVMITGDNELAAKQIADELKITDIHSQVSPQDKINLVSEYQQHGTTMMIGDG
FT                   INDAPALAQANLSIAIGVGTEVAHASADAILIADQLSKIIDFINLAKRSNTKQVQNLWW
FT                   GASYNIIAIPLAAGVLAFAGIMLNPMIAALIMSLSTIIVAINALLLKH"
FT   gene            complement(41448..41873)
FT                   /locus_tag="LEUM_0049"
FT                   /note="LactoCOG number LaCOG00574"
FT   CDS_pept        complement(41448..41873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0049"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61202"
FT                   /db_xref="GOA:Q040C0"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR014071"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q040C0"
FT                   /protein_id="ABJ61202.1"
FT                   /translation="MNKLLTTSEWEIMRVIWTLGEATTNQIIHIMHNQKDWQPSTVKTL
FT                   INRILKKGLLRTDGATRNRLYTPTVGEHETMTQTLRATIDDMCAMCIGHTLVDVLADMT
FT                   LSQSDIVKLQALLAQKVKNAPESIACNCLPENCEDCK"
FT   gene            42075..42440
FT                   /locus_tag="LEUM_0050"
FT                   /note="LactoCOG number LaCOG01597"
FT   CDS_pept        42075..42440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0050"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61203"
FT                   /db_xref="GOA:Q040B9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q040B9"
FT                   /protein_id="ABJ61203.1"
FT                   /translation="MAQIQRSQPLYEQLMWRIKAQIASGVLHIGDKLPSVREMALIEGL
FT                   NPNTVAKAYKALETQNVIETVTGKGTFVRENEGIVDDKLLAQLRLKMTEIVIEAKRASI
FT                   DAKQLHSWIEELYGEIS"
FT   gene            42437..43342
FT                   /locus_tag="LEUM_0051"
FT                   /note="LactoCOG number LaCOG01598"
FT   CDS_pept        42437..43342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0051"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61204"
FT                   /db_xref="GOA:Q040B8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q040B8"
FT                   /protein_id="ABJ61204.1"
FT                   /translation="MSLILENISKKIHHHAILNNASFELKEGEVVGLVGRNGAGKTTLF
FT                   RTISGEMQADFGRIGLDNKDYMKTIAVHDQLFYIDMPDNWLAYYTPKRIKSILSVAYVN
FT                   FDSEWYDERLNQFGLNNNKRVQNYSKGMKALFTIIVSFASRAQYVLLDEPLDGLDVLVR
FT                   DQVKQLIIDRVTKNNTTVLIASHNLVELDTLVDRILLLKDGTIDRAFAIENNKNIKKYQ
FT                   LAYDGDVMPEFLRNNGTIIAQVGHIVTIVFDNFDEDIGIKLAGSDFKFIEELPISSEDI
FT                   FRASFANEVYAWQQELGGEQ"
FT   gene            43501..44172
FT                   /locus_tag="LEUM_0052"
FT   CDS_pept        43501..44172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61205"
FT                   /db_xref="GOA:Q040B7"
FT                   /db_xref="UniProtKB/TrEMBL:Q040B7"
FT                   /protein_id="ABJ61205.1"
FT                   /translation="MGIMLIAAGAATYADQTRHLNTWLSTQSASRRQFFISKVVWMIIA
FT                   PIILGAAIDLFMSITIRSDNLHKVASNNLNDGVELFYVASVVVLVSTIVGPIWQKIVGS
FT                   FFALVVCSSLSVGVNTISIDFGMKELVQNAEFTTLVTFIVALLLLGASYYIVGIIGIES
FT                   EHDAVRVPALRWPVVIFVFISTLFLPLNESPLTASSFVLPVVLSVITFIFVFKPKLSWQ
FT                   K"
FT   gene            44198..45103
FT                   /locus_tag="LEUM_0053"
FT                   /note="LactoCOG number LaCOG01810"
FT   CDS_pept        44198..45103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0053"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61206"
FT                   /db_xref="GOA:Q040B6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q040B6"
FT                   /protein_id="ABJ61206.1"
FT                   /translation="MALLEVKNVNKKYGNRAAMDDVSFNVEAGHIVGLIGPNGAGKSTT
FT                   MRAITGLMSYSSGQITFDGQPVTFNNHSALDKIGNLIEYPAIYPNLTALEHLKLYAMDT
FT                   KNPADFKELMHKTQIDGDNFGKRKAKNFSLGMKQRLGIAIALIRNPKLVILDEPMNGLD
FT                   PQSVHDLRELIRSLAEEGVAFLISSHLLDELQKLVDDVVIINHGKIIQTATIETFFIHD
FT                   QARWTFDTSDNELALQIAQDKNWQATIDNSQLQISGAENLQQVITALNAANIQIQSLNT
FT                   ATGNLEKSLLDMLAADNQGE"
FT   gene            45107..45874
FT                   /locus_tag="LEUM_0054"
FT                   /note="LactoCOG number LaCOG01811"
FT   CDS_pept        45107..45874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0054"
FT                   /product="ABC-type transport system for multi-copper enzyme
FT                   maturation, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61207"
FT                   /db_xref="GOA:Q040B5"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:Q040B5"
FT                   /protein_id="ABJ61207.1"
FT                   /translation="MLTLMKQEYYKAFKQNRLYIWLILGFIFPIAIIGIFKSTRTAGSI
FT                   INLGQSLIYVEMAGIIITALSISQEFGFGTIRPLLSRRFSRGEVFISKLLLNISVYIGL
FT                   FLSAFIGTVLATAIFAPKYDFSQKLGYIGNSWQGMMISIMDVALQMIFVAALVLMVTNM
FT                   VKSSGAAIGLGVVMIVATPIISVISLKLIDLAPILKWNPFNIYLGIASIGQVKPSIMAQ
FT                   IMDMSQGAMISAYLIYIVLMYGIAYLIFRKRSV"
FT   gene            complement(45926..46786)
FT                   /locus_tag="LEUM_0055"
FT                   /note="LactoCOG number LaCOG00184"
FT   CDS_pept        complement(45926..46786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0055"
FT                   /product="Aldo/keto reductase of diketogulonate reductase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61208"
FT                   /db_xref="GOA:Q040B4"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q040B4"
FT                   /protein_id="ABJ61208.1"
FT                   /translation="MSLVDTYKLTNGIEIPIIGFGTWQSANGTEAYQSVRWALEAGYRH
FT                   IDTAAVYGNEDSVGRAIKDSGIPRDELFVTTKLWNDAHTYERAIQALDTSLSKLGLDYV
FT                   DLYLIHWPNPAALQKQGKDAWIDANADTWRALEDEYKIGKTTAIGVSNFQIEHLEALAK
FT                   TQTIAPMVNQNFLNPSDNQQELVDYDKDHGMLNEAYSPLGTGKLVDLPQVVSLSEKYNK
FT                   SVPQILIRWSLDKGFLPLPKSTHETYIKANADVFDFALTSAEIESLDSLTGVGGFHTDA
FT                   SSADF"
FT   gene            complement(47149..47220)
FT                   /locus_tag="LEUM_t0056"
FT                   /note="tRNA_Asn_GTT"
FT   tRNA            complement(47149..47220)
FT                   /locus_tag="LEUM_t0056"
FT                   /product="tRNA-Asn"
FT   gene            complement(47279..48397)
FT                   /locus_tag="LEUM_0057"
FT                   /note="LactoCOG number LaCOG00554"
FT   CDS_pept        complement(47279..48397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0057"
FT                   /product="acetylornithine aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61209"
FT                   /db_xref="GOA:Q040B3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q040B3"
FT                   /protein_id="ABJ61209.1"
FT                   /translation="MTLFPNYQRAPLTFKKTKNATWTDGKNNEYTDLSSGIGVYNVGAN
FT                   NDAVESALIAQAKEIWHLPNLYENELQETVAAKLGGEDYTTYFANSGAEANEAAIKLAR
FT                   LVTKRETIITFKNSFHGRTYGAMSATGQDSIHYGLPMLDGFQYAEFNDINSLKELLNKD
FT                   VAGVMLELVQGEGGVIPAHQDFVTELIQVVHDNGSLVMIDEVQTGMGRTGKKFAFENYH
FT                   FQPDIFTNAKALANGVPVGAMLAKNEFASSFSYNAHGSTFGGNPLAMSAASATLDELSL
FT                   ILPNISEKINLFWQELAAFKELRNVVEVRGLGMMAGIELNIPVKQVVADLLDEKIVTLG
FT                   AGHNTLRLLPPLTISESQLTTALQKIKQLLSQ"
FT   gene            complement(48408..49142)
FT                   /locus_tag="LEUM_0058"
FT                   /note="LactoCOG number LaCOG00555"
FT   CDS_pept        complement(48408..49142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0058"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61210"
FT                   /db_xref="GOA:Q040B2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q040B2"
FT                   /protein_id="ABJ61210.1"
FT                   /translation="MKKIVIKIGGNAATQLTPAFFDTIKFWQKQHYKIAIVHGGGDTIS
FT                   ALMSQLNEPVQKINGIRFTTQNGINITKMALLGQVQPALLESCRVNGLSVIGLNAASDQ
FT                   LLTGHTIDQDTFGYVGNIHQVNTKLIHNLWEKNLIPIIAPMAITNSGQWLNVNADHAAT
FT                   ALAKYLKADELYLLTDVSGVKIKGNVLQNLTSKTMEELQKKQMITGGMIPKVNSALFAA
FT                   RHGVRAVHITNTVTHPGTIVTI"
FT   gene            complement(49186..50400)
FT                   /locus_tag="LEUM_0059"
FT                   /note="LactoCOG number LaCOG00553"
FT   CDS_pept        complement(49186..50400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0059"
FT                   /product="glutamate N-acetyltransferase / N-acetylglutamate
FT                   synthase"
FT                   /EC_number="2.3.1.35"
FT                   /EC_number="2.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61211"
FT                   /db_xref="GOA:Q040B1"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:Q040B1"
FT                   /protein_id="ABJ61211.1"
FT                   /translation="MTELLNQITTLSTADIAAPIGFHADGQHVGLKHKSKDLGWIYSDV
FT                   IASVAGVFTTNLVQAAPVQLDKKTIRNGQLQAIIVNSGNANAVTGSIGVSHAESMQEFT
FT                   AQQLNIDTSLVGVASTGIIGKVLPIDKIINGIKQLKIDGDTNGFAHAIMTTDTKEKSIT
FT                   IQSTIQGKIVTMSGVAKGSGMLHPNMATMLGFITTDINIDAKLLQQALSEDVETSFNQI
FT                   TIDGDTSTNDTVLVMANGLAGHKMIENHTAEYEQFKDMLHTVTTALSIAIANDGEGATK
FT                   LIAVAVNHAQSALDARMVAKKIVGSSLVKTAIFGKDPNWGRIIAAIGASNVDLNPNLID
FT                   ISINKIAVLVNGAPADFNADTMAEKLEEHDIHIDVDLHAGTESGCAWGSDLTYEYVKIN
FT                   ALYTT"
FT   gene            complement(50445..51485)
FT                   /locus_tag="LEUM_0060"
FT                   /note="LactoCOG number LaCOG00552"
FT   CDS_pept        complement(50445..51485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0060"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61212"
FT                   /db_xref="GOA:Q040B0"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q040B0"
FT                   /protein_id="ABJ61212.1"
FT                   /translation="MTDKIIKIAIVGITGYGGLELLRLLYNHPNAKVVSIHNTQTENTD
FT                   ISEQFPHLKSMYNLTPTTFDPMHIMQEADLVFFATSSGVSKDLAQDFIQAKFPVIDLSG
FT                   DFRLPADIYKKWYKNEPASDEAIQQAHYSLADFYDNKVTYIANPGCYATGTLLALAPLA
FT                   QNHLLDKDNIIIDAKSGLSGAGKSLTLASHFVNVNENFTMYKANHHQHIPEITQQLQQW
FT                   QSDIAHIQFTTSLLPINRGIFVSAYVKINDDSQAEKIQELYTATYANKQFVRVMPKNQL
FT                   PSIKQVIGTNFTDIGLTYNPDTKYLTIVSVLDNMIKGAAGQAIQNMNHMFDLEESTGLH
FT                   LIAQYA"
FT   gene            complement(51610..52116)
FT                   /locus_tag="LEUM_0061"
FT                   /note="LactoCOG number LaCOG01605"
FT   CDS_pept        complement(51610..52116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0061"
FT                   /product="Phospholipid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61213"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:Q040A9"
FT                   /protein_id="ABJ61213.1"
FT                   /translation="MKIDVTLDNGFIPDKYAKYAPANYRTNDMPTTNFPVEISNTPAGT
FT                   QSLSVSLIDYDAVPVCGFPWIHWLAANLPVTNIPENLRATKRGTFGTNSTWHDVQKLGH
FT                   PANASINQSYIGPMPPDKTHNYTLTVFALDTKLDLQNGFFLNELRSKSMEHVLDIAILE
FT                   LPARA"
FT   gene            complement(52119..52499)
FT                   /locus_tag="LEUM_0062"
FT   CDS_pept        complement(52119..52499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61214"
FT                   /db_xref="UniProtKB/TrEMBL:Q040A8"
FT                   /protein_id="ABJ61214.1"
FT                   /translation="MSFFNIFKKKKTTEKNIDAANEPITWKNTTNASDFFEGYNIAITD
FT                   LESNGEVAAAETLRADKTQLQLDFIERFEKEIHSKTAGIQDIDTRTKIVIDAISSIRKY
FT                   NSEMPIAVRTRLAQAKKNLIGE"
FT   gene            52610..52906
FT                   /locus_tag="LEUM_0063"
FT   CDS_pept        52610..52906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61215"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q040A7"
FT                   /protein_id="ABJ61215.1"
FT                   /translation="MAAHKTVFNDKQRILRLYSALISHRALSIEEIEDMFFIGRKTVQR
FT                   DISEIRTFLHDLQIGEPIKSEIIFDRHSKKYRLTEMENLFRVFDKINKIDEEE"
FT   gene            complement(52927..53592)
FT                   /locus_tag="LEUM_0064"
FT                   /note="LactoCOG number LaCOG01872"
FT   CDS_pept        complement(52927..53592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0064"
FT                   /product="K+ transport systems, NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61216"
FT                   /db_xref="GOA:Q040A6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q040A6"
FT                   /protein_id="ABJ61216.1"
FT                   /translation="MRQTYAIIGLGRFGGALLETLVANGQDVLGIDISEEHVNDYRDIA
FT                   TQVVIADAQEDEVLRKLDIASFDHIVIAIGHNMQASILATINAKDLGAKNVIAKAENRT
FT                   HLRVLTKIGADVVVQPEREMGERVARKLLAPNMLNFIELSDDYSMAEVQIVNPAFYGRS
FT                   ISNLNIRKKFGLNVIAVRHDGDVIVAPDSTYKLHEKDIVSVVGPKDMVDDFDQLTNNK"
FT   gene            complement(53624..55027)
FT                   /locus_tag="LEUM_0065"
FT                   /note="LactoCOG number LaCOG01873"
FT   CDS_pept        complement(53624..55027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0065"
FT                   /product="Trk-type K+ transport systems, membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61217"
FT                   /db_xref="GOA:Q040A5"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:Q040A5"
FT                   /protein_id="ABJ61217.1"
FT                   /translation="MSRKIDLPTAAEMQKFHDKSQRHTFWSRISMPQRLSLGFLTVITV
FT                   GALLLMLPLSYHGNVGHTFMDGLFTATSAASVTGLTVVDTATHWTTFGQIVIMVLIEIG
FT                   ALGFMSFSVLLFTATRKKMDLRSKMMVQEVYNLESLYDTRVVFGYVIKLSVIIQSIGAV
FT                   LLAPFFINDFGWKHGMFYAVFHAISAFGNSGFSILPHGTAAYNNQPWILLIIAFLIIAG
FT                   SLGFLVWRDLLIYRTTHRLTLHSKLALVMTGVLIVGGWLLFELTERNMNSAQDIQPINR
FT                   IFDTLFMSISYRTAGFAQFGFDSMSSATVLLTMMLMYIGGTPGSTAGGIKTTTLGVLIL
FT                   QTHAALRGKKDVVFSHRRLSHENIVRALLLVFVSLAFLGILSFLLMLTQEHTAHYGLEY
FT                   IIFEVVSAFATTGLTLGLTPHLTTFGQLIIMLAMFIGRVGIYTVMFSILNVHDDKAPFR
FT                   YPEESVIIG"
FT   gene            55344..56549
FT                   /locus_tag="LEUM_0066"
FT                   /note="LactoCOG number LaCOG01857"
FT   CDS_pept        55344..56549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0066"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61218"
FT                   /db_xref="GOA:Q040A4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q040A4"
FT                   /protein_id="ABJ61218.1"
FT                   /translation="MIRLMQNKDQRNNISVRIAIYLTYIVQGFALIILAQTVQQLSELW
FT                   NASIAGTTAVVSAIGIGKLIAYPILGELSDHVDRKKLLMMAMFMYLIFFSILPLTKNIF
FT                   FAVVITTLAGLANAALDSVAYPTLLEMNHGKSSGNVLIKAMISLGEGILPIILVMLINQ
FT                   HIWFGWLFWVATAILVVNLIIMTSINAAGFYTIRTSKGGKRATNKGTWHWNITKILFMI
FT                   YGFSAMWVMIHFTQWVTRYFHIVQSFSTVSSHVLMSFYSIGSLMGVGTLFLLTNRGWIS
FT                   EKILLMITAIGTIVGLVIVVLSQETISASFGCFIFGFSAAGGALQLGLSQLIASDPKFS
FT                   GRLTGLYFFFGSIAFFVMPIVTGHFAAQHLQGVMLSLLAVAGLNLFIVVFNFYHSQQVQ
FT                   KQ"
FT   gene            complement(56606..57328)
FT                   /locus_tag="LEUM_0067"
FT                   /note="LactoCOG number LaCOG02101"
FT   CDS_pept        complement(56606..57328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61219"
FT                   /db_xref="GOA:Q040A3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q040A3"
FT                   /protein_id="ABJ61219.1"
FT                   /translation="MEIGNKIKALRKKNGLTQQQFAEKLYISFQSVSNWERHKGHPTTE
FT                   MMLLIIEKFDLPLDFFIIPPTNSCEDNDEELILLSFLANMHSNREDKPSLKQLEKTSGI
FT                   AIQKIKQYYPSYDDLFYAVINRIDKDVKIKVETSLSTNDNLISVFINDMAPMLYEKKEE
FT                   LHLLYTRPYIRNIWITFIKSKYLSLITRYNPKLAADILTTEYLIEMLTSFISVWMSQPE
FT                   PEPLVDFQNRMKKYLSNL"
FT   gene            57501..57764
FT                   /locus_tag="LEUM_0068"
FT                   /note="LactoCOG number LaCOG00006"
FT   CDS_pept        57501..57764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0068"
FT                   /product="Transcriptional regulator, xre family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61220"
FT                   /db_xref="GOA:Q040A2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q040A2"
FT                   /protein_id="ABJ61220.1"
FT                   /translation="MIENHEFCRLSEADIATVIGGESEDIAYNLRRLRLELGYRRADLA
FT                   DELNISLSTIAKYETGSRIPDIDTIIQLSKVLHTNVNNLIFK"
FT   gene            57869..58039
FT                   /locus_tag="LEUM_0069"
FT                   /note="LactoCOG number LaCOG03124"
FT   CDS_pept        57869..58039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61221"
FT                   /db_xref="GOA:Q040A1"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="UniProtKB/TrEMBL:Q040A1"
FT                   /protein_id="ABJ61221.1"
FT                   /translation="MEKLSEQELAKVSGGFPLLPIVVPIIAGGATYVAKDAWNHLDQIR
FT                   SGWRKAGNSKW"
FT   gene            58211..58408
FT                   /locus_tag="LEUM_0070"
FT   CDS_pept        58211..58408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61222"
FT                   /db_xref="UniProtKB/TrEMBL:Q040A0"
FT                   /protein_id="ABJ61222.1"
FT                   /translation="MDFKTQRNVLNSEKLMMISGGSTDDSWEGFGSGLHKTVNTVVYAG
FT                   TTVARAHTRSHQRCFTGNKW"
FT   gene            59113..59358
FT                   /locus_tag="LEUM_0071"
FT   CDS_pept        59113..59358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61223"
FT                   /db_xref="GOA:Q03ZZ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZZ9"
FT                   /protein_id="ABJ61223.1"
FT                   /translation="MIFNRAITVISKKVGQLIELVLVTVLIDIILDIPPACVFIDKSNG
FT                   WFVLLSIILGGVVSYFGYRYLASKTTAIFERINLKK"
FT   gene            59397..59777
FT                   /locus_tag="LEUM_0072"
FT                   /note="LactoCOG number LaCOG01370"
FT   CDS_pept        59397..59777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0072"
FT                   /product="Predicted metal-dependent membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61224"
FT                   /db_xref="GOA:Q03ZZ8"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZZ8"
FT                   /protein_id="ABJ61224.1"
FT                   /translation="MDLIIPAIFGQNQDISLNQKMIESMFQQGGIVALLFKLNTIIIAP
FT                   IIEEISFRGIIFEEAKPLGKVVQFIWPTFVFAAVHGPSTPEQWTVYLTAGALLMVVRLV
FT                   TKKLQYSVMFHMAHNLMATVGL"
FT   gene            59955..61511
FT                   /locus_tag="LEUM_0073"
FT                   /note="LactoCOG number LaCOG00896"
FT   CDS_pept        59955..61511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0073"
FT                   /product="nucleoside ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61225"
FT                   /db_xref="GOA:Q03ZZ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZZ7"
FT                   /protein_id="ABJ61225.1"
FT                   /translation="MTESTPVIEMRHIIKKFGDFAANDDINLQVQQGEIHALLGENGAG
FT                   KSTLMNILTGLLQPTSGEILINGKKVSVDSPSKSDALGIGMVHQHFMLIDAFTVTENII
FT                   LGSEVTKGLSLDTKTAAKKIQALSDQYGLSVDPMAKISDISVGQQQRVEILKTLYRGAD
FT                   ILIFDEPTAVLTPQEIDELIVIMHNLAQEGKSIILITHKLDEIRAAADTVTVIRSGKSI
FT                   DTFPVAGVSSQELADLMVGREVSFKTEKEVAQPGAVILSIDNLEVQDTRRVAAVKNFSL
FT                   DVRAGEIVGLAGIDGNGQTELIQGITGLTKVQAGHVKLKGEDITNKKPRHITEAGVGHI
FT                   PEDRLRFGMEVEMTLSENLSLQTYYKQPISKSGVLQPAEMDKLADKLVQEFDVRAASIH
FT                   VTAGSMSGGNQQKAVVARELNRDNDLVIAAQPTRGLDVGAVEYIHQRLIAQRTAGKAVL
FT                   VVSFELDEILNLSDRIAVINDGKIVGIVDAQDTNKQELGLLMTGMSLTEARAALKEEVG
FT                   S"
FT   gene            61511..62632
FT                   /locus_tag="LEUM_0074"
FT                   /note="LactoCOG number LaCOG00897"
FT   CDS_pept        61511..62632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0074"
FT                   /product="nucleoside ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61226"
FT                   /db_xref="GOA:Q03ZZ6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZZ6"
FT                   /protein_id="ABJ61226.1"
FT                   /translation="MIAQKNNLSVAMFSVLFGLIVGALIMLVFGYNPISGYVALLGSAF
FT                   GSMQDIGGVLTQMTPLILTALGFAVASSAGFFNIGLSGQALAGWVGAVWYALSFPDMSA
FT                   IIMIPSALIIGAGLGAIAGFIPGWLRAQFGASEVIVTIMMNYIFLFLGNDILQNTMSKN
FT                   IKESAETTKQVGANASLQMKWLTDLTQGSSISAGIFIALAMIVVVWFVMKKTTLGFEIR
FT                   AVGLNPDAARYAGMSAKRNATIAMAISGGLAGLAGTIEGLGNYLNFFTQNGSPSIGFDG
FT                   MAVALLGGGSYLGILGAAAIFSILKIGGLGMPMSSGVPFELVDIVTASIIFFVGVRYLI
FT                   LLIQKRIKDMDEKAALEAANKKAAKANQQKGGE"
FT   gene            62634..63590
FT                   /locus_tag="LEUM_0075"
FT                   /note="LactoCOG number LaCOG00898"
FT   CDS_pept        62634..63590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0075"
FT                   /product="nucleoside ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61227"
FT                   /db_xref="GOA:Q03ZZ5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZZ5"
FT                   /protein_id="ABJ61227.1"
FT                   /translation="MSLMAMLSLVISSTLVYSAPLIFTSIGGTFSERSGVVNVGLEGIM
FT                   GMGAFAAVVFNLTFAGQLGAATPWLGLLAGAIVGVVFSLIHAVATVTLRADHIISGTVI
FT                   NLMAPALGVFLIKVLYGKGQTESIGQDFGYATVPGLSKMPVLGQLFFEKTSGPAWLAIL
FT                   VAGISWYIIFKTKFGLRLRSVGENPQAADTLGLNVARLRYSGVMISGLLGGIGGAVVAQ
FT                   SISLNYSASTIVGQGFMAMAAMIFGRWNPLGALGASLFFGLSQSLAVIGAQLPGLKNVP
FT                   SIWLQIAPYVLTIIVLVFFFGKTRPPKADGVNYIKAA"
FT   gene            complement(63630..64544)
FT                   /locus_tag="LEUM_0076"
FT                   /note="LactoCOG number LaCOG00274"
FT   CDS_pept        complement(63630..64544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0076"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61228"
FT                   /db_xref="GOA:Q03ZZ4"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZZ4"
FT                   /protein_id="ABJ61228.1"
FT                   /translation="MRKIGVVGIGHVGVTVAHIIIAQGLADEIVLVDKNPEKLASEELD
FT                   FRDAASLLDHHVEVHAGTVTDLTDAEVVISALGHIELIKPGGDRFTELKANTPEVQQVG
FT                   SDLKQAGFNGVLIVISNPVDVITGIYQKATGLPANQVFGTGTYLDTARLKRALGDTLAI
FT                   DPRGISGYMLGEHGDSQFAAWSTVNALGKNADELVKLYDINLDKVAEAARVGGFTVFAG
FT                   KKYTNFAIAHAAVSLAKLVLSNARREAIVSHYDERFEGYISTPAIIGRDGVTAEFDLQL
FT                   TDEEKILLQKSANAIAEKTAAYL"
FT   gene            complement(64660..65415)
FT                   /locus_tag="LEUM_0077"
FT                   /note="LactoCOG number LaCOG01916"
FT   CDS_pept        complement(64660..65415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0077"
FT                   /product="ABC-type uncharacterized transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61229"
FT                   /db_xref="GOA:Q03ZZ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZZ3"
FT                   /protein_id="ABJ61229.1"
FT                   /translation="MTKPVFSLKDVIVTVGDSIQILKSINFDIYDGDFITVLGTNGAGK
FT                   STLFNTIAGNLSVASGKILHNGNNIAHETAVKRTNYIARVFQDPKMGTAPRMTVAENLL
FT                   LAEKRGSKRTLRSRGLTQKKLTEYAALTKVMGNNLDRRLNTATGDLSGGQRQALSFLMA
FT                   TRVKPELLLLDEHTAALDPKTSEQLMLATNEQVTANNLTALMITHNLADALKYGNRLII
FT                   LNAGNIVLDVRDDEKKALDETQILKYFVS"
FT   gene            complement(65408..66307)
FT                   /locus_tag="LEUM_0078"
FT                   /note="LactoCOG number LaCOG01073"
FT   CDS_pept        complement(65408..66307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0078"
FT                   /product="Ribose/xylose/arabinose/galactoside ABC-type
FT                   transport systems, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61230"
FT                   /db_xref="GOA:Q03ZZ2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZZ2"
FT                   /protein_id="ABJ61230.1"
FT                   /translation="MSMIVSSIGQGLLWAVLGVALFLTFRILNFPDMTVEGSFPLGAST
FT                   AVAMIAHGIDPFIATIAAFLVGTIAGLITGLLYTKGKIPILLSGILVMTATLSINLRIM
FT                   GSANISLLNQKSIFSIKILQHLPKYFDSVFLGLVIIAVITAGLIFFLQTELGQAFIATG
FT                   DNPNMAQSIGIQTDRMTIMGLMLSNGLIAFGGAVIAQNNGYADINMGIGIIVIALASII
FT                   IGEVVFGELTLNERLVAVIVGSILYRLVLLAVLRLGFSTNDINLISAIVLAAAMILPQL
FT                   RHALNLDKIIKKGVTPHD"
FT   gene            complement(66304..67308)
FT                   /locus_tag="LEUM_0079"
FT                   /note="LactoCOG number LaCOG01915"
FT   CDS_pept        complement(66304..67308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0079"
FT                   /product="ABC-type uncharacterized transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61231"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZZ1"
FT                   /protein_id="ABJ61231.1"
FT                   /translation="MNKRLLSAITIIVAFLAVAFIVTSKPNTQEKKSTYVPTVGILQLV
FT                   THPALDQIHHGIVAGLKSQGYSGKKIKIDYQNAQADQSNLKTMSQKFANENADLTIGIA
FT                   TPAALSLAKTADGNNPVILAGITDPAGSGLVKTTQRPGNNVTGVSGDSPLQQHLDVVQQ
FT                   VVPKAKTLGIIYTTSDHGGEYNAKNMEKLAKKAGYTVKMYTISTTNDMQQVAETMASQV
FT                   DVVYAPQDNGVASAMKTLINVTNQEKIPVIPAVDTMVKDGGVATVSVSQYDIGYQAGVM
FT                   AGQVLKGKNTATYPVKTITKGEMTINLKQAKLLGINLPASMVKEAETKGEVFK"
FT   gene            67775..68362
FT                   /locus_tag="LEUM_0080"
FT                   /note="LactoCOG number LaCOG00791"
FT   CDS_pept        67775..68362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0080"
FT                   /product="Transcriptional regulator, xre family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61232"
FT                   /db_xref="GOA:Q03ZZ0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZZ0"
FT                   /protein_id="ABJ61232.1"
FT                   /translation="MNDLVNTFSEVNNLGRLIRGMREARGVSVNDLVRATGLSRSMISK
FT                   FERGQTDIQLSSMIKIFSAMSLTLDDLCHARLFDEFLMNELCEKAYQFQNDHIVLKQIL
FT                   DEICSRDFLIRQEEILKLILQTLLNSNRGLPSEVENYFDNLDGIWSFDTYLALLAEPFL
FT                   TQRIHLRIAKELAQYQGYRPKIINTAYHVFVH"
FT   gene            68420..69157
FT                   /locus_tag="LEUM_0081"
FT                   /note="LactoCOG number LaCOG01519"
FT   CDS_pept        68420..69157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0081"
FT                   /product="Short-chain alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61233"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZY9"
FT                   /protein_id="ABJ61233.1"
FT                   /translation="MKNIVITGGTSGVGFAIAKEIAKEGHNIIIVGRHEYKAHIAQKKL
FT                   GNNVKVAIGDLSDEAEREGVIDEIKRSFSHIDVLIHSAGVLPRNASENIYVNLLPHYYL
FT                   TTRLRGLLANSRVLIITGHPQAVNLVPICEIQSSAFSRAAWVITHKTLLMILLNQMLRD
FT                   CNTTVNSFYPGQVNSNLMRYTKKIDNTEVPVGAYLALNATLEKMSGIFFDENGKIVQLD
FT                   NKKYNLKTAEEILAPYLSKITTY"
FT   gene            69273..69398
FT                   /locus_tag="LEUM_0082"
FT                   /note="LactoCOG number LaCOG01704"
FT   CDS_pept        69273..69398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61234"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZY8"
FT                   /protein_id="ABJ61234.1"
FT                   /translation="MAEKNDLSSAYRRLKSPNAKTRDRALKLLKEIKAKKSQKSK"
FT   gene            complement(70221..71570)
FT                   /locus_tag="LEUM_0083"
FT                   /note="LactoCOG number LaCOG00047"
FT   CDS_pept        complement(70221..71570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0083"
FT                   /product="lactococcin A ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61235"
FT                   /db_xref="GOA:Q03ZY7"
FT                   /db_xref="InterPro:IPR005696"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZY7"
FT                   /protein_id="ABJ61235.1"
FT                   /translation="MFNERLLESSEFYTKRYQNFTTLIIFPTLSLLVLLILLACLTHKE
FT                   TVIKSTGEIEPIKILRTIQSTSNNPIIKNELLTKKEITAGDILIQYQNTESDTNLQLQK
FT                   SSLKNLQEHVQALIIYKDSIKQNQNLFTDDDNFGCSTSYQSYLSQRRSLSTDHQQQVND
FT                   QDRVKQQKIIISEAINKKNSELSQYQDLINAIIKNTSLSPKNAYYSTFLDYQHQTKELP
FT                   ISQVDKLKKETVTSIQQQIDSINDALTSYKTQYAGFSSTNLAEDALTNKLNELKSQQLS
FT                   SITKELETLNQEIEQTKIQHAATETSGKNTIIATESGTVNLLINKTKLTSIPQGTNVAQ
FT                   IYPNLKKTPDLKVSFYISANEISEIVENQSIRYHLTEKNSKHMVIPGNIASIPANPITT
FT                   KDGNFYQVSAILNLRPKDYQNIHYGQTGTVSIITGKSTWISHIKNTLIHQ"
FT   gene            complement(71588..73735)
FT                   /locus_tag="LEUM_0084"
FT                   /note="LactoCOG number LaCOG00046"
FT   CDS_pept        complement(71588..73735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0084"
FT                   /product="bacteriocin-processing peptidase, Cysteine
FT                   peptidase, MEROPS family C39"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61236"
FT                   /db_xref="GOA:Q03ZY6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR005897"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZY6"
FT                   /protein_id="ABJ61236.1"
FT                   /translation="MRKFHYISQLEEKDCGVAALAMILKRHGSDVSLANIRERCQTSLS
FT                   GTTALGLVKAAESFNMDVRPIQADLTLFNMKDLPLPFIAHVEKKGQYLHYYVVYGFTKN
FT                   KVIIADPDPTVAKTAMTLQEFSKEWTGVALFMSPSPRYKPFKENKNSILSFLPIISRQK
FT                   GLIANIVVASLLVTLISIAGSYYMQLVIDTYIPSAMSNTLTVVSLGLIATYVLQQLLSF
FT                   ARTYLLTIMGQRLSIEVILSYIRHLFELPVNFFATRRTGEIVTRFNDANTIIDAMANTI
FT                   LSLFLDLGITIIVGSVLAIQNTKLFLLSLISFPIYFLIVYCFMKPFERLNQEQMASNAT
FT                   LSSSIIEDINGIETIKSLTSEKTSYQKIDREFIDYLKKSFAHQKSEAIQNSIKQATQLI
FT                   INVLVLWLGAKLVISNQISVGQLVTYNALLGYFTEPFQNIINLQAKLQTATVANRRLNE
FT                   VYLVKSEFKKSESQELHHNNPHNITVDDVSYQYGYQKNILHHFSIKIPFGEKIALVGVS
FT                   GSGKSTLAKLLVHFISPSAGNIFIGEQNIKHVQRQNLRQHILYLPQNPYIFTGSILDNL
FT                   TLGARENTTQEDILHAVELADIKDDIENMPQSYQTEISEEGGMSGGQKQRIALARALLS
FT                   NSQILILDESTSNLDVATEKKIIDNLLSLKNKTIIFIAHRLTIAEKVQRVILLEKGIIS
FT                   EDGSHAELIHKKSKYYHLVKH"
FT   gene            73966..74142
FT                   /locus_tag="LEUM_0085"
FT   CDS_pept        73966..74142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61237"
FT                   /db_xref="GOA:Q03ZY5"
FT                   /db_xref="InterPro:IPR023991"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZY5"
FT                   /protein_id="ABJ61237.1"
FT                   /translation="MINSTAVKELNDMELESINGGWSPQGFAISFVLGGAVGVGAYSIY
FT                   QFGMDQGYRNNKK"
FT   gene            74173..74334
FT                   /locus_tag="LEUM_0086"
FT   CDS_pept        74173..74334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61238"
FT                   /db_xref="GOA:Q03ZY4"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="InterPro:IPR023991"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZY4"
FT                   /protein_id="ABJ61238.1"
FT                   /translation="MALFKELSNKELVNVNGGVVPVAVVLGVPTLALGIYQAGYAAGKD
FT                   RAQAGLRR"
FT   gene            74331..74636
FT                   /locus_tag="LEUM_0087"
FT   CDS_pept        74331..74636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61239"
FT                   /db_xref="GOA:Q03ZY3"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZY3"
FT                   /protein_id="ABJ61239.1"
FT                   /translation="MKYLLLLLQCLIFIALCLLVILIGLSDQHRFGALSYHAMNNMFVL
FT                   LMLLQFVLFLIPNKLLGAFENSLSGYLRKKSLWKIVVWTGISGGILSLKEIVCNKF"
FT   gene            74793..74930
FT                   /locus_tag="LEUM_0088"
FT   CDS_pept        74793..74930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61240"
FT                   /db_xref="GOA:Q03ZY2"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="InterPro:IPR023991"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZY2"
FT                   /protein_id="ABJ61240.1"
FT                   /translation="MSLKNNIVGFNKLDSEELKNINGGCYPLVIIGALAGIAIRNRIKK
FT                   "
FT   gene            74945..75124
FT                   /locus_tag="LEUM_0089"
FT   CDS_pept        74945..75124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61241"
FT                   /db_xref="GOA:Q03ZY1"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="InterPro:IPR023991"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZY1"
FT                   /protein_id="ABJ61241.1"
FT                   /translation="MHKNDLINFSNFSQLDEYQLASVDGGFIPVAVWALWAGAGAAGFS
FT                   GGIAVGLNRVNRNN"
FT   gene            75286..75462
FT                   /locus_tag="LEUM_0090"
FT   CDS_pept        75286..75462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61242"
FT                   /db_xref="GOA:Q03ZY0"
FT                   /db_xref="InterPro:IPR023991"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZY0"
FT                   /protein_id="ABJ61242.1"
FT                   /translation="MTELNKKLQNSLHGYDILDAQQLSEVDGGIAPLLIAGGIVLAGGG
FT                   GFAAGYGLSRWLG"
FT   gene            75747..75917
FT                   /locus_tag="LEUM_0091"
FT   CDS_pept        75747..75917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61243"
FT                   /db_xref="GOA:Q03ZX9"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZX9"
FT                   /protein_id="ABJ61243.1"
FT                   /translation="MPILLSNFKKLNSEELLESEGIAPLIVAGLWIAGAVGGAFVWGYD
FT                   KGYQFGKDLAK"
FT   gene            75923..76135
FT                   /locus_tag="LEUM_0092"
FT   CDS_pept        75923..76135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61244"
FT                   /db_xref="GOA:Q03ZX8"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZX8"
FT                   /protein_id="ABJ61244.1"
FT                   /translation="MTDDTNAAIALGAFILYFVIAALRFFTDVGILNIISARDLEQASH
FT                   FLLIITFVNLIVWPLKKDSKFSLLR"
FT   gene            complement(76407..77132)
FT                   /locus_tag="LEUM_0093"
FT                   /note="LactoCOG number LaCOG01759"
FT   CDS_pept        complement(76407..77132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0093"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61245"
FT                   /db_xref="GOA:Q03ZX7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZX7"
FT                   /protein_id="ABJ61245.1"
FT                   /translation="MHINILEDDIIQQQKLRRYLNELVQENNWSCQQINTYSKPEQLSQ
FT                   HLLSNGTHHIYFLDIEIKGSDKKGFQVAKEIRKHDPYAAIIFVTTHSEFLPLTFQYHIS
FT                   ALDFIDKTQSSSDFKQQLKECLTHLVEKKHQDKPLDLFHYNTSQCHFQIPFNDILFFET
FT                   ISGTRQIALVSKNKRIQFTGRLQDIEAMDDRLFRSHRSYLVNINKIEQIDKVNNEIILH
FT                   NQLTCLISRRKIKALRNLL"
FT   gene            complement(77138..78448)
FT                   /locus_tag="LEUM_0094"
FT                   /note="LactoCOG number LaCOG01758"
FT   CDS_pept        complement(77138..78448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0094"
FT                   /product="Predicted signal transduction protein with a
FT                   C-terminal ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61246"
FT                   /db_xref="GOA:Q03ZX6"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZX6"
FT                   /protein_id="ABJ61246.1"
FT                   /translation="MYILSVTHILLGFCSLSSIEFIMFCTISRTKIRFKIYLLFILAEL
FT                   LTTSLLGIPARIIHIFILILLNVLLNKEKQNLNLIAFYALYTVVSVSAFGAIIQSLGKW
FT                   FGLTYLLENNIIAIYDTMITPILIGIIQFGVIKLIAPNLEIIRKNQHLQKSNRLKFINS
FT                   LLSISLILYLLTYQFNNTSYKNAVNMFFVISLISLLVYLKNTTQNYFNFQLAQQKQQQL
FT                   DHLTTYTTQIEDLYKSINGFRHDYANLIVSLETSIQAGDINQIRSIYEDVLKNSPNVLN
FT                   HGNHTLGSLTKIDIPAIKSILSNKIILALEKGIHIEFEIEQKWSTCHVDVFDYIRMLGI
FT                   LLDNAIEASEACSMAFINIAFITDNIKQEHRLIIENSTNQEFINIGHIFQDGVTSKGAN
FT                   RGIGLSNMQHILSNYEQAHIETEYSNYRFRQTLITQG"
FT   gene            78626..78745
FT                   /locus_tag="LEUM_0095"
FT   CDS_pept        78626..78745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61247"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZX5"
FT                   /protein_id="ABJ61247.1"
FT                   /translation="MVFLEQFEKLGQDKLVSTTGGDWVSFFSNRLATKGHILK"
FT   gene            78901..79704
FT                   /locus_tag="LEUM_0096"
FT                   /note="LactoCOG number LaCOG00855"
FT   CDS_pept        78901..79704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0096"
FT                   /product="Hydroxymethylpyrimidine/phosphomethylpyrimidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61248"
FT                   /db_xref="GOA:Q03ZX4"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZX4"
FT                   /protein_id="ABJ61248.1"
FT                   /translation="MNKILSIGGSDTSGGGGIEADIRTFEKYNIFNLVAIENIVTMAPQ
FT                   TWAVTQYTVPNHLFASQLQTAVAVDLAGIKVGMVSDVDNFNTLVGYLESVKPSALLVDP
FT                   VMATKLSIDNDRTVDLETYKEKLLAKADIITPNILEAAMLTGVKSINNVSEMKVAAEKL
FT                   SSYGIKYVVIKSGSRFDNNLATDMLYDGTTFEIFQRELIATDYNHGAGCTFSAAILANI
FT                   VKGMPIHEAVLDAKNFTFQSIENAVRVNQFVGHVWQGENGHETTK"
FT   gene            79688..80254
FT                   /locus_tag="LEUM_0097"
FT                   /note="LactoCOG number LaCOG01908"
FT   CDS_pept        79688..80254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0097"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61249"
FT                   /db_xref="GOA:Q03ZX3"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZX3"
FT                   /protein_id="ABJ61249.1"
FT                   /translation="MRQQNRIVIDIVLVALFTSITFVATSIQVPMPALIGKPFVHLGNS
FT                   AVLLSVLLLGYKRGALAGGFGLALFDVMHGYAMEAPYYFVECFIVGGVAAYVFSLVNYK
FT                   QHGTNLKLILVILSAVFAKLVMTTGHNFVMSLFKGMTLQPAIIATISSLFPTIINCITT
FT                   LVVVFVIYRVLAEQFKRLFVRNNFS"
FT   gene            80451..81848
FT                   /locus_tag="LEUM_0098"
FT                   /note="LactoCOG number LaCOG00754"
FT   CDS_pept        80451..81848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0098"
FT                   /product="Fumarate reductase, flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61250"
FT                   /db_xref="GOA:Q03ZX2"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR010960"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZX2"
FT                   /protein_id="ABJ61250.1"
FT                   /translation="MVKFNFSCTNIDNLKSSYDFVVIGSGATGMTAAIQAQELGLDVVI
FT                   FEKLNSLGGNSMRASTGMNAVETMTQLKYQIIDSQESFYEETLKGGKGSNNKELLSYFV
FT                   RHTESAIEWLSYHNIELNEIVSTGGMSKKRAHQPTGATAIGGYLVKGLQQQLAEKRIPV
FT                   FNQTKVLSLVKNDGHISGVEIEHPQAGKKIINAKTVLIASGGFAQNRAMMSVYAPDLLR
FT                   LGTTNHPGATGDGIKLATTAGGALVDMNKVQVHPTAQQETDHIYLIGEGLRGAGAILIN
FT                   HLGKRFTNEMATRDQVTKAIDDLHQDGATLVFDQGICEAFKAADFYVAMGLAVSGNTIY
FT                   ELAEKIGVNPNNLEKTVSGWNMYQKAFEDIAFDRQTGMDRGIEKSPYYAIHIKPAVHYT
FT                   MGGIKTNRLTEVLNEIGEAVPGLFAAGEVAGGLHGDNRIGGNSIAETIVFGRQAGQQAA
FT                   KHVLSLS"
FT   gene            82029..82919
FT                   /locus_tag="LEUM_0099"
FT                   /note="LactoCOG number LaCOG00708"
FT   CDS_pept        82029..82919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0099"
FT                   /product="XRE-family DNA-binding domain and ATPase
FT                   component of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61251"
FT                   /db_xref="GOA:Q03ZX1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZX1"
FT                   /protein_id="ABJ61251.1"
FT                   /translation="MENIFSYQLNMLRQKKSLSQEIIAQKLYVSRQSVSKWERGDAEPD
FT                   IDKLIALADIFGVDLNYLLAGQQSPEELLLKLTAVRKGFKKPVLNDVNLEIYGKDRIAL
FT                   LGSNGSGKSTIVNIIAGMLRPDAGHIERLFDPKEDLNVMPQENTLIETLRLAEHIALSA
FT                   GIHRIYSTQFVSGLLQKFHLEEQANVRISDLSGGQKRRLALLLSVMSSSKLLILDEPTV
FT                   GMDLESIDFFWNYMDHVAGSVLTITHDFNQIDRYFNRVLLLKDGVIVQDEKVTVIHSNN
FT                   QTIEEWYRKYNNNEG"
FT   gene            82926..83654
FT                   /locus_tag="LEUM_0100"
FT   CDS_pept        82926..83654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61252"
FT                   /db_xref="GOA:Q03ZX0"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZX0"
FT                   /protein_id="ABJ61252.1"
FT                   /translation="MITYIELKETFRNRRFILFTLISPVMWYIFMVNIAKSAGFFTHRY
FT                   SSIWFVASCVMGIMGNSVVTFGKTINRSQNFYFLQAKTSRYGIKNWVLDQMMIQLILNV
FT                   LIALTVTICGVVMQTIQVDINFIFEVLLCQILGVYFCLIGFAMGIVADNKVLDALSFPI
FT                   MMVWALLIIPFDTWTTGRFVTIISAVQKLFPGYYLFTIIQHLIDSSSLGYSLLRFVATI
FT                   VMTAVPIGVFTYLHIRRMTS"
FT   gene            83851..85953
FT                   /locus_tag="LEUM_0101"
FT                   /note="LactoCOG number LaCOG03125"
FT   CDS_pept        83851..85953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0101"
FT                   /product="4-amino-4-deoxy-L-arabinose transferase related
FT                   glycosyltransferase of PMT family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61253"
FT                   /db_xref="GOA:Q03ZW9"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZW9"
FT                   /protein_id="ABJ61253.1"
FT                   /translation="MQLKRMQKTDWYLVGILILSAFLYGWGIWDAGSANSYYTAAITSM
FT                   TKSWSNFWYGAFDPAGFITVDKPPVALWLMAISAKIFGVHGWSVVLPSVLSGIGSVYLM
FT                   YKLLAPKFGLLAGRIGSLILTLTPTVVANSRTNNMDAILVFFLLLAVYILQKAVAKKNI
FT                   WLVIVSFGLIGVGFNIKMLQAFMILPAMLVYYWVAIKLPWKKKIAWLVVGMASLSIFTV
FT                   AYPLAVDSVDQSSRPYIGSSQTNSLMELAFGYNGTERLLGQSTGTGGAFPGMGSTKKST
FT                   GTQKNNGAPSGKKPSGSASTGKMTGQAPTGQQNGGKAPTGTPPNQSTNKNANQAKGKAP
FT                   GQSGKMTRQAQGGQGGGNSAFAIGSAGPFRLFQSDLGSQIGWYLPLAILGLIAGWFGFR
FT                   KRGAKWHHVSEEQSEVLLWAGWFVPVYGFFSVASFFHPYYTIMLAPAIAALTAIGVAAV
FT                   VKMSAQSNKESMIARIVVSVAVLTTLLLQAYYVWSYYQIISIILIIVAIGLSIWWLLPR
FT                   QINNKIKIVLSAISILLMAGWWSLTPTLSHNSAAIPAASPSLLSQTGSSDMGGEVNNQL
FT                   LSYTKKHQGNAKYLFATTDSNSASGYIIKSGKAVMAIGGYNGTDPTMSLSEFKKLVKSG
FT                   QLKYFVMGNNSKTSSGQISKILTWVKKNGTKVTYSSSTSNQSSPTQQMGGQSQSTTLYD
FT                   LSNIYE"
FT   gene            85974..86978
FT                   /locus_tag="LEUM_0102"
FT                   /note="LactoCOG number LaCOG00697"
FT   CDS_pept        85974..86978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0102"
FT                   /product="Glycosyltransferase related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61254"
FT                   /db_xref="GOA:Q03ZW8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZW8"
FT                   /protein_id="ABJ61254.1"
FT                   /translation="MLTRFTTPRLGLILPAYNEQEVLPTTLSKLNTIKETLIQKNLISD
FT                   DSFIMVVDDGSVDNTWEIIQEKEQLNSDLIGVKLSRNFGHQSALLAGMSESIKLADIVI
FT                   TLDADLQDNPDIIQKMVLKYKAGNEIVYGVRSSRKTDTWFKRNTALTFYKISSFLGVEM
FT                   VPDHADFRLMSRVAVLALLRLPERNVFLRAMVPLVGFQSDKVFYERGERQAGTSKYPLK
FT                   KMLSFAIDGITSFSVQPIRLLFNLGILVISIASIEIVYTIFEKMIGNTEAGWSSLMISI
FT                   WLLGGINLVAISIVGIYIGKIFTEVKQRPLFQIETETGLFVEKLRKVDDYTMK"
FT   gene            87061..87543
FT                   /locus_tag="LEUM_0103"
FT                   /note="LactoCOG number LaCOG00411"
FT   CDS_pept        87061..87543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0103"
FT                   /product="Conserved membrane protein, GtcA family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61255"
FT                   /db_xref="GOA:Q03ZW7"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZW7"
FT                   /protein_id="ABJ61255.1"
FT                   /translation="MRKYLLSEKMKYIFWGVATTIVYLIVRLISMKIFDDTMLPVLISQ
FT                   TLTIIFAFVVNKLFVFTTKQTKSVFVQFVRFLWGRLFVAGIDFFLTYVMIEKYSNIFIH
FT                   IFFLNQVNFKLFPFSLPIVNQFASNSTELNSFLAIILIQVLSVIVNYLISKFMIFN"
FT   gene            87724..89094
FT                   /locus_tag="LEUM_0104"
FT                   /note="LactoCOG number LaCOG01917"
FT   CDS_pept        87724..89094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0104"
FT                   /product="NAD(FAD)-dependent dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61256"
FT                   /db_xref="GOA:Q03ZW6"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZW6"
FT                   /protein_id="ABJ61256.1"
FT                   /translation="MSKTKIIIVGASHGGHQAILELTRKYKNLDIKLFEAGDFISFMSC
FT                   GMELYLENSVTDVNDVRNFRPEDMEQLGAEIYSNHEVLAIDADDRTVSVKDVTTGSTEK
FT                   YSYDKLILSSGVTPNSLPVPGTDLENVYLMRGKDWATSIKAKLENPDVKNITIVGAGYI
FT                   GVEAAEASVKAGKNVTLIDMIDRPLGNYLDAELTAVLEKELADKGVKVVTDVRIESYEG
FT                   TSQVTAVKTDEGKYPSDLVIQAAGVKPNTNWLKGVIDLDDRGWIKTDEYLRTNLPDVYA
FT                   VGDAVLSYSIPAQTKLPIALATVVRREVRYIIAHLFENQPSVPFKGVVGSSALSVFDYH
FT                   FATAGLNTTTAQKSGVTLKCSFYQDTLRPDYVPRENGNTEVYVELGYDPQTHRILGGAV
FT                   LSTYDITAQGNVIALAIEHGLRLEDLAEADFFFQPGFDRQWSLLNLAAQHALGEPKF"
FT   gene            complement(89182..89721)
FT                   /locus_tag="LEUM_0105"
FT                   /note="LactoCOG number LaCOG01110"
FT   CDS_pept        complement(89182..89721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0105"
FT                   /product="Predicted periplasmic/secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61257"
FT                   /db_xref="GOA:Q03ZW5"
FT                   /db_xref="InterPro:IPR009898"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZW5"
FT                   /protein_id="ABJ61257.1"
FT                   /translation="MVTLNKPVASLKEIITKSIFYGFIAGMISGMVKIGWENILPPRTL
FT                   ARNATNPPQHMAEQLGIPSKLVHSFFYYSQDQKVFWFTLILHFSFAIAFAILYVFVSQY
FT                   WSKVALWQGAAYGIFLWILWHIIIMPAFGTIPAPWNQPLDEHISEFFGHIVWAWSIAVT
FT                   VYFLIAKDKNGHLENV"
FT   misc_binding    89942..90217
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="T-box leader, riboswitch"
FT   gene            90244..90390
FT                   /pseudo
FT                   /locus_tag="LEUM_0106"
FT   misc_binding    90438..90704
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="T-box leader, riboswitch"
FT   gene            90826..91908
FT                   /locus_tag="LEUM_0107"
FT   CDS_pept        90826..91908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0107"
FT                   /product="Predicted glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61258"
FT                   /db_xref="GOA:Q03ZW4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZW4"
FT                   /protein_id="ABJ61258.1"
FT                   /translation="MSDQTLQKELENIEVTDTLQACPIDFSQSKVANPRAHQKQKEYDN
FT                   GKDKSNFNEREKFSAYQGPQFKARFTDGTLPVTPNRYRLIWSRHCPWANRIAIGIDLLG
FT                   LDQVISNGIVDPLRPAGVVGDWFFTLDDGDVDPVLGIHSLGEAYRLADPSYDKRTTVPA
FT                   LVDTQTGKVVNNDYNNLIKEFALAWQEYVPETAPDLYPKNLRSDIDALSDIILMDINYA
FT                   VNEAGHGRSQADYKKWYDKVFNRLDWLEERLANQRYLFGDQITLVDINLYVTLSRFDLV
FT                   FYQKYFVNKKRLVDYPNLWNYAKDLYAIPAFGDNTNFESMRQRFYEVDHTPQEDLPRII
FT                   PLGPDDSIWEEANDRAEKFG"
FT   gene            91883..93217
FT                   /locus_tag="LEUM_0108"
FT   CDS_pept        91883..93217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0108"
FT                   /product="Propionate catabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61259"
FT                   /db_xref="GOA:Q03ZW3"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZW3"
FT                   /protein_id="ABJ61259.1"
FT                   /translation="MTEQKNLVSNTRKLAQLIVDSKFQIDELNVAKKCFVDYLASAYVS
FT                   RNEPAVKRLFDTLKNAGPAKLLGQAGTASSDHAALFNGFAAHYNDFDDVQANFRGHPSV
FT                   VIYSALLALADGTESADRFFEAYIVGVEIAGQIGFQVNPTHKLSGYHTTATLGTIAAAA
FT                   SLPFFKRFSLGQTIDILSFAATQAAGLGIEAGTDTKPMHAGLAAQRAVQSYQFVSSQLT
FT                   TNQDVFNNQTGWVKIVVGQELDLDLIESTWLTPAQIITPGIWFKRHQFCSAAMSGYDAI
FT                   KQGYLQGINIKNIKQVIFHFRPFGDKVLRYKQPLNGQEGKFSIEYIAWQILTFGDVNDE
FT                   LFDSSVSTEKFQEMSYLFKRVNDLKNIAVDQREILVEFVRTDKSINTIYIDWPQGSPQN
FT                   PLTMDEIYVKLAHALSIDENELFDILTAGLTSKSVAGLLNIIARI"
FT   gene            93239..93796
FT                   /locus_tag="LEUM_0109"
FT   CDS_pept        93239..93796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0109"
FT                   /product="Acetyltransferse"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61260"
FT                   /db_xref="GOA:Q03ZW2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZW2"
FT                   /protein_id="ABJ61260.1"
FT                   /translation="MITNRFIKKNEVKELQLLLHEAYKSDTQLGINFQAARVTLQQIDE
FT                   HIENTATFVTEINHTIVATVSVRLPWSKNPGPYAIPHLGWVATHSQFSKQGYATQLIDW
FT                   VEKEYIQKQLKAPMVSLGTAVEHPWLKRFYTSVGYQPVEMVQKTPDHLTVYMVKVLNRK
FT                   FDQLESEQLKKYLNKNKTKVRY"
FT   gene            93811..94479
FT                   /locus_tag="LEUM_0110"
FT                   /note="LactoCOG number LaCOG00648"
FT   CDS_pept        93811..94479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0110"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61261"
FT                   /db_xref="GOA:Q03ZW1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZW1"
FT                   /protein_id="ABJ61261.1"
FT                   /translation="MNFDWHYFVNTFPELVKYIPMTLLLAILSMLLAIVLGGIITLLHF
FT                   SHYKVIHWFASIYVSFFRGMPALVQLFLIYYGLPQIFPIFKGLPAIIATVIGLGFKQSA
FT                   YLSEVFRAAVNSVDRGQIEAGQSLNIKSFKIFRYVILPQAFINALPATGNTFVGLLKET
FT                   SLAFTLGITEVFAEGKMLAGDSFKYFETYLAVGLTYWVLIILYSWAQSGVERVLNTPYS
FT                   "
FT   gene            94494..95246
FT                   /locus_tag="LEUM_0111"
FT                   /note="LactoCOG number LaCOG01193"
FT   CDS_pept        94494..95246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0111"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61262"
FT                   /db_xref="GOA:Q03ZW0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZW0"
FT                   /protein_id="ABJ61262.1"
FT                   /translation="MALIEVNNLSVEIKKKKILQEINFSVEKGEVTVLVGPSGSGKTTL
FT                   LRTLNLLQEPSQGTIKIGGTSIDGRKINKKSTRSLRSESTMVFQQFNLFKNMTVIENVM
FT                   APLLLNKLAKWDEAHDIAASVLSEVGLVAFQDKYPSSLSGGQQQRVSIARAIAAKPSVV
FT                   LLDEPTSALDPELVGSVLKTILALAKQHITMVIVTHEMEFARLIGNQIIFLENGQIVHK
FT                   GSPDQVLSSNGPKRVNDFVNSVSKNNYL"
FT   gene            95281..96096
FT                   /locus_tag="LEUM_0112"
FT                   /note="LactoCOG number LaCOG00647"
FT   CDS_pept        95281..96096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0112"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61263"
FT                   /db_xref="GOA:Q03ZV9"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZV9"
FT                   /protein_id="ABJ61263.1"
FT                   /translation="MKKRNPIISVIIVVVLIAIVAVGGLIYQTNNHKNEAKGDTKQKVL
FT                   KIGATGTSFPTAYKSKGKLVGFDVDVINAAAKKAGYKVQWVTGEFDGLLGQLDNNKLDT
FT                   VANDVAITPERKAKYKFSNIYNKEETTVAVNKDSDYNTLNDLEGKTIAGASASNNTKNL
FT                   QDYNSKIKFKLYDARDVTFQALLAGHVDGVVNTRNNLEALIKAKNYPWKVVKGSAATVN
FT                   IALPFRKDDSESAKILKKLNPAINKLKEDGTLKKLSEKYFGYDATADLK"
FT   gene            96122..97288
FT                   /locus_tag="LEUM_0113"
FT                   /note="LactoCOG number LaCOG00664"
FT   CDS_pept        96122..97288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0113"
FT                   /product="Metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61264"
FT                   /db_xref="GOA:Q03ZV8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR033846"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZV8"
FT                   /protein_id="ABJ61264.1"
FT                   /translation="MAINDKTLEDKLTKVRHQLHQHPELSNQEHQTTLFLNSYLETLGY
FT                   HIVTPQKLLTGVIAEIGPSESNVIIGLRSDIDALPIAEKTGLNYASVNEGIMHACGHDF
FT                   HMASLLGAAELLADQANKLTGRVRLIFQPAEEIHVGAQAVAEAGGIKNLNAIIGFHNKP
FT                   DLKVNEIGILSGGLMAAVDQFKVTFRGQGTHAAMPQLGNDPIVALTSTVNTLQTVVSRK
FT                   TDPQSPVVVSVTHIDGGSTWNVLPDVAWFEGTVRSFDLASRQLAREQFYQIVNGQAATF
FT                   GLAVDISWIEGPNVVNNDSELTPIVIEETKQHAKLLTPKPSNAGEDFSYFSQKVPSVFA
FT                   FIGSAGTTDWHHDDLIIDDRGLLPAARWYFYTANRLLAHFSGTTTNDR"
FT   gene            97303..97617
FT                   /locus_tag="LEUM_0114"
FT                   /note="LactoCOG number LaCOG01080"
FT   CDS_pept        97303..97617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0114"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61265"
FT                   /db_xref="GOA:Q03ZV7"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZV7"
FT                   /protein_id="ABJ61265.1"
FT                   /translation="MVVKAITDEQYQEEVETGVSIVDFWATWCGPCRMQSPVLETVSED
FT                   RNDIHFFKVDVDISQETAASLGIRAIPTLVVHKDGKIVERLTGFHNSEQLVNILNKYVD
FT                   "
FT   misc_binding    97704..97980
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="T-box leader, riboswitch"
FT   gene            98013..98759
FT                   /locus_tag="LEUM_0115"
FT                   /note="LactoCOG number LaCOG03126"
FT   CDS_pept        98013..98759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0115"
FT                   /product="Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61266"
FT                   /db_xref="GOA:Q03ZV6"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZV6"
FT                   /protein_id="ABJ61266.1"
FT                   /translation="MTNKLNNILSELKEFQWVDLTHTFGPDSPHFPAFAAAKFETLFTH
FT                   DDGFFVKQYTFPGQYGTHIDPPVHFEKNQNVYDSDIDLKDFLLPLVVIDKSSEVASNAD
FT                   YILTVEDIKQWEKEHGTIPPKAFVALRTDWSKRWPSQEQFENKDDNLQNHYPGWSLEAL
FT                   KYIYEERQAIANGHETFDTDPAILQPEKGFEGEYYVLSSGHYQIELLANLDQVPATGAL
FT                   ISISVPKVEKSPGFPARVFAIVPEEV"
FT   gene            98761..100092
FT                   /locus_tag="LEUM_0116"
FT                   /note="LactoCOG number LaCOG01961"
FT   CDS_pept        98761..100092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0116"
FT                   /product="Amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61267"
FT                   /db_xref="GOA:Q03ZV5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZV5"
FT                   /protein_id="ABJ61267.1"
FT                   /translation="MAENKITLSRSLSTKDLVVYGIIFMIPVAPIAFYGSFLSPAHGMV
FT                   ALAYLIGMIAMLFTGFSYASMASEFPYSGSVYTYVQKGTNPVLGFLSGWGITLDYILIP
FT                   VITYLISASFGQSLLPAVPFWVWILGIAIFNTVINLLGIKVVSKFSWLLFGLQGVVLIA
FT                   FIVGTIVALANGTVSFNVSSFYNASHFDLSGVVQATGIVIVSYLGFDAISTLSEEANDP
FT                   TKSIGKAIVLSIILIGSLFVIVTFFAGFVAPNYSELNPDTAFLTILGKVGGSWLVHLAE
FT                   FTLVLSFGLAGGQEGQTAVSRILYSMGRDGILPKRLSYLHPRYNTPWVAIILVGIVSVA
FT                   LSLSLSLTTVSNLISFGALFGFLSLNIAVIWHFYIKRPDKNIESFVKYLVSPFIGFSVS
FT                   LWIFLSLALEAKLTGLFWLIIGLVILVYKTSIFKKPVPQFDFSE"
FT   gene            100143..100919
FT                   /locus_tag="LEUM_0117"
FT                   /note="LactoCOG number LaCOG00625"
FT   CDS_pept        100143..100919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0117"
FT                   /product="acetoin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61268"
FT                   /db_xref="GOA:Q03ZV4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014007"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZV4"
FT                   /protein_id="ABJ61268.1"
FT                   /translation="MSKKVAIITGSGRGIGKAIAERLATENYYVAVVDIDESSAKYVSD
FT                   SINAIKENQAKYYVLDVADRKSVFDLVDKVVADFGRLDVFVNNAGIAYIDSIIDSDPEK
FT                   VERLFDVNLKGTFWGIQAAAKQLKKQGSGGRIINAASLAAVEGSALQGAYSASKFAIRG
FT                   LGQSAAKELAKYNITVNTYDPGIVITPLRDYIDQRTAQIKNTTAEIQRQSVVNEIALGR
FT                   AALPDDVADVVSFLVSQQAKYITGQSILIDGGMRFH"
FT   gene            100967..101830
FT                   /locus_tag="LEUM_0118"
FT                   /note="LactoCOG number LaCOG01803"
FT   CDS_pept        100967..101830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0118"
FT                   /product="ABC-type metal ion transport system, periplasmic
FT                   component/surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61269"
FT                   /db_xref="GOA:Q03ZV3"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZV3"
FT                   /protein_id="ABJ61269.1"
FT                   /translation="MVKKKTVVIAAVVAGIVIVAGVIIHRNTAQTTDKTEVTVGSIGSD
FT                   AQIWEYIAKLPETKKENITIKVKNFTDGVSLNAATAQGKVDVNAFQSYAYFVAYNKNNS
FT                   SNKLSVLGTTYLEPMGIYSEKYDSIDDIPDGSTIAIANNAANTARGLKLLAKAGLITLK
FT                   DNFGSLSGVNDIKNNPHNFKFKEIDDTTGPRVIKDNSIAAALIGNTIALEGKLNVLKDS
FT                   LYYEKINQSTKDNINILATAEKNKNNAKFKKLVKLYHSKAAQKYINKKFDGTKIEVQKS
FT                   VSYLAD"
FT   gene            101869..102525
FT                   /locus_tag="LEUM_0119"
FT                   /note="LactoCOG number LaCOG02215"
FT   CDS_pept        101869..102525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0119"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61270"
FT                   /db_xref="GOA:Q03ZV2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZV2"
FT                   /protein_id="ABJ61270.1"
FT                   /translation="MSWEYIQQAEPEYIKAFWLTLKLSSVGIVGAIIIGIVTAFVNYHK
FT                   LPGRRGIITYVEIARNTPLLIQLFFIYYGLPSIGIKIPAEETAIIGLIFLGGAYMSEAF
FT                   LGGLKSVPKVQIESGRVIGLSAWQLSRYIIFPQGIVFSLPSLAANIIFLIKETSIFTVI
FT                   AIPEITNTTLDLIGQNYRTNEYLLMMIISYAIILIPLSLLLSWIEGRVRYANFDN"
FT   gene            102506..103186
FT                   /locus_tag="LEUM_0120"
FT                   /note="LactoCOG number LaCOG02214"
FT   CDS_pept        102506..103186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0120"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61271"
FT                   /db_xref="GOA:Q03ZV1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZV1"
FT                   /protein_id="ABJ61271.1"
FT                   /translation="MQILTISTIFAGNNLFRLLNGLVVTIEISLISIILGTILGVILGS
FT                   LWSAAGTLIKPIFKAYLEIFRVVPTIPLLFLFYYIFPRNLNINLSAMQVSILVFSLWFA
FT                   AELSDIVRGAIQSISKSQRENAYSIGLTTLQTYRYVLIPQSVPNILPAFINLSSRIIKT
FT                   TSILLLISVTDVITVGQQIIEANAQDTAVPLLIYGFIALLYFLINYLLSHFSRRLERKY
FT                   RKYE"
FT   gene            103179..103919
FT                   /locus_tag="LEUM_0121"
FT                   /note="LactoCOG number LaCOG02213"
FT   CDS_pept        103179..103919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0121"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61272"
FT                   /db_xref="GOA:Q03ZV0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZV0"
FT                   /protein_id="ABJ61272.1"
FT                   /translation="MSESLIQTSSLDKFYGKKQVLHQINVTIPKNKVTVLLGPSGSGKS
FT                   TLIRTFNGLENFSSGEINIFGQTIEPRNNKQWKSIQTRIGMVFQSYDLFPNMTVMKNIL
FT                   LGPLKVQKRSREEVVEKAKKLLSEVGLSEYENAYPRQLSGGQKQRVAIVRALILNPELM
FT                   LFDEVTASLDPEMVRGILDILKNLANKNLTMVIVTHEMNFARQVGNKVIFLENGRVVEQ
FT                   GDGATFFTHPTTKRAEAFLESMSF"
FT   gene            103980..104825
FT                   /locus_tag="LEUM_0122"
FT                   /note="LactoCOG number LaCOG01690"
FT   CDS_pept        103980..104825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0122"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61273"
FT                   /db_xref="GOA:Q03ZU9"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZU9"
FT                   /protein_id="ABJ61273.1"
FT                   /translation="MNKKSKWTLLVAVTVVTVGAGVNYRILSAKADTNQSGRTVKEIKK
FT                   SGEIKIAVFGDLKPYGWVDKNGKRQGYDIELAKKVAKDLGVKVKYVQVNANARVDALNS
FT                   GKVDLALANFTVTPERKKVIDFAKPYMKVSIGVASKKSKLITKVDQLHGKKLIVNKGTT
FT                   AETYFTKNYTKASLLKFDSKTQQFAALKDGRADAITDDNSYLFAWVKSHPDYKVGIKKL
FT                   GEQSYISPGVQKGNKSLLKWTDKEINKLNKNQFFTKDYDKTLAPYFGKDVKSSDITINN
FT                   "
FT   gene            104881..106002
FT                   /locus_tag="LEUM_0123"
FT                   /note="LactoCOG number LaCOG01249"
FT   CDS_pept        104881..106002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0123"
FT                   /product="Glycine/D-amino acid oxidase (deaminating)"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61274"
FT                   /db_xref="GOA:Q03ZU8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZU8"
FT                   /protein_id="ABJ61274.1"
FT                   /translation="MLYDLIVIGTGSVGSSTGYYAAKRGLSVLEIDSATPPHTNGSHHG
FT                   ETRMIRHAYGEGSSYVPLVLRAQELWNELKRDTQVDIFHQTGVLNIAPKQSIFLNNIIT
FT                   SAEKYELPIEVYDASEARKKWPQFTIPDQFRAVLEKNSGYLKSELAIDTYVKEAKRLGA
FT                   HEQFNTQVISVDNDDNGFVHVTTNAGTFIGKSAVITVGTWVKDLIPNLPIQPVRKVVSW
FT                   FEAPKQLAEEIGFPAFTIQLGDGTHYYGFPANKGLIKIGRHQGGQYITKREERLDFDAL
FT                   NEDRTEIEPLLNSVLKTVGNLDHGVACSYDLSPDEHFIVDDLPGKKNIQFVSGLSGHGF
FT                   KFASVLGEILVAKALNETLDFDLSPFLLSRFNS"
FT   gene            106151..106549
FT                   /locus_tag="LEUM_0124"
FT                   /note="LactoCOG number LaCOG01570"
FT   CDS_pept        106151..106549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0124"
FT                   /product="camphor resistance protein CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61275"
FT                   /db_xref="GOA:Q03ZU7"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZU7"
FT                   /protein_id="ABJ61275.1"
FT                   /translation="MQNQKNFLTELLVTGLGGAIGGATRYLLGLVPIIGPMPVMTMLIN
FT                   WLGTLLLAMLGAYLASHRSRLERWQSFLGTGVLGGFTTFSTMIWQVHQQLFISVANALV
FT                   YMILTLGGGLIMLKLGNYFGNKIGEAHV"
FT   gene            106546..106884
FT                   /locus_tag="LEUM_0125"
FT                   /note="LactoCOG number LaCOG01570"
FT   CDS_pept        106546..106884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0125"
FT                   /product="camphor resistance protein CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61276"
FT                   /db_xref="GOA:Q03ZU6"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZU6"
FT                   /protein_id="ABJ61276.1"
FT                   /translation="MTILGVAIGSALGTMLRYIVLNTWPAKSKYFTAVFIVNMVGSFAL
FT                   GYLMATGATYAMHSFWTTGVIAGLTTFSTMMTQSGQYTRGQQAWYLAWQIIFGMIFFSA
FT                   GTALITIL"
FT   gene            106928..107809
FT                   /locus_tag="LEUM_0126"
FT                   /note="LactoCOG number LaCOG01020"
FT   CDS_pept        106928..107809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61277"
FT                   /db_xref="GOA:Q03ZU5"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZU5"
FT                   /protein_id="ABJ61277.1"
FT                   /translation="MSKIAVIIDSSSAMPVAIRNRYHIFQVNDPIIFGDEVYKETVDIH
FT                   SLGELVKMMQEKKQLASTSQPAPGDWEEALNLAKASGYNQAILITLSSGISGTYQTANA
FT                   IAQSYDGMDEVRAWDSKIAVMGAGVQAILAAAMAEKNRSLDEIITSLEQLRSTIDVRFV
FT                   VNDISHLQRTGRLSRGQALIGGLLNIKPILSIDVQDEGKIGAVGKARKMSGALKEIKEP
FT                   LRQSLAEADYPVRAYVIDGNNTKLGDKWLKDLQSEYPTVKFERGVIGAFIGVHTGDGAM
FT                   GVIWARDWEDLI"
FT   gene            107893..108531
FT                   /locus_tag="LEUM_0127"
FT                   /note="LactoCOG number LaCOG00340"
FT   CDS_pept        107893..108531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0127"
FT                   /product="Predicted membrane protein, hemolysin III related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61278"
FT                   /db_xref="GOA:Q03ZU4"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZU4"
FT                   /protein_id="ABJ61278.1"
FT                   /translation="MQRSRRFQIVYEVLNAVTHGFGFILAVIAGVMLMIHVLSKPVTAL
FT                   TLTAVIIYISTVGFFLLASTLFHSLVFTRAAKIFQFFDHAGIYLVILGSYTPYTWLLIK
FT                   GWVGWTIWGAILAMTIAGFVYDLFFVGRWPWVSVTIYLVMGWLIILAMPILWGVLSHTA
FT                   FWLLVAGGLTYSAGTIFYLIPKIPMGHVYWHLFVLGGAGLMFASIYISL"
FT   gene            108674..110128
FT                   /locus_tag="LEUM_0128"
FT                   /note="LactoCOG number LaCOG00977"
FT   CDS_pept        108674..110128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0128"
FT                   /product="D-xylose proton-symporter"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61279"
FT                   /db_xref="GOA:Q03ZU3"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZU3"
FT                   /protein_id="ABJ61279.1"
FT                   /translation="MLKRKPISNNFIYFFGALGGLLFGYDTGVISGAMLFIGKELEIQT
FT                   GSFEDGFITASVLLGAILGAAIIGPMSDKLGRKKLLLSAAIIFFVGALGSGIGFNYTLL
FT                   VTSRVLLGIAVGAASALIPTYLAELSPADKRGGIGTLFQLMIMTGIFLAYVSNEWLSPS
FT                   GWLGLNQNVGWHWMLGLAAVPAALLFIGGLSLPESPRFLVKQGKMSEAQKVLSTMNPNA
FT                   KLVEEELYDIKLQANTPSGGFKELFGPMARPVLIMALGLAIFQQVMGCNTVLYYAPKIF
FT                   ISAGFSEHFALQSHIVIGLFNVIVTAIAVKIMDKIDRKKMLTYGAIGMGASLLTMSTAM
FT                   LVLRAGNGNVGSWICVIALTLYIAFFSATWGPVMWVMIGEAFPLNIRGLGNSFGAVINW
FT                   TANFAVSQSFPMLLIAFTPDHAINAEGQGIAKLFIIYGVLCFVAIWFIAKFTIETRNRS
FT                   LESIESDLRSKAHAKGYLESDYVGIK"
FT   gene            110334..111503
FT                   /locus_tag="LEUM_0129"
FT                   /note="LactoCOG number LaCOG01998"
FT   CDS_pept        110334..111503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0129"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61280"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZU2"
FT                   /protein_id="ABJ61280.1"
FT                   /translation="MKKSDHLTIRDHNQRLVLQALFNADETSRAQLAIDLNLNKSTISS
FT                   IYRDLDEKGFIESLGDGETSETGGRKAKLIRFNRRYGYVISFDMGRHHLRTALVQVGGA
FT                   VIMKQNTAVDGMSVLQVTELMISQIKKYKNNKNGTLNGLMGISVGIHGVVENNKVQYSP
FT                   FFDYSQLDMTVELENVSGVRVVLENEANFAATYMRDYHDYRKSDHYNNMVVLNIHYGIG
FT                   AGIIINGELYRGIQGRTGEIGRSVIETSTGETVRIEDLYSEDAMLRRTAERTGLIVQDR
FT                   DRFIQLRKEQPETVSLLLDEWVRGISRVAFNLVQTLAPEALFIHSRFIAEMPDLLERVI
FT                   VAYQMLNPINQSEILFANHSVYDATLLGGASSIAREVLDLDGLSLSFRL"
FT   gene            111678..113024
FT                   /locus_tag="LEUM_0130"
FT                   /note="LactoCOG number LaCOG00983"
FT   CDS_pept        111678..113024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0130"
FT                   /product="D-xylose isomerase"
FT                   /EC_number="5.3.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61281"
FT                   /db_xref="GOA:Q03ZU1"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013452"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZU1"
FT                   /protein_id="ABJ61281.1"
FT                   /translation="MAELFDFPQVTFVGIQSLQAGDGFHYYNPDEIVKGKKMSDWLKFS
FT                   VTYWHTMDQRLVDPFGEGTAVRPWDNQGKPDSMEQALAKVDYLFEFLEKTDVNYFAFHD
FT                   RDLAPEGHTLAETNKNLDQVIDKIEQKIHETGKKLLWNTSSLFTNKRFLAGGATTPFAE
FT                   VFAYAAGQIKHSLDIAKRLGSESYVFWGGREGYDFLLNTDTKRELDHIAAFFKLAKDYA
FT                   NEIGYQGQFLIEPKPKEPTQHQYDFDVQTTIAFLKTYGLEDTFKLNLEGNHAYLAGHTY
FT                   EHEVRFAREAGLLGSLDANMGDKLTGWDIDEFPNDVYEATLVMYEFLKNGGLPTGGLNF
FT                   DSKARRQSFQADDLFYAHIAGMDTYAAGLKVAAKLIDDQVIENVLKERYASFDSGIGAD
FT                   FEAGKVTLKELATYIENKTDEEINATLKSGRQERIKQTLNNYIFSVLGS"
FT   gene            113171..114682
FT                   /locus_tag="LEUM_0131"
FT                   /note="LactoCOG number LaCOG00982"
FT   CDS_pept        113171..114682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0131"
FT                   /product="xylulokinase"
FT                   /EC_number="2.7.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61282"
FT                   /db_xref="GOA:Q03ZU0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZU0"
FT                   /protein_id="ABJ61282.1"
FT                   /translation="MTKVVLGIDLGTSAVKVSAVDRRGNIVAQQSFDYPVTQPQVGWSE
FT                   QNPEDWVNGTTVAIVNLILKDHIAPTEIEGISYSGQMHGLVLLDENHQVLRPAILWNDT
FT                   RTSAQVEEIKNKLGKKFLDITRNYPLEGFTLPKILWVKEEEPEIFKQADLFLLPKDYLR
FT                   YRMTGKLAMDYSDAAGTVVLNVTKKCWSTDIAEAFDLPSSFFPNLIASTDFAGHISESY
FT                   ATFSGLTTQTKVYGGAADNAAGAIGAGLLKSNMVMSSIGTSGVVAKFEDNADIDYHGEI
FT                   HFFNHAIPNKYYSMGVTLAAGDANSWFKRVFGETQSFSAWLREAEQSSVGANGLLFTPY
FT                   ISGERTPYPDADIRGSFLGLDRKHQRGDFIRAVLEGIIFSFKDIMTIYDQQGVDFDTII
FT                   AIGGGAKSPLWLQIQADIFGKRVTTLENEQGPGLGAAIIAATGLGWFDSVQEAAQSFLS
FT                   FGMVYEPKAENVLKYQQMYSIYQTAYRSTAEISHKLVAYQRKISS"
FT   gene            complement(114832..114907)
FT                   /locus_tag="LEUM_t0132"
FT                   /note="tRNA_Lys_CTT"
FT   tRNA            complement(114832..114907)
FT                   /locus_tag="LEUM_t0132"
FT                   /product="tRNA-Lys"
FT   gene            115011..115892
FT                   /locus_tag="LEUM_0133"
FT                   /note="LactoCOG number LaCOG01480"
FT   CDS_pept        115011..115892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0133"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61283"
FT                   /db_xref="GOA:Q03ZT9"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZT9"
FT                   /protein_id="ABJ61283.1"
FT                   /translation="MDFCTICSRSISMFDLIKAIIIGIIEGLTEFLPVSSTGHIILAEA
FT                   LMKIPSGNVWTKAFSSVFDYSIQLGAIFAVIQLYFDKLNPFSSKKTDHEKFQTWRLWIR
FT                   VIVGVLPAIVFGFALNDFMDAHLMNFWVVSATLIIYGIAFIVIENRQKSIVPVITNVNQ
FT                   ITFKLALYIGLFQVLSIVPGTSRSGATILGAIILGASRFVAAEFSFFLSIPVMFGVTFL
FT                   KMGSFFRDGGSFTGMQSIVMLVGFIVSWIVAWFAIKFMMNYIKNNDFKVFGYYRIIIGA
FT                   IFLVFGILGIVG"
FT   misc_binding    116025..116303
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="T-box leader, riboswitch"
FT   gene            116440..117471
FT                   /locus_tag="LEUM_0134"
FT   CDS_pept        116440..117471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0134"
FT                   /product="Uroporphyrinogen-III decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61284"
FT                   /db_xref="GOA:Q03ZT8"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZT8"
FT                   /protein_id="ABJ61284.1"
FT                   /translation="MESTGKLSFTNNYNYVPASFWYHFSAASGVELDAFKNPEIIEGNI
FT                   LGTKKLVETTSPDFVKLMSDGLFHYEFNYQDADDKRVVYANLSPIADNHPWLIKTADLV
FT                   RRQKQVIGERASFYNVFSPTTLLKWALVKNPDGHYDKSKADEKLADIILTDSENVRQAL
FT                   EVITLDVIKQVKAAVNAGADGIYYSTQVIQDTRLGHADFDEFVAATDKQVLKAANQLSD
FT                   TNILHICGNGGARNAISWFENYPASIVNWSVDTEDISLHEGKEIFPGKIVLGGFGNTAK
FT                   DVLYRGTQSEIQQFAKRLVQEAGADNLIIGANCTVPRDIDPQHLQWAIEAVQKESEGLK
FT                   SYE"
FT   gene            117464..118465
FT                   /locus_tag="LEUM_0135"
FT   CDS_pept        117464..118465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0135"
FT                   /product="Uroporphyrinogen-III decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61285"
FT                   /db_xref="GOA:Q03ZT7"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZT7"
FT                   /protein_id="ABJ61285.1"
FT                   /translation="MSNQQNVLLDSTEKIPVSFWRHFADDETVDALENPTIATINIQGH
FT                   KEYVDDLRPDFVKLMSDGYFNVPFDNVTDPKNIDNLSKIQEIQDDDPWLTEQVKLVQEQ
FT                   KKVIGQRRGFYNIFSPVTILKWALYDAESELPAKGDERLTELFIQYPEEIKHILNVLAK
FT                   NIIKQVKAVVVDGGADGVYYSTQELQSSKYTKELFDGIQKNVDLSVIDAIKSVSDISIL
FT                   HICGFSGTSNHLEWFIDYDLPIVNWAVTVEGISLQQGQQIFKDKVVLGGFGNTTDDVLY
FT                   NGSKDEIEAAVQGLLSNVDKKRVIIGADCTVPRDIPVDHLKWAIAAVHENVV"
FT   gene            118481..119341
FT                   /locus_tag="LEUM_0136"
FT                   /note="LactoCOG number LaCOG01373"
FT   CDS_pept        118481..119341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0136"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61286"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZT6"
FT                   /protein_id="ABJ61286.1"
FT                   /translation="MVNKKGIITAAVAVVIIGGGLTIRHLNADSNKAAAKKVRTINVAH
FT                   TQNYVPYDYVKNGVSKGYEVDVLKAVDKLLPDYKFKYHPTSDEDLLVGLDSGKYDVGVK
FT                   GAWWTKERAKKYILPKQAVGASIIGITYRKDDNYKSFAEFAKKSGKLVPISPQNGQYAV
FT                   VQEWNKKHPNEKITLKSADQFTVGDAYNWVLEGRYDAYFDVKVNYQNSVVKSSGAYHSS
FT                   ADKLAYTPYKGIKTYPIISRANKDNSNFSKEYDQAIKKLQKNGTLEKLSQKYFKENVWD
FT                   FVGDK"
FT   gene            119365..120087
FT                   /locus_tag="LEUM_0137"
FT                   /note="LactoCOG number LaCOG01165"
FT   CDS_pept        119365..120087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0137"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61287"
FT                   /db_xref="GOA:Q03ZT5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZT5"
FT                   /protein_id="ABJ61287.1"
FT                   /translation="MPPFSFKFFLSVFGEVLPYFPVTLLIIVTSIIFSSLLGALVASGQ
FT                   LSRSPIWRTLSQGYVFVLRSTPPIVLLFLVFYGLPKLLLLSLNININDWQKSIFVIIAL
FT                   SLLFASNLAEVFKSAYLSVNTGQREAALMVGLSEWQTFYRITLPQTIVVALPNFANTVA
FT                   ALIKDAALAYVIGLLDMMGAGDNLISRNFGHHSLETYLALAIIYWILFVIIEQGAKYLE
FT                   RYLGKSRAIASNPAEVVA"
FT   gene            120084..120794
FT                   /locus_tag="LEUM_0138"
FT                   /note="LactoCOG number LaCOG01165"
FT   CDS_pept        120084..120794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0138"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61288"
FT                   /db_xref="GOA:Q03ZT4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZT4"
FT                   /protein_id="ABJ61288.1"
FT                   /translation="MNVPFLIQTFWSAIKAVPITLLITGASLLIGLPLGFLLAWIKIRK
FT                   IRILYPLVVAYTSLMRATPMVLLILLFYSTLPSLLNVLVNQKLHWNVKVFDTNPIIYAI
FT                   IVFALIAVANLSEVFRSAILTIDPGQKEAALMVGLTPIQAYYRIIIPQALVSAVPNIGN
FT                   LTLNILKGTSLAFMMTVQEVTAVAKTAASYTYDYTEAYIDIFIIYFILGTILQIIFKYL
FT                   ERYLGRHKLRGTVV"
FT   gene            120805..121587
FT                   /locus_tag="LEUM_0139"
FT                   /note="LactoCOG number LaCOG01193"
FT   CDS_pept        120805..121587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0139"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61289"
FT                   /db_xref="GOA:Q03ZT3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZT3"
FT                   /protein_id="ABJ61289.1"
FT                   /translation="MLKVRNFRKKYHEHEVLKGIDIEVNQGDVVALLGPSGSGKTTFLR
FT                   GLAFLTPGDSGVIEFDDQKISIESATPVDIKKLRQKMGFVFQNFNLFANKTAIQNVEEG
FT                   LIIGHKEPKEIARKKAQEALQKVGLLEFANHYPSQLSGGQAQRVGIARAAALNPEIILL
FT                   DEPTSALDPELVADVLQVIKQLADEGKTMIVVTHEMAFARDVADKVVFMDKGLVVEENE
FT                   PVEFFDNPKSPRLKEFLSRISAANVADNSFEYEKANQK"
FT   gene            121706..123217
FT                   /locus_tag="LEUM_0140"
FT                   /note="LactoCOG number LaCOG00253"
FT   CDS_pept        121706..123217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0140"
FT                   /product="bacterial peptide chain release factor 3 (bRF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61290"
FT                   /db_xref="GOA:Q03ZT2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZT2"
FT                   /protein_id="ABJ61290.1"
FT                   /translation="MENFQEQLKNRRTFAIISHPDAGKTTLTEQLLLHGGVIREAGTVK
FT                   GRGSNKLASSDWMAIEQQRGISVTSSVLQFDYEGKRINILDTPGHEDFSEDTYRTLMAV
FT                   DSVVMVVDAAKGIEPQTKKLFEIVSQRGIPVFTFFNKIDRDARPALDLVDELETVLGIQ
FT                   AYPMNWPVGSGQVLQGIYDLQADQLVPFKNATIHSEIVDEAMDEIELLRDAGNPFDEDK
FT                   IAHGQLTQVFFGSALVNFGVTEFLREYLTYAPAPAAMTTVDDKKINPEDAQFSGFVFKI
FT                   QANMDPRHRDRIAFVRIVSGEFNRGMDVLLQRNGKKLKLSNVTQFMAEERENVQTAVPG
FT                   DIIGVYDTGNFQIGDTIYSGKKAVQFPDLPTFTPELFNRVVAKDVMKQKSYHKGIEQLV
FT                   QEGTIQLYKSWNGGDYIIGAVGQLQFEVFQFRMENEYNVEIQFEPIGSKVARWIKPEQL
FT                   DEKMSSSRNLLVKDRYDEPVFLFENKFALNWFHDKYPDVELEEKM"
FT   gene            123307..123849
FT                   /locus_tag="LEUM_0141"
FT   CDS_pept        123307..123849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61291"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZT1"
FT                   /protein_id="ABJ61291.1"
FT                   /translation="MSYYTQQLFNGQRDRILRVVDSDDATQATAGFIHIFDERRAFDFE
FT                   YAKELTNGEITQEQFDEEGESVNTFSVNFMPLAHAEEEEIPNELFEEWAGLIGREYALV
FT                   PNLHMNMYQQSLKPGIEEIDKDLFEERLLELVTRVLGSSVVGFEEKALTLYPSFLVQEQ
FT                   PEQSEQKGPSTQIILPE"
FT   gene            124136..124693
FT                   /locus_tag="LEUM_0142"
FT                   /note="LactoCOG number LaCOG02072"
FT   CDS_pept        124136..124693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61292"
FT                   /db_xref="GOA:Q03ZT0"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR030949"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZT0"
FT                   /protein_id="ABJ61292.1"
FT                   /translation="MENTTRTWVFPKLDTRQFVLLAMLMALHMVLSRLTVGTNVLQVSF
FT                   AFVTMSLIAKWYGPLWSMLIAAILDVIGATIINPGAFFVGFTFTAMISALIYSLAYFKH
FT                   DKTSWWRVSVAVGLVLLIANIGLNSIWLVMMYHTAHDWPSFLAFITPRVIKNLIMFPIQ
FT                   VGISYFLLNNQVISHTTKKIFS"
FT   gene            124732..125559
FT                   /locus_tag="LEUM_0143"
FT                   /note="LactoCOG number LaCOG00855"
FT   CDS_pept        124732..125559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0143"
FT                   /product="Hydroxymethylpyrimidine/phosphomethylpyrimidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61293"
FT                   /db_xref="GOA:Q03ZS9"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZS9"
FT                   /protein_id="ABJ61293.1"
FT                   /translation="MVNEFPQVLTIAGSDSDGSAGMQADLHTFFIRKTYGMSVLVAAVA
FT                   GNSYGIHAAETLPLHFVDKQFEVLADDFKVRASKTGMLSDASLIEAVVKAYKQFDFGPL
FT                   VVDPVITTKHGAQLLEAAAFEALKEKLLPLATVATPNFFEAQLLTGRTIDNEQQQTAAA
FT                   KDIQSLGVQNVIVKGWHNQDNQNEVADYVLLADGSDFWLRHPYFDTTHINGTGDTLSAA
FT                   IAAEIAKGKDVATAIRIAHDVTATAIEHEIAVGHKFGPINHWAAQDYNKKEDK"
FT   gene            complement(125576..126259)
FT                   /locus_tag="LEUM_0144"
FT                   /note="LactoCOG number LaCOG01951"
FT   CDS_pept        complement(125576..126259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0144"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61294"
FT                   /db_xref="GOA:Q03ZS8"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZS8"
FT                   /protein_id="ABJ61294.1"
FT                   /translation="MYYIDGQFYQLGYKQKISFFFISLIINSFGNGLSVASAMGSAPWT
FT                   ASAANLSNTTGWQISIFLAITAVSVAFLNMWLAMRINWLRLLGNIFFGMAFSILVGVFA
FT                   NYFVSLGIRQLSWWWRIPLDLFGIWTIGVAISIYQRVNWILHPLDDLTNILRFDYFRGN
FT                   ASKAQMSNFAVAIGISIICLIISHQIVALGIGTVMSFLLQGRNIAWADRHIFKRLVHGD
FT                   ITGAS"
FT   gene            126386..127162
FT                   /locus_tag="LEUM_0145"
FT                   /note="LactoCOG number LaCOG00625"
FT   CDS_pept        126386..127162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0145"
FT                   /product="acetoin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61295"
FT                   /db_xref="GOA:Q03ZS7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014007"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZS7"
FT                   /protein_id="ABJ61295.1"
FT                   /translation="MSENKVALVTGAGQGIGQAIAERLSKDGFKVALVGRHIEKVQKVA
FT                   DEINENGGEAIAIKADVAKRDEVFAAVKETKEKFNGFDVIVNNAGVAPTTPIMSVTEDD
FT                   MNWTWGINVNGIVWGTQAATEAFKEFGHGGKIINATSQAGVQGNANLTAYGSTKFAIRG
FT                   ITQTTAKELAEFGITVNAFAPGIVKTPMMEDIAHEVSVNAGKDDEWGMAQFSEGITLGR
FT                   LSEPEDIANVVSFLSSSDSNYVTGQTLIVDGGMVFS"
FT   gene            127389..130091
FT                   /locus_tag="LEUM_0146"
FT                   /note="LactoCOG number LaCOG01452"
FT   CDS_pept        127389..130091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0146"
FT                   /product="acetaldehyde dehydrogenase / alcohol
FT                   dehydrogenase AdhE"
FT                   /EC_number="1.2.1.10"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61296"
FT                   /db_xref="GOA:Q03ZS6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR034789"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZS6"
FT                   /protein_id="ABJ61296.1"
FT                   /translation="MAEAIAKKPAKRVLTPEEKAELQTQAEKMTEVLIEKSQKALSEFS
FT                   TFSQEQVDKIVAAMALAGSENSLLLAHAAHDETGRGVVEDKDTKNRFASESVYNAIKFD
FT                   KTVGVISEDKIQGKVELAAPLGILAGIVPTTNPTSTTIFKSMLTAKTRNTIIFAFHPQA
FT                   QKASVLAAKIVYDAAVKAGAPENFIQWIEKPSLYATSALIQNPHIASILATGGPSMVNA
FT                   ALKSGNPSMGVGAGNGAVYIDATVDTDRAVSDLLLSKRFDNGMICATENSAVIQAPIYD
FT                   EILTKLQEQGAYLVPKKDYKKIADYVFKPNAEGFGIAGPVAGMSGRWIAEQAGVKIPDG
FT                   KDVLLFELDQKNIGEALSSEKLSPLLSIYKVEKREEAIETVQSLLNYQGAGHNAAIQIG
FT                   SQDDPFIKEYADAIGASRILVNQPDSIGGVGDIYTDAMRPSLTLGTGSWGKNSLSHNLS
FT                   TYDLLNIKTVARRRNRPQWVRLPKEVYYEANAITYLQDLPTINRAFIVADPGMVQFGFV
FT                   GRVLGQLELRQEQVETNIYGSVKPDPTLSQAVEIARQMADFKPDTVILLGGGSALDAGK
FT                   IGRFLYEYSTRHEGILEDDEAIKDLFLELQQKFMDIRKRIVKFYHARLTQMVAIPTTSG
FT                   TGSEVTPFAVITDDETHVKYPLADYELTPEVAIVDPEFVMTVPQHTVSWSGLDALSHAL
FT                   ESYVSVMASEFTRPWALQAIKLIFDNLTNSYNYDPKHPTKEGQNARTKMHYASTLAGMS
FT                   FANAFLGLNHSLAHKTGGEFGLPHGMAIAIAMPHVIKFNAVTGNVKRTPYPRYETYTAQ
FT                   KDYADIARYLGLKGETDAELVDVLIAEIKKLAASVGVNQTLSGNGVSKHDFDTKLEKMI
FT                   DLVYNDQCTPGNPRQPSLAEIRQLLKDQF"
FT   gene            complement(130124..131614)
FT                   /locus_tag="LEUM_0147"
FT                   /note="LactoCOG number LaCOG01469"
FT   CDS_pept        complement(130124..131614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0147"
FT                   /product="23S rRNA m(5)U-1939 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61297"
FT                   /db_xref="GOA:Q03ZS5"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZS5"
FT                   /protein_id="ABJ61297.1"
FT                   /translation="MTEQNKRPYQKSRNNNGKKPYYGKNFDPRKSGAPRGNTSEGVNVR
FT                   VGQNFPLTIKRLGINGEGIGYFKRKIVFVPGALPDEVAVVKVTEVEPKYIAAKVLKIRE
FT                   KSPDRVKPLDEFADSVGGFELEHMNYPAQLRFKKDVLVQSLEKFQPKGWSNYDIRDTIG
FT                   MDHPYEYRNKAQFPVRKIGDKLSVGMYKRGSHDLVDLPVVHTQTPATMKVMRTVRELLD
FT                   KLSVSIYNEDKNRGTVKTIVARVSQTTSEVQLTFITNTDGFPGDTALIEAINQALPEVT
FT                   GIFQNYNPGRTSLVWGEETLKLWGKDYIEEKVLGKTFQLSPRAFMQLNHTQMSVVYNQA
FT                   LAALDLTHADKLVDAYAGVGTIGLSLADKAGEVRGMEIIPEAVDDANQNATLNHISNAH
FT                   YEVGTAEKLFPKWQSEGWIADALVVDPPRTGLDTALRREILRTQPEKFVYISCNASTLA
FT                   RDLVDLSKAYQVDYIQSIDMFPQTARWEGVVKLTKRQK"
FT   gene            complement(131686..132849)
FT                   /locus_tag="LEUM_0148"
FT                   /note="LactoCOG number LaCOG00453"
FT   CDS_pept        complement(131686..132849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0148"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61298"
FT                   /db_xref="GOA:Q03ZS4"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZS4"
FT                   /protein_id="ABJ61298.1"
FT                   /translation="MSKTPYQLTLPDEIVSELHLKHNQPLNLTLRNGQLIIQQTNNPNE
FT                   RQTLSLRHFLIPSMVMAIIFTIYAVEEKMFRIPLGGDNSIASAVIMLSEISGIFMFLLI
FT                   YFQQQRQQIDKLRRKTSWRVLPALTVAFAIILAFVTSGFFWAINYLFQTASFDLFTSIA
FT                   LFTMFNGIINFLMIYSALSISTLFITSIFVMTIIGGVLTAMVTNSSRMWWQYNLSFLGT
FT                   DNALDSWQFNATLILAGLIWLALVDYLFVPLQKILRHNRRLITLRILLNLSALSLAGVG
FT                   LFPNNAGRLHILHDQMANFLIYFILIMMLGNRWLLPNAPREFEATSYIICAILVTSMIL
FT                   FQWVGYLSLTTFEIVAFVLALSWILLLFQNIYRLYYHTYQTFVVPIS"
FT   gene            133123..133347
FT                   /locus_tag="LEUM_0149"
FT                   /note="LactoCOG number LaCOG02129"
FT   CDS_pept        133123..133347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61299"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZS3"
FT                   /protein_id="ABJ61299.1"
FT                   /translation="MRFDIKAYLDDNSLTIYRVAKESGYGYTTIHKSFNKTQSDATSLN
FT                   MRDLDALAKVQHKQMWEVLRELEKLYFDE"
FT   gene            133404..135554
FT                   /locus_tag="LEUM_0150"
FT                   /note="LactoCOG number LaCOG02073"
FT   CDS_pept        133404..135554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0150"
FT                   /product="ATP-binding subunit of Clp protease and DnaK/DnaJ
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61300"
FT                   /db_xref="GOA:Q03ZS2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZS2"
FT                   /protein_id="ABJ61300.1"
FT                   /translation="MANNDFFNDPFGSDMNDIFNNMMGNMNGMNSENRRYLINGREVTP
FT                   EEFVQYRQTGKLPQGLQAANATNGQPVAQQAGQPGQVKQEGMLAKLGRNLTKEARDGLL
FT                   DPVIGRNKEIQETAEILGRRTKNNPVLVGDAGVGKTAVVEGLAQAIVNGDVPAAIKDKE
FT                   IYSIDISSLEAGTQFRGAFEENIQNLLKEVKQAGNVILFFDEIHQILGAGSTGGEDGGK
FT                   GLADIIKPALSRGEISLIGATTQDEYRNTIMKNAALARRFNEVTVNAPSPKDTLEILKG
FT                   IAKLYEKHHHVSLPENVLKAAVDYAVQYIPQRSLPDKAIDLLDMTAAHLSAKNPVTDKV
FT                   SLEKQMSDAKAKQEKAVADEDYEAALKYKNQIADLEKKVGSADEAKKVEATPNDVAESV
FT                   ERLTGIPVAQMGASDIERLKTIGDRLAGKVIGQDEAVSMVAKAIRRNRAGFDEGNRPIG
FT                   SFLFVGPTGVGKTELAKQLALDMFGSKDNIVRLDMSEYSDLTAVSKLIGTTAGYVGYDD
FT                   NSNTLTEKVRRNPYSIILLDEIEKANPQVLTLLLQVMDDGRLTDGQGNVVNFKNTVIIA
FT                   TSNAGFGHNSSDADQDLMAKLAPYFRPEFLNRFNGVIEFSTLTKDDLKQIVDLMLDDVN
FT                   KTLAKKDLTLHVSDEVKDHLIEDGYDEALGARPLRRVIEQQIRDQVTDFYLDNPGEKSL
FT                   SADLVDGKVVISAVVEKTAVTN"
FT   gene            135662..136654
FT                   /locus_tag="LEUM_0151"
FT                   /note="LactoCOG number LaCOG03127"
FT   CDS_pept        135662..136654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61301"
FT                   /db_xref="GOA:Q03ZS1"
FT                   /db_xref="InterPro:IPR007358"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZS1"
FT                   /protein_id="ABJ61301.1"
FT                   /translation="MIIQHAILHILDTNTGSLIASQGEMNVDNVGVHEYIEKLVNKIYK
FT                   GDIKTGNLLPDSYLDKMIKQSDFPEVTTQMATKLFDTIAASESIPAGDLLSFQATIDEG
FT                   PIFGLIKLNFGARYAHAVEYEDDQMVNNLVLNQSILPAATQTVDEAILVNVDDGSYQLL
FT                   EKKQLIDGHRVPYFSENFLEIKPEVSAKENIQVIKRTIKNIAEKYDEPEHEVLAATQEV
FT                   IYNSLAETGSISTDVIAEKVFGDNITAKQEYQEKLTEKSLPTEVSVVNSEKYEKKYQTQ
FT                   KFKLDSGIEISIPVHVYQDLSKVEFVNNADGTITLMIKDIASILNKFNV"
FT   gene            136666..137604
FT                   /locus_tag="LEUM_0152"
FT                   /note="LactoCOG number LaCOG00103"
FT   CDS_pept        136666..137604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0152"
FT                   /product="ADP-ribose pyrophosphatase with uncharacterized
FT                   conserved domain"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61302"
FT                   /db_xref="GOA:Q03ZS0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR014937"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR036287"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZS0"
FT                   /protein_id="ABJ61302.1"
FT                   /translation="MPYQDSYVARIREKIGHDFELVMPTIDVVIANSKGELLMIYNRDF
FT                   DGWAFPGGYIEPEMSWQENAAREALEESGIRANAKDLQLIGSVSGENYRTQYPNGDRVK
FT                   LYTNVFLLTKWSEELDKIDDTEIDGKKWMTPQTIDHVHLTFSGRAVYQAYRQFQETKQI
FT                   QLLTINSELQRFLDAQDGRIADVNTYEDAINELTAGQKRTHWMWFVLPQLRGLGTSERA
FT                   TYYGIKNAKEAREYLADDELRTRLEKILKIVSTIESSDPVAIFGQVDAEKFHASVTLFA
FT                   QVAETPDLYQQVLVKYFNGDLHQPTLDLLNK"
FT   gene            complement(137636..139066)
FT                   /locus_tag="LEUM_0153"
FT                   /note="LactoCOG number LaCOG01721"
FT   CDS_pept        complement(137636..139066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0153"
FT                   /product="fumarase"
FT                   /EC_number="4.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61303"
FT                   /db_xref="GOA:Q03ZR9"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZR9"
FT                   /protein_id="ABJ61303.1"
FT                   /translation="MRTESDSLGQINVPKDVYYGAHTQRALNNFPISKETTHPEIIRAF
FT                   LEIKQAAAQTNATSGNLDRAVAKHIVDATKILLSQPIDLTMFPISDVQGGAGTSTNMNV
FT                   NEVVANTALEQVGRARGEYGYVNPNDHVNMGQSTNDTYPSAGKIALIRLLEPLFSELTL
FT                   LVDALGNKADEFSTTYKMGRTQLQDAVPMTLGNTFHAWLKPLRRDFKRIEAARNELYTL
FT                   NLGGSAIGSGINVSYHYQVHIVPNLASITGLPLEQAHDLFDATSNLDSYVALSGSLKNL
FT                   AVNLSKMSNDLRLLSSGPRSGLHEINLPSKQAGSSIMPGKVNPVIPEVVNQVAFEMIGF
FT                   DTTVTAASEAGQLELNAFEPIIFKSLITGIEHLQQAMNTLRINAIDGITVNKHRLSQDI
FT                   DLSVSFATAMAPIIGYKEAAKIAKESLRTGKSLREIAEKKNRFTESELAHIFKVEDIVI
FT                   NARTPEHGLVLHAPKTTV"
FT   gene            complement(139184..139870)
FT                   /locus_tag="LEUM_0154"
FT                   /note="LactoCOG number LaCOG01508"
FT   CDS_pept        complement(139184..139870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0154"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61304"
FT                   /db_xref="GOA:Q03ZR8"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZR8"
FT                   /protein_id="ABJ61304.1"
FT                   /translation="MSSSQDLQKIIAGRRAADFVQDGMVVGIGSGSTIAQVITALGERV
FT                   ANENLKIVGVPTSEKTRRNAAKLGIPMYNVDDVDKIDLTIDGADQISDDFSAIKGGGAA
FT                   LLWEKIVAFNSRENIWVVDSSKRVSKLNQYLPVEIIPYGSDQLFKRFTADGFHPTWRLD
FT                   QNGNPVRTDSANYLIDLHVPVIEDPRDLGQELINMVGVVEHGLFTDVVNRVVIGSDDGV
FT                   EIIEAP"
FT   gene            complement(139867..140148)
FT                   /locus_tag="LEUM_0155"
FT                   /note="LactoCOG number LaCOG00456"
FT   CDS_pept        complement(139867..140148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0155"
FT                   /product="Predicted acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61305"
FT                   /db_xref="GOA:Q03ZR7"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZR7"
FT                   /protein_id="ABJ61305.1"
FT                   /translation="MEFQHENGRYFLEKNGKVIAQITYTVINEGQTYSINSTVVDPSLR
FT                   GQGVAKKLLDTIVADARAKNMTIKPVCPYVKEAFLRYPDTYQEIEYKS"
FT   gene            140381..140920
FT                   /locus_tag="LEUM_0156"
FT                   /note="LactoCOG number LaCOG00115"
FT   CDS_pept        140381..140920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0156"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61306"
FT                   /db_xref="GOA:Q03ZR6"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZR6"
FT                   /protein_id="ABJ61306.1"
FT                   /translation="MTRGFEIVSKYADENITVPKRSTQQAAGYDFEAAVDITIPSVLSN
FT                   NFFKGLNILSLGKLSKLRDNEDLQDMLKPVLIPTGIKAYMGEGEYLQLVSRSSGPIKKR
FT                   IMMPNAVGIVDADYYNNEGNEGEIFFQFINFGLKDAHIKKGERIGQGIFLPYLLADGDD
FT                   AVEKSDRKGGFGSTGQ"
FT   gene            141112..142338
FT                   /locus_tag="LEUM_0157"
FT                   /note="LactoCOG number LaCOG01381"
FT   CDS_pept        141112..142338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0157"
FT                   /product="Predicted ATP-dependent serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61307"
FT                   /db_xref="GOA:Q03ZR5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZR5"
FT                   /protein_id="ABJ61307.1"
FT                   /translation="MSLDGRNAKVEKINEITSEETPRVATKLKELNRVLGGGVVPGSMV
FT                   LIGGDPGIGKSTLLLQVSGQLAQEGRVLYVTGEESATQVKLRADRLGVGHDEFYLYPET
FT                   DMTAVKKQIEELQPNFVVIDSVQTMQEPDVSSAVGSVSQIREVTADLLQIAKTNNISIF
FT                   IVGHVTKDGAIAGPKILEHMVDTVLYFEGDSNYKYRILRAVKNRFGATNELGIFEMRNG
FT                   GLIEVANPSEIFLEERLSGATGSAIVVALEGSRPILVELQALVTPTVFGNAQRTAAGLD
FT                   RNRVSLIMAVLEKRANLLLQNQDAYLKAAGGVKLDEPAIDLAIAVALASSYHDKESRPS
FT                   DVFVGEIGLTGEVRSVADIEGRLKEAKKLGFKRAIVPKNNLNGIELPQGIKVIGVTTLS
FT                   EALKIALGE"
FT   gene            142341..142715
FT                   /locus_tag="LEUM_0158"
FT                   /note="LactoCOG number LaCOG01861"
FT   CDS_pept        142341..142715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0158"
FT                   /product="Uncharacterized integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61308"
FT                   /db_xref="GOA:Q03ZR4"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZR4"
FT                   /protein_id="ABJ61308.1"
FT                   /translation="MSEYLLTGLTDINSALYKHVEKGKAYSVRFFVGVMIFCALLLFFL
FT                   IGSAVTFFLMGIVFEQLEWIAMILVLFSALVTGMVGWLSWEWGHLVWQLLKQVDENGHY
FT                   YAHDKIRASDQTKSHLGKHF"
FT   gene            complement(142761..143999)
FT                   /locus_tag="LEUM_0159"
FT                   /note="LactoCOG number LaCOG03128"
FT   CDS_pept        complement(142761..143999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0159"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61309"
FT                   /db_xref="GOA:Q03ZR3"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZR3"
FT                   /protein_id="ABJ61309.1"
FT                   /translation="MSFKKFIVSKGVIGALIIVLFYGLLMVGIYFSGYKVVPSKINQLP
FT                   VAIVNQDKDSTTLKKQLKKSLPFKHVKTDLNMKQAKSQLNDRKVYLIIDIPKDFNANLK
FT                   KIDGQSKGELKFYINYANPMTSVSAMETVAKSVGNHVQKSVLLQQSKGILTATELSQLE
FT                   SETKSLITANPTQKDAILQKAEQTKSTATAKINQTYANVANSYNYSIVKVNKAPSGMQH
FT                   SMAPFFMSLAFYIGSMIGAMLIVVAYKSFSPLIGRWKAYTYTEIAIILISMIAPLLIVA
FT                   LSKSMLHFDSNTYWQLWVNHSIELFASLNVNLIFSLILGQLGIMINMPFMLTQVVSGAG
FT                   LIPRPILPDFFKVMSNISPCFYSIRADYNILYGGNNTHTLWLQLLTIGIVAIIIHLAIV
FT                   AFQKKRTPLVQPS"
FT   gene            144134..144721
FT                   /locus_tag="LEUM_0160"
FT                   /note="LactoCOG number LaCOG00172"
FT   CDS_pept        144134..144721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0160"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61310"
FT                   /db_xref="GOA:Q03ZR2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZR2"
FT                   /protein_id="ABJ61310.1"
FT                   /translation="MSKQPSKYDLILNAFITLLIEVGYQSATINKIAEKANVNPSTIFR
FT                   KFKDKEGLLSAVIDRHLNDLAAIFDDALVVTGDIETDLINMSRTYQEFQEKHQEVVLIG
FT                   LQESFRMPKVSHAVEEIPIRFRKILLQYFTEMRAQNKIKKSVDVEAAVMNVIWLNFGYF
FT                   LTAIRYDNPELITEPEDFYEKQIRFFAKSLRP"
FT   gene            144820..146316
FT                   /locus_tag="LEUM_0161"
FT                   /note="LactoCOG number LaCOG01374"
FT   CDS_pept        144820..146316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0161"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61311"
FT                   /db_xref="GOA:Q03ZR1"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZR1"
FT                   /protein_id="ABJ61311.1"
FT                   /translation="MTEDIRVRYAPSPTGHLHIGNARTAIFNWLFARHYNGTFVIRIED
FT                   TDSARNIADGEKSQLENLAWLGLDWDESPDKPGVYGPYRQSERNEQGIYQEFIDALLAS
FT                   GQAYKSYKTSGQLASEREAQQAAKQAPHYVYEYEGLTNEEREAKYAEFEAQGLKPVVRF
FT                   RVPEEQVYAWDDIVKGHIEIGAKEVGGDWVIQKADGMPTYNFAVVVDDHLMKISHVLRG
FT                   DDHVSNTPKQIMIYEALGWDVPKFGHMALIINGETGKKLSKRDENLLQFVEQYKELGYQ
FT                   PQAMVNFIGLLGWSPKGEDEIFSLSEFKEMFDEKRLSKANAKFDQKKLEWVNNQWMRRD
FT                   TDAVMPQLIQELVNAHLISADDAADKKKWLSEVIKVAGVDGISYTRQIVELVRKPFFEL
FT                   GDITDEMVEYLTSEDGRKVAAAWESTYESLPTDATPADYMSTIRAIQNDLEIKGRNLWN
FT                   PIRIMTTHEVQGPNLPEMLTLLDKNTVLKTMRDVKEKYLA"
FT   gene            146458..147864
FT                   /locus_tag="LEUM_0162"
FT                   /note="LactoCOG number LaCOG01232"
FT   CDS_pept        146458..147864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0162"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61312"
FT                   /db_xref="GOA:Q03ZR0"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZR0"
FT                   /protein_id="ABJ61312.1"
FT                   /translation="MIYVYNTLSREKEVFKPITAGKINMYVCGPTVYNYIHIGNARSAI
FT                   AFDTVRRYFEYRGYEVNYVSNFTDVDDKIINRAQEEGISELEVANKYADAFDEDTLPLN
FT                   IKPATVRSRATEVIPEIIEFVKDLIDKGYAYESEGDVYFRAKKFKGYGILAHQDLAEME
FT                   ANAAGRLNDEETIRKEDPIDFAVWKNEPREGVISWSSPWGNGRPGWHIECSVMAQKYLS
FT                   NTIDIHGGGIDLAFPHHTNEIAQSEARTGQKFVNYWMHNGFVNVNNEKMSKSLGNFTTL
FT                   HDMLATYDDPMVIRYLLTTTQYRRPINYEASTLEQARLELERIRTAYRNLMFRAETSEP
FT                   GGDEDVETLIEVQKKAFDQAMDDDFNTPNALAAIFELVSIGNTYTERNTVKVDTVQHLL
FT                   GTIADLLSVFGIEGLDGNEELTTKQRELLDKRVLARESHDFERSDLLRNQLKEVGIFVE
FT                   DTPQGQRWHK"
FT   gene            148404..149952
FT                   /locus_tag="LEUM_r0163"
FT   rRNA            148404..149952
FT                   /locus_tag="LEUM_r0163"
FT                   /product="16S ribosomal RNA"
FT   gene            150065..150137
FT                   /locus_tag="LEUM_t0164"
FT                   /note="tRNA_Ala_TGC"
FT   tRNA            150065..150137
FT                   /locus_tag="LEUM_t0164"
FT                   /product="tRNA-Ala"
FT   gene            150328..153241
FT                   /locus_tag="LEUM_r0165"
FT   rRNA            150328..153241
FT                   /locus_tag="LEUM_r0165"
FT                   /product="23S ribosomal RNA"
FT   gene            153359..153447
FT                   /locus_tag="LEUM_r0166"
FT   rRNA            153359..153447
FT                   /locus_tag="LEUM_r0166"
FT                   /product="5S ribosomal RNA"
FT   gene            153497..153590
FT                   /locus_tag="LEUM_t0167"
FT                   /note="tRNA_Ser_GGA"
FT   tRNA            153497..153590
FT                   /locus_tag="LEUM_t0167"
FT                   /product="tRNA-Ser"
FT   gene            153592..153664
FT                   /locus_tag="LEUM_t0168"
FT                   /note="tRNA_Val_TAC"
FT   tRNA            153592..153664
FT                   /locus_tag="LEUM_t0168"
FT                   /product="tRNA-Val"
FT   gene            153705..153777
FT                   /locus_tag="LEUM_t0169"
FT                   /note="tRNA_Thr_TGT"
FT   tRNA            153705..153777
FT                   /locus_tag="LEUM_t0169"
FT                   /product="tRNA-Thr"
FT   gene            153786..153857
FT                   /locus_tag="LEUM_t0170"
FT                   /note="tRNA_Gly_GCC"
FT   tRNA            153786..153857
FT                   /locus_tag="LEUM_t0170"
FT                   /product="tRNA-Gly"
FT   gene            153863..153946
FT                   /locus_tag="LEUM_t0171"
FT                   /note="tRNA_Leu_TAA"
FT   tRNA            153863..153946
FT                   /locus_tag="LEUM_t0171"
FT                   /product="tRNA-Leu"
FT   gene            153952..154025
FT                   /locus_tag="LEUM_t0172"
FT                   /note="tRNA_Arg_ACG"
FT   tRNA            153952..154025
FT                   /locus_tag="LEUM_t0172"
FT                   /product="tRNA-Arg"
FT   gene            154094..154167
FT                   /locus_tag="LEUM_t0173"
FT                   /note="tRNA_Pro_TGG"
FT   tRNA            154094..154167
FT                   /locus_tag="LEUM_t0173"
FT                   /product="tRNA-Pro"
FT   gene            154196..154269
FT                   /locus_tag="LEUM_t0174"
FT                   /note="tRNA_Met_CAT"
FT   tRNA            154196..154269
FT                   /locus_tag="LEUM_t0174"
FT                   /product="tRNA-Met"
FT   gene            154283..154356
FT                   /locus_tag="LEUM_t0175"
FT                   /note="tRNA_Met_CAT"
FT   tRNA            154283..154356
FT                   /locus_tag="LEUM_t0175"
FT                   /product="tRNA-Met"
FT   gene            154381..154470
FT                   /locus_tag="LEUM_t0176"
FT                   /note="tRNA_Ser_TGA"
FT   tRNA            154381..154470
FT                   /locus_tag="LEUM_t0176"
FT                   /product="tRNA-Ser"
FT   gene            154502..154575
FT                   /locus_tag="LEUM_t0177"
FT                   /note="tRNA_Met_CAT"
FT   tRNA            154502..154575
FT                   /locus_tag="LEUM_t0177"
FT                   /product="tRNA-Met"
FT   gene            154578..154651
FT                   /locus_tag="LEUM_t0178"
FT                   /note="tRNA_Asp_GTC"
FT   tRNA            154578..154651
FT                   /locus_tag="LEUM_t0178"
FT                   /product="tRNA-Asp"
FT   gene            154672..154744
FT                   /locus_tag="LEUM_t0179"
FT                   /note="tRNA_Phe_GAA"
FT   tRNA            154672..154744
FT                   /locus_tag="LEUM_t0179"
FT                   /product="tRNA-Phe"
FT   gene            154772..154842
FT                   /locus_tag="LEUM_t0180"
FT                   /note="tRNA_Gly_TCC"
FT   tRNA            154772..154842
FT                   /locus_tag="LEUM_t0180"
FT                   /product="tRNA-Gly"
FT   gene            154875..154948
FT                   /locus_tag="LEUM_t0181"
FT                   /note="tRNA_Ile_GAT"
FT   tRNA            154875..154948
FT                   /locus_tag="LEUM_t0181"
FT                   /product="tRNA-Ile"
FT   misc_binding    155014..155244
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="T-box leader, riboswitch"
FT   gene            155266..156573
FT                   /locus_tag="LEUM_0182"
FT                   /note="LactoCOG number LaCOG01121"
FT   CDS_pept        155266..156573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0182"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61313"
FT                   /db_xref="GOA:Q03ZQ9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZQ9"
FT                   /protein_id="ABJ61313.1"
FT                   /translation="MLDIRYMRKNSAEVKQRLEYRGVNPETIDELLELDQKRRDLIQKV
FT                   ESLKAQRNDVSDKIAFAKRQKEDASEAILQMKQVGADIKSLDNEQTLLDEQVREIAAHL
FT                   PNMAAFDVPVGPDESANVEQRKWAPEEYGSRPHALEEASWVKAHYEIGENLGILDFERG
FT                   AKVSGARFLYYVGDGARLERAVYNFMLDEHRQEGYTEMITPIVVNDSAMFGTGQYPKFQ
FT                   DDAYRVEGLNQTYIPTAEVPLTNYYSGEELPSEDLPIKFTALSPSFRKEAGSAGKDTRG
FT                   LIRLHQFNKVEMVKFTKPEDSYEELEKMTLDAENILQKLNLPYHVIVLSTGDMGFSAAK
FT                   TYDIEVWMPQQNVYREISSVSNTEDFQARRMHITYRDADNKLQLVHTLNGSGLAVGRTV
FT                   AAILENYQNEDGSVTIPEVLRPYLAGQEKLEPTTHH"
FT   gene            156709..159120
FT                   /locus_tag="LEUM_0183"
FT                   /note="LactoCOG number LaCOG00069"
FT   CDS_pept        156709..159120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0183"
FT                   /product="protein translocase subunit secA"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61314"
FT                   /db_xref="GOA:Q03ZQ8"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZQ8"
FT                   /protein_id="ABJ61314.1"
FT                   /translation="MANPIRKLVDNSKQQLKKLNKIADQVESYADTMASMSDSELQAKT
FT                   GEFKSKIADAIDGIEDKDKQNKALAKVLDELLPEAFAVAREGAKRVLGLYPFHVQIMGS
FT                   IVLHGGNLAEMRTGEGKTLTATMAVYLNALSGRGVHVVTVNDYLSARDAEQMGQLYNWL
FT                   GLTVGVNVGDAPAEEKRAAYNADITYSTNFNIGFDYLRDNMVRRADERVMQRGLNFALI
FT                   DEADSILIDTARTPLIISGPGSGVSQLYARADRFVKTLQRDEDFKVDEEAKATLLTPEG
FT                   IHKGEIFFNLNNLYDADDTALTHHIDQALRANFNYIKDKDYVVQDGEVKLIDQSTGRIS
FT                   EGTRLSDGLHQAIEAKENVEIQEENKSMAQITYQNLFRMYKKLSGMTGTAKTEEEELRE
FT                   IYNMEVISIPTNRPVRRVDKPDLLYTSIRAKYNAVVKLIVELHEKGQPILIGTGSVEDS
FT                   ELLSKILMTKNLPHNVLNAKNNAKEAEIIANAGQRGAITVATNMAGRGTDIKLGPGVAE
FT                   LGGLVVIATERHESRRIDNQLRGRAGRQGDEGFSQFFLSLEDDLMIRFGAERVRLMMQR
FT                   MNLDEDTVITNRFITRSVESAQKRVEGNNYDTRKNVLQYDDVVREQRELIYHERDVVID
FT                   ESESLEWVLMPMVERTINRVVDAQTKEKKSSDWNLPQIVAFVGNALAHDDAVTVQQLQG
FT                   LTRDEIKAKLLELAKLNYKEKQSQLYDPEQMLEFEKVVILRAVDQHWTDHIDSLDRLRQ
FT                   GVGLRGYGQLNPLIEYQSEAFANFQKMIADVEYDTTRTFMKAEIRQNLRS"
FT   gene            159171..160289
FT                   /locus_tag="LEUM_0184"
FT                   /note="LactoCOG number LaCOG00677"
FT   CDS_pept        159171..160289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0184"
FT                   /product="bacterial peptide chain release factor 2 (bRF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61315"
FT                   /db_xref="GOA:Q03ZQ7"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZQ7"
FT                   /protein_id="ABJ61315.1"
FT                   /translation="MEIIDAKHAVSDMQENIERFRGTLDMEALTEEIADYENRMTEPDF
FT                   WNDNEKAQKVIEENNVLKNRRDSFLNLTNQVEELELLIEMAVEDPEDEDTLGELEAGVA
FT                   KAQKDIDAYNLEQLLTEPYDANNAILEIHPGSGGTESTDWGANLYRMYTRWAQQHDFQV
FT                   ETLDYHAGDEAGIDSATIKVTGHNAYGFLRSEKGVHRFVRISPFDSAGRRHTSFVSVDV
FT                   MPELDDSIEVEVRDDDVKMDVFRSGGAGGQNVNKVSTGVRLTHEPTGIVVSSTVERTQY
FT                   GNRDYAMRLLKSKLYQLELEKKEAERAALTGEKMENGWGSQIRSYVLHPYQMVKDHRTN
FT                   YETNQPQAVLDGDLDPFINAYLQWQLSLKNPN"
FT   gene            160435..162915
FT                   /locus_tag="LEUM_0185"
FT                   /note="LactoCOG number LaCOG00432"
FT   CDS_pept        160435..162915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0185"
FT                   /product="ATP-binding subunit of Clp protease and DnaK/DnaJ
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61316"
FT                   /db_xref="GOA:Q03ZQ6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZQ6"
FT                   /protein_id="ABJ61316.1"
FT                   /translation="MDNNYTPSAQNVLVLAQEQAKYFKHQAVGTEHLLLALAIEKEGIA
FT                   SKILGQFNVMDDDIREEIEHFTGYGITSRYDKNIYLPYSPKAADILHQANEELRALAQS
FT                   KVGTEHILLALLQDESILSSRILLALDVNLQDMRRAILRKLGITDVRKQMKQQEKQQAS
FT                   AGTPTLDGLARDLTQMARDNKIDPVIGRPKEVRRVIQILSRRTKNNPVLIGEPGVGKTA
FT                   IAEGLAQKIVDGEVPENLAKKRLMALDMGSLVAGTKYRGEFEDRLKKIIEEIYNDGEVI
FT                   LFIDELHTLIGAGGAEGAIDASNILKPALARGELQTLGATTFDEYQKYVESDAALERRF
FT                   ASVTVDEPTQDDAIAILKGIRSHFEKHHQVQIDDAAIEAAVKLSARYISDRFLPDKAID
FT                   LMDEAGAKVRIDATGKATPISKAKVRFAEVQAEKEAAITSLDFEKAAQLRTEEMKLKQK
FT                   LAKSEAKDTQNNQKENAERYSLHVTEEDIAEVISQQTGVPVMQMEKNEQQRLVNLESVL
FT                   GRRVIGQKTAISAVARAIRRARSGLKDPSRPIGTFMFLGPTGVGKTELAKALAEAIFGS
FT                   EDNLIRIDMSEYQERWSSSRLIGSAPGYVGYDEGGQLTEQVRNHPYSVVLLDEAEKAHQ
FT                   DIFNLMLQVFDDGYLTDSKGRKVDFKNTIIIMTSNLGATRLRDEKSVGFGAVDLKDDHE
FT                   AVAAKIRETLKETFRPEFINRLDEAIVFESLTKPELHEIVKLMSRSVLQRVAEQGISVK
FT                   ITPAAIDVVASAGFDPEYGARPIRRALQTKVEDALSEELLRGNITTDDAVTIGAKNGEI
FT                   RISTKPLKKDTTKA"
FT   gene            complement(162920..163579)
FT                   /locus_tag="LEUM_0186"
FT   CDS_pept        complement(162920..163579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0186"
FT                   /product="Type II secretory pathway, prepilin signal
FT                   peptidase PulO"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61317"
FT                   /db_xref="GOA:Q03ZQ5"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZQ5"
FT                   /protein_id="ABJ61317.1"
FT                   /translation="MENIFVFLFNSIIVSTIICAAARLSNSVSLKIQRSFCFYCDHNLA
FT                   WFDIIPVISACVLRNKCRYCHAHFGHYYAIFELSYILIGTLLWATPVTWITGVLLLFLS
FT                   LEDCSKQSIHANILFPWIGYLLILHHDAAHLCLTVLILILSIILVKHRHTLGSGDIPVL
FT                   LSLVLSNTPVIFSCTLLISCCLALLYLLYSQQKRLPFVPFLSGGWVITNLYILFLL"
FT   gene            163832..164245
FT                   /locus_tag="LEUM_0187"
FT                   /note="LactoCOG number LaCOG01529"
FT   CDS_pept        163832..164245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0187"
FT                   /product="SSU ribosomal protein S12P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61318"
FT                   /db_xref="GOA:Q03ZQ4"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZQ4"
FT                   /protein_id="ABJ61318.1"
FT                   /translation="MPTINQLVRKPRKSKVSKSKSPALNFGYNSMKKKATNNAAPQKRG
FT                   VATRVGTMTPKKPNSALRKYARVRLSNLYEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIIRGALDTAGVDGRMTSRSKYGTKAPKK"
FT   gene            164261..164731
FT                   /locus_tag="LEUM_0188"
FT                   /note="LactoCOG number LaCOG01528"
FT   CDS_pept        164261..164731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0188"
FT                   /product="SSU ribosomal protein S7P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61319"
FT                   /db_xref="GOA:Q03ZQ3"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZQ3"
FT                   /protein_id="ABJ61319.1"
FT                   /translation="MPRKGYTKRQEILPDPIYNSKLVSRLINKLMLDGKRGTASTILYD
FT                   AFDRIKEATGNDPLEVFEQAMENIMPVLEVKARRVGGSNYQVPIEVRPDRRSTLGLRWL
FT                   VNYSRLRNEHTMDERLAKEIMDAANDTGASVKKREDTHKMAEANRAFAHYRW"
FT   gene            164892..167003
FT                   /locus_tag="LEUM_0189"
FT                   /note="LactoCOG number LaCOG01527"
FT   CDS_pept        164892..167003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0189"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61320"
FT                   /db_xref="GOA:Q03ZQ2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZQ2"
FT                   /protein_id="ABJ61320.1"
FT                   /translation="MAKREYPLERTRNIGIMAHIDAGKTTTTERILYYTGKIHKIGETH
FT                   DGASQMDFMEQEKERGITIQSAATTAVWHGFFDQFAKTPYRVNIIDTPGHVDFTIEVER
FT                   ALRVLDGAVAVLDGAAGVEPQTETVWRQATTYDVPRIVFVNKMDKLGADFQMSVDSIHE
FT                   RLQVNAEAIQWPIGAEDDFEAVIDLITQEAYYPEDDLGEKWAPREIPEELKELAEEKRN
FT                   TLIEAVADVDDDLMEKYLEGEDISIEELKAAIRRATLALQFYPVLAGSAYKDKGVQMML
FT                   DAVVDYLPGPLDVKPYIANDPKTDEEIDLIADDSKPFAALAFKIMTDPFVGRLTFMRVY
FT                   TGTLKSGSYVQNTSSDTRERVGRLLQMHATSRTEIEEVFSGDIAAAIGLKNTTTGDSLT
FT                   DVSHQLILESMEFPEPVIELAIEPKTKADQDKLSNAIQKLAEEDPSFRATTNQETGQTL
FT                   IAGMGELQLDIMVDRMRREFNVEATVGAPQVAYREAFTKTVQARGFFKRQSGGKGQYGD
FT                   VYIEFAPNEEGAGFEFEDAIVGGVVPREYIPSVEAGLKDALNAGPLAGFPLVDLKAKLY
FT                   DGSYHDVDSSEAAFKIAASLALKEAAKTAGAVILEPIMAVDIVAPEDNLGDVMGHVSAR
FT                   RGMIEGQESRGPVLAVKAKVPLSEMFGYATTLRSATQGRGTFQMVFDHYEAVPKNIQEE
FT                   IIKTNGQED"
FT   gene            167094..168287
FT                   /locus_tag="LEUM_0190"
FT                   /note="LactoCOG number LaCOG01557"
FT   CDS_pept        167094..168287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0190"
FT                   /product="Cyanate permease"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61321"
FT                   /db_xref="GOA:Q03ZQ1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZQ1"
FT                   /protein_id="ABJ61321.1"
FT                   /translation="MLKNNKNHSKFLVPGIIVVGMVLRLPFTSIPPILGNIARSLHVPV
FT                   SSLGILTTIPLLAFAIFSVFAPKVAQKLGLERAFTLMLGLLIIGSFIRILNTPLLYIGT
FT                   ACIGVAIAHMNVLLPSVIRTYFPQKVGFMTSIFTFSMMLATAIGAALSAPITAVTGWHT
FT                   FIILLTVLLIIALLVWLPNQNFVHNNQTTVKTKSENVLKPSIWRNKYAWLLLFFSGVQS
FT                   IMFYILLAWGPTMAVQTGLSASTASLFAGLNSLIGLPFALFIPSIVARLDSGQRQWLVG
FT                   MFSILGTLGYMLLLFPQGTFTYWLIVNLLIGVGTSALFPYLMTTFSLKTSNAEQTARLS
FT                   GMAQSGGYLLAATGPLLFGYAYGWFHSWIPQIIMLIILFILMTVAILIVENQDKILD"
FT   gene            168368..169474
FT                   /locus_tag="LEUM_0191"
FT                   /note="LactoCOG number LaCOG00787"
FT   CDS_pept        168368..169474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0191"
FT                   /product="ABC-type spermidine/putrescine transport systems,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61322"
FT                   /db_xref="GOA:Q03ZQ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZQ0"
FT                   /protein_id="ABJ61322.1"
FT                   /translation="MSEKQVPIIAFNQVDLSFGDTHVLNNVDLEIEAGKFYTLLGPSGS
FT                   GKSTILKLISGQLTADSGDISFEGQRVNDVPAEKRKVNTVFQNYALFPNMNVFDNVAFG
FT                   PTLKGMNKTEIKNKVKEMLNLVKLSDFVDREIDELSGGQQQRVAIARALANDPEVLLLD
FT                   EPLSALDYKLRKSMQYELREIQQRLGITFVFVTHDQEEALAMSDWIFVMNDGVIQQNGS
FT                   PEDIYDEPINHFVADFIGESNIVDGIMKEDYVVHFVGKDFENVDAGMRPNERVEVVLRP
FT                   EDLDLTSIENGKLVVTIEDQSFRGDYYEITARDDDGNEWQVQATNSAIIGARVGLTFDP
FT                   EDIHIMRFNESEDDFDARLESYEDDDEI"
FT   gene            169464..170282
FT                   /locus_tag="LEUM_0192"
FT                   /note="LactoCOG number LaCOG00788"
FT   CDS_pept        169464..170282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0192"
FT                   /product="spermidine/putrescine ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61323"
FT                   /db_xref="GOA:Q03ZP9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZP9"
FT                   /protein_id="ABJ61323.1"
FT                   /translation="MKSKQQRQIFYIVPYGIWLLLFVIAPLILMLFQSFTTASGHFTFS
FT                   NYAAYFGSGTYLRMTFNSVWYAFLITVITLVISYPTAYLLNQLKQKQFWLLLVILPTWI
FT                   NLLLKTYAFIGLLSKTGTVNNFISLWGIAPQQLLFSDWSFLLVAAYIEIPFMILPIFNS
FT                   LAEIDSRLSQASHDLGANKWQTLRYVIFPLSMPGVKAGIQAVFIPSLSLFMITRLIGGN
FT                   RVITLGTAIEEHFLVTQNWQIGSTIGVVLIAAMIATMLLTRDRTRKNLRK"
FT   gene            170296..171126
FT                   /locus_tag="LEUM_0193"
FT                   /note="LactoCOG number LaCOG00789"
FT   CDS_pept        170296..171126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0193"
FT                   /product="spermidine/putrescine ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61324"
FT                   /db_xref="GOA:Q03ZP8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZP8"
FT                   /protein_id="ABJ61324.1"
FT                   /translation="MHKKFRWSNLYLVFVFVLLYLPIFFLIIYSFNAGDVMQGWDGFSL
FT                   KHYTELFVDTRILEIVVNTFLVALLSSLLASIIGTAGALYIYNQRHQLAKNIFLSLNNI
FT                   LLVSPDVIIGASFLILFTVVGFTLGFTSVLLSHIAFSIPIVVLMVLPRLQEMNPYLVTA
FT                   AKDLGANNLQMLSRVVLPVISPGILAGFFMAFTYSLDDFAVTFFVTGNGFSTLSVEIYS
FT                   RARQGVSLEINALSAMMFLVSLLLVLIYYFISNRSSKGKKRGGTNLVMPATEGL"
FT   gene            171128..172207
FT                   /locus_tag="LEUM_0194"
FT                   /note="LactoCOG number LaCOG00790"
FT   CDS_pept        171128..172207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0194"
FT                   /product="Spermidine/putrescine-binding periplasmic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61325"
FT                   /db_xref="GOA:Q03ZP7"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZP7"
FT                   /protein_id="ABJ61325.1"
FT                   /translation="MKKLLSSVVGILIVVALLISAQHYFSAQTGTGDKSGKVLNLYNWG
FT                   DYIDPALLKKFTKETGYKVSYETFDSNEAMYMKVKQGSTSYDLAVPSEYMIEKMKADNL
FT                   LLPLDHSKLTGLNNYDSRFLNQSFDKGNKYSVPYFWGTLGIIYNDKYVKAKDIQHWDDL
FT                   WSSKFKNQIMLIDSARDVLGITLITQGKSVNNKSVADLAAAQGKLTTLMPNVKAIIADE
FT                   IKMYMAQDEAAIAVTYSGEAAEAMDKNSHLHYVVPNEGSNLWFDNIVMPKNAKHKAAAY
FT                   AFLNFMSEPKNAAQNAEYIGYATPNKKALSLLPKSIREDKQFYPDEKTVRNLQTYDDLG
FT                   QKWTEKYNDAFLEFKMTQR"
FT   gene            172504..172812
FT                   /locus_tag="LEUM_0195"
FT                   /note="LactoCOG number LaCOG01411"
FT   CDS_pept        172504..172812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0195"
FT                   /product="SSU ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61326"
FT                   /db_xref="GOA:Q03ZP6"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZP6"
FT                   /protein_id="ABJ61326.1"
FT                   /translation="MAQKKIRIRLKAYEHRILDQSAEKIVETAKRTGAEIAGPIPLPTE
FT                   RTLYTILRSPHKHKDSREQFEMRTHKRLIDIVNPTDKTVDALRKLELPSGVAIEIKL"
FT   gene            172886..173572
FT                   /locus_tag="LEUM_0196"
FT                   /note="LactoCOG number LaCOG01410"
FT   CDS_pept        172886..173572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0196"
FT                   /product="LSU ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61327"
FT                   /db_xref="GOA:Q03ZP5"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZP5"
FT                   /protein_id="ABJ61327.1"
FT                   /translation="MTKGILGRKVGMTQVFTESGELIAVTAVEATPNVVLQVKNAETDG
FT                   YSAIQLGYQDKRTVLSNKPEQGHASKANTAPKRYVREIRNAGDEFNVGDEIKVDTFQAG
FT                   EYVDVTGITKGHGFQGAIKRLGQSRGPMTHGSRYHRRPGSMGAIINRVFKGKLLPGRMG
FT                   NNKRTMQNIAIVHVDVENNLLLLKGNVPGANKSLLTVKSTVKVNAKHPEVKMANASASA
FT                   TNSEEA"
FT   gene            173605..174228
FT                   /locus_tag="LEUM_0197"
FT                   /note="LactoCOG number LaCOG01409"
FT   CDS_pept        173605..174228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0197"
FT                   /product="LSU ribosomal protein L4P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61328"
FT                   /db_xref="GOA:Q03ZP4"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZP4"
FT                   /protein_id="ABJ61328.1"
FT                   /translation="MTKVAVLKQDGSQAAEIELNDAVFAIEPNNAVITDAVLMQRASLR
FT                   QGTHAVKNRSAVSGGGRKPWKQKGTGRARAGSIREPQFRGGGIVFGPSPRSYAYRINRK
FT                   AYQLALKSVLSQKVADNKLVVVDALSFEAPKTQDFKKVLANLSADKKTLVVVDEDNENA
FT                   ILSARNLANVQVMTTKGINVLDVVNADKLVIVQSSIEEIQGGLA"
FT   gene            174228..174515
FT                   /locus_tag="LEUM_0198"
FT                   /note="LactoCOG number LaCOG01408"
FT   CDS_pept        174228..174515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0198"
FT                   /product="LSU ribosomal protein L23P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61329"
FT                   /db_xref="GOA:Q03ZP3"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZP3"
FT                   /protein_id="ABJ61329.1"
FT                   /translation="MDARDIIRRPIITEASMAQTERKRYVFEVDTRATKPEIKKAIEEI
FT                   FEVKVSGLNTANVRGKKKRQGRYVGYTRKLKKATVTLSKDSKDIQIFNEG"
FT   gene            174537..175370
FT                   /locus_tag="LEUM_0199"
FT                   /note="LactoCOG number LaCOG01407"
FT   CDS_pept        174537..175370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0199"
FT                   /product="LSU ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61330"
FT                   /db_xref="GOA:Q03ZP2"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZP2"
FT                   /protein_id="ABJ61330.1"
FT                   /translation="MAIKSYKPTSAGRRNMTTSDFAEITKTTPEKSLLAKKSKTGARNA
FT                   SGRMTVRHHAGGHKQAYRIVDFKRTKDDKTATVKAIEYDPNRTANIALLVYEDGIKSYI
FT                   LAPKGLKVGDKVQSGPDADIKPGNALPLSAIPEGTLIHNIELKPGKGGQLARSAGASAQ
FT                   ILGRDGKYIIVRLTSGEVRLVLATNRATIGEVGNAEHSLINWGKAGRNRWRGKRPHVRG
FT                   SVMNPNDHPHGGGEGKAPVGRPSPMSPWGKKTAGKKTRDKKKASTKFIVRGRKSK"
FT   gene            175388..175666
FT                   /locus_tag="LEUM_0200"
FT                   /note="LactoCOG number LaCOG01406"
FT   CDS_pept        175388..175666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0200"
FT                   /product="SSU ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61331"
FT                   /db_xref="GOA:Q03ZP1"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZP1"
FT                   /protein_id="ABJ61331.1"
FT                   /translation="MARSLKKGPFADPHLLKKIEAQVDSEKKSVIKTWSRRSTIFPSFI
FT                   GFTIAVYDGRKHVPVYVQEDMVGHKLGEFVPTRTFKGHKNDDKKTGK"
FT   gene            175681..176037
FT                   /locus_tag="LEUM_0201"
FT                   /note="LactoCOG number LaCOG01405"
FT   CDS_pept        175681..176037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0201"
FT                   /product="LSU ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61332"
FT                   /db_xref="GOA:Q03ZP0"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZP0"
FT                   /protein_id="ABJ61332.1"
FT                   /translation="MAEQVTSARATAKIVRVAPRKARLVLDTIRRKSVNEAYAILKFLP
FT                   NTSTEDIYKVLNSAVANAENNFSLDREDLIVKEAFANEGPTLKRFRPRAKGSASPINKR
FT                   TSHLTIVVAEKEAK"
FT   gene            176037..176708
FT                   /locus_tag="LEUM_0202"
FT                   /note="LactoCOG number LaCOG01404"
FT   CDS_pept        176037..176708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0202"
FT                   /product="SSU ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61333"
FT                   /db_xref="GOA:Q03ZN9"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZN9"
FT                   /protein_id="ABJ61333.1"
FT                   /translation="MGQKINPTGFRVGVIRDWDAKWFADKADYANQLHEDLRIRKYIEK
FT                   NLADASVDRIEIERTTKSRVDVSIQTAKPGMVIGKGGSEVEKLRTQLAKLTDTDEKGRS
FT                   KRVFINIVEIKKPDLSAHLVGQQIAGDLERRVAFRRAMRGAIQRATRSGAKGIKVMVSG
FT                   RLNGADIARIEQYTEGTVPLHTLRADIDYSWDEAMTAYGNLGIKTWIYRGDVLPQKKNS
FT                   K"
FT   gene            176723..177136
FT                   /locus_tag="LEUM_0203"
FT                   /note="LactoCOG number LaCOG01403"
FT   CDS_pept        176723..177136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0203"
FT                   /product="LSU ribosomal protein L16P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61334"
FT                   /db_xref="GOA:Q03ZN8"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZN8"
FT                   /protein_id="ABJ61334.1"
FT                   /translation="MLVPKRVKFRRVHRGHMRGEAKGGKTVTFGDFGLQATTSSWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPHKSYTSKGVGVRMGNGKGAPEGWVEPVKRGKVMF
FT                   EVAGVPEATAREALRLAQHKLPVRTKIIAREAE"
FT   gene            177136..177342
FT                   /locus_tag="LEUM_0204"
FT                   /note="LactoCOG number LaCOG01402"
FT   CDS_pept        177136..177342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0204"
FT                   /product="LSU ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61335"
FT                   /db_xref="GOA:Q03ZN7"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZN7"
FT                   /protein_id="ABJ61335.1"
FT                   /translation="MAKASELKELSLADLQKREAEFKEELFNLRFQLATGQLENTARIA
FT                   QVRKDIARVKTVIRAQELANANK"
FT   gene            177365..177631
FT                   /locus_tag="LEUM_0205"
FT                   /note="LactoCOG number LaCOG01401"
FT   CDS_pept        177365..177631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0205"
FT                   /product="SSU ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61336"
FT                   /db_xref="GOA:Q03ZN6"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZN6"
FT                   /protein_id="ABJ61336.1"
FT                   /translation="MSEERNTRKVYQGRVVSDKMNKTITVAVDTYLTHDVYGKRVKYTK
FT                   KFKAHDENNAAKQGDIVQIMETRPLSATKHFRLVKIVEEAVIL"
FT   gene            177680..178048
FT                   /locus_tag="LEUM_0206"
FT                   /note="LactoCOG number LaCOG01400"
FT   CDS_pept        177680..178048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0206"
FT                   /product="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61337"
FT                   /db_xref="GOA:Q03ZN5"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZN5"
FT                   /protein_id="ABJ61337.1"
FT                   /translation="MIQQESRLKVADNSGAREILTIKVLGGSGRKFAGVGDMIVATVKQ
FT                   AIPGGNVKKGDVIKAVIVRTVSDVRRADGSYINFDENAAVIVKDDKSPVGTRIFGPVAR
FT                   ELRDNDYMRIVSLAPEVL"
FT   gene            178072..178380
FT                   /locus_tag="LEUM_0207"
FT                   /note="LactoCOG number LaCOG01399"
FT   CDS_pept        178072..178380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0207"
FT                   /product="LSU ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61338"
FT                   /db_xref="GOA:Q03ZN4"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZN4"
FT                   /protein_id="ABJ61338.1"
FT                   /translation="MFVKTGDKVRVIAGKDKGKEGTITKTVAGKDRVVVEGVNIVKKHQ
FT                   KPSNEYPQGGVIDIEAPIHVSNVQLLDPSTNEPTRVGFKVEDGKKIRVSKKSGNVLG"
FT   gene            178404..178946
FT                   /locus_tag="LEUM_0208"
FT                   /note="LactoCOG number LaCOG01398"
FT   CDS_pept        178404..178946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0208"
FT                   /product="LSU ribosomal protein L5P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61339"
FT                   /db_xref="GOA:Q03ZN3"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZN3"
FT                   /protein_id="ABJ61339.1"
FT                   /translation="MANALKEKYVNEVQPALIEKFNFKSSMQAPKIDKIVLNMGVGDAV
FT                   SNSKNLDEAVEELKLIAGQQPVITKAKKSIAGFRLREGMSIGTKVTLRGERMYDFLDKL
FT                   INISLPRVRDFRGVSSKAFDGRGNYTLGIREQLIFPEIDFDKVNRVRGLDIVIVTTAQN
FT                   DEEGRELLTQMGMPFAK"
FT   gene            179080..179478
FT                   /locus_tag="LEUM_0209"
FT                   /note="LactoCOG number LaCOG01396"
FT   CDS_pept        179080..179478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0209"
FT                   /product="SSU ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61340"
FT                   /db_xref="GOA:Q03ZN2"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZN2"
FT                   /protein_id="ABJ61340.1"
FT                   /translation="MSMTDPIADFLTRVRNANLARHEVVEAPASKIKKSIAEILKAEGF
FT                   IRDFEYIDDNKQGVIRVFLKYGEDRNRVITGIQRISKPGLRKYAKAEELPKVLNGLGIA
FT                   IISTSAGVITDKEARSKQVGGEVIAYVW"
FT   gene            179503..180039
FT                   /locus_tag="LEUM_0210"
FT                   /note="LactoCOG number LaCOG01395"
FT   CDS_pept        179503..180039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0210"
FT                   /product="LSU ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61341"
FT                   /db_xref="GOA:Q03ZN1"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZN1"
FT                   /protein_id="ABJ61341.1"
FT                   /translation="MSRIGNKTITLPADVTVSQEGAVVTVKGPKGELSREIVSAITMTV
FT                   EGNEVSFSRDSDDSKTRALHGTTRANVANMVEGVSEGFTKTLKLVGVGYRAAKSGSKLT
FT                   LSVGYSHPVDFEDREELSVEVPDALTIKVSGISKQKVGDLAAEIRAVRSPEPYKGKGIR
FT                   YEGEVVRRKEGKTGK"
FT   gene            180120..180473
FT                   /locus_tag="LEUM_0211"
FT                   /note="LactoCOG number LaCOG01394"
FT   CDS_pept        180120..180473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0211"
FT                   /product="LSU ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61342"
FT                   /db_xref="GOA:Q03ZN0"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZN0"
FT                   /protein_id="ABJ61342.1"
FT                   /translation="MISKPDKNKLRVKRHKRVRGKISGTAARPRLNVFRSNANIYAQLI
FT                   DDVAGVTLASASSHDAEVTGSKTEQAVKVGELIASRGKAAKIEDVIFDRGGYVYHGRVQ
FT                   ALADSARENGLKF"
FT   gene            180493..180999
FT                   /locus_tag="LEUM_0212"
FT                   /note="LactoCOG number LaCOG01393"
FT   CDS_pept        180493..180999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0212"
FT                   /product="SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61343"
FT                   /db_xref="GOA:Q03ZM9"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZM9"
FT                   /protein_id="ABJ61343.1"
FT                   /translation="MVEFVNPKSLGELEENVVAINRVTKVVKGGRRLRFAALVVVGDKQ
FT                   GHVGFGTGKAQEVPEAIRKAIEDAKRKLITVPTVSTTIPHDVLGEWGGGKILVKPAEEG
FT                   SGVAAGGAARSVMELAGIADVTAKSLGSATPINVIRATFDALTSLKDAEEVAKLRGVSL
FT                   EHLAE"
FT   gene            181011..181193
FT                   /locus_tag="LEUM_0213"
FT                   /note="LactoCOG number LaCOG01392"
FT   CDS_pept        181011..181193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0213"
FT                   /product="LSU ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61344"
FT                   /db_xref="GOA:Q03ZM8"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZM8"
FT                   /protein_id="ABJ61344.1"
FT                   /translation="MADLKITLIKSAVHRLPKQRAIVKSLGLGRVSSSVVKPNNEATRG
FT                   AIFHIAHLVNVEEVK"
FT   gene            181224..181658
FT                   /locus_tag="LEUM_0214"
FT                   /note="LactoCOG number LaCOG01391"
FT   CDS_pept        181224..181658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0214"
FT                   /product="LSU ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61345"
FT                   /db_xref="GOA:Q03ZM7"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZM7"
FT                   /protein_id="ABJ61345.1"
FT                   /translation="MNLNELQPAAGSRHVRNRVGRGTSSGNGKTSGRGQKGQKARGKVR
FT                   LGFEGGQMPLYRRIPKRGFTNISRKEFAVVNLNKLNSFDDGTEITPTLLIENGIVKNQK
FT                   SGIKILAVGQLEKKLTVKAHKFSAAAVAAIEQAGGSTEVL"
FT   gene            181658..182992
FT                   /locus_tag="LEUM_0215"
FT                   /note="LactoCOG number LaCOG01390"
FT   CDS_pept        181658..182992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0215"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61346"
FT                   /db_xref="GOA:Q03ZM6"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZM6"
FT                   /protein_id="ABJ61346.1"
FT                   /translation="MLSTLFNAVREKDIRKKLGWTFFILFIYRVGTHITVPGVNPSAMS
FT                   EMASSGLMNILNIFSGGGLTNYSLFAMGVSPYVTAQIIVQLLQLDIVPRFVEWSKQGEV
FT                   GRRKLNNATRWLTLVLAFVQSVGITAGFNSLSSYGLVSQTNSVMSFVVIGSVMTIGTFF
FT                   AMWLGEMITEKGLGNGVSMIIFAGIIAQAPEGFYEIFKENILQADSSDMLNGWIFVVVL
FT                   VIAMILVVAFTTWSYEGTRRLQMQYTRSATSYGSEAYLPLKVNVSGVIPVIFASSFIST
FT                   PQTVMLAFQDKYSSAQWYQIMQQIFSMTTLPGAILYTALIVVFTYFYAFVQVNPDKLSE
FT                   NLQKQGAYIVGVRPGAETKAFVSKLLLNLSFVGSIFLGVVALVPLIASDVWGLNEKIGL
FT                   GGTSLLISIGVALDLIRQIDGLMQKKNYVGFITKDQLAAREAING"
FT   gene            182985..183548
FT                   /locus_tag="LEUM_0216"
FT                   /note="LactoCOG number LaCOG01389"
FT   CDS_pept        182985..183548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0216"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61347"
FT                   /db_xref="GOA:Q03ZM5"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZM5"
FT                   /protein_id="ABJ61347.1"
FT                   /translation="MAKNLILLGLPGAGKGTQADFIVKDYSIVHISTGDIFRANLAENT
FT                   ELGQKARQFMDAGDLVPDEITNAMVADRLNQQDVETGFMLDGYPRNEAQAVFLDKYLSD
FT                   NGKSVSATLYFEVADTLLRERLLGRGRADDTPEVIDNRLAVNKAANLPLVDYYQKAGVL
FT                   HTIDGGRELADVYHDVKEVLDNLN"
FT   gene            183655..183870
FT                   /locus_tag="LEUM_0217"
FT                   /note="LactoCOG number LaCOG01388"
FT   CDS_pept        183655..183870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0217"
FT                   /product="bacterial translation initiation factor 1
FT                   (bIF-1)"
FT                   /note="IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61348"
FT                   /db_xref="GOA:Q03ZM4"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZM4"
FT                   /protein_id="ABJ61348.1"
FT                   /translation="MANDVIEIEGKVKETLPNAMFQVELENGAVILAHVSGKIRKNFIR
FT                   ILPGDRVTVEMSPYDLTKGRITYRFR"
FT   gene            183915..184034
FT                   /locus_tag="LEUM_0218"
FT                   /note="LactoCOG number LaCOG01387"
FT   CDS_pept        183915..184034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0218"
FT                   /product="LSU ribosomal protein L36P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61349"
FT                   /db_xref="GOA:Q03ZM3"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZM3"
FT                   /protein_id="ABJ61349.1"
FT                   /translation="MKVRPSVKKMCDACRVIKRNGRTMIICSANPKHKQRAGK"
FT   gene            184111..184482
FT                   /locus_tag="LEUM_0219"
FT                   /note="LactoCOG number LaCOG01386"
FT   CDS_pept        184111..184482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0219"
FT                   /product="SSU ribosomal protein S13P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61350"
FT                   /db_xref="GOA:Q03ZM2"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZM2"
FT                   /protein_id="ABJ61350.1"
FT                   /translation="MARIAGIDLPRDKRIVIGLTYIYGIGNTTAQKVLAEAGVSEDVRV
FT                   RDLTSDQEDAIRATVDKLNLQLEGDLRRKVSLDIKSLQEIASYRGIRHRKGLPVRGQNT
FT                   KNNARTRKGPAKAIAGKKK"
FT   gene            184608..184994
FT                   /locus_tag="LEUM_0220"
FT                   /note="LactoCOG number LaCOG01385"
FT   CDS_pept        184608..184994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0220"
FT                   /product="SSU ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61351"
FT                   /db_xref="GOA:Q03ZM1"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZM1"
FT                   /protein_id="ABJ61351.1"
FT                   /translation="MAGRTTRKRRVKKNIESGVAHIHSTFNNTIVMITDAQGNAVAWSS
FT                   AGALGFKGSRKSTPFAAQMAAEAAAKSAMEINMRTVAVTVKGPGSGRESAIRALAAAGL
FT                   EVTSIKDVTPVPHNGSRPPKRRRV"
FT   gene            185042..185986
FT                   /locus_tag="LEUM_0221"
FT                   /note="LactoCOG number LaCOG01384"
FT   CDS_pept        185042..185986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0221"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61352"
FT                   /db_xref="GOA:Q03ZM0"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZM0"
FT                   /protein_id="ABJ61352.1"
FT                   /translation="MIEFEKPNIHNIEEDARYGKFVVEPLERGYGTTLGNSLRRILLSS
FT                   LPGAAVNTVQIDGVVHEFSTVDGVVEDVTQIILNLKKVVLAIDSDDERSLEIDIQGPAD
FT                   VTAADLQGGADVEVLNPDLHIATVAAGKSLHMTVTAVKGRGYTSADENKKLRDEMPIGV
FT                   LAVDSIYTPIERVNYQVENTRIGARDDYDKLTFDIWTNGSIKPSDALSLGAKILAEHLG
FT                   LFMDISPVAAEASVMVEAEPVAASASDSAPIEDLDLSVRSYNCLKRAGINTIVELTDRT
FT                   EADMMKVRNLGRKSLDEIQEKLTDMNLGFRKED"
FT   gene            186023..186406
FT                   /locus_tag="LEUM_0222"
FT                   /note="LactoCOG number LaCOG01383"
FT   CDS_pept        186023..186406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0222"
FT                   /product="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61353"
FT                   /db_xref="GOA:Q03ZL9"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZL9"
FT                   /protein_id="ABJ61353.1"
FT                   /translation="MAYRKLGRTSSQRKAMLRDLTTDLLINGRITTTEARAKEVRKTTD
FT                   KMITLGKRGDLNARRQAATFVRNEVADVIEDGDDVKVQSALQKLFDDVAPRFAERNGGY
FT                   TRILKTVQRRGDAAQLVILELVD"
FT   gene            complement(186448..187446)
FT                   /locus_tag="LEUM_0223"
FT                   /note="LactoCOG number LaCOG00120"
FT   CDS_pept        complement(186448..187446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0223"
FT                   /product="Geranylgeranyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61354"
FT                   /db_xref="GOA:Q03ZL8"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZL8"
FT                   /protein_id="ABJ61354.1"
FT                   /translation="MAMPSLPKIWDTFPELNPPLQNVLIEMSESWRIGFSEIDNAIRSQ
FT                   ASAGKLVRPALTLLFSELTDAPYNQKAIVLGASIELLHLATLIHDDIIDESKLRRGQDS
FT                   IQAHFGKDTAVYAGDYLLTGMLSLLNDADNIQANKLALESLRNILFGELTQKHNRYLTD
FT                   TSFDNYLTQITGKTAALFKLSVLFGATSSDGVSSQLLDVVGKLGENLGIAFQLLDDYLD
FT                   FESITEQLSLGKPAGQDIRNGIYTAPILFALENPDINAELKELLALRDGITDDQLVHIH
FT                   NVVLESDAMSRLNSLLAEYSQELDDLLNKLPNNALRQKLSHLATLLLNRKN"
FT   gene            complement(187515..189185)
FT                   /locus_tag="LEUM_0224"
FT                   /note="LactoCOG number LaCOG00571"
FT   CDS_pept        complement(187515..189185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0224"
FT                   /product="NADH dehydrogenase, FAD-containing subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61355"
FT                   /db_xref="GOA:Q03ZL7"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZL7"
FT                   /protein_id="ABJ61355.1"
FT                   /translation="MNEKNIVIVGAGFGGVFAAKTLSKKLRSHKEYNIILVDKHSYFTY
FT                   MTELHEVASQRVKPKHVQEDLEHLFYQDKNVKLLTTEVTNINKDKKTISTTQGDIPYEK
FT                   LVLAVGGQSNDFGTPGVKEHGFELWSMEESLKIRNHVENIIGQGAAELDPDKREQMLTI
FT                   AVVGSGFTGAELMGEFIEQRKVLAQTYKLDESEIKLVLLEASPSILNMLKDRKLADKAF
FT                   KYMEDNGVDIRLNSRVTGVDENGVFFQDGSTLPTKSLIWTAGVKAKSFISNWGFKYGRG
FT                   GRIEADDYMRATKEDGTPEKDIYVAGDTLSYVDEKTGPIPQTVEGAESAARAASANILA
FT                   DFGLGKAKTFSEAVKYHGFAVSIGSHYTVASLMGLNFSGFIASIAKHGINLFFYSQIRS
FT                   AYSIFHYMLDEFFRTEDGRNPFKGSISRLGNVLWSTPLRLFLGIFWILVALGNAGDLNN
FT                   FFWQSGLASFIEIVTGAGILLGLFTWPLGLLSILLTIVSGATHSFELTHWFVMLSSLAI
FT                   MNGSGRGFGLDFYVVPLLQKIFGGLWYGKAKSTYNELEK"
FT   gene            189360..190178
FT                   /locus_tag="LEUM_0225"
FT                   /note="LactoCOG number LaCOG00190"
FT   CDS_pept        189360..190178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0225"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61356"
FT                   /db_xref="GOA:Q03ZL6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZL6"
FT                   /protein_id="ABJ61356.1"
FT                   /translation="MVKAIKIDNLKYSYDERSLFSDFNLDIDAGQWVALVGHNGSGKST
FT                   LAKLILGLLVAEQGDIDVFDERLTVETVHHVRSKIGMVFQNPDNQFVGATVADDVAFGL
FT                   ENIQVESSEMPQKIDNALTIVGMQEFKNREPHTLSGGQKQRVALASVLALQPKIIILDE
FT                   ATAMLDPDGRATVMETLQKLKKQFGKELTLVTITHDMDEATLADRVVVINDGQKILDGT
FT                   PAEVFSQRKALHENGLELPFANELAFHLNEKPNKYMDERELIQWLSTLNK"
FT   gene            190154..191011
FT                   /locus_tag="LEUM_0226"
FT                   /note="LactoCOG number LaCOG00191"
FT   CDS_pept        190154..191011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0226"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61357"
FT                   /db_xref="GOA:Q03ZL5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZL5"
FT                   /protein_id="ABJ61357.1"
FT                   /translation="MAINFEQVNFSYGAGTTLAQPILHDINVTIPDGQVTAIIGQTGSG
FT                   KSTFIQHLNGLLKPTTGRVVIDDFVLTSDLKEKNLTSLRARVGMVFQFPENQLFANTVL
FT                   EDVMYAPINFGYAKADAEFAAKTALKQVNVSEELWDKSPFELSGGQMRRVAMAGTLASN
FT                   PDIIVLDEPAAGLDPKGQKELLAIVRGLKEAGKLVVFISHQMDHVIAVADHVIVMHDGG
FT                   VVAEGTPVEIFNKDLVWFKTVALDLPKAGQFAEQLRQKGHILRHRPLLLTELATMLNEE
FT                   KRHE"
FT   gene            191004..191807
FT                   /locus_tag="LEUM_0227"
FT                   /note="LactoCOG number LaCOG00192"
FT   CDS_pept        191004..191807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0227"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component CbiQ related transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61358"
FT                   /db_xref="GOA:Q03ZL4"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZL4"
FT                   /protein_id="ABJ61358.1"
FT                   /translation="MNNIMIGRFVPGDSWIHRLDPRTKMIGTFIFIFVMLWSTSWATYA
FT                   WSAAFVVLAIRLTKQPFRLYWDGLKPIFWLILFTVVLQLFFTPGTPVLLHAGPLKVTIP
FT                   GIINAIYVMIRFVLIILMSTILTLTTPPTSIANALESLLKPLKKIHVPVAELSLMLSIA
FT                   LRFVPLLMDETQKIMNAQKSRGMSFSTGGPIKRAKAIVPLLIPLFVGALQRALDLANAM
FT                   EVRGFQDATQRTKYRVLSYGSNDRSAFIGLIGFTIIFIGINFFIK"
FT   gene            191828..192595
FT                   /locus_tag="LEUM_0228"
FT                   /note="LactoCOG number LaCOG00330"
FT   CDS_pept        191828..192595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0228"
FT                   /product="Pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61359"
FT                   /db_xref="GOA:Q03ZL3"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZL3"
FT                   /protein_id="ABJ61359.1"
FT                   /translation="MPRYKAVIAYDGAEFFGFQLQTKNGVESVRTVQGELNKVINKMAK
FT                   NPSPQIKVVGASRTDTGVHAFGQVVHFDLPFNIDPEGVRKGMNTLLPFDVVVNHVEHVS
FT                   DDFHARFNTHSKRYIYRVSTTDYKDPFKRKYTGHFHWKLDINRIKAALPDLLGEHDFAS
FT                   FAASGNETATTIRLITRADVDEKPEEHEIVFTFEGNAFLYNQIRIMVGVLLEIGTGKRP
FT                   VHDIVRLIEVKDREQARYTAPASGLYLDEIDYN"
FT   gene            192645..193055
FT                   /locus_tag="LEUM_0229"
FT                   /note="LactoCOG number LaCOG01379"
FT   CDS_pept        192645..193055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61360"
FT                   /db_xref="GOA:Q03ZL2"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZL2"
FT                   /protein_id="ABJ61360.1"
FT                   /translation="MTFFEEYIQASRGLVFVATTRDNQPSIRIMGFAVSPERENLWYFN
FT                   VDPTSYKVHDIDNNDKVAIITPFNENGARIESNNATMRRSDKTWADVKPLFIDNKSYMQ
FT                   GHPDIENEIVLELHIHSASLASYGYKKDVNFE"
FT   gene            193193..193636
FT                   /locus_tag="LEUM_0230"
FT                   /note="LactoCOG number LaCOG01522"
FT   CDS_pept        193193..193636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0230"
FT                   /product="LSU ribosomal protein L13P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61361"
FT                   /db_xref="GOA:Q03ZL1"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZL1"
FT                   /protein_id="ABJ61361.1"
FT                   /translation="MRTTFLAKPGEIEKKWYIIDAKDVVLGRLSTVVASILRGKNKPTF
FT                   TPNVDMGDNVIIINASEVKLTGKKATDKVYYHHSNHPGGLKARTAGNYREFNPEKLLEL
FT                   SIHGMLPKNTLGRKQGLNLHVYAGSEHDHAAQKPEALDINKLV"
FT   gene            193655..194050
FT                   /locus_tag="LEUM_0231"
FT                   /note="LactoCOG number LaCOG01521"
FT   CDS_pept        193655..194050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0231"
FT                   /product="SSU ribosomal protein S9P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61362"
FT                   /db_xref="GOA:Q03ZL0"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZL0"
FT                   /protein_id="ABJ61362.1"
FT                   /translation="MTTAVQYAGTGRRKNSVARVRLVPGNGQITMNGKSIEEYIPFANL
FT                   REVVLQPFNVTETLGNYDVLVNVIGGGYSGQAGATRHGIARALLTVDPDFRAALKAAGL
FT                   LTRDSRMKERKKPGLKKARKASQFSKR"
FT   gene            194240..195157
FT                   /locus_tag="LEUM_0232"
FT                   /note="LactoCOG number LaCOG00236"
FT   CDS_pept        194240..195157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0232"
FT                   /product="fhu operon transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61363"
FT                   /db_xref="GOA:Q03ZK9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZK9"
FT                   /protein_id="ABJ61363.1"
FT                   /translation="MNFDQLLYAEVLAQHNSMQKAADVLHISKSGLSIAIHQLENELEV
FT                   TLFDKSSSGTKLTSEGRQLLSSISDILRFKNNLEKTATIVANPQKHQKVSIHYMNTMLK
FT                   PFISTFIDNYVAKFENVQVNISCHEFESIVRRVRSQEIDAGFIAINNINDESIKNLDFT
FT                   PVCDSKLVLFCAPNNPLNALNRPISLTDLKKQKFSLFNDKFHDEIFERLQFQCGPLSLV
FT                   LRVDDAWAMNQAIINLNTVCFGRIVQGNLSSNTDFSKLKIIHIGHVFDDDFKLGWLTNP
FT                   NYMISEKAQELLRDITAEVKKDAQ"
FT   gene            complement(195180..196364)
FT                   /locus_tag="LEUM_0233"
FT                   /note="LactoCOG number LaCOG01111"
FT   CDS_pept        complement(195180..196364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0233"
FT                   /product="NADH:flavin oxidoreductase, Old Yellow Enzyme
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61364"
FT                   /db_xref="GOA:Q03ZK8"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZK8"
FT                   /protein_id="ABJ61364.1"
FT                   /translation="MKNLIDKVTFRHGATIDTRTAQSPMLTNSGLNEKVTQDTINYYNA
FT                   RSQSAGMVIVEYTSVSPNGGPSRSWAPDREQLAIYDDSFVPGFKKITEKLKKDGNKAIL
FT                   QLVHSGREAQYRYALGGQVEVPSNIDFPWINYPLHELSEDEVWQIVKDFGTATKRAIAS
FT                   GFDGIEIHGANHYLHQEFFSAYSNVRTDFWGGSLEKRMNFALEVAREVFKVAKENAPKD
FT                   FIIGYRISPEEVHEDNIGYTWHEAQLLVNQLTENFEFDYVHLSTNDYTATPTDSDKNYA
FT                   QLLGERVKKPALLMIAGGIHTVEKMKDALQYVDIVSLGRPTLIDNQIGYKIKNGQADHI
FT                   FLEFNEESVKESHLTPGLIDLLANTAYFDMPGIDYLKTLTDVKLGDAVTHDGTK"
FT   gene            complement(196602..196805)
FT                   /locus_tag="LEUM_0234"
FT   CDS_pept        complement(196602..196805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61365"
FT                   /db_xref="GOA:Q03ZK7"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZK7"
FT                   /protein_id="ABJ61365.1"
FT                   /translation="MKKIIFEQTGNIVTTPLIAFAMIQSILLSPQSINKYKHHKYKHFY
FT                   YCNVNKYADSCVFNILNRLDYL"
FT   gene            197140..197222
FT                   /locus_tag="LEUM_t0235"
FT                   /note="tRNA_Tyr_GTA"
FT   tRNA            197140..197222
FT                   /locus_tag="LEUM_t0235"
FT                   /product="tRNA-Tyr"
FT   gene            197260..197334
FT                   /locus_tag="LEUM_t0236"
FT                   /note="tRNA_Gln_TTG"
FT   tRNA            197260..197334
FT                   /locus_tag="LEUM_t0236"
FT                   /product="tRNA-Gln"
FT   gene            complement(197424..197511)
FT                   /locus_tag="LEUM_t0237"
FT                   /note="tRNA_Leu_AAG"
FT   tRNA            complement(197424..197511)
FT                   /locus_tag="LEUM_t0237"
FT                   /product="tRNA-Leu"
FT   gene            197625..197960
FT                   /locus_tag="LEUM_0238"
FT   CDS_pept        197625..197960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61366"
FT                   /db_xref="GOA:Q03ZK6"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZK6"
FT                   /protein_id="ABJ61366.1"
FT                   /translation="MRFFNRKKTEVITPEIQAHNEALQNENDDLLDQIEALKLDVSELK
FT                   SENQHLTERLSRSKYQQKLTKTGGGLAVLFISYMLLSLLGEPSRYMIWLLLIEAVFIFM
FT                   MLRGDEK"
FT   gene            197957..198766
FT                   /locus_tag="LEUM_0239"
FT                   /note="LactoCOG number LaCOG00761"
FT   CDS_pept        197957..198766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0239"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61367"
FT                   /db_xref="GOA:Q03ZK5"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZK5"
FT                   /protein_id="ABJ61367.1"
FT                   /translation="MSQHNASRIPFVVANWKINKLHADVAEFLDKVNGKVPAENVVETG
FT                   IAAQDLFLSDMVRATAQSPIHIVAENVHWEDSGAYTGETSPKALKDIGAKYVLIGHFER
FT                   RKFFNETDSTVNLKVTAALRNGLRPIIDVDEDMSTYAQFMDAEPSVAQVAAALAGVSVD
FT                   QIRNVTLAYEPTWAIGSGEAASAVQAQKAAHLIRQTLAKLYSPVIAEQVRVLYGGSVTP
FT                   DNAREIMLQKDIDGVLVGTSALDPEKFLQLVAIAQDPEVPEFNIENT"
FT   gene            198908..200233
FT                   /locus_tag="LEUM_0240"
FT                   /note="LactoCOG number LaCOG00434"
FT   CDS_pept        198908..200233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0240"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61368"
FT                   /db_xref="GOA:Q03ZK4"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZK4"
FT                   /protein_id="ABJ61368.1"
FT                   /translation="MSLITDIIAREVLDSRGNPTLEAEVITELGGFGRGMVPSGASTGE
FT                   HEAVELRDGDKSRFGGKGTTKAVANVNDAIAKALVGKFDVTDQRAIDQAMIELDGTENK
FT                   GNLGANAILAVSIAAARAAADELGVPLFSYLGGANSYVLPTPMMNVINGGAHSANKVDF
FT                   QEFMIMPVGAPTVKEAIRYGSETFHALKKLLEADGKATSVGDEGGFAPDFADNEEPLKY
FT                   LIRAIEAAGYKPGKDIAIAVDVASSELYDAETKTYKLRWSTGEEFTTPEFIKYLEDLAD
FT                   RYPIISIEDPIDENEWEDWAAITAELGKKVQLVGDDFFVTNTQYLEKGINMGAANSILI
FT                   KVNQIGTLTETFEAIEMAKEAGYTAIVSHRSGETEDTTISDLVVATNAGQIKTGSLSRT
FT                   DRIAKYNQLIRIEELLDTTAKYKGIHSFYNLSAAAREVIENK"
FT   gene            200330..200917
FT                   /locus_tag="LEUM_0241"
FT                   /note="LactoCOG number LaCOG00752"
FT   CDS_pept        200330..200917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0241"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61369"
FT                   /db_xref="GOA:Q03ZK3"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZK3"
FT                   /protein_id="ABJ61369.1"
FT                   /translation="MDDLKRCSWVDNYPDSNIMTTYHDAEWGQPNQYSDEKLFELLTLE
FT                   VFQAGLSWETSLKRRSGMNTAFLSFDIDLVSKMTNEDIERLKNNPNIISNKLKITSTIH
FT                   NARVIRQIRQQRGSFFDYMWSFTDGQIINHHITSGDEIPSQNELSQQITKDMKKQGFKF
FT                   IGPVIVYSYLQAIGIINDHEQCCSFNPDNARL"
FT   gene            200993..202471
FT                   /locus_tag="LEUM_0242"
FT                   /note="LactoCOG number LaCOG01679"
FT   CDS_pept        200993..202471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0242"
FT                   /product="Exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61370"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZK2"
FT                   /protein_id="ABJ61370.1"
FT                   /translation="MAKLQGVILLNTDAAALQIVDSRGRQIEHVKREYSEKNLPLASFS
FT                   AEVMQRALSQLQRFQQLLRDYGVEDVRLYGSENLSKMLNAIYFVDQVENVTGLELLWLN
FT                   ANQENYYRQLALRVHDEKILNERYAFVLGVSSTRIDLSYFENNQFKFSQHSAIGPVRLT
FT                   QSIRDMAAEITEIPDLIPEFIDSKLADFWHMLPPVQATDTIILLGADVLNQLFLNKKPK
FT                   TTIHKSELQSLIHSFNQMNKQAIAEQYSIDLNDIWMVFMEAVLVVEVMSAVGASNLHMS
FT                   SLTVLDGLVVKDNNAQNDIITAARGIADRYMVEEKHRELVLRYAWRLFDRLKRIHRLSA
FT                   RDRLLLGVAALTHDVGSFINSQKHYQYSEEILEGIDFHGLSTSEQRMIASIARYHSAET
FT                   PDNALRSTQEFSPRQRMRIAKMAALLRLADALDDSRLQKISKLTVSIGTEKITVIGQSA
FT                   ADLQLEMYIFAQKAHFFEAVFGLPIVLKRQGKRS"
FT   gene            202480..204612
FT                   /locus_tag="LEUM_0243"
FT                   /note="LactoCOG number LaCOG01678"
FT   CDS_pept        202480..204612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0243"
FT                   /product="Polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61371"
FT                   /db_xref="GOA:Q03ZK1"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZK1"
FT                   /protein_id="ABJ61371.1"
FT                   /translation="MTDLKQHKYYVNREMSWLAFNKRVLEEGRDTQNPILERANFLAIT
FT                   QKNMDEWFMVRVASLQQQMFVGHDKVDASGLSPKQQLIKISAAAGEQIKNQYQVLNRSI
FT                   IPTMKKLGFSLVHKNDLTNAQVNFLKKFFEKELRPVLTPMAIDSTRPFPFLANDTLNIG
FT                   VRLKKNDEKSEKYIAVLQVPETSGRVIALPEENQVILVEDVVQLFLDALFPGYTIKESN
FT                   VFHILRDMELDVADDEDTPNILQEVQSKLQERERGRVIRVIVSANTGKMLMTQLIKALQ
FT                   VPDDRIYEVSGPIDLTFISSWLKVIDAPTLEYTSFHGYENPDLTADKIFESIRKRDYLL
FT                   HHPYDSFKPVVQFIQTAAIDDDVLAIKMTLYRVSGNSPIIKALSDAAQRGKQVTVLLEI
FT                   KARFDEENNVHWARELEQKGVHVVYGLRGLKVHAKMAMVVRRESDTIRRYVHLATGNYN
FT                   DVTANFYTDLGLLTVDSELGADVASIFNILTGYSDPSFFHQLHMSPNGIREFIYEKINV
FT                   EIKNAKAGKPSGIKMKFNSLSDERMIRHLYEASEAGVPVELIVRGITMLKVGIPKVSET
FT                   IAVHSIVGRFLEHSRVFIFHNDDSPQVYLSSADLMTRNLDRRVELLFPIRNAGLSQQVI
FT                   NIFEIMWADNVKTRVLQPDGSFDKIDRRGLSSVNAQEMFIAESMVKQIELKQQQDRENT
FT                   QKEFEPINNPFIGGES"
FT   gene            204609..205574
FT                   /locus_tag="LEUM_0244"
FT                   /note="LactoCOG number LaCOG01612"
FT   CDS_pept        204609..205574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0244"
FT                   /product="Exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61372"
FT                   /db_xref="GOA:Q03ZK0"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR022371"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZK0"
FT                   /protein_id="ABJ61372.1"
FT                   /translation="MTVIAVIDLGSNSVRMTISRYHQDGHYEVVNRLQEMVRLSEGMGE
FT                   NKVLQPEAIKRTMNALKNFKETLDKYPKAKIRAVATAAVRQATNQMAFLTEFEETMGFT
FT                   LQVLTGEEEAHYDYVGIVNTLNINDALILDTGGASAELILVRNKESVHEISLPIGAVTI
FT                   SEMFLEKDVINADSLFQATVALRQMFGDVSWLSDAMHLPLVALGGSNRTLAKISRRQRK
FT                   ITDMPIHGYHLSKQDATDIYQKILSKNLVERQKMAGLAKDRGDIIVGGLLPLVELLLFL
FT                   GGQQVIFSQAGLREGILFETIRQETGQHVIAPEPASMTID"
FT   gene            complement(205620..205691)
FT                   /pseudo
FT                   /locus_tag="LEUM_t0245"
FT                   /note="tRNA_Other"
FT   tRNA            complement(205620..205691)
FT                   /pseudo
FT                   /locus_tag="LEUM_t0245"
FT                   /product="tRNA-OTHER"
FT   gene            complement(205711..206346)
FT                   /locus_tag="LEUM_0246"
FT                   /note="LactoCOG number LaCOG00729"
FT   CDS_pept        complement(205711..206346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61373"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZJ9"
FT                   /protein_id="ABJ61373.1"
FT                   /translation="MVKYFTIKPTAFTWEKEIKKSRFILNMARITSENDARDFIEKINK
FT                   IHYKASHNVFAYVLGDNDSIKRYSDNGEPSGTAGIPMLEVLQKNDLHDVVAVVTRYFGG
FT                   IKLGAGGLIRAYAGTIAEGLESIDFVERLTRLQITISIDYKHGETLNYWLNSHNYQIID
FT                   TQYDTNVHVVVPVSEEDLTKFQSDLMNQFSGHILFDIGDETYFEIPVK"
FT   gene            206364..207644
FT                   /locus_tag="LEUM_0247"
FT                   /note="LactoCOG number LaCOG00728"
FT   CDS_pept        206364..207644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0247"
FT                   /product="Superfamily II DNA/RNA helicase required for DNA
FT                   uptake (late competence protein)"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61374"
FT                   /db_xref="GOA:Q03ZJ8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZJ8"
FT                   /protein_id="ABJ61374.1"
FT                   /translation="MNDEYFYGRQIVQPKVETTTKHIIEPFIGKKCQRCGQKNTEELPN
FT                   QHYYCNACLILGRVSSLDNLVSLPEPNQFSGTAKMTWQGELTQQQEKVSNELLVTLFQK
FT                   GEHLVWAVTGAGKTEMLFPVIHKALCQRLRVAIVSPRVDVIVELAPRIQSAFEETELMI
FT                   LHGNQKENYRYTQLVLATTHQMLRFYHAFDLVIVDEVDSFPFAGDAMLAYAVNKARKEN
FT                   SALIYLTATPTLAMRKKAGKKLPTSYLPLRFHQHVLPEIKVRLVSNWRKRLPNVIKKQI
FT                   IQLITSKQRFLIFVPKVSDLKPLHQKLHQLFPSVQSDYVHAADPFRQEKVKKMRDEKLQ
FT                   YLITTTILERGVTFPRIDVLIIGADDKTFSENALVQIAGRVGRSADRPTGLVQAYVQHI
FT                   NLKVRAAQKQIIMMNRRGEKLKRRMDN"
FT   gene            207658..208332
FT                   /locus_tag="LEUM_0248"
FT                   /note="LactoCOG number LaCOG00727"
FT   CDS_pept        207658..208332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0248"
FT                   /product="Predicted amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61375"
FT                   /db_xref="GOA:Q03ZJ7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZJ7"
FT                   /protein_id="ABJ61375.1"
FT                   /translation="MHCALCQTQLFEVNSFLQFFGLIRHENSVLCESCRHNFDAINDQS
FT                   CPACGRQQLNNDACYDCQRWQLNNRPSLHHRALYQYNDAMRLFMQQYKFNGDYKLRKIF
FT                   NRELINLIHTSDMDLVVAVPVSQHTMMTRGFNQVASLLEGIELTEALQVKVTKKMQQSH
FT                   FNRRARMKREQPFSIIDEKIIEGQSILLVDDVYTTGSTLHHAADLLLAHGADSVKSISL
FT                   AR"
FT   gene            208469..209014
FT                   /locus_tag="LEUM_0249"
FT                   /note="LactoCOG number LaCOG00433"
FT   CDS_pept        208469..209014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0249"
FT                   /product="SSU ribosomal protein S30P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61376"
FT                   /db_xref="GOA:Q03ZJ6"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZJ6"
FT                   /protein_id="ABJ61376.1"
FT                   /translation="MLDYNVRGENITVTDAIREYVEKRLTKLNRYIEENAKANVNLRTY
FT                   KSDNSGKVEVTIVLPYVVLRAEDTNQDLYAAVDNVSEKVERQIRKYKTKINRKSRETGF
FT                   KGIDSKGEIPEEEVDDSALQIVRTKQVDLKPMSPEEAALQMDLLGHVFFIFKDAESNTD
FT                   SVIYKRADGKYGLLETAE"
FT   gene            209162..210700
FT                   /locus_tag="LEUM_0250"
FT                   /note="LactoCOG number LaCOG00613"
FT   CDS_pept        209162..210700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0250"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61377"
FT                   /db_xref="GOA:Q03ZJ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZJ5"
FT                   /protein_id="ABJ61377.1"
FT                   /translation="MFGWQTILKNKHSLVKWLLAMVIPVILVAGYLGATSHVTQHANRL
FT                   KVAVVNLDKPAQFEGEQQSVGAKLTDQFKASKKLVVKKYSSEKSAREALKLGQISSVIV
FT                   FPNKMTQQLANFKSSGKNVNVKQVIATGNNQFATQYTSRVLEDLINEANVKLSMGISND
FT                   STLKNLAKQSNSLADKTSDLQANLQAVGNAIDTDTAKDLQTDASDLATQLATYSVELNT
FT                   AISNSDTDKIKEAAAKINDVSYKMQTTVVGGISNIVVNLNNTQALSQKSGIIQTEATSV
FT                   KNGQTAISNKLKSLLGDKSETTTSLTQMLTLNITDIKPVKNDGQVILPQVLAVGVTVMA
FT                   ILFGLVLPIKPEKPEALALEQWWDNFQIGGLLSVVGALLMTTSVLLWKIPITHFWFIVG
FT                   VVILAEWIMLSFVWYLKQLFGQAGWWLATGISVLQLIIVAVSYPAIVQDTAFGISRPFW
FT                   PLTALISAVNHITFSGEIQQNVMILVIWWIILTILLVSQYRFRQRKSLTEKIDE"
FT   gene            complement(210744..211415)
FT                   /locus_tag="LEUM_0251"
FT                   /note="LactoCOG number LaCOG00658"
FT   CDS_pept        complement(210744..211415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0251"
FT                   /product="Phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61378"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZJ4"
FT                   /protein_id="ABJ61378.1"
FT                   /translation="MTVNIYMVRHGETYFNLLHRFQGWSDAPLTEKGIQDGYAAGTRLA
FT                   NVHFDGAYSSGLTRTIHTSQYILANNKSDSPNQAIQLPDFREENFGYFEGVHTGLALTT
FT                   LGAYKNDTFSDFSDVIAKYGMPAAMDLIREGDPFKIAEDYQQFINRIQHGFDDILSRHQ
FT                   DGDNVLIVSHGTAIRAIVDYFGYHDFAKISVKNGAVTQLELAADHAKITNFNDDSTIFN
FT                   S"
FT   gene            complement(211509..212909)
FT                   /locus_tag="LEUM_0252"
FT                   /note="LactoCOG number LaCOG01208"
FT   CDS_pept        complement(211509..212909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0252"
FT                   /product="Hemolysins related protein with CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61379"
FT                   /db_xref="GOA:Q03ZJ3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZJ3"
FT                   /protein_id="ABJ61379.1"
FT                   /translation="MDSGPSMIINFFIILVVLLLAILFTLTEYSLVKVRLSALKALQET
FT                   REKPSRNISNAIYMTTHLTEYLSTAQVGITLTSLILGWIGEETVAEIILGSGIIPAEYA
FT                   HAVASVAAMIIFTIVHAVFTDLVPKNIAIESPVKVLLFIVRPVRFFHIALFPLIWTLDH
FT                   LSNGITHLLGFRTDGEEDIYSQTEILSLSKNAAAAGELDEEDLTFMQRAFEMNDKVAVD
FT                   IMIDRTSMTIIDVTASIADGLNLYLQERYSRFPVVADNDKDKVLGYVFNYDLVRQARIK
FT                   SSDPVSKIMRDIPAVPENMDLHDVMDEMIIKRSPIAIVVDEYGGTSGLITDKDIYEELF
FT                   GTVRDEIDDVSDDYIEKLGDHRFKISGKMTLYDFERYFNRNIKELENDDAVTLTGYVLN
FT                   HDPEFRAGDTMKVANFELTALDYDNAYISQFIVKELPLPKDDLNQNGIFDEDEAASEKN
FT                   SEDEVAAN"
FT   gene            213338..213568
FT                   /locus_tag="LEUM_0253"
FT                   /note="LactoCOG number LaCOG00683"
FT   CDS_pept        213338..213568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0253"
FT                   /product="Glutaredoxin related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61380"
FT                   /db_xref="GOA:Q03ZJ2"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011909"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZJ2"
FT                   /protein_id="ABJ61380.1"
FT                   /translation="MEKVTVYTKYNCVQCKMTKKFLEAQGIPFKEINIEEETQFVEELK
FT                   ANGHRQTPVVAVEGLPAFSGFRPDVLKKISA"
FT   gene            213736..215907
FT                   /locus_tag="LEUM_0254"
FT                   /note="LactoCOG number LaCOG00681"
FT   CDS_pept        213736..215907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0254"
FT                   /product="ribonucleoside-diphosphate reductase class Ib
FT                   alpha subunit"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61381"
FT                   /db_xref="GOA:Q03ZJ1"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZJ1"
FT                   /protein_id="ABJ61381.1"
FT                   /translation="MSLKELDLENVTYFDLNNQVNIPKNNEIQLDKDQEALNAFLDENV
FT                   LPNVMHFDSLQERLDWMFDHRFLEREFIQKYNITFIEKLYTYLAGEHFKFKSFMAAFKF
FT                   YNQYALKTNDGAYYIETYEDRVAMNALYYADGNENLALRLADEMIHQRYQPATPSFLNA
FT                   GRARRGELVSCFIIQTSDDMNSIGRTINSALQLSKMGGGVGINLSNVREAGAPVMGIDN
FT                   AAGGVVPIMKLLEDSFTFSSQVGARQGAGVVYLSVFHPDILSFLSTKKENADEKIRVKT
FT                   LSLGLTVPDKFYDLVKQNETMYLFSPDDVEKVYQQPFNYVDITAEYDNMVANDKIRKQR
FT                   IDARSLEEEISKLQQESGYPYIINIDTANRTNPVPGKIVSSNLCSEILQVQTPSEIDNE
FT                   QHYTKLGSDISCNLGSINIVNMMNTNDFGGSVDTMVRALTFVSDSSNLDVVPSIDLGNK
FT                   EKHAIGLGAMGLAAYFAQNKMYYGDEEALDFTSTFFMMLNYYSIKSSMGIAKERHETFY
FT                   QFDQSGYADGTYFDKYVEKNWTPKTEKVAKAFAGFDVPTEQDWAQLKEDVAKYGMYNAY
FT                   RHAIAPTGSISYVNDATASLLPIVNKIEERQEGMIGKVYYPAPGLSNETMPYYVSAYDT
FT                   DMRRVIDVYAAAQEHIDQGMALTLFMRSTLPEHLYEWKNNRTNKMTTRDLTILRNYAFN
FT                   KGIKSLYYVRTFTDDNQESGVNECESCSI"
FT   gene            215944..216384
FT                   /locus_tag="LEUM_0255"
FT                   /note="LactoCOG number LaCOG00682"
FT   CDS_pept        215944..216384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0255"
FT                   /product="Ribonucleotide reduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61382"
FT                   /db_xref="GOA:Q03ZJ0"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZJ0"
FT                   /protein_id="ABJ61382.1"
FT                   /translation="MTTINILYASTEGNTKAFIEKLAAVAESNGDGFSARLIGDETEYA
FT                   NETQPYVAFVPTYLTGGTGTGPEVKEIFTNALGDYIAFGNNARYLKGVVGSGNRNFNIQ
FT                   FNLTAIRYGKNFDVPMIAAYELRGSKFDAEKIYNKIKPYFGE"
FT   gene            216387..217364
FT                   /locus_tag="LEUM_0256"
FT                   /note="LactoCOG number LaCOG00680"
FT   CDS_pept        216387..217364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0256"
FT                   /product="ribonucleoside-diphosphate reductase class Ib
FT                   beta subunit"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61383"
FT                   /db_xref="GOA:Q03ZI9"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZI9"
FT                   /protein_id="ABJ61383.1"
FT                   /translation="MAHINNGSYTAINWNNIEDELDKATWEKLTQQFWLDTRIPISNDL
FT                   RTWRGNMSEQERQTMNLVFGGLTTLDTLQSQDGMAQLKLDATNQKEEAVLNNIQFMESV
FT                   HAKSYSSIFETLNEKVEIEKIFEWADSNEFLQYKANRINDIYHNGSALQKKIASVFLET
FT                   FLFYSGFYTPLYFLGHNKMLNVAEIIKLIIRDESVHGTYIGYKFQIGFNKISAEERTEL
FT                   QSWMYDLLYELYENEEKYTHELYDDLGWTEQVLTFLRYNANKALMNLGQEPMFPDGAED
FT                   VNPVVMNGISTSTANHDFFSGVGNGYLLGEVEAMNDDDYNIGLD"
FT   gene            complement(217395..218060)
FT                   /locus_tag="LEUM_0257"
FT                   /note="LactoCOG number LaCOG00700"
FT   CDS_pept        complement(217395..218060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0257"
FT                   /product="Membrane-associated phospholipid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61384"
FT                   /db_xref="GOA:Q03ZI8"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZI8"
FT                   /protein_id="ABJ61384.1"
FT                   /translation="MIISVKNKQLRYAIICFISALIISVFVKIKFIFPTIIDNSIHSFM
FT                   AGIQTGLNDILMTVFSFLGSPILDVIYVLILAAILLLANLRIPAIWAVTTIILGNIFNT
FT                   IIRLSVDRSRPVGHLLSDQGSSFPSSHVFGIFSVIFILSLLVIPNIESPRKQFLISWAI
FT                   TVIGVMTLMSRIYFNAHYLSDTIAAVLFAYAWIIFAGKLYPVLAKLLTSLSFFSHDEV"
FT   gene            complement(218177..219172)
FT                   /locus_tag="LEUM_0258"
FT                   /note="LactoCOG number LaCOG00893"
FT   CDS_pept        complement(218177..219172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0258"
FT                   /product="ketopantoate reductase"
FT                   /EC_number="1.1.1.169"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61385"
FT                   /db_xref="GOA:Q03ZI7"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZI7"
FT                   /protein_id="ABJ61385.1"
FT                   /translation="MKYTVVGAGAMGLRYGILLQENAGVPVDFVEPTQASLDKIHEQGD
FT                   KVWKSRDHKDRHEIKINIFSPEEYEGSPDVWIFFMKQMQLQDTLDRLSPKFKPGQTALG
FT                   AMNGMGHIEKLQKYFDDEHIIGGTAMIATVLNDYGDVDFMGGESMGSSVYANLTEKPST
FT                   VMDKIQEDFKAAHLNPSYTENFMGTLLTKVFFNAVENSIATMFQSRMGQLMAYDNFLEG
FT                   IARPLINEAYDAAEAAGITLIETRDEMVKQVDYVSNIGNPLHFPSMYQDFVKGRPTEVD
FT                   YINGWIADLADKNGVNAPNQHLVTNFVHLAESMRKFTPPVNKLAPDYKGN"
FT   gene            219352..220002
FT                   /locus_tag="LEUM_0259"
FT                   /note="LactoCOG number LaCOG00730"
FT   CDS_pept        219352..220002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0259"
FT                   /product="Glycopeptide antibiotics resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61386"
FT                   /db_xref="GOA:Q03ZI6"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZI6"
FT                   /protein_id="ABJ61386.1"
FT                   /translation="MHIVYLNNQQYIAQSVHATTIVSLLCVYILLRHTLKSLRNKSFSW
FT                   RGLLGRAILSVYATLVAAFTLTFYKWPSFATYLAVIKGYGGFGQYSFVHLSLFNADNVA
FT                   LSWYQLTGNFMLLLPLGFIAPFLFPKWRGLLRIVPRIFLTTLTIEIIQGTSTFFYLSNR
FT                   IFDMNDLAVNTAGGVVGYVIYLITIFVMKKDKNFVPNHVEKGNLNEHNLYIKS"
FT   gene            220345..221337
FT                   /locus_tag="LEUM_0260"
FT                   /note="LactoCOG number LaCOG01901"
FT   CDS_pept        220345..221337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0260"
FT                   /product="Actin-like ATPase for cell morphogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61387"
FT                   /db_xref="GOA:Q03ZI5"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZI5"
FT                   /protein_id="ABJ61387.1"
FT                   /translation="MAKDIGIDLGTANVLIYVEGKGIVLNEPSVVAVDDKTDRVLAVGS
FT                   EAYRMVGRTPGNIRAVRPLKDGVISDFDVTEAMLTYFVDKLNVKGFMSKPNIMICAPTN
FT                   ITEIERKAIIQAAEKAGGAKVYLEYEPKVAAVGAGLDIFKPIGSMVIDMGGGTSDIAVL
FT                   SLGDIVVSESIRIAGDKMNFDIVNFLKRRHNLIVGERTAETIKIQIGSALQADEPLTME
FT                   VRGRDNFEGMPKTVTINSNEVEDSLHDTLQQIVRAAHSVLAKLPPELASDIIDRGIMLT
FT                   GGGALLHGMDQLLSDALEVPVVVSDSPLDNVAKGAGALLEHMKSGRRGL"
FT   gene            221337..221546
FT                   /locus_tag="LEUM_0261"
FT   CDS_pept        221337..221546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61388"
FT                   /db_xref="InterPro:IPR021351"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZI4"
FT                   /protein_id="ABJ61388.1"
FT                   /translation="MRRKNQNFDVELIVNDQQTQVLVDKKQIGYIEKADRGFVGFFGQQ
FT                   AIINQAKDEAEALQAILASFNLNH"
FT   gene            221676..222890
FT                   /locus_tag="LEUM_0262"
FT                   /note="LactoCOG number LaCOG00623"
FT   CDS_pept        221676..222890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0262"
FT                   /product="cell division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61389"
FT                   /db_xref="GOA:Q03ZI3"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZI3"
FT                   /protein_id="ABJ61389.1"
FT                   /translation="MQQTRQTSRRTSGSELDWGIILALLLFMIIGLSSLYEAATHMQGA
FT                   TTLSAVKVVMNQGIFWFIGVLLIVFLVRFDGSQLWKLAPITYGLGIFLLVAVLIFYNRA
FT                   MYDSTGARSWFVIGPLSFQPSEVVKPAFILMLSRVVAQHNRNYPNHALSTDWLLLGKMA
FT                   VCFIPVAALIALQNDLGTLLVFVAIFGGVALVSGVTWRILAPVIILGATVGTTLLTLVI
FT                   SSAGRTILSKLGFQSYQFSRIDTWLNPANDTSGNGYQTYQSLKAIGSGQLTGNGWGSLK
FT                   VYVPVRESDMIFSVIGESFGFIGGAFLIALYFGLIYLLIRATFRAQSAFYAYIATGVVM
FT                   MVLFHVFENIGMSIGLLPLTGIPLPFVSQGGSSLLGNMIGVGLILSIGYQRQNSTFTET
FT                   TGFFI"
FT   gene            222890..223894
FT                   /locus_tag="LEUM_0263"
FT                   /note="LactoCOG number LaCOG01897"
FT   CDS_pept        222890..223894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61390"
FT                   /db_xref="InterPro:IPR021247"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZI2"
FT                   /protein_id="ABJ61390.1"
FT                   /translation="MIELDELKKEFITLRQKVRNGDVFQSLGELMKESLHKMPPQSLTT
FT                   VSLPVDGEFALKRMQNYTQRADQMTESETATEDFDFQVKDTDLALIVEQLASPLPKYRD
FT                   TGAFFFLSDMIQNDLLSEEQLRWLTDYLVSDEQLFAHILEPQNDAIYRRSFSVLVLSLL
FT                   LFSNRIKTPFMSETQLNHVIDQVALYAALERDGRGFIDENGWAHAFTHIGNAVAEIFLM
FT                   PDLVRADKVFVLGAVLAGYHELSQPLTFGETERLVEVITHISKQHELYADYLLLTLKMW
FT                   RKDLVTQTPPKTQQQWQQLYNRSQFFHEILLRGKNEVPEAVFDYVSVTKNYLA"
FT   gene            223938..225071
FT                   /locus_tag="LEUM_0264"
FT                   /note="LactoCOG number LaCOG00245"
FT   CDS_pept        223938..225071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0264"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61391"
FT                   /db_xref="GOA:Q03ZI1"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="PDB:1EHI"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZI1"
FT                   /protein_id="ABJ61391.1"
FT                   /translation="MTKKRVALIFGGNSSEHDVSKRSAQNFYNAIEATGKYEIIVFAIA
FT                   QNGFFLDTESSKKILALEDEQPIVDAFMKTVDASDPLARIHALKSAGDFDIFFPVVHGN
FT                   LGEDGTLQGLFKLLDKPYVGAPLRGHAVSFDKALTKELLTVNGIRNTKYIVVDPESANN
FT                   WSWDKIVAELGNIVFVKAANQGSSVGISRVTNAEEYTEALSDSFQYDYKVLIEEAVNGA
FT                   RELEVGVIGNDQPLVSEIGAHTVPNQGSGDGWYDYNNKFVDNSAVHFEIPAQLSPEVTK
FT                   EVKQMALDAYKVLNLRGEARMDFLLDENNVPYLGEPNTLPGFTNMSLFKRLWDYSDINN
FT                   AKLVDMLIDYGFEDFAQNKKLSYSFVSLGEEKIGKFN"
FT   gene            225157..225741
FT                   /locus_tag="LEUM_0265"
FT                   /note="LactoCOG number LaCOG00172"
FT   CDS_pept        225157..225741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0265"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61392"
FT                   /db_xref="GOA:Q03ZI0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZI0"
FT                   /protein_id="ABJ61392.1"
FT                   /translation="MVQVISQNEHRRQQIIEAATTIFLSKGFEQTTTRDIAKKVNISQP
FT                   ALYHHFGDKESLFVEVISRVGESTYTDMQSILSQTYAEPIDQLVDLTQVIVLRHPRDVF
FT                   RLIHDSFDSLSATHRSKLGMIFGRDYVGPIAQFFESIQLRDNVDAQIASSFYITSLSPL
FT                   FGEFHSLGEQITMRERIQQLLDLILYGVEKK"
FT   gene            225752..225931
FT                   /locus_tag="LEUM_0266"
FT                   /note="LactoCOG number LaCOG01417"
FT   CDS_pept        225752..225931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0266"
FT                   /product="LSU ribosomal protein L33P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61393"
FT                   /db_xref="GOA:Q03ZH9"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZH9"
FT                   /protein_id="ABJ61393.1"
FT                   /translation="MILEEYGGCPMASHKVSLACTVCGSRNYTVTLSKDRTERLSVSKF
FT                   CQHCGKHTLHQQTK"
FT   gene            225942..226118
FT                   /locus_tag="LEUM_0267"
FT                   /note="LactoCOG number LaCOG01416"
FT   CDS_pept        225942..226118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0267"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61394"
FT                   /db_xref="GOA:Q03ZH8"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZH8"
FT                   /protein_id="ABJ61394.1"
FT                   /translation="MINYFKNVAQEMKNVTWLTGEQTSKETITVITVSIIFALFLGGVD
FT                   WLLQQGFNFLLAK"
FT   gene            226197..226775
FT                   /locus_tag="LEUM_0268"
FT                   /note="LactoCOG number LaCOG01415"
FT   CDS_pept        226197..226775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0268"
FT                   /product="transcription antitermination protein nusG"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61395"
FT                   /db_xref="GOA:Q03ZH7"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZH7"
FT                   /protein_id="ABJ61395.1"
FT                   /translation="MSEEIEKSWFVVHTYSGYEHKVKANLESRTQTMGMSEQIFRILVP
FT                   EQEVTTIQDGEAKQTVENDFPGYVLVEMATPYEDNMTDEAWYVVRNTPGVTGFLGSHGA
FT                   GSKPNSLLPEEVDLLMKRMGMVTREQVDLDVAVGQTVKIISGPFSGMEGVVTSIDQEKQ
FT                   TLEATVAVFGRETPTELDFSDVDTTLDSL"
FT   gene            226902..227366
FT                   /locus_tag="LEUM_0269"
FT                   /note="LactoCOG number LaCOG01339"
FT   CDS_pept        226902..227366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0269"
FT                   /product="LSU ribosomal protein L11P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61396"
FT                   /db_xref="GOA:Q03ZH6"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZH6"
FT                   /protein_id="ABJ61396.1"
FT                   /translation="MAKKVVNVVKLQIAAAKATPAPPVGPALGQAGINIAQFTKEFNAR
FT                   TADQAGSIIPVEISVFDDRSFEFVTKTPPAADQLRKIVGKGSGEPNTKKAGNVTLDQIR
FT                   AIAENKMSDLNANDITNAMRMIEGTARSMGVTVDGVDLTVEGTAIKEDAE"
FT   gene            227366..228058
FT                   /locus_tag="LEUM_0270"
FT                   /note="LactoCOG number LaCOG01338"
FT   CDS_pept        227366..228058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0270"
FT                   /product="LSU ribosomal protein L1P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61397"
FT                   /db_xref="GOA:Q03ZH5"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZH5"
FT                   /protein_id="ABJ61397.1"
FT                   /translation="MTQKHGKNYVAAVAKVEAEKAYALNDAVSLVKEIDFAKFDASVEV
FT                   VFKLNVDTRQADQQLRGAVVLPNGTGKDKTVVVFAQGDKAKEAEAAGADVVGAADLVQR
FT                   IQGGWLDFDVAVATPDMMAQVGRVGRALGPKGLMPNPKTGTVTMDVTKAVSDAKGGQVT
FT                   YRTDRDGNVAVPVGRVSFEEGKLAENIKSIAETVLKARPAAVKGTYVQHVSISSTFGPA
FT                   VTLDINTL"
FT   gene            228242..228778
FT                   /locus_tag="LEUM_0271"
FT                   /note="LactoCOG number LaCOG00859"
FT   CDS_pept        228242..228778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0271"
FT                   /product="LSU ribosomal protein L10P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61398"
FT                   /db_xref="GOA:Q03ZH4"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZH4"
FT                   /protein_id="ABJ61398.1"
FT                   /translation="MSEKAIAVKAQKVEEIADQFKAAASAVVVDPRGLTVAQSTELRHQ
FT                   LREEGVVLEVIKNKVLTRAAEKAGYAELNDIFAGPSAVAFSNDDAVAPARILKKFADEN
FT                   EALEIKGGVVDGTIANIDDINKYASLPSREGLLGQLMAEFQFSIRSFAYAVKAVQDKLE
FT                   EESAAPAAEASTDAE"
FT   gene            228823..229188
FT                   /locus_tag="LEUM_0272"
FT                   /note="LactoCOG number LaCOG00858"
FT   CDS_pept        228823..229188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0272"
FT                   /product="LSU ribosomal protein L12P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61399"
FT                   /db_xref="GOA:Q03ZH3"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZH3"
FT                   /protein_id="ABJ61399.1"
FT                   /translation="MAFDKDAIIASLKDATILDLADLVSAIEEEFNVSAAAPVAAAGAA
FT                   DGAAAAKSEFDVELTSAGTAKVKVIKAVREATGLGLKEAKDLVDNAPSVVKEGLSEDDA
FT                   NALKESLEATGASVTVK"
FT   gene            229288..229923
FT                   /locus_tag="LEUM_0273"
FT                   /note="LactoCOG number LaCOG00939"
FT   CDS_pept        229288..229923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0273"
FT                   /product="16S rRNA m(2)G 1207 methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61400"
FT                   /db_xref="GOA:Q03ZH2"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZH2"
FT                   /protein_id="ABJ61400.1"
FT                   /translation="MTEKNISGEQYFTANPNAEHHYQNFDFDLLGHELHFTTDSGVFSK
FT                   STVDFGTRTMLDALEKTSIPIGKVLDLGTGYGPVGLTVAKAYQRHVDMVDVNERALDLA
FT                   RKNAQQNGVAQRVNIFKSDVYASISDKYALILVNPPIRAGKQVVTAMLQEAANYLQDGG
FT                   KLIAVLQKKQGAPSAQKNMSLAFGNAKVIHKNKGYYILESTYGTNTSI"
FT   gene            229901..230407
FT                   /locus_tag="LEUM_0274"
FT                   /note="LactoCOG number LaCOG00487"
FT   CDS_pept        229901..230407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0274"
FT                   /product="tRNA-adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61401"
FT                   /db_xref="GOA:Q03ZH1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZH1"
FT                   /protein_id="ABJ61401.1"
FT                   /translation="MAQIPAFSDEQIDYFMQEALNEAKIAQSEGEVPIGAVIVYENQMI
FT                   ACAHNHREADQLATAHAELLAIESANTKLKSWRLENTALFVTLEPCIMCAGAIINARIP
FT                   VVYYGANDPKGGATRSLYSLLEDNRLNHMVKVYEGIRGEESGLLLQRFFSNIRAKRKIR
FT                   KAIAK"
FT   gene            230471..230989
FT                   /locus_tag="LEUM_0275"
FT                   /note="LactoCOG number LaCOG01146"
FT   CDS_pept        230471..230989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0275"
FT                   /product="Predicted HD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61402"
FT                   /db_xref="GOA:Q03ZH0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZH0"
FT                   /protein_id="ABJ61402.1"
FT                   /translation="MQNPNAWRTDKDYINIIDDLLQHEEVQQLALYTQHHFSNRLTHSI
FT                   SVSYQSYLIAKKIGADEVATARAGLLHDLFYYDWRVTKFDEGSHAYVHPRIALKNARKI
FT                   TNISDKEADIIVKHMFGATIALPKYRESWIVSLVDDFAAVNEYLIPKTYLTYFKWQEKL
FT                   ATKFVSVFA"
FT   gene            231240..232967
FT                   /locus_tag="LEUM_0276"
FT                   /note="LactoCOG number LaCOG01482"
FT   CDS_pept        231240..232967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0276"
FT                   /product="DNA polymerase III, gamma/tau subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61403"
FT                   /db_xref="GOA:Q03ZG9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZG9"
FT                   /protein_id="ABJ61403.1"
FT                   /translation="MKLAYQALYRVYRPRSFDDMVGQKIITQTLKNAIATQQTGHAYLF
FT                   SGPRGTGKTSAAKIFAREVNGIAPETDDSQIPDIIEIDAASNNGVDEIRNIRDGANYAP
FT                   IESEYKIYIIDEVHMLSSGAFNALLKTLEEPPANVKFILATTEPQKIPATILSRTQRFE
FT                   FKRIDNDTIQARMAEILQKEGISFDDDALHIIANVAEGGMRDALSILDQVLAFGADHVT
FT                   LENALQVTGSTTASQLVTYLQQVSNYDTESALQTLHDILLEGKDAVRFVADLLGVLRDV
FT                   MLAEVAPNLIKTTAPLADLKALTIKLGTSRIQQMMVTLDDIQKQLLQTMQSDVYLELLT
FT                   VKLSMPEPEQTVPAKQSSNVIKEKPQNIDDIVKASKNTEVHEEQVVEPAIEKTPVEVPA
FT                   VENAEYEDLLVRTGQNAVFAVLIAAKRDALARVKNAWSDLLRQFNVTQQAMLTIAEPVA
FT                   ASEQAVVLAFDYPVLLEQALHDATLQNHLVQQLQSQNLPSELVFISQDEWTSDRASYVN
FT                   KLKTGETPQIQLEDVPRVKAANLSAIPTKTPQESSNKELKIVSEAKELFGEDLVNIVD"
FT   gene            232986..233627
FT                   /locus_tag="LEUM_0277"
FT                   /note="LactoCOG number LaCOG00244"
FT   CDS_pept        232986..233627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0277"
FT                   /product="DNA replication and repair protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61404"
FT                   /db_xref="GOA:Q03ZG8"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZG8"
FT                   /protein_id="ABJ61404.1"
FT                   /translation="MFNAVRVRHFENMQYPEPIAKLIDSYTKLPGIGPKTATRLAFYTL
FT                   GMNEEDVQDFSKALISAKTDLTFCSICGNITATDTDPCVICRDQSRDQSTVFVVENSRD
FT                   VMAMENTRDYHGLYHVLNGVISPSAGTGPEDINLPSLIRRLSEHEEIKEVIVGTNANAE
FT                   GEATAMYLARLLKPAGIAVTRLAHGLAVGSDIDYADELTLIKAVQGRTKL"
FT   gene            233624..233884
FT                   /locus_tag="LEUM_0278"
FT                   /note="LactoCOG number LaCOG02168"
FT   CDS_pept        233624..233884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61405"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZG7"
FT                   /protein_id="ABJ61405.1"
FT                   /translation="MIFGKKKTGLRKEYDRALVFQIDKAKIDWDTARNSEAALLDGQVN
FT                   LRLIQAQTALARAKFNYLYREARRRKTVGHMQTHVLKTDRI"
FT   gene            233915..234556
FT                   /locus_tag="LEUM_0279"
FT                   /note="LactoCOG number LaCOG00291"
FT   CDS_pept        233915..234556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0279"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61406"
FT                   /db_xref="GOA:Q03ZG6"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZG6"
FT                   /protein_id="ABJ61406.1"
FT                   /translation="MPKPIFISFEGPEGAGKTSVLEALISELKTKLGDDLVTTREPGGN
FT                   PISEAIRSILQPEEDNGMDKRTEALLYTAARRQHLVENIKPALDQNKIVISDRYVDSSL
FT                   AYQGGGRGLGIDNIWEINQFAIDGLLPDMTIYLDVPVEIGLARVNENRQGKIDRLDKES
FT                   ISFHQKVRETYLKLQSEFSDRIKIVDATQPLNKVIDDTRILINQILEDKS"
FT   gene            234553..234882
FT                   /locus_tag="LEUM_0280"
FT                   /note="LactoCOG number LaCOG01657"
FT   CDS_pept        234553..234882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61407"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZG5"
FT                   /protein_id="ABJ61407.1"
FT                   /translation="MKLVTAIVQDKDTTKLSNAFVKANIRATRLATSGGFLRSGNTTFM
FT                   IAIEDERVPDVMEIIKKVSQKRKQFMVPPISLDASGDHAGAYPIEIEVGGATVFTQSID
FT                   SFEQF"
FT   gene            234882..235784
FT                   /locus_tag="LEUM_0281"
FT                   /note="LactoCOG number LaCOG00292"
FT   CDS_pept        234882..235784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0281"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61408"
FT                   /db_xref="GOA:Q03ZG4"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZG4"
FT                   /protein_id="ABJ61408.1"
FT                   /translation="MLPDFATIAQKNYPAQLAHFNDLLQQDKLSHLYLFVGPSQSAKLA
FT                   FSRYIAWQVVHADERNALRITENEHPDVHITAPIPPATSLKVAQIRDLTPEFVTTATES
FT                   PRKIFILDAVETLTASAANSLLKFIEEPAGPQLIMMLTENMSDVLPTIRSRAQVVQLAS
FT                   AIASDDDGLMDGDWQKQTQLVLFKWFELMMQRRIEAFAFVQTKIISQLNDTKQQQLFLN
FT                   WLHELARDTIVYGQIPDDRLAFPNLIGLYKTLRQRYDMYRLVKASDEVFADDKLRKVNL
FT                   SLQARLEKMTLDVIIALGE"
FT   gene            235786..236655
FT                   /locus_tag="LEUM_0282"
FT                   /note="LactoCOG number LaCOG00295"
FT   CDS_pept        235786..236655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0282"
FT                   /product="Predicted methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61409"
FT                   /db_xref="GOA:Q03ZG3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZG3"
FT                   /protein_id="ABJ61409.1"
FT                   /translation="MQQQKSFENQETGTLFLVPTPIGNLQDMSPRAIDTLRDVDIIAAE
FT                   DTRHTQQLLNHFAITTKQTSFHEHNWQAKIPGLIADLRNGKNVAQVSDAGMPSISDPGK
FT                   ELVAAAVAENLAVVPIPGATAGVTALIASGLVPQPFYFYGFLQRKNSEQLAELQQLSTM
FT                   RDTVIFYESPHRLKQTLVNIQKVMGDERRIVLARELTKRYEEFIRGTIDELVSWSQSNE
FT                   IRGEFVVMIDGFHGEISEPDNSIALTVQEAVSALIKKGLKPNAAIKQIAKERGLDRQAV
FT                   YADYHEIE"
FT   gene            236657..237388
FT                   /locus_tag="LEUM_0283"
FT                   /note="LactoCOG number LaCOG00766"
FT   CDS_pept        236657..237388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0283"
FT                   /product="Acyl-ACP thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61410"
FT                   /db_xref="GOA:Q03ZG2"
FT                   /db_xref="InterPro:IPR002864"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZG2"
FT                   /protein_id="ABJ61410.1"
FT                   /translation="MKKYEIKRRVEYYEADTTQKLSLPMILNYAVLASKCQSDELGVGQ
FT                   DFHLGRGLGWIILQYEVIIKRRPKIGEIIRIQTFATQYNPFFVRRPFVFLDENDNEIIR
FT                   VDSIWTMIDMTNRRMARLPQDIIDQYDAKRVKQISRIPNPEKFSDDDQYTERDYHVRYL
FT                   DIDGNKHVNNSKYFEWMQDVIAPEYLLTHEITYINLKFENEIRLGHTILSQVVQNDNKS
FT                   KHRIMMENVISAEAEFKWRKI"
FT   gene            237417..238409
FT                   /locus_tag="LEUM_0284"
FT                   /note="LactoCOG number LaCOG01320"
FT   CDS_pept        237417..238409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0284"
FT                   /product="UDP-galactose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61411"
FT                   /db_xref="GOA:Q03ZG1"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZG1"
FT                   /protein_id="ABJ61411.1"
FT                   /translation="MAILVLGGAGYIGSHMVKRLIEADRDVVVVDALFTGHREAVNPKA
FT                   KFYQVDIRDKTALSEVFDKENIEQVVHFAAFSIVPESVANPLKYFDNNTSGMITLLEVM
FT                   KEHDVKQIVFSSTAATYGNPVNIPIKETDPQRPINPYGESKLMMEKIMAWSDQADGVKW
FT                   VALRYFNVAGAAEDGTIGEDHAPETHLVPIILQAGLGQREYIEMFGDDYNTPDGFNVRD
FT                   YVHVLDLADAHILALKYLADGNDSNQFNLGSATGFSVKEMVEAARSATGVDIPAKIGPR
FT                   RAGDPDILIANSDKARDVLGWAPKYDNVQDIIKTAWNWHKNHPSGYNDK"
FT   gene            238607..239080
FT                   /locus_tag="LEUM_0285"
FT                   /note="LactoCOG number LaCOG00124"
FT   CDS_pept        238607..239080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0285"
FT                   /product="Fe2+ transport system protein A"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61412"
FT                   /db_xref="GOA:Q03ZG0"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZG0"
FT                   /protein_id="ABJ61412.1"
FT                   /translation="MQMLSEIAGKGTYIIRELTGSRRLTKRLAEIGIKAGKSIEVISLP
FT                   DHTSGLIIYFQGQRLAVSNDIASQISVAPVSEITTDHFKTLSDMPINKPGVVAKILGNK
FT                   ALRKRLMDMGITKNTVVRIDRVAPLGDPIELVVRGYKLSLRKSDAQLVVLTEI"
FT   gene            239084..241198
FT                   /locus_tag="LEUM_0286"
FT                   /note="LactoCOG number LaCOG00123"
FT   CDS_pept        239084..241198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0286"
FT                   /product="Fe2+ transport system protein B"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61413"
FT                   /db_xref="GOA:Q03ZF9"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZF9"
FT                   /protein_id="ABJ61413.1"
FT                   /translation="MNKQCTVALAGNPNSGKTTLFNLLTGSHQHIGNWPGVTVEKKSGR
FT                   LKNNPDIIIQDLPGTYSLSAYSPEEVITRNFLINDKPEQIINVLDATNIERNLYFSLQL
FT                   METGVPIILALNMLDLLVKQRQYRIDTKKLSYLLNVPVVSISALKKKNINQLTKQVIAN
FT                   TDQPQTYPHPVYDKRLESALSMIEEQIDGIIEADQLRWYAIKLFERDEAVGHLKLTAQQ
FT                   QTEIDNIIDTAEKLFNDDSDSIVVNARYDYIERIINMCVVRTSDFSMSMSDRVDMVVTN
FT                   RILALPIFIFVMWIVYFLSIQTIGTIGSDWVNDVLFGDFIPNSANAILTYLHVSVWLKS
FT                   LIIDGLINGIGSVLGFLPQIMMLFLCLSILEDCGYMARIAFVMDRIFHRFNLSGKSFIP
FT                   MLISTGCGVPGIMSTRTIESKSDRRMTIMLTTFMPCSAKLTVIALVSGTFFPENSWVAP
FT                   TSYFISILTVVGSGIFLKKTKLFSEPPTPFVMELPAYHLPSIGNVSHSVWIKAHAFIKK
FT                   AGTIIFASCVAIWFLSNFNFHFQMVDQNDSILRDIGMVIAPIFAPLGFGDWHATVAVIA
FT                   GLIAKENCVSTLNITFGSSSTASFMSTLRQTYSPMAGYSFLVFNLLCAPCFAAIGAMYK
FT                   EFGDALWTWRAVIYQTVVAYMCALSIFQVSEIIQGNVSGYFVALSFIAIGLMLYGIFIK
FT                   RERPQQLELY"
FT   gene            complement(241727..242692)
FT                   /locus_tag="LEUM_0287"
FT                   /note="LactoCOG number LaCOG01084"
FT   CDS_pept        complement(241727..242692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0287"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61414"
FT                   /db_xref="GOA:Q03ZF8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZF8"
FT                   /protein_id="ABJ61414.1"
FT                   /translation="MEKKLTITDIANMAQVAKSTVSRYLNGGPVSAKTREKINKVVTEN
FT                   NYQPNTFAQSLKQKVNHTIGVIVPRLDSSAQVEMLRGLDDANENDTFLIVNTYQSTKRE
FT                   LAAIEKLRTQNVGGLIVLTANLNDELRNALTEFDAPVVIQGQEEPNFHRVVMNDLQAGT
FT                   VVGEFAASLHPQNTLLLKIDETMDWAIGHDRFLNIRKKLSTSKVTVVDSKFSIAEAKIA
FT                   AQQAMQSQNFDLIIGATDRITIGALQAGLATGQNAQYIGFGRSDLSTTVTPNLTSFEYD
FT                   FYQTGKKIYELFCTVRDTNPSNTIRTVLDGELVVRDSTEK"
FT   gene            242852..244813
FT                   /locus_tag="LEUM_0288"
FT                   /note="LactoCOG number LaCOG00949"
FT   CDS_pept        242852..244813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0288"
FT                   /product="PTS system sucrose-specific IIC component, Glc
FT                   family / PTS system sucrose-specific IIB component, Glc
FT                   family / PTS system sucrose-specific IIA component, Glc
FT                   family"
FT                   /note="TC 4.A.1.2.12; TC 4.A.1.2.12; TC 4.A.1.2.12"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61415"
FT                   /db_xref="GOA:Q03ZF7"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010973"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZF7"
FT                   /protein_id="ABJ61415.1"
FT                   /translation="MDHNKVAKRIADAVGKDNIVAAAHCATRLRLVIKDVKKIDQDALD
FT                   NDSDLKGTFNANGQYQIIVGPGDVNGVYDEFVKITGVEQASTADLKKIAAQSGKRNPLM
FT                   DLVKVLSDIFVPLIPALVAGGLLMALNNILTGEGMFGAKSLVEMFPQITGLAEMINLMA
FT                   SAPFAFLPILIGITATRRFGGNEILGAAAGMMLVMPSLVNGYNVAEAVATGKMPTWDLF
FT                   GLSVAQAGYQGQVLPVIGVAFILANLEKFFHKHLKGAIDFTFTPMLSIILTGFITFIVV
FT                   GPVLRIVSNGITDSLTWLVTTFGFIGYGVFGTFYSAIVITGLHQSFPAIETQLLADVAK
FT                   TGGDFIFPIAAASNVAQGAATFAIYFLSKGDEKVRALASSSGASAMLGITEPAMFGVNL
FT                   KYKFPFFIALGSAGISSLVMGLFQVMSSSLGPAGIIGFIAIPANKWVGFFIAIALSFVI
FT                   AFTATLAYGRSHMPVSKSGNRLANPVVTEHEAGFEVDAPVSGHLIPLADVPDNVFSTGM
FT                   MGKGVAIEPSDGTIYAPADGEITVAYQTKHAYGLTTDDGVEILIHIGLDTVNLEGQGFE
FT                   SFVTQGQKVKKGDKLGTFDTNTIKKAGYPVTTMVIITNTKAFNDVAVDEAFDNDIQAGH
FT                   QIITAIPKTSDSAVGAPA"
FT   gene            244866..246131
FT                   /locus_tag="LEUM_0289"
FT                   /note="LactoCOG number LaCOG01566"
FT   CDS_pept        244866..246131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0289"
FT                   /product="beta-fructofuranosidase"
FT                   /EC_number="3.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61416"
FT                   /db_xref="GOA:Q03ZF6"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR006232"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZF6"
FT                   /protein_id="ABJ61416.1"
FT                   /translation="MFIKDDINHFEKYHLYPTQGLLNDPNGLIYFKGQYHVFFQWNPHA
FT                   CNHKYKEWGHFVSNDLKTWTRLETALKPSLPDMDSAGIYSGTAFVKDDKLYVFYTGNVR
FT                   DESGRSVASHQMWAVSEDGIHFEKLGELFPHPEGFTKDVRDPKVWQGRNGRYYLMVGAR
FT                   SNENIGDILIYESENFSQWQLHGSLIEGELTDIRGYMIECPDLIEIDGKQILMFSPQGL
FT                   PADEENYRYQNIHNTGYVVGTFDEETLHFKPETSFKEVDKGFEFYAPQTMHTNEGRKIM
FT                   WGWAGMMTPEREASTPTIASNNWVHVLTIPRELHVTSDNLLTQTPISEILHTKPLTNFG
FT                   AINVGQYTIDSHDNWTLSFGENMTLVRNKNQLILSRRQWENGEIEKRLVVGDINHTLLI
FT                   VDTDIIEVFTNNNQSVMTARYF"
FT   gene            246232..247098
FT                   /locus_tag="LEUM_0290"
FT                   /note="LactoCOG number LaCOG00968"
FT   CDS_pept        246232..247098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0290"
FT                   /product="branched chain amino acid:
FT                   2-keto-4-methylthiobutyrate aminotransferase /
FT                   fructokinase"
FT                   /EC_number="2.6.1.-"
FT                   /EC_number="2.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61417"
FT                   /db_xref="GOA:Q03ZF5"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZF5"
FT                   /protein_id="ABJ61417.1"
FT                   /translation="MGLLGAIEAGGTKFVVAVADHDYNIVERTSFPTLDGQKTVEQVIA
FT                   FFDKFDDIDAIGIAAFGPIDIVEGSTTYGHVLDTPKRGWSGYDFLGAMKDWRDIPYYWT
FT                   TDVNGAGWAEFETGAAKDVNNMVYLTVGTGVGAGIVSGGKLVAGYGHPEAGHIFLQKHP
FT                   LDKYEGHCPFHGDNCLEGLAAGPAIEERWGRSAKEIPDDDVAWKIEAFYLAQAALDYTM
FT                   ILRPEKIVFGGGVPHREILFPLIRESFAEQMSDYLAVPDLDEYIVPVANGDNAGILGCF
FT                   YLAKTLL"
FT   gene            247526..247601
FT                   /locus_tag="LEUM_t0291"
FT                   /note="tRNA_Lys_CTT"
FT   tRNA            247526..247601
FT                   /locus_tag="LEUM_t0291"
FT                   /product="tRNA-Lys"
FT   gene            247666..248439
FT                   /locus_tag="LEUM_0292"
FT                   /note="LactoCOG number LaCOG00659"
FT   CDS_pept        247666..248439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0292"
FT                   /product="D-Ala-D-Ala carboxypeptidase, Metallo peptidase,
FT                   MEROPS family M15B"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61418"
FT                   /db_xref="GOA:Q03ZF4"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZF4"
FT                   /protein_id="ABJ61418.1"
FT                   /translation="MQRNVGKKLKKHLLLIVLVIMLIVVVVICFFNTKQPIKNTGKIAK
FT                   TSSVKKVDDLPKGVKTTDWNLVLVNKNHSYQTELNFTKVTVDSKQIDQRIAQALANFRS
FT                   AAQKAGYATTLVSGYRSIAYQTTVYNNSISQYESNGMSATEAKRLTESVIQVPGSSEHQ
FT                   TGQAVDLAGNDALAAYPSLEAGMDKFKSQQWLMKHAPEYGFILRYPSDSQSIKETGIDY
FT                   ESWHFRYVGVSNATYITNHHLTLEKYIQTLKKAGR"
FT   gene            248538..249185
FT                   /locus_tag="LEUM_0293"
FT                   /note="LactoCOG number LaCOG00338"
FT   CDS_pept        248538..249185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0293"
FT                   /product="Deoxynucleoside kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61419"
FT                   /db_xref="GOA:Q03ZF3"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZF3"
FT                   /protein_id="ABJ61419.1"
FT                   /translation="MIVLSGTIGAGKTSLTKMLAKHLDSQAFYESVDDNPILPLFYQNP
FT                   KKYGFLLQIYFLNKRLEQIKRAQVDAKNILDRSIFEDALLFQLTADLNRATQTEVDIYQ
FT                   SLVNNMMAEIPGSATSKDPDLLIHVRVSFDTMLARIKKRGRSFEQVEANPGLYDYYKEL
FT                   NSRYDDWFAAYDRSPKIQIDGDHFDFVENEESGAKVLDMIDAKLAQTGVLSF"
FT   gene            249255..250043
FT                   /locus_tag="LEUM_0294"
FT                   /note="LactoCOG number LaCOG01054"
FT   CDS_pept        249255..250043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0294"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61420"
FT                   /db_xref="GOA:Q03ZF2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZF2"
FT                   /protein_id="ABJ61420.1"
FT                   /translation="MNSWHRIVVKVGTSTIVNRDGQINYPVVNRLAQTLSSLQKSGHEI
FT                   LLVTSGAIGVALDQMNLEKRPQEIPQQQALAAIGQGYLMSLYNQSFAFYQQLIGQVLLT
FT                   YDVFDNKAMLENTMNAIEMMFSQHIIPIVNENDVIAVDELDHQHSFGDNDRLAAIVTRE
FT                   IGADGLIILSDVDALYTANPNIDEFAQAIDKVTKITDDIRMSATGSTSGLGTGGMSTKL
FT                   AAGEFVMKNGGKMVLINGNNPALILEVIAGKTVGTLFQGE"
FT   gene            250048..251289
FT                   /locus_tag="LEUM_0295"
FT                   /note="LactoCOG number LaCOG01053"
FT   CDS_pept        250048..251289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0295"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61421"
FT                   /db_xref="GOA:Q03ZF1"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZF1"
FT                   /protein_id="ABJ61421.1"
FT                   /translation="MNAVEEIGKRAKLVTSDVANLAVDIRNQILLDMSSALVANWQEIV
FT                   AANKKDLDAATQLSGPMRNRLTLDQKTIGGIAASLSAVAKLADPLAGPYDNWKNHTGFK
FT                   IVKKTVPLGVVAMIFEARPNVTVDAAALTFKSGNAVILRGGKEAIESNIILTNILRNVL
FT                   RKHNLNPDIIQLITDTTHDSVNTLLNLRDYVDVLIPRGSGQFIDFVVKNATVPVIETGA
FT                   GNTHIFVDESAKQDEAIRVIHNAKTQKPAVCNAAEKLLIHEAIAGEFLPKIVDDLLAAG
FT                   VELRGDQKARSIDSRVIGASAEDWDTEYNDLIMAIKIVHNNDEAITWINDHTTHHSETI
FT                   ISEDLNHVTDFMNTVDAAVVYQNVSSRFTDGFEFGFGAEIGISTQKLHARGPMGLSALT
FT                   TIKYEVFGEGQIRE"
FT   gene            complement(251369..252325)
FT                   /locus_tag="LEUM_0296"
FT                   /note="LactoCOG number LaCOG01922"
FT   CDS_pept        complement(251369..252325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0296"
FT                   /product="Inosine-uridine nucleoside N-ribohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61422"
FT                   /db_xref="GOA:Q03ZF0"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZF0"
FT                   /protein_id="ABJ61422.1"
FT                   /translation="MATKKMILDLDTGVDDALALAYAVADPNVDLIGIISSYGNTLVET
FT                   AAQNSLNLLHLLGADDVPVFIGASHSSTTNNFEVMPISQLIHGKNGVGEITLETSPRQI
FT                   ETQSAVDFLIESAHQYKENLIFIPTGPLTNLAAAIEKDNDVATLIGNTTLMGGALTVPG
FT                   NLTPFTEANIHQDPEAADFAFVHQQNLTMVGLDVTLRTLLTKKETAAWRTLGTLAGEKF
FT                   ADLMDFYIDAYANLNINKNGAALHDPLAVAVGIDPSYVTSIALAMRVTYDKESGDYGRT
FT                   IGDKEKLLVPTTTKAAVLVDSKRFVHDFQNLMLTVLQ"
FT   gene            252464..253474
FT                   /locus_tag="LEUM_0297"
FT                   /note="LactoCOG number LaCOG01083"
FT   CDS_pept        252464..253474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0297"
FT                   /product="Thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61423"
FT                   /db_xref="GOA:Q03ZE9"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZE9"
FT                   /protein_id="ABJ61423.1"
FT                   /translation="MTELYDVAIIGGGPVGMFTAFYAGLRDTKAVLVESLATLGGQVTS
FT                   LYPEKKILDVAGFTGIKGSALIDSLDEQMKLFPIDIKTSTTVTNVTKTNDLFTVTINNG
FT                   SSFQAKTIIITTGKGSFEPRKMQVSGVDQLVGQGIHYFVTNKHDFDNHDVAIAGGGDSA
FT                   IDMATMLNEFTHSTRIIHRRDQFRAMEQSVKQLSQSSVIKETPKKVSQIEKQSDGKLKI
FT                   TLAQVKNDQVTNDICVDDLIINYGFISENKIVHGWDIQPENEGQAFSVDQAMQTTIPGV
FT                   FAIGDASHYEGKADLIAVGFGEAPTAVNAAIRFFDPQRRGPGHSSSMVIQDGKLI"
FT   gene            complement(253521..254390)
FT                   /locus_tag="LEUM_0298"
FT                   /note="LactoCOG number LaCOG00097"
FT   CDS_pept        complement(253521..254390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0298"
FT                   /product="DNA-entry nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61424"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZE8"
FT                   /protein_id="ABJ61424.1"
FT                   /translation="MARKRTYRRKSKPQNKILSLLILVVVAGFYLWQNYESTNTSTETS
FT                   HPTVTAQSDQALLNLKWDGTLDGDIVHVNNNKATFTDDQMKETFPSQASKLNPVDGLSL
FT                   SALDSLGRSQQGNFVASKSAISKVTKRPDRIPYTVRPSGWFINDRYDGTKWVGGYHDNP
FT                   NVKLGNGMQALWNKSHIVGYQFFGLPTMVTENMITGTRVENAYPGQLVPENDIRNAIQN
FT                   NPTITVRAQVTPLYVGNERLARGVHYMAKSVEDNGKTLNLNYWIFNVQPGIQIDYATGE
FT                   ATVLDSAK"
FT   gene            complement(254466..255119)
FT                   /locus_tag="LEUM_0299"
FT                   /note="LactoCOG number LaCOG00036"
FT   CDS_pept        complement(254466..255119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0299"
FT                   /product="Predicted HD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61425"
FT                   /db_xref="GOA:Q03ZE7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZE7"
FT                   /protein_id="ABJ61425.1"
FT                   /translation="MDQLEMINRYMKDALTKDNTGHSIDHINRVLALANKILAHEKKAD
FT                   AFVVRAAALLHDVYDDKLYDSQEDILAAKNNMISFLLSIGVHPEMIEEITYIIDNMSWS
FT                   KSLEGTQELNINGQIVQDADRLEAMGAIAITRAITYGAVKNRVLYDPEIQPHLPQNKTD
FT                   YRNQKSTTINHFYEKLLLIQDKLNTDTARTISESRQQFMLSFLAQFKAEWELER"
FT   gene            255378..257486
FT                   /locus_tag="LEUM_0300"
FT                   /note="LactoCOG number LaCOG00547"
FT   CDS_pept        255378..257486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0300"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61426"
FT                   /db_xref="GOA:Q03ZE6"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZE6"
FT                   /protein_id="ABJ61426.1"
FT                   /translation="MSEPNNILFNTGNHTDSAVIYDKFSKAEQQFSVKKDKTFYITTPI
FT                   YYPSGKLQLGNTYTTVLADAAARYHRLLGEDVYFLTGTDEHGLKIQQKAEAAGISEIDF
FT                   LDGMAKQIKDLWKLMDISYDDFIRTTEDRHEKAVAKIFTQLLENGDIYKGEYEGWYSVS
FT                   DEEYFTESQLAEVYRDDAGKVIGGKAPSGHEVELVKEEAYFFKMSKYADWLLDYYKTHP
FT                   EFIQPEARMNEMINNFIAPGLEDLAVTRTSFDWGISVPGDEKHVIYVWIDALANYITAL
FT                   GYNSDDTTLFDKFWPANVQLVGKEIVRFHTIYWPIMLHALGLELPKSVVGHGWLVMKDG
FT                   KMSKSKGNVIYPEVLEERYGLDAVRYYLLRSMPFGNDGVFTPEDFVARVNYDLANDLGN
FT                   LLNRTVAMINKYVDGVIPELLTGKTSFDEDLVRTVEDAIVEYNKNFKELRTADALESVW
FT                   KIIRRANKYIDETQPWVLAKDENEKEVLSSVMAHLAGALRVTAVLLQPVLTQAPKKIFD
FT                   QLGLDYSDKGVAIAGLTFSKLPTGGHVVKKGEPIFPRQDVEEEVAFISGLVSKDTKGKG
FT                   RAVKEAAKEAAQVAPSKDLITYDDFDKVEILAAKITAGEIVAKSEKLLKFTLDDGSGKP
FT                   RQILSGIRKWYSDPAALVGKTVAIVANMKPRKMAGELSEGMILSAEKNDIVTVTILPDS
FT                   IEPGSGIE"
FT   gene            257595..258578
FT                   /locus_tag="LEUM_0301"
FT                   /note="LactoCOG number LaCOG01184"
FT   CDS_pept        257595..258578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0301"
FT                   /product="Biotin operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61427"
FT                   /db_xref="GOA:Q03ZE5"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZE5"
FT                   /protein_id="ABJ61427.1"
FT                   /translation="MSTADKLLALLVNTAGDWVSGEAIAQQLGITRTSIWKSVKKLESQ
FT                   GHLIESVRGQGYRYVEGAKISAVGIKKYLKSDVDLKVFDTIDSTNVYAREKLSSGEITK
FT                   NTVIVSESMSAGIGRLGRKFFSPKNTGMYVTFALPLPVETIVNPGRLTTSTAVAVSKMV
FT                   KEVFDIDIQFKWVNDLLYNNKKVGGILTEAITDFESQQFSSLAVGIGMNLATPDGGFPD
FT                   EISQKAGALTDEMAVSGNEVVGSLINHFFDMYQDYQDGHYIPQYRKKVVGVGQSVELKR
FT                   GQVNLTGIIREIDNDGCLVLDTKRGIERINSGEITKLLLPNNEYQG"
FT   gene            complement(258617..259186)
FT                   /locus_tag="LEUM_0302"
FT                   /note="LactoCOG number LaCOG00223"
FT   CDS_pept        complement(258617..259186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61428"
FT                   /db_xref="GOA:Q03ZE4"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZE4"
FT                   /protein_id="ABJ61428.1"
FT                   /translation="MYQQTNVSVSAQTICKIGIYFALLVLSAKVAIPIPFYDYISLQTA
FT                   FIFLVYPILGAKYGSWLTVLYLVSGLLGLPIFASGGGLGYIFKTTFGFLIAFTLMPFFA
FT                   AIIRKGNKLFSHHQFLNTLVSNYLCLIMVHLIGFAYKCFIIKFYIGNIINVTGILGFTS
FT                   LLDFLIDVGLIFFVTLVELQIIKRIH"
FT   gene            259358..259785
FT                   /pseudo
FT                   /locus_tag="LEUM_0303"
FT   gene            259775..260452
FT                   /locus_tag="LEUM_0304"
FT   CDS_pept        259775..260452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0304"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61429"
FT                   /db_xref="GOA:Q03ZE3"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZE3"
FT                   /protein_id="ABJ61429.1"
FT                   /translation="MKNKGYFITGTDTEIGKTFVTARLARYFNKHNQDIGVFKPLMSGT
FT                   RRENPCSDAYILKSGAKVLDGLEEINPFQWDEALAPALAQKRAKTDYSLDDVLKKYNVL
FT                   AQKHKGMLVEGAGGITVPYGDDFTVTDLACALNLPLIIVAPNKLGVINHIILTIEFAKN
FT                   HDLTIAGIIFNGVKHKGVVEDTNLTLLKEMTDVPIIGELPWITNQINAELPLEKYLDIN
FT                   LLM"
FT   gene            260650..261669
FT                   /locus_tag="LEUM_0305"
FT                   /note="LactoCOG number LaCOG02463"
FT   CDS_pept        260650..261669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0305"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61430"
FT                   /db_xref="GOA:Q03ZE2"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZE2"
FT                   /protein_id="ABJ61430.1"
FT                   /translation="MTVKIGINGFGRIGRLAFRRILELSDKASDIEVVAINDLTSPDML
FT                   AYLLKYDSIHGTLNAEVSSDDTGIVVNGKHYAVYSERNAADLKWVANDGVDYVLEATGF
FT                   YTSAEKSQAHLDAGAKKVLVSAPAGAVPTVVYGVNQDILTADDKIVSAGSCTTQSLAPI
FT                   ANVLEQEFGVKTGLMLTVHAYTASQSLQDGPKSAKFAKRQANRDAASNSLPHSSGAAKA
FT                   IGMVVPSLDGKLTGSAIRVPVPDGSITELTAVLKKDVTVEEVNAAMKKYESDSFGYNGD
FT                   GLVSTDIINDTHGTVFDPTQTEVVAGEGQQLVKVAAWYDNEYGFTSNMIRTLLHFATL"
FT   gene            261873..262682
FT                   /locus_tag="LEUM_0306"
FT                   /note="LactoCOG number LaCOG00676"
FT   CDS_pept        261873..262682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0306"
FT                   /product="Predicted phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61431"
FT                   /db_xref="GOA:Q03ZE1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR022302"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZE1"
FT                   /protein_id="ABJ61431.1"
FT                   /translation="MKVAFSSDNHFDLNKINVERAMRAQALYLLNKNVNVYVIAGDLFN
FT                   DFKQSLAFARNMQDLVKNKLTIRFLAGNHDMGKNVTYEELESDIDELYFHNKYIDLTDD
FT                   IRLIGNNGWYDYSFVGNDYTEEEIQSFKNSYWYDRRIKQPITDKERFDINLKQIKDQLL
FT                   AAGNKQTIVVSHFVPREDYIKRFPNGNTRLDIANAFLGSSKIGQAVDQSYTIATITGHL
FT                   HLHPAPLKFGNNVYYNAAVGYSTERVHEWSSDDFLTEWQKRLVVLEF"
FT   gene            262738..263265
FT                   /locus_tag="LEUM_0307"
FT                   /note="LactoCOG number LaCOG00376"
FT   CDS_pept        262738..263265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0307"
FT                   /product="3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl
FT                   carrier protein) dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61432"
FT                   /db_xref="GOA:Q03ZE0"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZE0"
FT                   /protein_id="ABJ61432.1"
FT                   /translation="MTIEINYDNILTIRYFDYQSILKKESIMPVLTTTEIMDLIPNRYP
FT                   ILYMDYVEEMVPDESIVAVKNVTINEQFFQGHFPGNPVMPGVLIIESLAQAASILILSS
FT                   PQFQGKTAYMTGIDNAKFKRMVKPGDVLKLHVTFGKLRANMGSVLVEAKVDGKTATSAE
FT                   LMFVVAPDEKDE"
FT   gene            263258..263716
FT                   /locus_tag="LEUM_0308"
FT                   /note="LactoCOG number LaCOG00476"
FT   CDS_pept        263258..263716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0308"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61433"
FT                   /db_xref="GOA:Q03ZD9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZD9"
FT                   /protein_id="ABJ61433.1"
FT                   /translation="MNEAITTDFEQINTELVGVFNNVMWIEEAALKRSYFSDITLKDMH
FT                   TIEAISMYDEKSASQVAKIIHLTPSSMTAAIDKLVEKGYVERRRSSKDRRVVRLGLTHK
FT                   GRVVYRAHQEFHRDLTHNLVKNMSPNDVSVVKQAIHNLVSYLAQIINH"
FT   gene            263728..264699
FT                   /locus_tag="LEUM_0309"
FT                   /note="LactoCOG number LaCOG00527"
FT   CDS_pept        263728..264699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0309"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61434"
FT                   /db_xref="GOA:Q03ZD8"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZD8"
FT                   /protein_id="ABJ61434.1"
FT                   /translation="MEQLKIVASARQIPDRQVTNQELSTMMETDDEWIYTRTGIHQRNV
FT                   VTTENTSDLASEVAKKILAKSGVSPDSIDFIIVSTMSPDSLSPSTAAIVQANIGATNAF
FT                   AFDLSAACSGFVYGLSVASSLLMSRYQRGLIIGAEVLSKLVDWKDRTTAVLFGDGAAGV
FT                   LVERTQDNVGLLGEELRTFGEKGDNLVAGRFANTNPFSENISPLDPYFHQNGREVYSFA
FT                   TREVPEALQAALETAQVTADDVDYYLLHQANARIVSSIAKRFGQPVSKFPTNMASNGNT
FT                   SAASIGILLDELIESNTIHAGQTIAFAGFGGGLTVGAQIWKI"
FT   gene            264775..265014
FT                   /locus_tag="LEUM_0310"
FT                   /note="LactoCOG number LaCOG00528"
FT   CDS_pept        264775..265014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0310"
FT                   /product="Acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61435"
FT                   /db_xref="GOA:Q03ZD7"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZD7"
FT                   /protein_id="ABJ61435.1"
FT                   /translation="MTDAEIFDKTKEILVDQFDLEEDEVSLTTDLTNDIDADSLDLFEV
FT                   LNRVEDDFDIKLAVAEDIKTVQDLVDKIKEQLAA"
FT   gene            265065..266030
FT                   /locus_tag="LEUM_0311"
FT                   /note="LactoCOG number LaCOG01185"
FT   CDS_pept        265065..266030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0311"
FT                   /product="Dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61436"
FT                   /db_xref="GOA:Q03ZD6"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZD6"
FT                   /protein_id="ABJ61436.1"
FT                   /translation="MTVKTMNPIFEKLGMKYPIVEGGMTWAGTGALAAAISEAGGLGFI
FT                   GTGYWHGDDVRKEIRRAKALTDKPFGVNVMLLSRHIREVFDVIIEEKVAVVATGAGDPS
FT                   PFLDELHAAGIIVMPVVPSVSLARMMEKKGVDAVIAEGMESGGHIGMLTTMTLVPQVAD
FT                   AVNIPVIAAGGIGDGRGVAAAFMLGAAGAQMGTRFLTATESEVHPNFKSKILKAKDIDT
FT                   IVTGNLLGNRARVLKNKMAKSFVKNEVNELQKEKPDAAAIEKLESGTLRRAVQEGDKEG
FT                   GAFMAGQISGLIKDEKPAADILSDIWAQATDLMGIENTTL"
FT   gene            266088..267026
FT                   /locus_tag="LEUM_0312"
FT                   /note="LactoCOG number LaCOG00529"
FT   CDS_pept        266088..267026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0312"
FT                   /product="[Acyl-carrier-protein] S-malonyltransferase"
FT                   /EC_number="2.3.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61437"
FT                   /db_xref="GOA:Q03ZD5"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZD5"
FT                   /protein_id="ABJ61437.1"
FT                   /translation="MKIGLLFSGQGAQQAGMGTDLYEALPEYKSTIDRASEVLGYDLSD
FT                   VMKNADKIAQTQYAQPAILSMSNAIVNALGSALQQPVAALGLSLGEYSALTAAGAMNFE
FT                   QAVAIIKDRGRYMQTVGDANPGKMAAIMGEDQKLIEAVLAQLQAKGKQVFPANYNTFAQ
FT                   LVIGGIAADVDEAKATLTAAGIKRTIDLPVSGAFHTPLLKDAAVQLSERLATEAFTDVN
FT                   YPVYSNTTSEPFIIADLHETLTKQIVSPTYFAQAMKKMLDAGVDTFIEVGPSDTLIKFA
FT                   KKIAPKDVKRYAIKDLKSFNEVKELLTAEEV"
FT   gene            267028..267759
FT                   /locus_tag="LEUM_0313"
FT                   /note="LactoCOG number LaCOG00530"
FT   CDS_pept        267028..267759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0313"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61438"
FT                   /db_xref="GOA:Q03ZD4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZD4"
FT                   /protein_id="ABJ61438.1"
FT                   /translation="MADFTDKTVLVTGSSRGIGLAIAKAFDAAGANVILHARSEISPET
FT                   LTEFKSEPKTLQFDIADAEAAEDSLKVLYKQENFSGIDILINNAGITKDQLAIAMTPAD
FT                   FAQVVNVNLNGTFNVTQPVFKKMIRQKHGAIINLASVVGLMGNMGQANYSASKAGLVGL
FT                   TKTLAKEGARRHIRVNAIAPGMIVSDMTGALPEKTQEEILKNIPLSRFGEASEIADVAL
FT                   FLAGNDYITGQTITVDGGLYI"
FT   gene            267882..269144
FT                   /locus_tag="LEUM_0314"
FT                   /note="LactoCOG number LaCOG00531"
FT   CDS_pept        267882..269144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0314"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61439"
FT                   /db_xref="GOA:Q03ZD3"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZD3"
FT                   /protein_id="ABJ61439.1"
FT                   /translation="MTRVVITGLGAVTPLGNDTQSFLDGIFNEKIGIKPITKFDASETG
FT                   ITVAGQVDGFDPAARVGKRDARKMDLFSQYAVDAADQALTNAGLKAEEGAEAPTTVADP
FT                   TRFGVILGNGIGGLTTIQDQVIKMHDKGPQRVSPLFVPESIPNMVSGNVSLRFGAKGIN
FT                   STIVTACASATNAIGEAFWRIQSGKADVMLTGGSEATVNEIGIAGFAALTALSKEEDPT
FT                   QASKPFDKNRHGFVLGEGSGILVIESLEHAQARGAHILAELVGYGASSDAYHMTSPSPD
FT                   GEGAARAIRDALNDANLEANQISYINAHGTATGANDSGEAHAIATVFGENTVPVSSTKG
FT                   MTGHLLGAAGAIEALISVGSLTRGELPVNVGLDEQDEDTKVVNLVDQENKHQAPEYVMS
FT                   ANYGFGGHNAVIVFKKWHEGV"
FT   gene            269148..269606
FT                   /locus_tag="LEUM_0315"
FT                   /note="LactoCOG number LaCOG00532"
FT   CDS_pept        269148..269606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0315"
FT                   /product="biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61440"
FT                   /db_xref="GOA:Q03ZD2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZD2"
FT                   /protein_id="ABJ61440.1"
FT                   /translation="MSLNIEEIRGLIADLENSSLREFKVVDGEFSLHLSKNKNEAVVNA
FT                   PVQTPVVAPAAVTSDQAQVAAEPETLKTGTEIVAPMVGTVYLQPKPDAPMFKQVGDKVS
FT                   VGETVAVIEAMKLMTEIHSEVSGTVAEILVANEEVVDYNKPLYRITTD"
FT   gene            269813..270118
FT                   /locus_tag="LEUM_0316"
FT                   /note="LactoCOG number LaCOG00376"
FT   CDS_pept        269813..270118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0316"
FT                   /product="3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl
FT                   carrier protein) dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61441"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZD1"
FT                   /protein_id="ABJ61441.1"
FT                   /translation="MKKFSKAISLGNPTFPGALTVEALAQTGAVALLSMPEFKGKTAYF
FT                   GGIKKARYRRMVRPGDQLRLEVTLDRLRGPIGTGKGIVWVGDKKATTAELTFIIGD"
FT   gene            270120..271496
FT                   /locus_tag="LEUM_0317"
FT                   /note="LactoCOG number LaCOG00534"
FT   CDS_pept        270120..271496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0317"
FT                   /product="Biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61442"
FT                   /db_xref="GOA:Q03ZD0"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZD0"
FT                   /protein_id="ABJ61442.1"
FT                   /translation="MFKKVLVANRGEIAVRIIRTLREMGIASVAVYSTADKDSLHVQIA
FT                   DEAIAVGGVKPTDSYLNMKNILSAALLTGSEAIHPGYGFLSENALFAEMVGEVGIKWIG
FT                   PRPDTIELMGNKANAREEMRQAGVPVIPGSDGFIRDFSEAKVVADRIGYPLLLKAAAGG
FT                   GGKGMRFVYSEDELSDKFDDAQNEARLSVGDDQMYIEKVMEHVRHIEMQLLRDENGHVV
FT                   YLPERDCSLQRKNQKVLEESPAVGVTPEMRAYLGGIVTKAAQAIRYENTGTIEFLQDHE
FT                   GNFYFMEMNTRIQVEHPVTEMVTNLDLIRLQIEVAAGQDLPIKQDDIQVNGHSIEVRLT
FT                   AERPESNFAPSAGTVDLVFLPTGGPGVRIDSALFVGDKVQPFYDSMIGKLVAKADTREQ
FT                   AVQKIHRIVDETVVHGISTSLNFQKALLEDPHVQRGEFDTRYLETEFLPRWTESLSEDE
FT                   "
FT   gene            271553..272395
FT                   /locus_tag="LEUM_0318"
FT                   /note="LactoCOG number LaCOG00535"
FT   CDS_pept        271553..272395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0318"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61443"
FT                   /db_xref="GOA:Q03ZC9"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZC9"
FT                   /protein_id="ABJ61443.1"
FT                   /translation="MDLYNNKNSDTSKIKRDASVNDRIPDGLFLACPYCGAQMYNKQLG
FT                   KYRVCAKCNYGFRLQAWERVELLTKNFEEMDSDIQMDHPEFPGYAEKLKRAQSQTELAE
FT                   SVLTGTADIEGEQVALGIMDSYFMMGSLGSMTGEKITRLFEYATAHTLPVVLFTASGGA
FT                   RMQEGIDSLMQMAKVSAAVAAHQEAKLLYLVVLTDPTTGGVTASFAMQGDVTLAEPHAL
FT                   VGFAGARVIESTIHEKLPKDFQRVETLLENGFVDQIVPRSELAQLIAKIVRLHTAEAE"
FT   gene            272396..273199
FT                   /locus_tag="LEUM_0319"
FT                   /note="LactoCOG number LaCOG00536"
FT   CDS_pept        272396..273199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0319"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61444"
FT                   /db_xref="GOA:Q03ZC8"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZC8"
FT                   /protein_id="ABJ61444.1"
FT                   /translation="MPDILSGLKLFKRELTPAQVVKKSREDRFMAREIIDGIFADFVEL
FT                   HGDRLGGDDMSIIGGIAFLADRPVTVIVVDKGTDIHDKLSKRNGSPEPWGYRKAQRLMQ
FT                   QANRFNRPIIMFVNTPGAFPGKEAEAQGQGEAIAKSILDSMKLTVPMISIIYGEGGSGG
FT                   ALALATADQVWMFQNATYSILSPEGFASILWKDSKRSEEAAAVMGLTAKDLLEKNVIEY
FT                   IIPESRNHPRVFNLIRKRLNDEIHTLNQLTPDELLTKRRNRFRAF"
FT   gene            273252..273609
FT                   /locus_tag="LEUM_s0320"
FT   tmRNA           273252..273609
FT                   /locus_tag="LEUM_s0320"
FT   gene            273696..274196
FT                   /locus_tag="LEUM_0321"
FT   CDS_pept        273696..274196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61445"
FT                   /db_xref="InterPro:IPR011235"
FT                   /db_xref="InterPro:IPR038231"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZC7"
FT                   /protein_id="ABJ61445.1"
FT                   /translation="MESLNLIEGVVARMYQCDVTRVSEESQNNEYEGTTLFVGNKSLRI
FT                   RLAKKTPTKQGYFVVLWEKDDRGQNKPFDAYNSPELLVVCVIDNQQKGVFIFPKVLLVQ
FT                   QKILSSQQTKGKMAFRVYPDWVVELNKTAQQTQTWQKNYFVDLSTDQVDEDRFKRLLSK
FT                   SNC"
FT   misc_binding    274286..274487
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="T-box leader, riboswitch"
FT   gene            274513..277197
FT                   /locus_tag="LEUM_0322"
FT                   /note="LactoCOG number LaCOG01463"
FT   CDS_pept        274513..277197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0322"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61446"
FT                   /db_xref="GOA:Q03ZC6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZC6"
FT                   /protein_id="ABJ61446.1"
FT                   /translation="MRDIDMSTKYDPTSVEAGRYDNWQSKKLFAPESNKEIQGNEPEPY
FT                   SIVIPPPNVTGKLHLGHAWDTTLQDMIIRQKRMQGFDTLWLPGMDHAGIATQAKVEQRL
FT                   RGEGVSRYDLGREKFVEQVWDWKNEYATTIKQQWGKMGLSLDFDRERFTLDEGLNKAVN
FT                   KVFIDLYNKGLIYRGEYIINWDPQARTALSDIEVIYQDDAGAFYHVKYPFTDGTTFDGK
FT                   DYIEIATTRPETMFGDVAVAVHPSDERYKDLIGKKVLVPLVGREIPIIADEYVEKDFGT
FT                   GMVKITPAHDPNDFQVGNRHDLERINTMTEDGHLNEFAGKYNGMDRFDARKAIAADLEA
FT                   GDYMLKVDPIVHSVGHSERTGVQVESRLSTQWFVKMEPLAKQILDMQKNDDEKVEFVPA
FT                   RFEDTFSRWMENIRDWVISRQLWWGHQIPAWYKNKGTDQEELYVGTEAPAGDGWERDPD
FT                   VLDTWFSSALWPFSTMGWPEKLDGDFARYYPTNTLVTGYDIIFFWVARMMFQGKEFTGQ
FT                   RPFKNVLIHGLIRDGEGRKMSKSLGNGVDPMDVIEKYGADALRWFLVTGSTPGQDLRFT
FT                   YEKMDSAWNFINKIWNASRYVIMNLDEDTPSTLPDMSQLTLADQWILSRLNTVVTNVTR
FT                   NFDKFEFGEAGRELYNFIWSDFADWYIEMTKETLNGDQDKAPVQQTLAYVLDQTLRLLQ
FT                   PIMPFVTEAIWQEMPAQNGSEADFAIVKYPVVREELSNPDAEQAFKSLQDLIVAVRNIR
FT                   AEANAPMSTPIDLMIQTTDDNLKHIFEANADYINRFAHPKTLIISDDVQAPNLAMSQVI
FT                   SGAEIYVPLAELIDIDEEITRLQTEVKKFSGEVKRAEGKLGNDKFVSGAPEAVVAAEKE
FT                   KLADWQAKLNATEERLQTLKANQ"
FT   gene            277377..278345
FT                   /locus_tag="LEUM_0323"
FT                   /note="LactoCOG number LaCOG00527"
FT   CDS_pept        277377..278345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0323"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61447"
FT                   /db_xref="GOA:Q03ZC5"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZC5"
FT                   /protein_id="ABJ61447.1"
FT                   /translation="MSGSKILASAHYVPRDIVTNNDLAKIIDTSDEWIQAHTGIKTRHI
FT                   SLQGENTSDLATRAAESVLSQTDIKPEDIDLIIVTTFTPDGLAPSTAALVQRNLHAENA
FT                   WAYDIVTACSGFVFGLSTADKFIKSGQYKNALVISAEVNSKMMDFKDRTSTVFFGDGAG
FT                   AVLMTADDSGIVEAEKMHTIGNADVVHSGRIAPLTSLSVDNYPKIDAFSQQGRNVFDEV
FT                   TTIVPDHIRNFLSEHNLSTSDIDYFIPHQANLRLIEYIANDLGEPMTKFSTNVVTNGNT
FT                   SSAGIAIGLDELNKSVSLKGKRVLLTGFGAGFTYGSMLLQF"
FT   gene            278664..279974
FT                   /locus_tag="LEUM_0324"
FT                   /note="LactoCOG number LaCOG00356"
FT   CDS_pept        278664..279974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0324"
FT                   /product="Muramidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61448"
FT                   /db_xref="GOA:Q03ZC4"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZC4"
FT                   /protein_id="ABJ61448.1"
FT                   /translation="MGKFFKKTLLTTAAGAAAFVGGHAAASADTVEVQSGDTLSKIAAA
FT                   NNTTVDALAKANGISNKDLILAGSSLEINATQEVSGLSEDGTSYTVQSGDTLSKIAEKT
FT                   GVDVSVLSSLNSLSNTDLVLTGQELSLKASTTQATSSAATTVTAASAQSSSVDTSNLKY
FT                   IAAADTDSNNFMTLDEYNTYVANGGSTSSAATESSASSASASSATEDITYIAAADSDND
FT                   GYMTMAEYNAYKANGGSTSSSAQATTSTASSSASTSSASSSTSDNITYVAAADTNNDGY
FT                   MTMAEYNAYKANGGSTSSASSASSSTQTTTTNTTATATTTNVSTGSTTADATINAWNAK
FT                   RAELGLSPVTISASLTSQAQSRAQSIGTSSNWFSTHMSSGTAEVVANGFGAGSSVINAW
FT                   YYETGMVNGGHTAFIVNPNFTQAGVGYYNGWIVINAQ"
FT   gene            279934..280329
FT                   /locus_tag="LEUM_0325"
FT                   /note="LactoCOG number LaCOG00646"
FT   CDS_pept        279934..280329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0325"
FT                   /product="Cell wall-associated hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61449"
FT                   /db_xref="GOA:Q03ZC3"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZC3"
FT                   /protein_id="ABJ61449.1"
FT                   /translation="MAITTVGLLLTHNNMQNDYLKLALDNLGKTFNDYNSGRFVAQQLM
FT                   RAQVPLPEGSHWDASPAHLIKQMHHLLGVLQATPGDLLFWGTQNAPYEVGIYVGGNHFI
FT                   AVNNGDHVAKIQTLSRNWYPCIAGSIF"
FT   gene            280521..281639
FT                   /locus_tag="LEUM_0326"
FT                   /note="LactoCOG number LaCOG00356"
FT   CDS_pept        280521..281639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0326"
FT                   /product="Muramidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61450"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZC2"
FT                   /protein_id="ABJ61450.1"
FT                   /translation="MKKSTIAKSVVTAAGAFAVAGAAQVSANTVSVKAGDTLYKIASAN
FT                   GTTVDALVKANNISNANLIFVGQQLQTASSSSTTTQSSSSESSTTTTSSSNGSYTVKSG
FT                   DTLNKIAAANGTTVANLVATNNISNANLITVGQTLKLSASSTSSSTTTQSSTTTTQTTS
FT                   NNTATASNGSYTVKSGDTLNKIAAANGTTVANLVAANNISNANVITVGQTLKLSASSAS
FT                   TSSSSTATTSQSSSSTQSSSTSNNTASTSNTSNTSNSSSTSTTADATINAWNAKRATLG
FT                   LSPIKISASLTAQAQSRAQALATSSNWFGLHESSSTPEVVANGFAAGATVINAWYYETG
FT                   MVNGGHTEFIVNSSFTEAGVGYYDGWIVIDAH"
FT   gene            281715..282968
FT                   /locus_tag="LEUM_0327"
FT                   /note="LactoCOG number LaCOG02113"
FT   CDS_pept        281715..282968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0327"
FT                   /product="Peptidoglycan interpeptide bridge formation
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61451"
FT                   /db_xref="GOA:Q03ZC1"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZC1"
FT                   /protein_id="ABJ61451.1"
FT                   /translation="MLYKFTELTKEEYTEFEKQSSVGTFLQSGEQAELLQKRGYKIWLL
FT                   GIKADDKVVAAALVMREKVHMGYIFSIDRGPLLDFENHELLAFFMSNFVKFSRENKGLY
FT                   IEVRPNVTLKMTNNHGDLLGEENTVFIEEMKKLGFTHLPFVDGFTTAGSPEWEYIKDLS
FT                   ELTDEKSVRASYNKKAQYYLKKNAQFGIRLRQLTRDDLPDFKELTQKTADRLHYKDKNL
FT                   NFYQTVYDVYGDDATFVFAELNFDNYIKEENEKISELDAKLAKINQKIEKYPTNDKFKR
FT                   QYAEFDDQKNQHSKRILKAEQQKEAAGKSTVVVAGALFIQQPQEMNYLYSGTYEEYMDY
FT                   YGPYQIQDVMINKAVQAGLKRYNFYGIAGKFDGSDGVLGFKTTFEGQARQLVGNFMMPV
FT                   NPFKYGVYRLLKKMMGRA"
FT   gene            283049..285091
FT                   /locus_tag="LEUM_0328"
FT                   /note="LactoCOG number LaCOG00243"
FT   CDS_pept        283049..285091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0328"
FT                   /product="cell elongation-specific peptidoglycan
FT                   D,D-transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61452"
FT                   /db_xref="GOA:Q03ZC0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZC0"
FT                   /protein_id="ABJ61452.1"
FT                   /translation="MKHNPYLEERDNKNDARANLPTRLRILLFISFILMVALVVQLGFL
FT                   TIKQGANYLAEVNRSEETVEKGNTPRGLVYDSTGRVLAGNKAQTAITFTRGTNITSSTM
FT                   RSTAIKLGKYLTVDTTRLSDRSKADFYLADATNAAKVQKRVAKEHKNGSSLTTSEINSL
FT                   SVSYVEEHNLLSKVSDNDAMIFQRMSGAYSLSTTFIKEDDVTETELAEIGERLSQFPGI
FT                   KIGTSWARQYPEGNDFKALIGTVTSEDNGLPDDKLHTLLAQGYSQNESVGSSNLESSYE
FT                   SLLKGSASQTVVTTASDGTVKSSSVKYKGQSGDSLKLTINADFQKEVQKILEDNLPTGD
FT                   VQGAYATVMNPYTGGIYAMAGVDRDYSTGTKTADPLGNINHAIVMGSVVKPAVLATAFQ
FT                   KGVITPSNSTLLDQAIKIAGTPTITSYWNKTGTPVSVDAQTALERSSNTYFVQLGMKIG
FT                   GQTYSSGSALALNSDAFQTLRNGLGQFGLGTKTGIDVSGETAGYRGDTTGSNIGKYLYE
FT                   SFGQYDTYTTLQLARYVSTIANGGYLIQPHLVSSILQSSTNSSKKRTVWTATPNIQGQV
FT                   QLDSDEWKVIHEGMNRVANGTDTYNTGGTDIHKLEPHVYAKTGTAETTTNGHTTYTESI
FT                   VAYVPGQPMVMAMAIPGMNNYLDGTNGKIAAKIINAYWKYVQNKP"
FT   gene            285214..285480
FT                   /locus_tag="LEUM_0329"
FT                   /note="LactoCOG number LaCOG01894"
FT   CDS_pept        285214..285480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0329"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61453"
FT                   /db_xref="GOA:Q03ZB9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZB9"
FT                   /protein_id="ABJ61453.1"
FT                   /translation="MSLQNTLKAISNPVRRDILTLLKEGPQSAGSIADHFELSKATISS
FT                   HLAQLKQADLIREDKYKNFIYYELNLSVFEEATLWLKGFTNEK"
FT   gene            285470..286105
FT                   /locus_tag="LEUM_0330"
FT                   /note="LactoCOG number LaCOG02882"
FT   CDS_pept        285470..286105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0330"
FT                   /product="Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61454"
FT                   /db_xref="GOA:Q03ZB8"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="InterPro:IPR025962"
FT                   /db_xref="InterPro:IPR026272"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZB8"
FT                   /protein_id="ABJ61454.1"
FT                   /translation="MKNKKSFLPLIITLLPIFYGLILWTKLPVELPIHFNINGEVDRYA
FT                   NKVWLIIIWPIIATLLHLFLIIYRTKIVARSQNNKMHTIISWSIPLGNNILLSYIFAYG
FT                   LGNHINITSILLPTIGILFIALGNYMPKTQRNRFVGIRIPTALNNDINWFKTQRIGGLM
FT                   FVVGGFMMIGGGFLGMISEFWTIALMILPLVLITVVPIIYSIRSSHKA"
FT   gene            286311..288299
FT                   /locus_tag="LEUM_0331"
FT                   /note="LactoCOG number LaCOG00481"
FT   CDS_pept        286311..288299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0331"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61455"
FT                   /db_xref="GOA:Q03ZB7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZB7"
FT                   /protein_id="ABJ61455.1"
FT                   /translation="MSFLELKDIHKSYFLGKDEFPVLKGINLSFDKGEFVSILGESGGG
FT                   KSTLMNIIGGLDRNFSGDVLINGNRLDHKQEKKLDVYRRETIGYIFQSFNLINYQTNLE
FT                   NVETSLNMTTLSSAQRKQRAMELLEKVGLSEHVHKYPSQLSGGQKQRVAIARALAADPD
FT                   VMIADEPTGALDSVNTTEVLELLEQIAQEGKLVIVVTHSQAVANYGTRILHMADGKIDE
FT                   EKNLKDKFEAPSAPDRLTSRPLSTRSVWDMAFDHLKYKKLQNFLIILGSAIGVFSVILF
FT                   LGLGNGIKGYINNQVSSLANPNYPTVVKNTLDDDDASSNERVQARAQASTTNYSSIVFS
FT                   DNVIKKVSNVKNVAKTYQGYEFNGAVFKYGKAQSQAGTQVQTWSPIYADKVIKAGHKPS
FT                   GDNEIVIDKTFAQKANKNWKSLIGKNITYTYVAYNQNNQAVPVTSTMKIVGITDGGQAG
FT                   TVFATTFAAMKKDLAKANAMTEANYLTLKVNDTENVKSTVSAVNKIKDNGKQAVVAVSI
FT                   GSVLDTINTITSLASYVLAAIAGISLIVSAIMIIVTTYMSVSERTKEIGVLRALGARSK
FT                   DIRGLFTNEALLMGIISAVLGIVTAYLGQFAMNAALYGLIKFDIVQVSLGNVIFAVVIS
FT                   LVIALVASFVPSRRAANLNTIDALAAD"
FT   gene            288504..289664
FT                   /locus_tag="LEUM_0332"
FT                   /note="LactoCOG number LaCOG00320"
FT   CDS_pept        288504..289664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0332"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61456"
FT                   /db_xref="GOA:Q03ZB6"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZB6"
FT                   /protein_id="ABJ61456.1"
FT                   /translation="MDNNMSRMARQNQAPRPDDKQPRKPKRRHKKWRWIVSIIVILLII
FT                   GGVVISMLLSNIKESVDTMHRSANITKARDVNQVLKDGKPFSILVLGTDTGALARDRTG
FT                   LTDSMMLITVNPKSKTTTMLSIPRDIMVSIVGREDTFPQKLNAAFPIAGVGATMSTLQN
FT                   YLNVPIDFYALVNMGGLEKVIDQVGGVKVKSPLTFTYQPENDKSDVYKFYKNQEKYEYA
FT                   SDGKNFKTYTTMDGYAALSFSRMRYDDPEGDYGRQKRQRLVLKALVKKSASAKTLLNAK
FT                   FMKSISKNAETDLTYNNVTKIALSYMAATKNQKSDHLQGVGDMYNGVSYQMVKASEKQR
FT                   VTNLLRKSLNLGSKTTGTQFGSSVPVLSYGVAEYNLNVIGETLDAQ"
FT   gene            complement(289714..290115)
FT                   /locus_tag="LEUM_0333"
FT                   /note="LactoCOG number LaCOG03129"
FT   CDS_pept        complement(289714..290115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61457"
FT                   /db_xref="GOA:Q03ZB5"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZB5"
FT                   /protein_id="ABJ61457.1"
FT                   /translation="MKILLIALGALSFAIGTIAIWIPGLPTTGFYVLTAILWSKSSKKL
FT                   DSWLHNNKYYQKYVDEAVFDRQLSLKGRALIYLVTAAMMAIPFFKTDMVWLKWVLPLTS
FT                   LTQIISMESYYRGYLWRDGIPFTKAKTRE"
FT   gene            290175..291098
FT                   /locus_tag="LEUM_0334"
FT                   /note="LactoCOG number LaCOG01612"
FT   CDS_pept        290175..291098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0334"
FT                   /product="Exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61458"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZB4"
FT                   /protein_id="ABJ61458.1"
FT                   /translation="MSYLAIVDLGSNSARMVVEELHDDGTHTELIREKRDTRIAQNMGE
FT                   ELLLKETPILRTIEALKYFQSKYINFHPKVRAITTAAVRMAKNQTEFLDRVARETGIQF
FT                   QVLTGDQEAYYDYLGVISTLNVTEGVILDTGGASVELIAVDNRRSKEAVSLSFGAVTLS
FT                   EQYHLANNIMPNNLASASDYILSQYNTLQWLETQYQKPVILLGGANRSLARMARTRLGE
FT                   TEVSMIHGFEMPVDLVEQIFEEIRQMTRKEREKIAGLETSRADIIVSGLLPLLNLMRKI
FT                   NSPKVIFSESGVREGLIAETLAQQDE"
FT   gene            291091..292296
FT                   /locus_tag="LEUM_0335"
FT                   /note="LactoCOG number LaCOG01027"
FT   CDS_pept        291091..292296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0335"
FT                   /product="3-hydroxy-3-methylglutaryl-coenzyme A reductase"
FT                   /EC_number="1.1.1.34"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61459"
FT                   /db_xref="GOA:Q03ZB3"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004553"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZB3"
FT                   /protein_id="ABJ61459.1"
FT                   /translation="MSKKFYELTPDERLLALNLKEDIRLSFSSRQSPVNAQMVENYISD
FT                   FRMPMGVVHDILIDEQHFRVPMAIEEPSVIAAANNGAKMLSNGVHVIMADTAMIGQMLL
FT                   VDAAGVDEFINLHRDEIFAKAKQAKPSIYKRGGGLRDVRVRNISKTETSVDFIIDTKDA
FT                   MGANIVNTILEAELPLFEKFIPLGVILSNYATNQLVTVTGDVDFERIGGREVAQKIVAL
FT                   NHFSKNDPYRATTENKGLFNGISAVVLATGNDWRAVEASGHAYASRDGQYRGLVTWTIL
FT                   NGKLHGELTLPISVGTVGGAISAMPDAKQALSIIGDVNADTLRGVILSVGLAQNLAALK
FT                   SIASGGIQRGHMRMQYRALAMQVGAKTDEIAAVVSRLISLSHVDASVAKKILMEIRNEP
FT                   KN"
FT   gene            292280..293230
FT                   /locus_tag="LEUM_0336"
FT                   /note="LactoCOG number LaCOG01613"
FT   CDS_pept        292280..293230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61460"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZB2"
FT                   /protein_id="ABJ61460.1"
FT                   /translation="MNPKIKDLLDNVNGVYPGTVMTRVNGGETGELHIDQVSQEILGQR
FT                   LLIEIANKTESDFLLGNELLKMLLTLNGIAPQVFFALTFNDGKLDDQLIQIATRMHRTV
FT                   VHAITYRELAKQGITTSATVKAYFSGLNAELTPENGEVDDESLWRLLMILDALVFANTI
FT                   SDSSFVAELQQKYPLAYTAASSLIKPVMAADLKQARNIRHQMVSLFEGIDEVLTRWGKP
FT                   TVNAKEYVTLTSVLSKRQLDLPVNQVFTIYHSEMTDFQTQKTAYVGLSKNDNQNSFVVS
FT                   PPDNEADKPTFFKELYALKVSELFQKLALPYIERD"
FT   gene            293272..293976
FT                   /locus_tag="LEUM_0337"
FT                   /note="LactoCOG number LaCOG01614"
FT   CDS_pept        293272..293976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0337"
FT                   /product="NAD-dependent protein deacetylase, SIR2 family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61461"
FT                   /db_xref="GOA:Q03ZB1"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZB1"
FT                   /protein_id="ABJ61461.1"
FT                   /translation="MLVTAEIQKRFDNAKNIVFMTGAGVSTLSGIPDYRSKGGIYDGIS
FT                   LQPEYLLSATAFHNEPEKQYQFMIDNMYFPEAVPNVIHKKMAALTRQGKAKIITQNVDD
FT                   LHVKAASDPEKLIRFHGSLYDVYAPVDGQKSPYQDYLRAMRRADNALLRPRITFYEEMP
FT                   FDVKKSALWVRNADLIVIVGTSFKVYPFAGLLQYASPAVPVMSINFERIATPFDVDQIV
FT                   GDAGEFFSELKL"
FT   gene            294078..294995
FT                   /locus_tag="LEUM_0338"
FT                   /note="LactoCOG number LaCOG01052"
FT   CDS_pept        294078..294995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0338"
FT                   /product="Co/Zn/Cd efflux system component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61462"
FT                   /db_xref="GOA:Q03ZB0"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZB0"
FT                   /protein_id="ABJ61462.1"
FT                   /translation="MKKPMEQLKMKQMPYLIGISLNMIFVLSELVFAKLAHSTALFADA
FT                   FHNLSDVLALMIAWLAVVVFGLQATKRHTYGWHNMSILASVFNTILLIFAVITIFYESI
FT                   RNLILPENTVTTGWLVMVVAAVGIVINFATAMLFKASGVPDEHGHHHEQDLNAKTAYIH
FT                   LLADAGVSVGVIIAGLLIQVTGWHVIDPIVSMIIGVIIAVTSWPVMKSTFNLALNGVPD
FT                   NVNESDVLRYLSTHEGVEQLHDLHIWPLSTTEAAMTVHLSVKKNVDEQELLANISSDLR
FT                   EKYDISHVTIQIETNEFDQSCNVI"
FT   gene            295370..296764
FT                   /locus_tag="LEUM_0339"
FT                   /note="LactoCOG number LaCOG00722"
FT   CDS_pept        295370..296764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0339"
FT                   /product="Mn2+ and Fe2+ transporter of the NRAMP family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61463"
FT                   /db_xref="GOA:Q03ZA9"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZA9"
FT                   /protein_id="ABJ61463.1"
FT                   /translation="MQDSTSVNPKHHLVQKTEDDLSLSDVNGSIEVPENGSFWRKLLAF
FT                   SGPGALVAVGYMDPGNWVTSVAGGAQYRYTLLSVVLISSLIAMMLQYMAGKLGIVKQED
FT                   LAQATRDRTNKVGGFVLWIMTELALIATDIAEVIGGAIALHLLFGWSMIASVLTTAFDV
FT                   ILLLLLMKFGFRKIEAIVMTLIITILVIFAYLVILSTPQLSALFGGYLPQLQTLSSHTP
FT                   IGGGDSQLTLTLGIIGATVMPHNLYLHSSISQTRKVDRSNKSELKEAVRFMTWDSNIQL
FT                   SLAFVINSLLLILGAALFFGHADKVGTFGSMYNALKDNSIAGAIASPILSTLFAVALLA
FT                   SGQNSTITGTLTGEIVMEGFLHLRIPMWLRRVVTRGLALIPVVAFTLIYGGSEGKLDDL
FT                   MVQSQVFLSIALPFTMAPLIYFTSSKKIMGEEFANPKWIATLGWIAFAVLTYLNVQLVV
FT                   QQLMGS"
FT   gene            296803..297270
FT                   /locus_tag="LEUM_0340"
FT                   /note="LactoCOG number LaCOG01954"
FT   CDS_pept        296803..297270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0340"
FT                   /product="nucleotide-binding protein, UspA family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61464"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZA8"
FT                   /protein_id="ABJ61464.1"
FT                   /translation="MSELNLNIEPTQFKNILVGVDESEQGYFALANAIHQASEDGATLT
FT                   IATILEMGDLSAIEALHLDFIKEKRAEFEANLVRYKEYALSKGATNVETVFEDGSKAGE
FT                   VLVQKIAPQVGADLIIVGAHSREGFWGSLGSQAAYIARHAKVSSMVARKEN"
FT   gene            297355..297699
FT                   /locus_tag="LEUM_0341"
FT                   /note="LactoCOG number LaCOG01051"
FT   CDS_pept        297355..297699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0341"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61465"
FT                   /db_xref="GOA:Q03ZA7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZA7"
FT                   /protein_id="ABJ61465.1"
FT                   /translation="MKKEAIIELEKIFKLLGNKQRLIILELLRERSYSVSEIINSLGME
FT                   QSAVSHQLKLLREAQLVETEKRGREVLYGLSDSHILILLDNALKHVSHTITGNVNDTTR
FT                   QVKKEKPKKG"
FT   gene            297748..297834
FT                   /locus_tag="LEUM_t0342"
FT                   /note="tRNA_Leu_CAA"
FT   tRNA            297748..297834
FT                   /locus_tag="LEUM_t0342"
FT                   /product="tRNA-Leu"
FT   gene            298091..299647
FT                   /locus_tag="LEUM_0343"
FT                   /note="LactoCOG number LaCOG00248"
FT   CDS_pept        298091..299647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0343"
FT                   /product="ABC-type oligopeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61466"
FT                   /db_xref="GOA:Q03ZA6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZA6"
FT                   /protein_id="ABJ61466.1"
FT                   /translation="MGNSGNSNDKTLRFSLPTPLNGLDSATITDEYSITVVGNAGEGLM
FT                   RADKNGKPQPALAKSVKSSSDGKTWTIKLRNGLKWSDGSKLTAKDVVYAWQRANDQKTA
FT                   SEYAYLYSGIKNADAIQAGKVDKKDLGIKASGNTLTVSLEKPMPQFKSLLTFPTFFPQK
FT                   QSFVEKYGKKYGTTTSKTLYNGPYTFKGWNGTNNKFKLVKNKYYWDAKNVKTPEIDLQV
FT                   VQKPEVAVQMYKTGKLDSALVNTPQLSQANKTNKGYRITPQATTVFLAYNQSGNVKALN
FT                   NKKIRQALNMVTNRSELNSQVLSGTSTPATSFTPKGLSTVNGTDFATYAKQDYTYNKSE
FT                   AQKLFKEGLSELGEKSITLEIEADTDRVANAKDVVNYLQGQWSKNLPGLKVTEKFVPFK
FT                   QRLQDGTDANFQVMLTQWGADYAEPTTFLDLASTGNANNYNHNSNADYDALWNKAKGAD
FT                   ATNDTKRAADEKGLEKIIHQEAILNPLYYQAQPELVNPNITGFYHHAVGVPLDFKLAAR
FT                   K"
FT   gene            299939..300886
FT                   /locus_tag="LEUM_0344"
FT                   /note="LactoCOG number LaCOG01607"
FT   CDS_pept        299939..300886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0344"
FT                   /product="Inosine-uridine nucleoside N-ribohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61467"
FT                   /db_xref="GOA:Q03ZA5"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZA5"
FT                   /protein_id="ABJ61467.1"
FT                   /translation="MTIPLIFDTDPGIDDAAAIAILLTNDDFEVRLITSVSGNVSVDKT
FT                   TNNVLKLTHYFNRPDVKVARGAEKPLVKPFKDASNIHGKSGMPGYEFGELSTRTISKKA
FT                   VDAIHETLNSYDDQTTLVAVGAFTNIANLIQKYPQDLQKIERLIVMGGSLTGGNLTSVA
FT                   EFNVFTDPDAAKIVFESDLDITMIGLDVTEKALLTKKSMSELLQMNETGKMLMGLFGHY
FT                   QDGSNAGGKPMHDVNTLYYLLHPEKYKLEDLWVDVVTDGPAIGATVADILHSTHSQTNV
FT                   HVAKDIDVPAFNAWYLLQISGISDGNINAGRLEN"
FT   gene            300963..301682
FT                   /locus_tag="LEUM_0345"
FT                   /note="LactoCOG number LaCOG00909"
FT   CDS_pept        300963..301682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0345"
FT                   /product="16S rRNA m(7)G-527 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61468"
FT                   /db_xref="GOA:Q03ZA4"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03ZA4"
FT                   /protein_id="ABJ61468.1"
FT                   /translation="MTNEDFIEALSSAGITLTTQQVRQFERYYELLVATNEHVNLTAIT
FT                   EKKDVYLKHFYDSLTVAMYEQKLKSSESTLIDIGTGAGFPSLPLKIAFPDLKITMVDAL
FT                   KKRVNFLQEVVDTLDLTGVEIVHGRAEDIGQNPKYRENFDYATARAVARTSVLAEYTLP
FT                   FVKIGGRFLVMKGSAAHQELLDGQKALAMLGGQVNEEFVFTLPNGDQRYIQIVDKKTKT
FT                   PKKYPRQAGTPSKKPIS"
FT   gene            301701..302462
FT                   /locus_tag="LEUM_0346"
FT                   /note="LactoCOG number LaCOG01736"
FT   CDS_pept        301701..302462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0346"
FT                   /product="chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61469"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZA3"
FT                   /protein_id="ABJ61469.1"
FT                   /translation="MAQIIVLANQKGGVGKTTTSINLGAALAQAGQRVLLVDIDAQGNA
FT                   TSGSGVDKSLLEHDSYDVIVEQTPLHEVIVATDNYDLVPATIQLSGAEIELAKQPQREY
FT                   RLKTALETVRDDYDFILIDNPPALGLMTVNAFTAADAILIPVQTEFYALEGLGQLLNTI
FT                   ELVRQQFNPDLDVAGILLTMYDGRTNLAKQVAQEVRSYFDDKVYDTIIPRSVRLSEAPS
FT                   YGQAIIDFDPRSVGAQMYNNLAQEVLKQYGK"
FT   gene            302452..303351
FT                   /locus_tag="LEUM_0347"
FT                   /note="LactoCOG number LaCOG00053"
FT   CDS_pept        302452..303351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0347"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61470"
FT                   /db_xref="GOA:Q03ZA2"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZA2"
FT                   /protein_id="ABJ61470.1"
FT                   /translation="MVSKKGGLGKGMNSLFGANNVSKEAVEHTKVVTKEQEATEQVVKL
FT                   PLKDIQPNPFQPRYHFDESKLKELSASITENGVLTPIIVRQIGQKFEIIAGERRVRASK
FT                   LSGLKSISAIVRHVDDDTMAALALIENLQRDDLDAIEEAQAFDALMTRLQMTQAEVAEK
FT                   VGKDRATVANLLRLLKLPESVQVLIQDGELSMGQARALLGLKKKPQIEKVAETVVFRGL
FT                   NVRQVENLVRQMNDGVPEPNTKEISPFAVSLSNQLEEKFGTKVKVNAGRKGNGKIEINY
FT                   VSNEDLSRILALLDIEVD"
FT   gene            303351..303560
FT                   /locus_tag="LEUM_0348"
FT                   /note="LactoCOG number LaCOG00005"
FT   CDS_pept        303351..303560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61471"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZA1"
FT                   /protein_id="ABJ61471.1"
FT                   /translation="MAIAPDYKLHDIVEMKKPHACGANSWEITRVGADIKLSCTNCGRG
FT                   IMMSRFDFNKRIKKILQVANQKEE"
FT   gene            303562..304662
FT                   /locus_tag="LEUM_0349"
FT                   /note="LactoCOG number LaCOG00007"
FT   CDS_pept        303562..304662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0349"
FT                   /product="Predicted GTPase, probable translation factor"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61472"
FT                   /db_xref="GOA:Q03ZA0"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q03ZA0"
FT                   /protein_id="ABJ61472.1"
FT                   /translation="MALTAGIVGLPNVGKSTLFNAITKAGAEMANYPFATIEPNVGMVE
FT                   VPDTRLARIQEVVPADKIIPTTFEFTDIAGIVKGASQGEGLGNKFLENIRQVNAIVHVV
FT                   RAFDGDEIIHVNGVVDPLDDIETINTELILADLEAVDKRYSKVARAAKGNDKNAKAEFV
FT                   VLEKIKPVLEAGKSARTITFTEEEQKIVKGLFLLTTKPILYVANLAEDDMADPMGSKYF
FT                   NQIKEFAATEGADVIGLSASAEEEIAQLPEEEKAEFLEMAGVEEAGLNKLIRAAYHLLD
FT                   LRTFFTAGGKETRAWTFTAGSKAPQAAGVIHSDFERGFIRAETIAFSDLDELGSVKAVK
FT                   EAGKLRSEGKEYVVQDGDIIEFRFNV"
FT   gene            304707..305405
FT                   /locus_tag="LEUM_0350"
FT                   /note="LactoCOG number LaCOG00129"
FT   CDS_pept        304707..305405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0350"
FT                   /product="Uncharacterized membrane-bound protein conserved
FT                   in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61473"
FT                   /db_xref="GOA:Q03Z99"
FT                   /db_xref="InterPro:IPR009214"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z99"
FT                   /protein_id="ABJ61473.1"
FT                   /translation="MSEQKRELTKKNQDFIFQFKKLLAQNSKLTGEQIEGIVTEVENNL
FT                   LETQGKGQTAAQIYGTPTMAVQQYLDPKRTAKKLFDYKFSTLALDTSLAIFMLFAVVFG
FT                   LTLFFSKNASNQGAGIVSLLLIAALGGSIYTGVVLKLTPNPKAKDKQEPTSRRWVYLLM
FT                   AVVAWLGGFLILGMLPQVINPTLPPVVYIILGAAAFGVFRWNRKKYGLTGGFFAISQLS
FT                   QQARLEASKK"
FT   gene            305442..306134
FT                   /locus_tag="LEUM_0351"
FT                   /note="LactoCOG number LaCOG02003"
FT   CDS_pept        305442..306134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0351"
FT                   /product="DNA-binding response regulator, OmpR family
FT                   (Rec-wHTH domains)"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61474"
FT                   /db_xref="GOA:Q03Z98"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z98"
FT                   /protein_id="ABJ61474.1"
FT                   /translation="MKILVVDDDIEIAELLEIYLKNEGYEPIMADDGKEALSKLNTNPD
FT                   IALMILDVMMPNMNGLDVVKTVRKDSRIPILMLSAKSGDMDKIQGLITGADDYVTKPFN
FT                   PLEVMARVRSLLRRAENAVQDQTPDVLDIGSLIINKDSHEVKTSTGDLVNLTALEFGIL
FT                   YLLASHPNRVFSADDIFERVWQQESVVSAKTVMVHVSHLRDKIEEATNGDQVIQTVWGV
FT                   GYKIEVNQ"
FT   gene            306131..307216
FT                   /locus_tag="LEUM_0352"
FT                   /note="LactoCOG number LaCOG02002"
FT   CDS_pept        306131..307216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0352"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61475"
FT                   /db_xref="GOA:Q03Z97"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z97"
FT                   /protein_id="ABJ61475.1"
FT                   /translation="MTKVALILKHNRTKIYYLVVTILLLLLFSWTIMTGFDALRHRFSF
FT                   ISFNIWNVLEFVTFVSGNIGIVFWQYLKWRRDESLYRLIREMRQVARENSDMTISWRAP
FT                   YAPTTQALIDVSNTIAENTRRIREEERQSERSKDEMITNISHDLRTPLTAIIGYLGLVE
FT                   MGQALSEKDRKKYIHTAYSKSNQMKVLVEDLFEYSQTQAQDAALNITSLSLNDLFGQLL
FT                   AGYELEAQEKNIALNQLTNPEMIVIEADSDKLARVLMNLVSNAFKYGDGATFIKLTAQI
FT                   DDKNVVIRVTNDGVKIPDEAIGDIFDRFYRVESSRNSKTGGTGLGLAIVKGIVVQHHGS
FT                   VAVESDDDMTSFIITLPLKQT"
FT   gene            307224..308558
FT                   /locus_tag="LEUM_0353"
FT                   /note="LactoCOG number LaCOG01530"
FT   CDS_pept        307224..308558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0353"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61476"
FT                   /db_xref="GOA:Q03Z96"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z96"
FT                   /protein_id="ABJ61476.1"
FT                   /translation="MLQNKKHQVKRIWFIITALVVVLLAIFFMVPRHEQSTQSTTKVAT
FT                   VDDQPVQLNTSATSALVVDLTTGQILGQKNSSKQVAIASQSKMLTAYGVLKSIKSGKIK
FT                   WSTMVPITSKADLSKEDSHLFSHIAIKAGDKVSVRELYDVMFANSANDAAFALGEFVTP
FT                   KGETTQQALESWAKELHLSGSQWYNSAGQVNENAFENEISSAPKTASNKASNQQLAMIA
FT                   RAILELDPSLRQLSKKLTISYHMTPNFVVTDKTDYWQLMTETMPNLSNPNQLTIEGLKT
FT                   GSSPESGAGFTGLIKDKNGHEFITVVNGIANYMDETKRYQESLRIVDQVLAQKQPNYIK
FT                   ENQTVGHLKTLTFPNTKQEHIIVKAAQTRHYWTNKGVKLAFTQPTFDSKLANIKKNQTV
FT                   GYTTAALNAQYLPYAQKTEKRISLKSTSSSKPVNWFVKFWRDRTK"
FT   gene            308693..309394
FT                   /locus_tag="LEUM_0354"
FT                   /note="LactoCOG number LaCOG01030"
FT   CDS_pept        308693..309394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0354"
FT                   /product="Glucosamine-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61477"
FT                   /db_xref="GOA:Q03Z95"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03Z95"
FT                   /protein_id="ABJ61477.1"
FT                   /translation="MNIIRVKDVEQSAEKALEIYQNAVQHGAKVLGLATGSTPIPLYQK
FT                   LATSQINFSELVSINLDEYLGLDGEDEQSYRYFMTKHLFQYKPFKHSYVPDGKSEDHEA
FT                   AIKAYDRIIVEHPIDLQLLGIGRNGHIGFNEPGTSFDSTTHIVNLTQSTVAANARFFEK
FT                   ESDVPTQAISMGIASVMSAKKILLIATGESKAEAVAATINGPITEDVPASILQKHSDVT
FT                   IIIDEAAASKL"
FT   gene            309442..310794
FT                   /locus_tag="LEUM_0355"
FT                   /note="LactoCOG number LaCOG01458"
FT   CDS_pept        309442..310794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0355"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61478"
FT                   /db_xref="GOA:Q03Z94"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03Z94"
FT                   /protein_id="ABJ61478.1"
FT                   /translation="MAHITFDTKNIENFVADHELDEMQPLIKMADEQLRNRSGAGAEYS
FT                   DWITLPTDYDKDEFARIQTAAQKIQSDSKVLVVIGIGGSYLGAKMAVDFLNPMFNNELA
FT                   DNQRQGVKIYFAGNSTSASYINDLVRVIGDQDFSVNVISKSGTTTEPSIAFRVFKQLLE
FT                   KKYGAEAAKQRIYATTDANRGALHDEAKISGYETFTIPDGVGGRFSVLTAVGLLPIAAS
FT                   GADIEALMTGARDAQEEYSDSDIKNNEAYKYAAVRRILYDKGYTTELLINWEPTMQYLS
FT                   EWWKQLMGESEGKNQKGIYPSSANFSTDLHSLGQYIQEGRRDLFETVVKLDNPVSNIDL
FT                   PHEDGNNDGLQYLEGVTIDEVNTKASQGVTLAHVDGGVPNLAVHLPAQDAYSLGYLIYF
FT                   FEIAVGASGYTFGINPFNQPGVEAYKTAMFALLGKPGYEEQTKVYRARLGK"
FT   gene            complement(310914..311528)
FT                   /locus_tag="LEUM_0356"
FT                   /note="LactoCOG number LaCOG00945"
FT   CDS_pept        complement(310914..311528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0356"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61479"
FT                   /db_xref="GOA:Q03Z93"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z93"
FT                   /protein_id="ABJ61479.1"
FT                   /translation="MSKIREPRYRKIAFQIAEKIVNNEYKVGSKLHARSTLSVTFGVSA
FT                   ETARKAINILSDLDIVKPIHGSGIEVLSRERAKYFLNQAQETTNIQTIHDQINDLIETQ
FT                   RTSLNSLSDSLTALFDQTQRVQRHNPLTPYEFSLSDSSKQLGESIGNLNIWQNTGATII
FT                   AILHNEELVVSPGPYAVIESGDTLYFVGTEMAFHAVQNFFQ"
FT   gene            311744..312937
FT                   /locus_tag="LEUM_0357"
FT                   /note="LactoCOG number LaCOG00944"
FT   CDS_pept        311744..312937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0357"
FT                   /product="ABC-type proline/glycine betaine transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61480"
FT                   /db_xref="GOA:Q03Z92"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z92"
FT                   /protein_id="ABJ61480.1"
FT                   /translation="MPKVEIKHLTKIFGKRPKAAMKMVKQNKSKNEIVEKTGSTVGVYD
FT                   INMSIEEGEIFVIMGLSGSGKSTLIRLLNRLIEPTAGQLFIDGQEITKLNKKQMIEIRR
FT                   KKMSMVFQNFALFPHRTLLENTEYGLEIQGVGKEERRKRAEQALENAKLLSFKDQYPHQ
FT                   LSGGMQQRVGLARALTNDPDILLMDEAFSALDPLVRGEMQDELLDLQANVEKTIIFITH
FT                   DLNEALRIGDHIAIMKDGRLQQIGTGEEILTNPANDYVKTFVGDVDRSKVLTADSIMIP
FT                   ALTSNIYVDGPTVALRKMTAEEVSGLVAVNRHRQLEGYLSSEEAVRARREKLPLADVLT
FT                   EMPKIKPDTLIMDIMPIIYDAQTPVAVVDDDNRLKGVVIRGAVLKALADTEGEDDNE"
FT   gene            312930..314645
FT                   /locus_tag="LEUM_0358"
FT                   /note="LactoCOG number LaCOG00943"
FT   CDS_pept        312930..314645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0358"
FT                   /product="ABC-type proline/glycine betaine transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61481"
FT                   /db_xref="GOA:Q03Z91"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z91"
FT                   /protein_id="ABJ61481.1"
FT                   /translation="MNNLVSIPKIPLEDWVSSAVSWLTTNLSGFFDAIQSGGQYIMDAL
FT                   TNGLTAVPMALMIIGITVIAIVTTPKKIGFPLFTLLGLLLIANQGLWSDLMNTVTLVIM
FT                   ASIVSLIIGIPLGILTAKSQKTAVVVQPILDFMQTMPGFVYLIPAVAFFGIGVVPGVFA
FT                   SIIFALPPMVRMTSLGIRQVPVDLVEAADSFGSTTWQKLFKLELPSAKNTILAGANQTI
FT                   MLALSMVVTASMIGAPGLGRGVLSAVQHADVGSGFVNGLGLVILAIVIDRFTQKFNTQP
FT                   GQKAVTKPWRRWTVLAALLVMIGGGVVNTLTSDKTTGQKVTIGYVEWDSEVASSNVLAE
FT                   SLRQHGYDVTLTPLDNAVLWQSLSNNQIDISVSAWLPDTHKALYDKYKNDVTLLGPNLK
FT                   GVKTGLVVPDYMDVNSISDLTTQANKTITGIEPGAGEMATAANALKSYSNLSGWNLSSS
FT                   SSGAMVSALDKAYKNKQDVVVTGWSPHWMFSKYHLKFLSDPKNVFGSGETINTIVNKKF
FT                   KTSNPKAYKVADNFNWTKDDMESVMLDIQNGQTPKQAAAKWIKSHQKLVDSWYK"
FT   gene            complement(314684..315163)
FT                   /locus_tag="LEUM_0359"
FT   CDS_pept        complement(314684..315163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61482"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z90"
FT                   /protein_id="ABJ61482.1"
FT                   /translation="MNNTPYFLTNPKWYKYEERQTSTGIPFQRFELTKHATPEAIASFK
FT                   QTMIAIGPDSSIDPNNLNRFQQALGYAERQHLFVEKNGLSEESWQREHELMTYAIRSYQ
FT                   LLSDDLVAPNTLIFKPRIAFLYKRFLKEHPTRIDDGDLCHFIVEQDKRMTIQNNK"
FT   gene            complement(315178..316398)
FT                   /locus_tag="LEUM_0360"
FT                   /note="LactoCOG number LaCOG01178"
FT   CDS_pept        complement(315178..316398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0360"
FT                   /product="ABC-type Na+ efflux pump, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61483"
FT                   /db_xref="GOA:Q03Z89"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z89"
FT                   /protein_id="ABJ61483.1"
FT                   /translation="MTNQLFIVIKDTFLSQFKSRGYWMLVISPLIFAALAGAVIFGITK
FT                   MQGNTTPNIAVVGNQEVRSILVQSEKELDIHVSNITNEKKANTALQNEKLDGVLTVNKN
FT                   EATITTQPKSEQIPKEKITAILGNLSRSQKATQYGLTAEQTADLVQPYNLKSVVKQAKQ
FT                   STNSGNTESANQLIASAIGIITIIIVMWYTSMIANAIANEKSSRIMEILLAATSARVQY
FT                   FGKIIGIFALVTTHLLIYVIAGFTTFNFFKENSFVKGLASNLNGVTLSFIIYAVIFVLV
FT                   SVALYLVLTSMIASLINDNAQVQQAIQPISMIAMVGYVFSFIMTQMPNNLLIRILSYIP
FT                   FASQSMMPIRLVTHTEGWPAAISALLIAVITLFLLLWFGQGIYARNVLSYSDEPIMKQL
FT                   AARLRHK"
FT   gene            complement(316391..317284)
FT                   /locus_tag="LEUM_0361"
FT                   /note="LactoCOG number LaCOG01179"
FT   CDS_pept        complement(316391..317284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0361"
FT                   /product="ABC-type uncharacterized transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61484"
FT                   /db_xref="GOA:Q03Z88"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z88"
FT                   /protein_id="ABJ61484.1"
FT                   /translation="MIQLTNLNKTFGQNIAVSNMNMTLTEGKVMGLIGQNGAGKTTTFR
FT                   MLLNFIKPTSGTITWNDQQITQNDKQRIGFLPEERGLYQKRTVEEQILYFAELHGMKRS
FT                   DARVALKDWMKRLDVVGKVSDKVQSLSKGNAQKVQMIASLIFEPSLLILDEPFSGLDPV
FT                   NTSLMMDEIIRLRDNGAMIIFSSHDMNNVTKISDDLTMLKRGKIVLQGPVQNIREQFGR
FT                   TRVYVESSTSSAALKAIDGVASVTPHGVGYDLILSEEEAGHRVFDLVTKNGYIPAFSQQ
FT                   PPTLDDIFRQEVAIHD"
FT   gene            complement(317296..317763)
FT                   /locus_tag="LEUM_0362"
FT   CDS_pept        complement(317296..317763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61485"
FT                   /db_xref="GOA:Q03Z87"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z87"
FT                   /protein_id="ABJ61485.1"
FT                   /translation="MINKLFASPKPGITDDEYRAKIKYQVNFLTIVIILTVTITMLLAS
FT                   LQKSPASRSFLRGFSSGILGGGIGTIITSRILFHNRKYLHKSKIKATDERLQEITHRAN
FT                   TITFIMLLIVSYIAICWATFYWDRRAAYLYLLIVLIYLFNSGVRYILNKIL"
FT   gene            complement(317756..317962)
FT                   /locus_tag="LEUM_0363"
FT                   /note="LactoCOG number LaCOG00232"
FT   CDS_pept        complement(317756..317962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0363"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61486"
FT                   /db_xref="GOA:Q03Z86"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z86"
FT                   /protein_id="ABJ61486.1"
FT                   /translation="MINRIQELRKSRKLTQAELAAELEVTRQTVISLEKGKYNASLFLA
FT                   HRIAEFFDLPIEDVFIFEGGKND"
FT   gene            318106..318321
FT                   /locus_tag="LEUM_0364"
FT                   /note="LactoCOG number LaCOG01978"
FT   CDS_pept        318106..318321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61487"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z85"
FT                   /protein_id="ABJ61487.1"
FT                   /translation="MADEKFETLDLPMSEVFSWSEDKTPLRDALWNHYMDTSNKNTLET
FT                   LKHLKAYESMSSDEVKLEAEKVLQEA"
FT   gene            318416..318487
FT                   /locus_tag="LEUM_t0365"
FT                   /note="tRNA_Glu_CTC"
FT   tRNA            318416..318487
FT                   /locus_tag="LEUM_t0365"
FT                   /product="tRNA-Glu"
FT   gene            318663..318968
FT                   /locus_tag="LEUM_0366"
FT   CDS_pept        318663..318968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61488"
FT                   /db_xref="GOA:Q03Z84"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z84"
FT                   /protein_id="ABJ61488.1"
FT                   /translation="MEFLGLVISLADELFDVDDNKPFGFKFWLSIFVWLIMLSGFIVVA
FT                   TVFIILFPAVFLKILNTIWLAVMGIEILLAWFCYYSGKRVVIWAFQIKNNIQAHSK"
FT   gene            complement(319399..319899)
FT                   /locus_tag="LEUM_0367"
FT                   /note="LactoCOG number LaCOG01375"
FT   CDS_pept        complement(319399..319899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0367"
FT                   /product="Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61489"
FT                   /db_xref="GOA:Q03Z83"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z83"
FT                   /protein_id="ABJ61489.1"
FT                   /translation="MLPISDTLLVIDFQNGVCKEPQDIFNIQECVTGINSRITAYRHAH
FT                   KPIIFIQHNDEELIFGSFLWKIIPEIDSQPNDYFIQKTHANSFYHTKLRKLLNENDVRS
FT                   IEICGAQTEFYVDTTIKMAHGLGYELQMKKGLSTTLDNYYMSAKQTVQFYENIWNDRFL
FT                   RLF"
FT   gene            320524..321270
FT                   /locus_tag="LEUM_0368"
FT                   /note="LactoCOG number LaCOG01165"
FT   CDS_pept        320524..321270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0368"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61490"
FT                   /db_xref="GOA:Q03Z82"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z82"
FT                   /protein_id="ABJ61490.1"
FT                   /translation="MNNFFQPHLIWEYLPDVLSALPTTLLLTLVSTIIGVIVGAGIAFV
FT                   KMEDTPIFKQIAVVFTSFIRGTPILIQMFLVYYGLPMFLGYVGINTDDVSPLIYLFITY
FT                   GLNMAAFLSEIIRAALESVPASQREAALTSGYTKRQMYFKIIFPQAVIIAVPSFATMVI
FT                   SLLQDTSLAFTIGVLDVVGKAKALGTATFHTVEAYISAMIIFIILSFILERFFRWIEKR
FT                   SNFTSRKTPILANNPVIPVIETPKTT"
FT   gene            321321..322148
FT                   /locus_tag="LEUM_0369"
FT                   /note="LactoCOG number LaCOG01165"
FT   CDS_pept        321321..322148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0369"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61491"
FT                   /db_xref="GOA:Q03Z81"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z81"
FT                   /protein_id="ABJ61491.1"
FT                   /translation="MQNKASRSKGLWIGIIVVVVAVIAVALLHNNGKSSGSSSKVQTIK
FT                   VGSGNDAQPFAYLDKSGKPVGMDIALIQAIDKKLPQYKFKLTLSDFPTLITNLKSGKTT
FT                   MAMEQIEQNTERKQDFKFGSVGYTVWDTLLATKKSTGVLNSFADAKGKKLYVTNSTNQA
FT                   TLTDAYLKKNPNAYSVVRGTYTMEQVAQGINSNQFNVYPAPKYSIDLLNRQFKTKLVYG
FT                   KAVNHSNAYPMFNKKADPKLVKAVNKAMEELKKDGTIKKLSNKWLKGDYVPKD"
FT   gene            322161..322865
FT                   /locus_tag="LEUM_0370"
FT                   /note="LactoCOG number LaCOG01165"
FT   CDS_pept        322161..322865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0370"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61492"
FT                   /db_xref="GOA:Q03Z80"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z80"
FT                   /protein_id="ABJ61492.1"
FT                   /translation="MNFDIGFIFQVVVKLIPYIPITIYMAFVSLILGGLLGLVIALVRH
FT                   YKVPVLSQLFTIMITILKGVPLILVFLLIFMVTSQNFNRVAKALGWHMHYGDLPMSLLA
FT                   IIGLSLMAMVGLSEAFRGAFESVKTVQFDAARSLGMTNLQTIRRVLIPQAFPVALPMII
FT                   NMLINLIKGTAIASLISVVEIFSTATQAASSNYKYFEAYIAAAIIYWLMTIVIERAAVL
FT                   LEGRMDKKTRRA"
FT   gene            322868..323605
FT                   /locus_tag="LEUM_0371"
FT                   /note="LactoCOG number LaCOG01193"
FT   CDS_pept        322868..323605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0371"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61493"
FT                   /db_xref="GOA:Q03Z79"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z79"
FT                   /protein_id="ABJ61493.1"
FT                   /translation="MIEVKDVHKSFNDNEVIKGVSLSLNEGEVVTILGPSGSGKTTFLR
FT                   CLNFLETADSGSITVNDEQVTFGQANANDILQLRRQMGMVFQNYALFLNKTAKQNIMEP
FT                   MVIVHGFSVKEAEVRAAELLEAVGLPDHGDYYPAQLSGGQKQRIGIARALAVHPAVLLF
FT                   DEPTAALDPELVGEVLKVMKGVKDAGVAMIVVTHEMQFAYEVSDRVIFMADGVIVEEGT
FT                   PQQIFETPKEERTKAFLNRFTVQ"
FT   gene            323638..324873
FT                   /locus_tag="LEUM_0372"
FT                   /note="LactoCOG number LaCOG02007"
FT   CDS_pept        323638..324873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0372"
FT                   /product="2-aminoadipate aminotransferase apoenzyme /
FT                   aromatic amino acid aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.39"
FT                   /EC_number="2.6.1.57"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61494"
FT                   /db_xref="GOA:Q03Z78"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z78"
FT                   /protein_id="ABJ61494.1"
FT                   /translation="MSEKRYEFATRVAGLLPNPLREQAKHVQEADDYIKLTYGYPSNQA
FT                   FPVEKLAKISEKIYRDHAFDFMQYGETEGIPRLRAQIKERLAKYQSLDVENNDVLITSG
FT                   STQGMDLVFKIFVNEGDIVLTEEQTFVGAVNAIKSYGGTVQGLPFDFSAGSIDTSALKA
FT                   TLEADTEHRIKVLYLIPTFQNPVGTSMPLEKRQEVYDICQAHEVMIYEDDPYGDLLYAE
FT                   KTAIPKIKSFDQTGNVIYAGSFSKILAPGSRLGYLLAPKDVFDKLVLMKQVADSFANLY
FT                   WQYLASQLIDDYDFNEHIDYLRQLYKEKMDTMISSLAQKSDDNMAFVVPDGGYFISVKL
FT                   NDDIETEAFYDELEQRHIGVIPGNIMSAAGSGYEQYFRLNFTLPTLSEIKIGIERISEA
FT                   AAAAKQTKSPVI"
FT   gene            324885..325856
FT                   /locus_tag="LEUM_0373"
FT                   /note="LactoCOG number LaCOG00403"
FT   CDS_pept        324885..325856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0373"
FT                   /product="Lactate dehydrogenase related 2-hydroxyacid
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61495"
FT                   /db_xref="GOA:Q03Z77"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z77"
FT                   /protein_id="ABJ61495.1"
FT                   /translation="MKILFFNVSAVEKNIIDEWADTQLISVKTLPVSIDYDNIDLTRNF
FT                   DAVIFYPGKSFQTDEKLYARLAENGMKQISVKSTGYDNINFEFAEKYHLTITNVPDYSP
FT                   ESVSHFTVMSVLMLLRNLPRYLDSPETTQRKEFMGRELTEVTVGIYGAGRLGSLVAKTL
FT                   KFMGARVMMNSRSLKPELIGSGIEFVDFKQLLVESDVLSIHVPLNKQTFHKFDFDNLSL
FT                   MKQNAILINTARGEIVDTSALITHLQQGKFQGLALDALEDEDTKGFATNPYYQSLHKFE
FT                   NVLLTPHIAYFTKAAVRDIAITALENARDIVIEGKSENTVVQ"
FT   gene            325867..326640
FT                   /locus_tag="LEUM_0374"
FT                   /note="LactoCOG number LaCOG01193"
FT   CDS_pept        325867..326640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0374"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61496"
FT                   /db_xref="GOA:Q03Z76"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z76"
FT                   /protein_id="ABJ61496.1"
FT                   /translation="MSFIEIKDVHKSFYQKEILKGIDLTLHKGEVIVILGPSGSGKTTF
FT                   LRCLNTLEKADKGQIKIDDVTKDFTVKDRQNTRDLILKTAMVFQGHALFDNMTVLQNVI
FT                   EGLIRVKKMDREAATKIGLSTLDRVGLSDRANYYPVQLSGGQQQRAGIARAMAMQPELL
FT                   LFDEPTSALDPELVGEVLSAMKELAQEGHTMIVVTHEMQFAYEVADRVLYMEGGVVVEQ
FT                   GPPEEIFNAPKDKRTQQFLARLSGKNFGEPELVNS"
FT   gene            326637..327872
FT                   /locus_tag="LEUM_0375"
FT                   /note="LactoCOG number LaCOG00095"
FT   CDS_pept        326637..327872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0375"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61497"
FT                   /db_xref="GOA:Q03Z75"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z75"
FT                   /protein_id="ABJ61497.1"
FT                   /translation="MMQNNQQSLDKVKGAVSTQSRDTDQRLFTKDFIILMMINFLVMTA
FT                   VTTQMGTLPLYVTHLGGNSIMSGLVVGIWGLAALCARIPVGKLLDTYGRKKLIFIGLAI
FT                   LMADFSMLIFYSTIASLIVLRALQGIGNGTQSTSVATMVADKLPKQKLSIGLGYFSISQ
FT                   TLPAAIGPAIGLVVVENFGFQSLFYFSLSLICLAFVLSFFVKDNYTHVEKSKHVVDENT
FT                   GFLDLIRLKSVWVPSLIVFVVCFANAAVTAFLVQFGEQKNLSATIVGFSFTMQAIIGAL
FT                   VRVWFAKLYLYFRSYVLVIAGILMIASAYFMIAFGATVEWLVLAGALNGFGFALLIPLM
FT                   NAVVLKNVSSAQRGRATAIFSSGTDVAYGLGAFMWGVVANFIGFFGMYCLTATMVIATL
FT                   LLVIAHNRLLNE"
FT   gene            328023..329243
FT                   /locus_tag="LEUM_0376"
FT                   /note="LactoCOG number LaCOG00093"
FT   CDS_pept        328023..329243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0376"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61498"
FT                   /db_xref="GOA:Q03Z74"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z74"
FT                   /protein_id="ABJ61498.1"
FT                   /translation="MANEKHPAVWYEHLHTEKYTGARRGRIHTPHGTFETPMFMPVGTQ
FT                   GAVKGVGTRELKDIGSQFILSNTYHLWVRPGDELIAEAGGLHKYMGWDQAILTDSGGFQ
FT                   VFSLSDARKLKEEGVTFQNHVNGDRMFLSPEVAMRIQNNLGSDVMMQLDEAIPYFETYD
FT                   YIKNSMQRSLRWAERAKVAHKKTDTQALFGIVQGAGFKALRTESANNLVDMDLPGYAVG
FT                   GLSVGESKAEMNRVLDFTMPLLPEDKPRYLMGVAAPDSLIDGVMRGVDMFDCVLPTRIG
FT                   RKGTLMTRYGRVVIRNSKYKNDFTPLDPDLSYYSPNPIRKEQFGNLAQYDIPGYNPFKT
FT                   LTRSYLHHLFNANELLGAQLASEHNLRFLLQFMEDMRTAIENDELLAFRETVMEEYGYN
FT                   KPNARLF"
FT   gene            329335..329697
FT                   /locus_tag="LEUM_0377"
FT                   /note="LactoCOG number LaCOG01437"
FT   CDS_pept        329335..329697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0377"
FT                   /product="protein translocase subunit yajC"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61499"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z73"
FT                   /protein_id="ABJ61499.1"
FT                   /translation="MSLNLILPLVIIVAMFWFMSRQQKKQREQQQNMQKSLQKGSKVVT
FT                   IGGLHAVVDSVDNAAKTVDLDAEGVILTYELSAIRSISNPVDTEKPTVADITPADKVEE
FT                   TSEKITDDAEKPADDK"
FT   gene            329755..330489
FT                   /locus_tag="LEUM_0378"
FT                   /note="LactoCOG number LaCOG00569"
FT   CDS_pept        329755..330489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0378"
FT                   /product="Alpha/beta superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61500"
FT                   /db_xref="GOA:Q03Z72"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z72"
FT                   /protein_id="ABJ61500.1"
FT                   /translation="MKTVTKVMSDGTKIVYDEYGNDQLKTVFLLHGNGSSAHYFKRQLP
FT                   SYTAYFHVIAIDSRGHGRSTNTKKSIDMADVIRDIDELRRELSIDKIIIVGYSDGANIA
FT                   LKYAVENQNHVSRMVLNAPNVTADGVYRILWWGDAIARFGTELFSPISQKARRRHMQLH
FT                   VMSEPLDITRAQLKVLTIPILFVIGQFDIVKRQHIESISKIMPVAKVMILRGHGHFVTY
FT                   TNPRKFAQLITPFLLGGKHEGH"
FT   gene            330476..333010
FT                   /locus_tag="LEUM_0379"
FT                   /note="LactoCOG number LaCOG01655"
FT   CDS_pept        330476..333010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0379"
FT                   /product="Lysyl-tRNA synthetase (class II)"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61501"
FT                   /db_xref="GOA:Q03Z71"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z71"
FT                   /protein_id="ABJ61501.1"
FT                   /translation="MKGINHVLSKLIILVITLVLITQLFIMTREITWHAILSTMNDIAW
FT                   WQMVLLLIAGFLVIMPMLFNDLILREWQGYGLTTSEMLQRAWLVNVFNLNAGFIGILSV
FT                   FLRRIFYNDQPKQKPIKPYIQMYILGQSGLLFATVVAFVILILDANKQLTEQLVWLALF
FT                   ILVAIIGIIVSFSKRINIWQSLNSTVVARFIINSVITLSAQVGLFILIGRIIDIDIGPS
FT                   EIILSFIISSAIALITMTPGTWGSFDVAIIIMLSFFDVARVDSFIWLILYRVSYNLFPL
FT                   LSAVALLFLRISKRINASFRGVPHYVAQSVVHQFLIIILYLSGMLLVLAGTMPKVAEQI
FT                   FVFNHLRSWPVTYTLINQLPNILFGFLILISARGIANRVQRAYGATIVVLLLVATYVFF
FT                   FYQYVAPLFFIAVILIAVLFSKKSLYRKQFIHSWEEQAVDFLIWATLIISYLALGVVNL
FT                   PPIHRHFRHVGNMPSMHWWYVGLIIISVVSVSGLALSKFLHSQQIPLGVGLDEARVNKV
FT                   LTIGDNHYTNLVFLGDKRLYFYRIDDEDVVGIQFRIINNKAMVMGDPFGNEKYFAAAME
FT                   QFVNEADVLGYMPVFYEISENIAMMAHEFGYDFFKLGEEALVILDDFSTAGKKMQNIRS
FT                   EMNQATRAGFKFKVLEPPFKHDVLQQMQLISDEWLAGREEKGYSLGFFDENYLQRGPIA
FT                   VLEKEGQIEAFATLVTSYTEQQMTVDLMRFTHAAPNGVMDVLFVNVFDYAKQRHFKIFN
FT                   LGMSPLANVGQHRQSFGRERLANLVYQFGSKVYSFEGLHHYKNKFTKVWQPMYIGYSRK
FT                   SSIIAVMFGLLKIDNKGVKHAPKSDMRYTRSN"
FT   gene            333068..333721
FT                   /locus_tag="LEUM_0380"
FT                   /note="LactoCOG number LaCOG01666"
FT   CDS_pept        333068..333721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0380"
FT                   /product="Predicted hydrolase of HD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61502"
FT                   /db_xref="GOA:Q03Z70"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z70"
FT                   /protein_id="ABJ61502.1"
FT                   /translation="MAMHQYFMGMSQLELINRAPGFFKYQPHSVAAHSWKVTQIAQFLA
FT                   DVEEQNGAQINWKSVYEKALNHDYTERFIGDIKTPVKYATSTLRSMLADVEESMTENFI
FT                   KTEIPEQFQAAYTRRLGEGKDDTIEGKILSISDKIDLLYEAYGELEKFNPEPVFVNIFQ
FT                   SSLEALAEFKDMASVKYLAKEILPEVFKEDFIHKDLLFDLAKSLLPDFAEVVNN"
FT   gene            333723..334217
FT                   /locus_tag="LEUM_0381"
FT                   /note="LactoCOG number LaCOG00103"
FT   CDS_pept        333723..334217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0381"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61503"
FT                   /db_xref="GOA:Q03Z69"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z69"
FT                   /protein_id="ABJ61503.1"
FT                   /translation="MEKNYIARMREKVGHEGMIFVSAFGVLWNDTHDAILLEKRWDSDE
FT                   GWGFPGGYLEYGDSPMQAVTREFKEETNLDVKVTRMLGIATNEVKKNSWGDAQETIGIG
FT                   FEVEHVGGEMLKDGTETLDLQFVPVHPEPKMFVPQAQKTMHLILTQNEISEQPWMREKN
FT                   E"
FT   gene            334214..334870
FT                   /locus_tag="LEUM_0382"
FT                   /note="LactoCOG number LaCOG00658"
FT   CDS_pept        334214..334870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0382"
FT                   /product="Phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61504"
FT                   /db_xref="GOA:Q03Z68"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z68"
FT                   /protein_id="ABJ61504.1"
FT                   /translation="MKLYVVRHGQTIFNTLNKVQGWADTPLTKKGEKDGQEAGKRLKNV
FT                   AFDVAFSSDTSRAMHTAEYILAENIHEHTKLQITPEWREYFFGSFEGGSNDVMWGAVAK
FT                   EFGVNKGTPDAIAAEVQDMTAIMNKIYEVDPEHLGENATRFWQRIDAALEKLLMTQKAN
FT                   ANVLLVTHGQLIGNLAQHYGHFLGAERPKNGAVAVFNLDDDGLQVELFNDVNTVF"
FT   gene            335069..336259
FT                   /locus_tag="LEUM_0383"
FT                   /note="LactoCOG number LaCOG01608"
FT   CDS_pept        335069..336259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0383"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61505"
FT                   /db_xref="GOA:Q03Z67"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z67"
FT                   /protein_id="ABJ61505.1"
FT                   /translation="MVKQDSLLTKIAFLGISFVLTSAYAINGALPQMTEALHISSTEAQ
FT                   VLATTPSITVTIFVLLSSFIAAKLGDKNTIILGVTLVGIAGMIPFFTDSYVIILASRTV
FT                   LGAGFGIFNSLAVSMIAVMYNGKTRSSMLGYRAAAEQVGQAVLTLLAGLLLAFGWHATF
FT                   LVYLIAFPILFLFIKRVPDTSEMTPLKTETTDSTQVEEVTRISPLVLVLTFFAAFLVID
FT                   YMAIQLSFPFMAADLKGDGYNTSPILSAMLIAATIGGVTYGWFMAKFGRFTLQIGLVLM
FT                   AISNFLVAFSNGNFGMLILGVLLIGFPLQLISPFIFNQLPKLAPLARQSLVTSIILIGF
FT                   NVGVFIEPIVVAAFAKMIGHGGGSAASSAYATIPYLGSVLLIIAIITVITNRKQEK"
FT   gene            336262..337740
FT                   /locus_tag="LEUM_0384"
FT                   /note="LactoCOG number LaCOG02237"
FT   CDS_pept        336262..337740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0384"
FT                   /product="Glycosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61506"
FT                   /db_xref="GOA:Q03Z66"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR016377"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022527"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z66"
FT                   /protein_id="ABJ61506.1"
FT                   /translation="MEIQNKAMLITYADSLGKNLKDVRKVLKEDIGDAIGGVHLLPFFP
FT                   STGDRGFAPSDYTRVDSAFGDWSDVEALGEEYYLMFDFMINHISRESVMYQDFKKNHDE
FT                   SKYKDFFIRWEKFWAKAGENRPTQADVDLIYKRKDKAPTQEITFDDGTTENLWNTFGDE
FT                   QIDIDVNSAIAKEFIKTTLEDMVKHGANLIRLDAFAYAVKKVDTNDFFVEPEIWDTLNE
FT                   VREILTPLKAEILPEIHEHYSIPKKINDHGYFTYDFALPMTTLYTLYSGKTNQLAKWLK
FT                   MSPMKQFTTLDTHDGIGVVDARDVLTDEEIDYASEELYKVGANVKKTYSSASYNNLDIY
FT                   QINSTYYSALGNDDAAYLLSRIFQVFAPGIPQIYYVGLLAGENDIELLESSKEGRNINR
FT                   HYYSVDEVKEEVKRPVVAKLLKLLSWRNNFAAFDLDGSIDVETPSDTTIKITRKDKSGE
FT                   NVAVLVANAADKTFTITANGEEILANTEADKQQL"
FT   gene            337936..339654
FT                   /locus_tag="LEUM_0385"
FT                   /note="LactoCOG number LaCOG00179"
FT   CDS_pept        337936..339654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0385"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61507"
FT                   /db_xref="GOA:Q03Z65"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z65"
FT                   /protein_id="ABJ61507.1"
FT                   /translation="MQILKEHAKPYARDIMFSIIAVVIMAVASLWQPRLLQQVMKAIIA
FT                   DDQNKVVAYGFQLLFLALIGLVAGVINTIFASKVSQAIAADIRAHEYKKIQSFSFGNIE
FT                   KFSAGNLVVRMTNDVNQVQQLIMMILQSLTRIPILFVGAFILALITLPRLWWIVILMVV
FT                   LIFVSSQVIFKQMGKFFSKIQTLIDKTNTLAKENLQGVRVVKSFNQEKNETNRFTDNSN
FT                   ELTRVNTTVGYLFSTMMPMFMLISYVAIGTAIWFVGRDVVKHPNDLVAIASFTSYLMQI
FT                   FFAIMIGGMMATFASRGFVSLRRIKEILDTTPDLTYAQDAPDRDLNGNISFKNVSFTYP
FT                   GDTKPALKNVSFDIEAGEMIGIVGATGSGKTTLAQLIPRLYDPTEGVVAVGGVDLKAVN
FT                   EKSLRAAVSFVLQKAILFSGTIAANLRQGKKDANEKDFQKAVEIAQAAEFVNRYEDNFD
FT                   HIVEERSANFSGGQKQRLSIARGVVGSPKILILDDSTSALDARSEKLVQEALDQELKGT
FT                   TTIVIAEKISSVIHANRILVMDEGKVVGIGAHHELLETSPVYAEIYQTQKAKGAE"
FT   gene            339654..341435
FT                   /locus_tag="LEUM_0386"
FT                   /note="LactoCOG number LaCOG00180"
FT   CDS_pept        339654..341435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0386"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61508"
FT                   /db_xref="GOA:Q03Z64"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z64"
FT                   /protein_id="ABJ61508.1"
FT                   /translation="MTDIKHAIKYFAKYLKRYWLALSFVVVVTIASTYFQVKAPVYMGK
FT                   AITELSTYLGQYLNPQTHAVASKTPFYHALEAMMIFFTLTAVTMFISSFISSRISSEAS
FT                   GRMRIGLFAKLQRMTIKYFDTHQDGEILSLFTSDLDNIFNAMNQAIFQLLSQFALFVGI
FT                   IIMMFQQNVKLAWVTMASTPVAIIVAWFVISRARKYIDTQQDETGRMNGYINEQINGEK
FT                   IIITQGLQQESIANFGPYNERVKQATFKGQMYSGMLFPLMQGLSLLNLAIVIFFGSWLI
FT                   VHDGMDKSVGLGLIVVFVNYSQQYYQPITQITSIYNMLQLAVTGARRLSDVHEQAEEVN
FT                   PESGQKLTNLKSGVTLENIHFGYNDDKEILHGVSIDVKKGEMIALVGPTGSGKTTVMNL
FT                   LNRFYDVTEGSVKFDGTDVRKLDLKSLRDHVGIVLQESVLFSGTVADNIKFGEPDATEE
FT                   EMIDAAKQANIHDFIMTLPEGYQTKVDDENSVFSTGQKQLLSIARTILTNPDFLILDEA
FT                   TSNVDTVTEAKIQAAMDNVIAGRTSFVIAHRLKTILGADKIVVLKDGRVIEKGSHQELV
FT                   AEGGFYSELYHNQMVFD"
FT   gene            341614..342840
FT                   /locus_tag="LEUM_0387"
FT                   /note="LactoCOG number LaCOG01442"
FT   CDS_pept        341614..342840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0387"
FT                   /product="1,2-diacylglycerol 3-glucosyltransferase"
FT                   /EC_number="2.4.1.157"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61509"
FT                   /db_xref="GOA:Q03Z63"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z63"
FT                   /protein_id="ABJ61509.1"
FT                   /translation="MNIGLFTDTYFPQVSGVATSIKTLKEALESQGHEVYIFTSTDPKV
FT                   PKNKFESHIYRFSSLPYLGFKDRRLAFRGLIQAVEIAKSVQLDIVHTQTEFSLGLMGKF
FT                   VARQLKIPAVHTYHTMYEDYTHYFAKGMLIGPHGVGRIMKGYMVSMAGVIAPSNLVQDT
FT                   LRRYGVTVPMRVIPTGVCLPEHGTKQTNLREKYHFSELQPIVLSLGRLAFEKNISVTIS
FT                   VFSEVLQTIPEARLVIAGDGPARKSLEEQVEELALEDKIIFTGMVNHDDIFDYYKMSNV
FT                   FVSSSDTETQGLTFIEAMAADRPFVAIHSPYLDNLVDNEAIGTLVSDYDELLAGITKYL
FT                   KRPNTEEDIAYRHKKMKDVDANTFATRVLAFYDDILASYHASDVEDEYPNDEEVGYMKR
FT                   ILRNPFRRN"
FT   gene            342841..343848
FT                   /locus_tag="LEUM_0388"
FT                   /note="LactoCOG number LaCOG01441"
FT   CDS_pept        342841..343848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0388"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61510"
FT                   /db_xref="GOA:Q03Z62"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z62"
FT                   /protein_id="ABJ61510.1"
FT                   /translation="MKVLLYFENQNLIAKSGIGRALKLQKEALSYTDVEVTTDTQSLDY
FT                   DVLHINTYGVNSHHMVNKAHKLGKKVVYHGHSTYEDFRNSFTGSNTIAPLFKRYLVSLY
FT                   SKSDAIITPTPYSKQLLRGYRLNQPIIPISNGIPLEKYQHDDDKIKKFREYFDLADDQK
FT                   VIMSVGLFFERKGILDFVELAKRHPEHVFIWFGYTDLRLVPNKISRLIKGNHPRNLIFP
FT                   GYITGDVIRGAFQGADLFLYPSYEETEGIVVLEALASKQKVLVRDIPVYKKWLQDGVNS
FT                   YKARDLDEFEIKMQKILTGESPNLSESGYKLAQTRDLPEIGKQLQAVYKMVLEG"
FT   gene            343858..344895
FT                   /locus_tag="LEUM_0389"
FT                   /note="LactoCOG number LaCOG01748"
FT   CDS_pept        343858..344895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0389"
FT                   /product="Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61511"
FT                   /db_xref="GOA:Q03Z61"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z61"
FT                   /protein_id="ABJ61511.1"
FT                   /translation="MFKRDRVSMIIVVVLTAIVVYFLTKELSGKGHQLSVALENLDWHW
FT                   LLFGLFTMIISIFLEAAATRALLSKEDRRHTSVLSLLRVPLLNLLGTGVTPFATGGQPA
FT                   QLYGLSRSGVETGRAMSVILMKFLVYQIVVVVFFIIGYVSAEHFIYQQVNPTFATFIPF
FT                   AIAIHAVVIIGIILVMFWPSLTLRLVDLVAIVVKKMMRRERFERLIANVKQKIDNFHTE
FT                   SRRVISSWQSLVGATFFTSLQLITFYMIPYFVIRAFGYQSVNPWLIVTMNIMIVMVISL
FT                   FPIPGGVGGAELSFQLLFSPFVKNPATLILVILLWRFITYYFGIFAGIIAYLIPAHHDR
FT                   RSDNA"
FT   gene            344888..345151
FT                   /locus_tag="LEUM_0390"
FT                   /note="LactoCOG number LaCOG01443"
FT   CDS_pept        344888..345151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61512"
FT                   /db_xref="InterPro:IPR014904"
FT                   /db_xref="InterPro:IPR038073"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z60"
FT                   /protein_id="ABJ61512.1"
FT                   /translation="MLDNKYNTSDLKQILCRLRAMIDSTDGSVQTRRFDAFGIEALQVT
FT                   YDQLTRIWTVQEHREIRQFQFDDIDLVAIEIYDVLHDFKLIY"
FT   gene            345266..347341
FT                   /locus_tag="LEUM_0391"
FT                   /note="LactoCOG number LaCOG00559"
FT   CDS_pept        345266..347341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0391"
FT                   /product="Phosphoglycerol transferase related protein,
FT                   alkaline phosphatase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61513"
FT                   /db_xref="GOA:Q03Z59"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z59"
FT                   /protein_id="ABJ61513.1"
FT                   /translation="MDTSAPIVWFFILNVVLVWLKTYAEYHMNFNLGVEGSTQQFLLFL
FT                   NPIPTAIIFLSISLYFRGVTSYWLAIIFNLIQSIWLFANMLYYREFSDFLSMGILGSGS
FT                   STGTNLGKSIAAIIHWTDYLVFIDIVILILLVVFKQLTIDHKGVQKKFAILTTLFGVIL
FT                   MLVDYGIASTDRSGLLTRSFDNNYIVKYLGLNEYAVFNAVQTYNQTESRKRAKPSDLAK
FT                   VKKFVATQKLPANIQYYGTQKGKNVFMIHLESFQQFLIDYKVDGQEVTPNLNQFYHDQN
FT                   TLSFDNFYNQVGQGKTSDAEMMQENSLYGLATGSAMVKYGTSNTFESLPAILGQRGYTT
FT                   AAFHGDVASFWNRDNTYKSFGYNYFFSKAYYANANKANYNIGYGMKDKIFLRDSAKYIE
FT                   QLPQPFYAKLITVTNHYPYDLDKQNISFPATKTGDKTVDGYVQTAHYLDQAFAELMSYL
FT                   KKAGLYDNSVFVLYGDHYGISENHQDAIAQLLGKDKITNNDLATFQKVPFMIHATGLKG
FT                   GIDHTYGGEIDMLPTLMDVLGIPDNNMTMFGQDMLSSKYDGKVVFRDGDWITPTYTKYN
FT                   NQYFNTTTGDQVTLKSDKKLQKVAKQMSAYATKVLGYSDAVITGDLLRFDTSNSDFNLI
FT                   NKKNYNYKKTEGLASLKKALKSNPSSVLAKNKGKSTLSDYVTDAPELKTDSDDDDK"
FT   gene            347458..349467
FT                   /locus_tag="LEUM_0392"
FT                   /note="LactoCOG number LaCOG00373"
FT   CDS_pept        347458..349467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0392"
FT                   /product="Excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61514"
FT                   /db_xref="GOA:Q03Z58"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z58"
FT                   /protein_id="ABJ61514.1"
FT                   /translation="MIERQIEHEFEIKSKYEPTGDQPKAIEKLVGGINNHVKEQILLGA
FT                   TGTGKTFTISNVIKEVKKPTLVLSHNKTLAGQLYGELKEFFPNNAVEYFVSYYDYYQPE
FT                   AYVPSSDTFIEKDSAVNDEIDKLRNSATSSLLERNDVIVVASVSSIFGLGDPHQYKDHV
FT                   ISLRVGYEYERDQLMRDLIDVQFTRNDIDFHRGTFRVRGDVIEIFPASQDEMALRIEFF
FT                   GDEIDRIREINSLTGETIAERDHVAIFPAKHFMTDDDQMQVALDGIRQEMNTQVELFKK
FT                   EGKLLEAQRIKQRTEYDLAMLEEMGFVGGIENYSRWMDGRQAGEPPFTLIDFFPDDFLI
FT                   VIDESHVTMPQIRGMFNGDKARKETLVNYGFRLPSALDNRPLKLPEFEKHVNQIIYMSA
FT                   TPGDYENERVDSKHVIQQIIRPTGLLDPEVEVRPVMGQIDDLVGEITKRSERDERVFIT
FT                   TLTKRMAEDLTDYLKDLGIKVAYLHADIKTLERTEIIRDLRLGKYDVLIGINLLREGID
FT                   VPEVSLVAILDADKEGFLRNPRSLIQTIGRAARNENGHVIMYADKMTRSMLEAIDETAR
FT                   RREIQMQYNTQHGITPKTIKKDIRDLISVTHAATEEKVVDLTKVAFNDLPKDEQQSIVD
FT                   NMTSQMKAAAKALDFEEAAQLRDTVMELKTRANL"
FT   gene            349499..352357
FT                   /locus_tag="LEUM_0393"
FT                   /note="LactoCOG number LaCOG01211"
FT   CDS_pept        349499..352357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0393"
FT                   /product="Excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61515"
FT                   /db_xref="GOA:Q03Z57"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z57"
FT                   /protein_id="ABJ61515.1"
FT                   /translation="MAKDHIEIRGARAHNLKNIDVNIPKNQLTVVTGLSGSGKSSLAFD
FT                   TLYAEGQRRYVESLSSYARQFLGQMDKPDVDSIDGLSPAISIDQKTTSNNPRSTVGTVT
FT                   EINDYFRLLYARVGRPDDPKDGTKIMYTIDQMVEYTLNNLPEGTRLQVFAPIIRGKRGS
FT                   HETAFDHMRKQGYIRARVDGDIIEIDSQQLSLNKNKPHDIDVMIDRIVLRGNSRSRLFD
FT                   SIEAAVRLNDGQVELDVVTRDDENPVAPLKFSDHYLGELKDFRAGRLEPRLFSFNAPLG
FT                   ACEFCQGLGVTREVDIDLVIPDDAKTLNEGAILPWNPISSNYYPEMLRQFAEQFAIDMD
FT                   TPFNKLPKKQQDLILNGSDEKDFHFHYKNDFGGVRDVDIPFEGVINNIARRFTETNSDF
FT                   TREQMTHYMTELKCKACGGYRLNKAALSVKINGKHIGEVSELPVDQELAFFNSVSLGQQ
FT                   DSEIASPIIKEIKDRLGFLQSVGLKYLTLSRSARTLSGGESQRIRLATQIGSNLSGVLY
FT                   VLDEPSIGLHQRDNDMLLESMHRMRDLGNTLVVVEHDEDTMRAADYLIDVGPGAGALGG
FT                   TIVASGTPAEVEANKSSLTGQYLSGKKFIAIPAKRRKGNGNWITVKGAKENNLKNITAK
FT                   IPLGKFVAVTGVSGSGKSTLVNTVLKRALKQKLNNNSEKPGAYRSIEGTENIEQIVDID
FT                   QSPIGRTPRSNPATYTGVFDDIRDLFSQTNEAKMRGYNKGRFSFNTKGGRCENCRGDGV
FT                   IKIEMNFLPDVYVACEVCGGTRYNSETLEVTYKGKNISQVLDMTASEALEFFTPIPKIA
FT                   KKLQTINDVGLGYVKLGQSATTLSGGEAQRMKLASELHRRTNGKTIYILDEPTTGLHTD
FT                   DIARLLEVLERLVDAGNTIVVIEHNLDVIKSADWIIDMGPEGGAGGGKVLVAGTPEKVM
FT                   KTAGSYTGKYLKEVIERDLSRA"
FT   gene            352455..353423
FT                   /locus_tag="LEUM_0394"
FT                   /note="LactoCOG number LaCOG00670"
FT   CDS_pept        352455..353423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61516"
FT                   /db_xref="GOA:Q03Z56"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z56"
FT                   /protein_id="ABJ61516.1"
FT                   /translation="MKPKIVIIGGGSGLPVIIKPLVKQEVDLSAIVTVADDGGSSGLLR
FT                   NYINIVPPGDIRNILVAMADTDAEFLKVMQYRFDAKDDFFAKHAVGNLIIAAMTEMHGN
FT                   IFDAVQYLANFMHVQGHIYPVSNEPLVLHAEFKNGNTVAGEAEITHAHQTIDHVWVTGD
FT                   EPGEEPKAAPEVVEAILSADLIVYGPGSLFTSILPNVVVPEVREALQLTKAKQVYIANI
FT                   MTQKGETDAYTDAQHLLALNAHIGMQAIDYVISNSEKVPDDFVDFQKWNEVSNQVKLDE
FT                   QAVVVQGATQISGDFLQLRDAGAFHDGQKITEELLKILEQC"
FT   gene            353424..354368
FT                   /locus_tag="LEUM_0395"
FT                   /note="LactoCOG number LaCOG00671"
FT   CDS_pept        353424..354368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61517"
FT                   /db_xref="GOA:Q03Z55"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03Z55"
FT                   /protein_id="ABJ61517.1"
FT                   /translation="MSYAADVKKELTGLIVHAGNAKAELAALMRMNGVSTLGFDQTIRV
FT                   QTENAAIARRIYTLLKETYVEVEVEVSVTDHNHLSQHKSYGVLLKTKIDEVLDDLGIDP
FT                   FGLHPEVPPRMLNQVDKRRSFLRGAFLAAGSVNSPERANYHLEIYTTHEELAEQLMIMM
FT                   QEFDLPSKISERGNGFIVYLKRAEKIVDFLQTIGATQSMLKFEDIRMMRDMRNSVNRLV
FT                   NAETANMQKTAIAANKQVSQINLIIDTLGSLDILPKKLRDIAKARLEYPDETLAELGEV
FT                   LDISKSGANHRMRKLTQLATMIEQGIDYDLTKL"
FT   gene            354456..355058
FT                   /locus_tag="LEUM_0396"
FT                   /note="LactoCOG number LaCOG00451"
FT   CDS_pept        354456..355058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0396"
FT                   /product="ATP-dependent Clp protease proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61518"
FT                   /db_xref="GOA:Q03Z54"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z54"
FT                   /protein_id="ABJ61518.1"
FT                   /translation="MWPGVIEQTANGRENYDLPSRLLKDRIILVQGEIEDSMATSIVAQ
FT                   LLFLEAQDPTKEISMYINSPGGSVTAGLSITDTMNFIKAPVTTIVMGLAASMGTIIAAS
FT                   GEKGHRFMLPNAEYLIHQPMGGAAGGTQQTDMAIIAEQLTKTRAKLNKILADASGKDLK
FT                   VIGRDTERDNWMSAEETLEYGFIDGILTKSGEKPATK"
FT   gene            complement(355130..355774)
FT                   /locus_tag="LEUM_0397"
FT                   /note="LactoCOG number LaCOG01627"
FT   CDS_pept        complement(355130..355774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0397"
FT                   /product="CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61519"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR017036"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z53"
FT                   /protein_id="ABJ61519.1"
FT                   /translation="MFQKSLVIPKSELTTVTENATIQEVYDIFNDPENAHTRTMPILDE
FT                   SGKLFRGNVYKQHVFEHVAKNGNMNLPATAIMRNSTKFIYTNSKFYEVFFAIRDLPFIA
FT                   VLDENHQFYGIFTHDALMDLLSQSWSVRSGGVAIAISTHNTQGDLSKISKIITRYSNIE
FT                   SLLTIQSELKPLTVLFTLPLQEDSEQLEKLIKRLEKKGYHVSSVENLNRFR"
FT   gene            355900..356466
FT                   /locus_tag="LEUM_0398"
FT                   /note="LactoCOG number LaCOG00008"
FT   CDS_pept        355900..356466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0398"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61520"
FT                   /db_xref="GOA:Q03Z52"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03Z52"
FT                   /protein_id="ABJ61520.1"
FT                   /translation="MKFIFGLGNIGAEYDQTRHNIGFMAVDAFATANHMSFSPSKQFAL
FT                   VAKTIIGGESVMLVKPTTYMNDSGKAVRAILDYYDGDVDDVLVLVDDMDLPFGKMRFRA
FT                   KGSAGGHNGLKSIMTHTGSQTFLRLKFGLGHPVHEQNVVVNYVLGKFTAAEKPDIDAML
FT                   DRSTQAIADWIQGATAPELSNRYNG"
FT   gene            356467..360006
FT                   /locus_tag="LEUM_0399"
FT                   /note="LactoCOG number LaCOG00009"
FT   CDS_pept        356467..360006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0399"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61521"
FT                   /db_xref="GOA:Q03Z51"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z51"
FT                   /protein_id="ABJ61521.1"
FT                   /translation="MTLIDFLSDTVTIKKLNEQATVGSAQLLLGVNGTARAASIAALYR
FT                   KNPRPMLIISDTQVHADQFFDDLSSLLEDLVYNFPAEESIATEMAISSSELRLQRVQTL
FT                   LALKTEKPIIVVTSLAGAERLVPKKQSLEQAHLHVKVGDAYNLNVIKNTLMMMGYTPTK
FT                   LVQTPGEFAHRGSIVDVYPITFDDPIRLDFFDDELDQLKSFDVATQKSTTSFDEINIEP
FT                   ATDFIVSEHQYDQAKLAIESAFSDYRTNLSGVDKKHATDGFAPTQYMLNERERGSVLVP
FT                   YAPFFFDGQTTLLDYFPTDSLIIIDEYTRLMETRLQQMTRDQEWIEQQIEAYQLLPKQT
FT                   WRTEITDLLASNQHATIYLANFQRGLNRIKFTNVEEVTTRPANQYYGQIPALKNDLIYA
FT                   QESGITMVLLIPDAKRRANFSRSLSELEVPVTETRDIVKNQVQIMPGELSAGFEWPKLH
FT                   LTVLTTHELFTQAKHSAPRTRKIANSERLKSYNELNVGDYVVHINHGIGRYEGLQTIEA
FT                   DGGKQDYLTIAYQQNAKIFIPVTQLNLIQKYVGASDVAKKPKLNKLGGSEWAKTKRQVA
FT                   AKIEDIADDLLELYAKREAQQGYVFPPDDHAQIKFDDSFGYPETPDQIRSIEEIKVDMQ
FT                   KLRPMDRLLVGDVGFGKTEVALRAVFKAAHSGKQVAFLAPTTILVQQHYETMLARFSDF
FT                   PEIKIGVLSRFQTPTQNKMIIEQLQNHEIDVVVGTHRLLSKDVDFSDLGLLIIDEEQRF
FT                   GVKHKERLKQLRTSVDVLTLTATPIPRTLNMAMVGARDLSVIETPPANRYPIQTYVLAM
FT                   DWKIVRDAIEKEITRNGQVFYLHNRVADLDRIVSQIEELIPSARVAAIHGQMSETQLES
FT                   ILYDFLNGQYDVLVTTTIIETGVDIPNANTLIVENADHMGLAQLYQLRGRVGRSTRLAY
FT                   AYFTYPFTRTPSEEAEKRLEAIRDFTELGSGFRIAMRDLSIRGAGDLLGKQQHGFIDSV
FT                   GYDMYTQMLKDTVAQKQGKQVTASQPETDAELILGVLAYLPDEYVSDNAQKIELYSRIR
FT                   QARTDAEFEDIESDMLDRFGEMPDEVARLLLVGQIKQLADQSQITNIRRQRKQLIMTFN
FT                   ETATKNLAGEAIFETMVDVPLKAAVRTEEGNLQVIFTVNDVAESSIWLNILRNFLLVII
FT                   NKLSAKTLNELHH"
FT   gene            360022..360303
FT                   /locus_tag="LEUM_0400"
FT                   /note="LactoCOG number LaCOG00010"
FT   CDS_pept        360022..360303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0400"
FT                   /product="Ribosome-associated heat shock protein implicated
FT                   in the recycling of the 50S subunit (S4 paralog)"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61522"
FT                   /db_xref="GOA:Q03Z50"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z50"
FT                   /protein_id="ABJ61522.1"
FT                   /translation="MRLDKYLKISRLIKRRTVAKEIADQGRISINGKVAKSSSDVSTND
FT                   ELEVRFGNKTLTVKVLKIVETTKKEESADMYEVISEKFQQDFRKIGDE"
FT   gene            360385..360783
FT                   /locus_tag="LEUM_0401"
FT                   /note="LactoCOG number LaCOG00011"
FT   CDS_pept        360385..360783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0401"
FT                   /product="Septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61523"
FT                   /db_xref="GOA:Q03Z49"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z49"
FT                   /protein_id="ABJ61523.1"
FT                   /translation="MAGNFKRRQSNITPLNPAIAREIKKSERANSEAAKHYRKAHARRE
FT                   KKILLFGGLIAIIFVVQLLIGQVKLHAANQELTNTQDRLEKVQKTNTDLTADTKRLKDA
FT                   TYLQQLLRDKYGYSKQGELVYNLPSDNN"
FT   gene            360814..362106
FT                   /locus_tag="LEUM_0402"
FT                   /note="LactoCOG number LaCOG00013"
FT   CDS_pept        360814..362106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0402"
FT                   /product="tRNA(Ile)-lysidine synthetase, MesJ"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61524"
FT                   /db_xref="GOA:Q03Z48"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z48"
FT                   /protein_id="ABJ61524.1"
FT                   /translation="MTEKILQTIQQYNWPETVIVAVSGGVDSVVLVHALSKTKANLVIA
FT                   HVNYRLREESDDDADFVRQLATQTGAIFEEQVWQHIPDHAVEKAARQFRYDFFEELAQK
FT                   YHTNTIAVAHHADDQAETVLLKMIRGGRLQQMGGMQTKNHKVIRPFLSITKQELITYAQ
FT                   DNHLGWRQDKTNFDVDYTPRNLLRNDVLPKLTTINQRAVRHINNMAAQILQQQRLIDNQ
FT                   AKIYANDIQDWQKIPTLWQLPTLKYWLQKNKLFNIKENQLQQMIQLLSNTHKPNGKIAL
FT                   ADNFEFIKTYQKISIQKQQNMAQVLTPVMLKLNQWHSFAKTTFMWTDNVPMNGQSFIKF
FT                   QLTRSLPYLSLRPAKASDKIALINGHKNLRRLAIDEKLTPQERTMMWVLATADDEVIAV
FT                   HLRSNQWRVNADFAVKENTQPYWLVCQIEET"
FT   gene            362107..362646
FT                   /locus_tag="LEUM_0403"
FT                   /note="LactoCOG number LaCOG00014"
FT   CDS_pept        362107..362646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0403"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61525"
FT                   /db_xref="GOA:Q03Z47"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z47"
FT                   /protein_id="ABJ61525.1"
FT                   /translation="MDNDIQEVLYDQESIQKAAERLGKQITQDYAGSTPLFLSVLKGAY
FT                   LWTADLLREVDLYAELEFIKISSYHGGVSSSDEITLVTDVRSDVRGRDVIILEDIVDTG
FT                   QSLLFLKELLAKRGAKSIKVATLLDKIEGRKVEVDADYAGFNVRNEFVVGYGLDYEEHY
FT                   RNLPYVGILKKEVYTK"
FT   gene            362674..364776
FT                   /locus_tag="LEUM_0404"
FT                   /note="LactoCOG number LaCOG00015"
FT   CDS_pept        362674..364776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0404"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61526"
FT                   /db_xref="GOA:Q03Z46"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03Z46"
FT                   /protein_id="ABJ61526.1"
FT                   /translation="MNNNKGGFLRSSVFYIFIFLAVVGMVYGLFGNDKTTTKTITSSEF
FT                   IKALNDKELKSVTVQPGNSIYNVTGTYKKAQTATKDKGLSLFQPTQKVTKFTSTLLPND
FT                   ASLKSVTDAATKTKTELVTKQAENSGFWLNLLVSLVPVLLIVAVFYLMMNQAGGGKGGQ
FT                   GGMMSFGKSKAKPSDPKDNKVRFADVAGAEEEKQELVEVVEFLKAPKKFVNLGARIPKG
FT                   VLLEGPPGTGKTLLAKAVAGEASVPFFSMSGSDFVEMFVGVGASRVRDLFENAKKSAPA
FT                   IIFIDEIDAVGRRRGTGMGGGNDEREQTLNQILIEMDGFEGSEGVIILASTNRSDVLDP
FT                   ALLRSGRFDRKILVGAPDVKGREAILNVHAKNKPLADNVDLKAIAQQTPGYVGADLENL
FT                   LNEAALLAARRNKSKVDAADIDEAEDRIFQGPAKTNHNMSESERRTTAYHEAGHALVGL
FT                   VRSEASVVRKVTIVPRGRIGGYALMTPKNDRYNLKYSEAKEQLAGLMGGRASEIFMFNE
FT                   ASSGASNDFQQATGLARQMVTAFGMSDKLGMVQLEGNASVGYADQAGNRAYSEETARLI
FT                   DEEVRRLAREAFDDAIAILRDNKDKLTAIAEALLEVETLDEKQIKDIYLTGTFTRKDIQ
FT                   DDTELAKAKSFEEAKAAADAKDSQAEQRFEKQDEEKSSDDHSESKNEDTDSTDKSETDD
FT                   NNTENK"
FT   gene            364885..365778
FT                   /locus_tag="LEUM_0405"
FT                   /note="LactoCOG number LaCOG01304"
FT   CDS_pept        364885..365778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0405"
FT                   /product="Disulfide bond chaperones of the HSP33 family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61527"
FT                   /db_xref="GOA:Q03Z45"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z45"
FT                   /protein_id="ABJ61527.1"
FT                   /translation="MADQFIKAITKNKYFRTFAVNGTNLVHQAAQIHETSRIAAVVLGR
FT                   GLLATTLTAQAVLKGEETLSTKINGRGPIGNVVVESDAKGSVRGYVTNPNLETLINEAG
FT                   QLDVAKAVGKNGFLQVTKFAPYSDPYIGQSQLVSGEIGDDFTYYLAQSEQTPSVIGVSV
FT                   YMNSDDTVAGAGGFLVQALPDATDEAIDQLELALKNMKPLSEMIQERYTPLEVLEEIFG
FT                   KGEVEILQTAGIGLAAEPSKDAYAKMLLTLPASEIQAMIKEDHGAEIVGKFSGKRYFFT
FT                   EEQLSEILKQIEKNNE"
FT   gene            365865..367352
FT                   /locus_tag="LEUM_0406"
FT                   /note="LactoCOG number LaCOG00271"
FT   CDS_pept        365865..367352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0406"
FT                   /product="Lysyl-tRNA synthetase (class II)"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61528"
FT                   /db_xref="GOA:Q03Z44"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03Z44"
FT                   /protein_id="ABJ61528.1"
FT                   /translation="MAEEKALNDQMLARRQKLATIVSDLHLDPFGKRFERTAKAQELHN
FT                   LYDASSLEELENAKHEVVIAGRMVAKRGAGKVIFADFRDVSGKIQVYARRDDLADNYPI
FT                   IKRADLGDFLGIKGIMMKTEAGELTVLATELTHLSKALRPMPDKFHGISDVETRYRKRY
FT                   LDLIANEDSFKKFQERSHIISAIRAYMDRNDFLEVETPILQTEAGGAAARPFITHHNAL
FT                   NIDMYMRIATELYLKRLVVGGMERVYEIGRIFRNEGMDPKHNPEFTTMESYAAYMDFTD
FT                   VMDETEGIFKAAASVVSDDLKITYQGTEIDLGTKFARKHLVDLIKEQTGIDFWQEMSVE
FT                   EAQKLADDNHVKYEKYWGVGHIINAFFEEFVEDTLVQPTFVYGHPVEVSPLAKKNTDDP
FT                   RFTDRFELFIMGSEYANAFTELNDPIDQRARFEAQAAERENGNDEAEGIDEDFIEALEY
FT                   GMPPTGGLGVGIDRLVMLLTDSDTIRDVVLFPTMRPE"
FT   gene            367415..367487
FT                   /locus_tag="LEUM_t0407"
FT                   /note="tRNA_Asn_GTT"
FT   tRNA            367415..367487
FT                   /locus_tag="LEUM_t0407"
FT                   /product="tRNA-Asn"
FT   gene            367594..367666
FT                   /locus_tag="LEUM_t0408"
FT                   /note="tRNA_Asn_GTT"
FT   tRNA            367594..367666
FT                   /locus_tag="LEUM_t0408"
FT                   /product="tRNA-Asn"
FT   gene            367671..367746
FT                   /locus_tag="LEUM_t0409"
FT                   /note="tRNA_Thr_CGT"
FT   tRNA            367671..367746
FT                   /locus_tag="LEUM_t0409"
FT                   /product="tRNA-Thr"
FT   gene            367822..368355
FT                   /locus_tag="LEUM_0410"
FT                   /note="LactoCOG number LaCOG00914"
FT   CDS_pept        367822..368355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0410"
FT                   /product="ribosomal large subunit pseudouridine synthase E"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61529"
FT                   /db_xref="GOA:Q03Z43"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z43"
FT                   /protein_id="ABJ61529.1"
FT                   /translation="MIVLFNKPYNVLTKFTDAEGRPTLADYIDIPRVYAAGRLDMDSEG
FT                   LLLLTDSGKLNHELTDPDNKAYKTYVVQVEGVPTKSQLKQLEQGVALKDGLTLPAKVKR
FT                   IPYPKWLWEREKPIRIRKNQPTSFIQLKIKEGRNRQVRRMTAAVGIPTLRLIRTHIGEY
FT                   HIADLKPGQYRIVK"
FT   gene            368426..369142
FT                   /locus_tag="LEUM_0411"
FT                   /note="LactoCOG number LaCOG00158"
FT   CDS_pept        368426..369142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61530"
FT                   /db_xref="GOA:Q03Z42"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z42"
FT                   /protein_id="ABJ61530.1"
FT                   /translation="MGRKWENIKMKKAQTDGAAAKVNSKYGIEIYAAAKQGGSPDPEAN
FT                   STLKFVIERAKQAQVPKHVIERAIEKAKGSGDETFIEGRYEGFGPNGSLIIVDTLTSNV
FT                   NRTATNVRTAFNKNGGTYGAAGSVSYLFDETGVIVFEGEDADATLETLLDAEVDVRDAE
FT                   QQDDHIVVYTEPTALHQAIAALRESGVSDFSTTEISMLPQSEMTLAGEDLEIFEKLIDV
FT                   LESDDDVQKVYHNVEL"
FT   gene            complement(369191..370138)
FT                   /locus_tag="LEUM_0412"
FT                   /note="LactoCOG number LaCOG01024"
FT   CDS_pept        complement(369191..370138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0412"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61531"
FT                   /db_xref="GOA:Q03Z41"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03Z41"
FT                   /protein_id="ABJ61531.1"
FT                   /translation="MNKKGLLLVNLGTPDSPHPDDVKAYLKEFLSDTNVIQMPRLLWQP
FT                   ILRGKILPKRSFKSAELYQKIWRKDGSPLMVYAKKQVEQVQQLQPNWIVRCAMTYRKPN
FT                   IAETLKEMRLAGADDIVVLPLFPQYSVTSTQSVIDQVRKADKNINIVKSFYNDEAYLDL
FT                   LARDIREAWAKNDYDRLIISYHGVPESYVRRGDPYVDHCTATTQGVLERVGPLTPDNTH
FT                   QVFQSRFGPTEWVKPYLSDTLRSLPSQGIKRVLVATPAFVADCLETIEEIHVENHDIFK
FT                   QAGGEVFDVVQPFNEHIDFSKYIASLANRHFAQN"
FT   gene            complement(370545..370616)
FT                   /locus_tag="LEUM_t0413"
FT                   /note="tRNA_Glu_TTC"
FT   tRNA            complement(370545..370616)
FT                   /locus_tag="LEUM_t0413"
FT                   /product="tRNA-Glu"
FT   misc_binding    370765..370861
FT                   /bound_moiety="guanine"
FT                   /note="Purine riboswitch"
FT   gene            370951..372399
FT                   /locus_tag="LEUM_0414"
FT                   /note="LactoCOG number LaCOG01139"
FT   CDS_pept        370951..372399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0414"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61532"
FT                   /db_xref="GOA:Q03Z40"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z40"
FT                   /protein_id="ABJ61532.1"
FT                   /translation="MEKLFQLKENKTTVRREIIAGITTFVSMAYIFFLNPQILGQAGVP
FT                   TQAVFLAAILVAVFGTLFMGLFANVPFALAPGIGMQAYFTYTIVFGFGFTWQQALAIVF
FT                   LVGVVDIVITLTHGRRAIVKGIPTELKAAIGGGIGLFVTYIGLKNAGFINFIVDPSNIM
FT                   TLNGKPFTGEVHGAVNSILANGGVTPELTKFNNASTLLALIGFVILVVLVMRKVPGAFL
FT                   ISLIVTTLIGIPMGVTNTHIGAGTSVSHAFGELGQVFGQSLGAQGLGSLFNNWHHASLA
FT                   LVTIFAMGLTGLFDAIGTLIGIGNQTGIFSKEDQKSFESSNGFNSKMDRALVVDTFTTA
FT                   FAGIVGTSNTTTFIESASGVAAGARTGLANVVTAAGFALMILFAPLVGVVPTAATSPLL
FT                   ILVGIMMMGEFKKISWESLEVALPAFFTSVFMAFSYSISYGIAAGFIFFIIVKFALGKF
FT                   KEVSPVLLIVSAFFLLNFAVLAFM"
FT   gene            372519..373319
FT                   /locus_tag="LEUM_0415"
FT                   /note="LactoCOG number LaCOG00349"
FT   CDS_pept        372519..373319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0415"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61533"
FT                   /db_xref="GOA:Q03Z39"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z39"
FT                   /protein_id="ABJ61533.1"
FT                   /translation="MLNIKNLSVSYGRKVALTVPKLSINKGEIIGVMGKSGSGKSTLVN
FT                   SCLGLIPFKGQVRIDTDDVGILMQEQHYVDTMTNQKMIEGMLNTRIKRDKKLTELIDFF
FT                   DFSDQLSLHFKNLSGGQKQRMSLIMVLYQEPELLFLDEMTTGLDFESRQALISQLKIYF
FT                   KQHQTTVLMVTHYAQEIEALADKLLVIHDGQVKAFDEPKNLFKQYIGYSAFIVDNHTEK
FT                   SIKVQQPEDEYKVARRLIDDGDDFRRTQSDIELVYTEVMKGQRA"
FT   gene            373316..374044
FT                   /locus_tag="LEUM_0416"
FT   CDS_pept        373316..374044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61534"
FT                   /db_xref="GOA:Q03Z38"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z38"
FT                   /protein_id="ABJ61534.1"
FT                   /translation="MIKKRKLVFEFQNLLGNIITLFFGFAFAPMMALVFGNSYANVPQA
FT                   LNQLYLGFFCTIPLSMVFVGFSSLFSQEVEQGFTLRAELFGYSRVSQALHKFMALTVFV
FT                   LLSSIIYSWIFLSHFNLPLPNAVIIGQMAIFQILNTAVYFIIVFILTTILKKFSRVYGI
FT                   SMISYFAIMIISGIMGNMDVGKLGDYLPIKLFVTNYTNHLNDTDYISGKIGLYLLILLG
FT                   ILGVILKVIVRNKNGNKHQY"
FT   gene            374022..374489
FT                   /locus_tag="LEUM_0417"
FT                   /note="LactoCOG number LaCOG00352"
FT   CDS_pept        374022..374489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0417"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61535"
FT                   /db_xref="GOA:Q03Z37"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z37"
FT                   /protein_id="ABJ61535.1"
FT                   /translation="MEININIDDKLKDVQVVISGSDIEQLADIAQYLKSRNTPSRQLAI
FT                   KTADNIRVVDKEDIILVESYGNDLTFTLKNNHKITTRKTLKRFLEENQKSDFVQISKSE
FT                   VMNLSYLSKMESAFSGNYYAFLTNQARVTVSRRFIKGILKRLEGNAEDEAF"
FT   gene            374476..374886
FT                   /locus_tag="LEUM_0418"
FT                   /note="LactoCOG number LaCOG02243"
FT   CDS_pept        374476..374886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0418"
FT                   /product="hypothetical protein"
FT                   /note="similar to uCOG01554"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61536"
FT                   /db_xref="GOA:Q03Z36"
FT                   /db_xref="InterPro:IPR021560"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z36"
FT                   /protein_id="ABJ61536.1"
FT                   /translation="MKHFKEAIVYLLVGIGVGSFISLLSFTLNHATPSMKQFGLLMTMS
FT                   AIMGLLSLIFEYDKITFITQLISHFILEILTYGFFIWLTFGSAVITFTNIPTFVITYVI
FT                   IFIYFRKQGRDNARRINEQLQKNKPKKSDSTN"
FT   gene            375020..377110
FT                   /locus_tag="LEUM_0419"
FT                   /note="LactoCOG number LaCOG00833"
FT   CDS_pept        375020..377110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0419"
FT                   /product="DNA topoisomerase I, TopA"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61537"
FT                   /db_xref="GOA:Q03Z35"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z35"
FT                   /protein_id="ABJ61537.1"
FT                   /translation="MPNYLILTEKPSAAANFTKALGGKTGVFSDFTYKITNLRGHVMTL
FT                   KDPEEMVAEDLKKQYKSWLVKHLPWNLEDFSWARTYIRQRNIRTGKIESTKKLIDELKK
FT                   ESKSGYDAIVIATDTDPSGEGELLAWEALDAIGWRGQVLRANFMDESVSGIQKAMHQLR
FT                   NVSDKMADGEYVKGESRNRWDFASMQLTRIATTAAKKEGFKVVAREGRLKSVIVWRIYQ
FT                   QLAAIKNYIKTPYFEVKFKDPAGHIFGRVTPQGEVIPWRFATKEQAKVDFNNYHETEVI
FT                   NEKHQTRTQAPGKLLDLAGLASILAPRGFSSKEVLSTYQKMYEAQIVSYPRTEDKTVTP
FT                   EQFNELLPLIDQIAGVVGVDKNLLTHRSPRKTHVKSQGAHGANRPGENVPQTTQSLAKF
FT                   GSSGPAIYEVLAKNYLAMLAEDYVYDHVTANLKDYPEFKTAFNIPIKLNFKLVYDSQKA
FT                   IKVEEGEEEESISGQLGPQAMPYLHEGANPKPQVPTTKWIMAFLEKHNVGTGATRVSTL
FT                   SEMSRGTKAMLTEKRGKLGLTETGNVSAIMVKDTWIASPKITKRLFEMMDQVGRFEMTM
FT                   VQVLDSATKVVEHDMPIMLDNAQTLETLLGKPKPSIKKPRKTSEKMTGIWQGQEITFAR
FT                   EWSGHVFTDEELQKLLTGSEVSFPAKSKRGKSYTAVGKMAKQTFKGNTFYGFKLNPKTK
FT                   KA"
FT   gene            complement(377143..378969)
FT                   /locus_tag="LEUM_0420"
FT                   /note="LactoCOG number LaCOG01797"
FT   CDS_pept        complement(377143..378969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0420"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61538"
FT                   /db_xref="GOA:Q03Z34"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z34"
FT                   /protein_id="ABJ61538.1"
FT                   /translation="MIKSTKRLGFIGLTIAMFMGTLDSTIVNIALPKLMTTFNTNLAGV
FT                   SWVATTYTLALAVFMITATKLGDKFGRKKLMIIGLLLFAGSSAACMFAPSLMYLLVFRS
FT                   FQGLGGAIITPLVLPMGVELFGKQHMSKIAAIVGAITALAAAGGPAAGGFILEYMSWHW
FT                   IFGLNVPIGLISLLLVLLFTKESFDETLVGHFDISGMLFLTISLTGITFGLLEGREYGW
FT                   TSTLILSSFLAGIIGLITFILIELKVSSPIVELNLFREKTFTSSCIIYFATGFALVAPA
FT                   VIFNYYLQNVLNYDALHAALMIIPVSLAIAVTMPLATRLSDRISAIPVNLIGMLLIAGS
FT                   LLLFSFITTTTPKRVMIVFSIIIGSGFGFSTVSFVSSVRHLPKSKTGIGSGITNASRQI
FT                   GTCLGIAVLVTVLNTNISTAKSHIQNHSVAIINRKNLSPNVKNTAESGIRQIFSSNDQK
FT                   NVNYTSRQKQFTKQLKHAALNKNNLPRPKKGTDYRKLYDATFKISEGNQKINDSLQKLA
FT                   GTTTTNKVLNNSIIALSDGTLTLLNGQKNILEAIKLLAQRDELKSTLSEIKKEKNTSLS
FT                   HAFSKTYVICAFLLLLCSPIALLSDKRQKKTH"
FT   gene            379192..379740
FT                   /locus_tag="LEUM_0421"
FT                   /note="LactoCOG number LaCOG00992"
FT   CDS_pept        379192..379740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0421"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61539"
FT                   /db_xref="GOA:Q03Z33"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z33"
FT                   /protein_id="ABJ61539.1"
FT                   /translation="MNNRMSLQTREWVRSAFLELLDEVEDIKSITISDISKRSGISRRT
FT                   FYRYYASKEDILTEYIDILIEQYGNDLRSKKLANFKEFIVYFFNYWGQYDHELFILQKN
FT                   GLFTYVLSEFNKMIPELYATISAPWHIQKEVNSREIIYTTRYGVGGLWNVYGEWLEFDR
FT                   EKIEITEVAKILIQSFNSL"
FT   gene            379852..380973
FT                   /locus_tag="LEUM_0422"
FT                   /note="LactoCOG number LaCOG00585"
FT   CDS_pept        379852..380973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0422"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61540"
FT                   /db_xref="GOA:Q03Z32"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="PDB:5ZL6"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z32"
FT                   /protein_id="ABJ61540.1"
FT                   /translation="MNYNAPHRHAVIELSQSAVVHNLKVIKENTHAKEIMAVLKANAFS
FT                   HGLPEMASLSITAGATRFGMAMLDEALILRDLGYIQPIDVLGLTDPRYARLAAERNITL
FT                   AFSTKESIKAAAEQLAGTGLTLKVSLPVDTGLNRIGFKSREDLVAAIQEVSAQDTLIFQ
FT                   SMWTHFATADTPNVDYVDFQISEWQRLTHDLPVEPNEKHFANTGIATWYPEKINTDIVR
FT                   LGIGLFGINGSVPIMSMPFELIPALSLKAKVVNSKPLKKGDAVGYGAEYHAPNDGYLIT
FT                   IPIGHSDGYPFNGSGMRALVADGQIGHIVGGVAMDQSMILVTNPVAVGTTVTLIGRVGD
FT                   QSITMQDLAEHTQSSIVALMNDFAPRLQRIIVS"
FT   gene            complement(381019..381090)
FT                   /locus_tag="LEUM_t0423"
FT                   /note="tRNA_Gln_CTG"
FT   tRNA            complement(381019..381090)
FT                   /locus_tag="LEUM_t0423"
FT                   /product="tRNA-Gln"
FT   gene            381189..381713
FT                   /locus_tag="LEUM_0424"
FT                   /note="LactoCOG number LaCOG02028"
FT   CDS_pept        381189..381713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0424"
FT                   /product="Phosphatidylglycerophosphatase A related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61541"
FT                   /db_xref="GOA:Q03Z31"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026038"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z31"
FT                   /protein_id="ABJ61541.1"
FT                   /translation="MQYATYENTVAKLAAHHITISDIARIAFNNEQSYVEGLTIEQVED
FT                   AVESILHKRVVQHQVWVGLELDRLAEAHLLEAPLQDLVENDDGLFGVDETIGTAIAMSF
FT                   DTIGVTNYGYIDKTKVGLVGELDRKGKTSEVVTTFADDIVGALAAAAASKVAHKYATGR
FT                   VDSVLPNQDNA"
FT   gene            381824..382990
FT                   /locus_tag="LEUM_0425"
FT                   /note="LactoCOG number LaCOG00902"
FT   CDS_pept        381824..382990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0425"
FT                   /product="N-acetylglucosamine 6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61542"
FT                   /db_xref="GOA:Q03Z30"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z30"
FT                   /protein_id="ABJ61542.1"
FT                   /translation="MVTSLRVRNIMAKLIKNIDLYTGYQHMEDAFMRFTDTVEEVGYMI
FT                   DFKEKADDELINEASGKIIVPGFIDVHKHGGYGLDTMDGDPEKLNTMINKMVTEGITSL
FT                   FPTTITQSPENIERALKNIDQVAKTNPVIQGIHLEGPFINKVFMGAQPEEYIIDPNTEL
FT                   LKKWYALSGERIRLVTYAPENGGIPDFEEFMLQHNIIPSIGHSNATRAQLVHSRATHIT
FT                   HLYNAQRPLQHREPGVTGHAMLEDAITGELIADGFHIVPDMLQLAFRIKGAQKLELVTD
FT                   SMRAEGLGNGISELGGQKVTVKDKQARLDNGHLAGSVLAYDDAFTNIQKFTSADINDAV
FT                   QMSSVNQAREFGLTQKGNLSEGKDADFNIFDKELHLEATYSLGRRFAR"
FT   gene            382995..383693
FT                   /locus_tag="LEUM_0426"
FT                   /note="LactoCOG number LaCOG00934"
FT   CDS_pept        382995..383693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0426"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61543"
FT                   /db_xref="GOA:Q03Z29"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z29"
FT                   /protein_id="ABJ61543.1"
FT                   /translation="MAKPRYIEIHNQILSRIEAGEWRSQERLPAERDLALEFNVSRMTL
FT                   RQAVQTLVDEGILERKVGSGTYVAEQKVSERALGVTSFTELMAATGRTPHTVTVSYKTT
FT                   TPSASEIEHLQLDSTDKVLIMERLRLGDDEPILLERTTLPVQLIESFTRGALTESLYAT
FT                   LASAGVYPGHAEQTITATLANERLSELLQIKRGDPILSVRQVSYDQHDTPFEYVRSYYV
FT                   GERFEFTLTR"
FT   gene            complement(383727..384422)
FT                   /locus_tag="LEUM_0427"
FT                   /note="LactoCOG number LaCOG00228"
FT   CDS_pept        complement(383727..384422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0427"
FT                   /product="ABC-type metal ion transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61544"
FT                   /db_xref="GOA:Q03Z28"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z28"
FT                   /protein_id="ABJ61544.1"
FT                   /translation="MSQWFTNTFPNVVYQGWSGDTGWWTSIIQTLYMTFWSAIFGGILG
FT                   LIFGLGLIITAPNGIAPNKASFWIFDKVVSLFRAIPFIILLAFIAPFTKLLIGTQIGTT
FT                   AALVPLSLGVFPFYARQIQVALSEVDSGIVEAAQSVGSSFWDIVFGVYLREGLSEIIRV
FT                   STVTLISLIGLTAMAGAIGAGGLGNMAISYGYNRFATDTTLVATLLVLILVLTVQVTGD
FT                   FLAKKFNHK"
FT   gene            complement(384425..385504)
FT                   /locus_tag="LEUM_0428"
FT                   /note="LactoCOG number LaCOG00227"
FT   CDS_pept        complement(384425..385504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0428"
FT                   /product="ABC-type metal ion transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61545"
FT                   /db_xref="GOA:Q03Z27"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03Z27"
FT                   /protein_id="ABJ61545.1"
FT                   /translation="MTEPIIELKNIDVTFHQKKRTIEAVKNVSINIERGDVYGIVGYSG
FT                   AGKSTLVRVINLLQEPTSGSVTVNGETFFQADSQDAKKTRIGTNDLRVRRRKIGMIFQH
FT                   FNLLNERTVTENVAFALQHSKLKDDEKKAKVAELLELVDLSDRAEQYPSQLSGGQKQRV
FT                   AIARALANDPEILISDEATSALDPRTTNQILALLKKLNQEFGLTIVLITHEMQAVKEVA
FT                   NKVAVMQNGEIIERGSLLEIFAQPKQQLTREFIETATNIDKAIETIRHEPLVNELKEGE
FT                   IFARLSYVGETTDEPLIASLFRDFNVTANILYGNIEVLQDTPVGSLLVILSGEPTQVQT
FT                   ALSTLHDHHVEVTILKGGN"
FT   gene            complement(385501..386838)
FT                   /locus_tag="LEUM_0429"
FT                   /note="LactoCOG number LaCOG02244"
FT   CDS_pept        complement(385501..386838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0429"
FT                   /product="Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61546"
FT                   /db_xref="GOA:Q03Z26"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z26"
FT                   /protein_id="ABJ61546.1"
FT                   /translation="MNMSSNQKYLNLLRDLVALPSVSATHRCLPEAAQLLTTTFRELGA
FT                   QVTYDDTYFAPFVLAQFRSSVPDAQTLVIYNHYDVQPVEPISLWQTDPWTLSEHDGKLY
FT                   GRGTDDDKGNITARLTAIEDYLTEHEGHLPVNITFIIEGSEESSSQHLDEYLSKYQDQL
FT                   FADLVIWESGGKNVHDVVEIFGGNKGIVTFNVDVKTAKTDLHSSLAGVVDSAAWRLTQA
FT                   LATLFDREGHIAVPGFYDDVAIPNQREKELVRNLPTTRDTLIQQHGLTSPLLSDKTGDD
FT                   LKETLYFQPTLNIEGIQSGYLGDGVKTVLPAVASAKLEARLVPNMDPDKTLQQIKQHFQ
FT                   NEGFSDIVVTKTLGQPGYRSDMSDPEILRVIDITEKYYHQHPVIMPTSPGTGPMYYIHE
FT                   ALNAPIASLGVGYAHTLDHAPNENIRLTDYNQHIAVIKELIRSYEK"
FT   gene            complement(386884..387726)
FT                   /locus_tag="LEUM_0430"
FT                   /note="LactoCOG number LaCOG00226"
FT   CDS_pept        complement(386884..387726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0430"
FT                   /product="ABC-type metal ion transport system, periplasmic
FT                   component/surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61547"
FT                   /db_xref="GOA:Q03Z25"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z25"
FT                   /protein_id="ABJ61547.1"
FT                   /translation="MSKKKNYIIAGVAVVVIAGAAYLSFGGQGKTESKTVTIGVMAGSK
FT                   AEDEIWASTIKTAKDKYGITLKTKKFTDYSQPNKALADGDIDLNAFQNYPFLKNWNKTY
FT                   KTNIVSIGDTWTTPLRIYSTSYKKISEFKSGDQILVANDVTNENRGIHLLAEAGLIKIK
FT                   DTDTATPKDITSNPKNLTITPVDASQTAKSLDDSKVAGAVVNTNYAVSANLDVNSAIYV
FT                   EGLNKETEQYFNFIAANKKDKDNETYKKVVKSLQTDKTKKLVKKYYGSAEVTVWDYNK"
FT   gene            complement(387754..388599)
FT                   /locus_tag="LEUM_0431"
FT                   /note="LactoCOG number LaCOG00226"
FT   CDS_pept        complement(387754..388599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0431"
FT                   /product="ABC-type metal ion transport system, periplasmic
FT                   component/surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61548"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z24"
FT                   /protein_id="ABJ61548.1"
FT                   /translation="MSKKTKWLIGGAAVIVIAGAAYASFGQHSKTSSKTVTIGIMSGSK
FT                   QDQAIWNTVKKTAKDKYGITIKFKEFTDYSQPNKALAAGDIDLNAFQHYAFLKASNKAT
FT                   GNKIVSIGDTVISPIRLYSKTYTKVSQFKSGDTIAVPNDPSNESRSLYVLKSAGLIDLK
FT                   NGLTTATVKDITKNPKNLKIKELAADQTARTLSDIQGAVINGTYADSAKLDYKKAIFVE
FT                   PINKNSHQWVNIIAANSKDKDNKTYKQVVKAYQTDAVKKAINKQYDGVELPAWDKDFSK
FT                   "
FT   misc_binding    complement(388683..388974)
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="T-box leader, riboswitch"
FT   gene            complement(389047..389706)
FT                   /locus_tag="LEUM_0432"
FT                   /note="LactoCOG number LaCOG00483"
FT   CDS_pept        complement(389047..389706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0432"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61549"
FT                   /db_xref="GOA:Q03Z23"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z23"
FT                   /protein_id="ABJ61549.1"
FT                   /translation="MILKNKNPMQERLRIGLLLVMNSGFIDSYTFEYHHERFASLQTGN
FT                   IIQAGFHLAQGHWKATLFFVIPIIFFVLGAAFNTVLNHFVPAGKLSLQQHSILIEFIGI
FT                   AMIGVFNHHLASTVIISALSFLLAMQLDSFPKLRGLPFTSVMSTGNLRNVGTNLVKYFI
FT                   NRDHIFLHNAWVFSILVVFFMVGAFSSAVLSGIFGTFALLGSSIIMFVVFLLLFKN"
FT   gene            389803..391644
FT                   /locus_tag="LEUM_0433"
FT                   /note="LactoCOG number LaCOG01959"
FT   CDS_pept        389803..391644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0433"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61550"
FT                   /db_xref="GOA:Q03Z22"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z22"
FT                   /protein_id="ABJ61550.1"
FT                   /translation="MIKLKIVVFTFLFAMMGVLTVSADGDYRITDLNEVVRIDANGDAR
FT                   ITKKVTYHFDDEMNGVYFKESLKKGTASQSLQWGGLTSIEVSHNNGEKQTILPRQGDSS
FT                   YGYVETKTSQQVQEKIYYPVQENDQLTMFYHYTLKGVVVNWDDIAEINWLPIGTRDVAI
FT                   EKLRLEFALPNQPASTLKAWVHGRSVGHVLVNKKQANITVNSKKIGPDDTVEVHTYFDT
FT                   SQTPLNTNKKSGNRAAYIQKQEKAIALKNKKSLQIKKVIGFIVSPIVIMILVFIIMLKT
FT                   IQRRKLLQSARQQSGVTGDIVHIFDIPNDIGPALVSERIAKSVTNAKLIIATLLDLIAR
FT                   RKIAMTYDDIQKQDDITYSVLDETNLQPFELVFINMIFGKYRRAVVHAEFKQPESGVSN
FT                   RIKKDISSFTKALKEAEKQASIIDHVLTNKIKSQQFFLTLALIISTIISTFLLGIFAYS
FT                   TQAWSMWYVIFTEIIVVILVLIFSIKPAIFYKVPDGFQEKWQWDGFAKMLHDIAHLENK
FT                   TVLDVQLWDKLLAYAIIFGEAKNVAKQMKVWSQKVDTDDSIIFVPIMLYGDDWSESLIY
FT                   NIENDGAFHVDNNVNGDGGGFSAGSSGGAGGGSDGAF"
FT   gene            391916..394579
FT                   /locus_tag="LEUM_0434"
FT                   /note="LactoCOG number LaCOG00919"
FT   CDS_pept        391916..394579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0434"
FT                   /product="Cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61551"
FT                   /db_xref="GOA:Q03Z21"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z21"
FT                   /protein_id="ABJ61551.1"
FT                   /translation="MADKPLYNQDNTEVLSHLQTDASKGLSSSEANKRLEQNGANQLNE
FT                   AKSTNLVQKFINQFKDLMIAILLAAAIVAAFTGEVVDAIFILAIVIINAIFGVFQEAKA
FT                   EDAINALKEMSTPNASVIRDGKETSIKSTELVVGDIVRLEAGDIVPADVRLIESASLQV
FT                   EEASLTGESVPINKSAETLQETDLPLGDRTNLGFMNTNVTYGRGVGVVTGTGMQTEIGH
FT                   IAGMLEATDETKTPLQANLAKLGQVLTYLILGIAVVTFIVGLARGKETIIDMLLTSISL
FT                   AVAAIPEGLPAIVTITLALGTTRMAARHALVRKLPAVETLGSTDIIGSDKTGTLTQNKM
FT                   TVEKLVVNTEISDAATTEELTGTYARLADILALNNDTKRTENGFIGDPTETALIAFNEN
FT                   HGRDLDKLFTEMPRVAELPFDSERKLMSTVHPAPTGYIITVKGAPDELLKRATRIEING
FT                   EIKPLSDDIRAKLLSINSELATQALRVLGFAYKTVDQIPGNLDTETVEQELVFTGFVGM
FT                   IDPERPEVAQAVAEAKAAGIRPMMITGDHRDTAAAIAIRLGILDEADKETAVISGSDLD
FT                   AMSEEQFAQNVDKYNVYARVAPEHKVKIVNAWQKKGKVVAMTGDGVNDAPALKTADIGI
FT                   AMGITGTEVSKGASDMVLADDNFATIVHAVEEGRKVFANIQKALQYLLASNLAEVIAIF
FT                   VMTLLGWNILAPIMILWINLVTDTLPAIALGIEPAEKGIMKNKPRGRGASFLSGGVGPA
FT                   IIWQGILQAVIVLSVYGFALAAPVHPEVHLAHQDALTMAFMTLGLMQMFNAINVKSVYG
FT                   SMIGPQAFQNKMFNWALLGSVLVMAAVVVIPGLNPLFHVSHLDGYQWAIVLVAGMSIIV
FT                   IVELVKLIQRSIFKKG"
FT   gene            394586..395032
FT                   /locus_tag="LEUM_0435"
FT                   /note="LactoCOG number LaCOG01633"
FT   CDS_pept        394586..395032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61552"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z20"
FT                   /protein_id="ABJ61552.1"
FT                   /translation="MAKFNPKQAQVYVQTLQEVLTITQDTADRVAPFFTKLDDAKEANA
FT                   VADIPAAEFAEIKAEFEDAVAAYQKNAQILNAVQAPVRLLGLHKSLAKNYSAYAGATNM
FT                   MSEALNVADQTVDDVLYVKSEEDQELYLGKIQANVSKIMMGAGR"
FT   gene            complement(395103..396044)
FT                   /locus_tag="LEUM_0436"
FT                   /note="LactoCOG number LaCOG02116"
FT   CDS_pept        complement(395103..396044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0436"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61553"
FT                   /db_xref="GOA:Q03Z19"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z19"
FT                   /protein_id="ABJ61553.1"
FT                   /translation="MPPGALKAKADYAAIAAATGWKILPLERYNDGRFDSETRQQKIRS
FT                   WLNMVNPGDQVIHQFPTYMSADFELELIMVLSKHQAQSALLIHDIEPLRLIKTASWEIN
FT                   VLNSYDTIIVHSQAMYDELKKLGVHVPAIIQPFFDYLGDVTKKATFSHKINFAGTFQKS
FT                   PWLKHYNGPKIELFGSRPKRWADVTFPSNINYRENFDPTSILDAFHDGFGLLWDSDFED
FT                   KTYQTYTRFNAPHKASLYLRAGLPLIAWNQSAIGHLILQYNLGFVIDSLSELERISSIS
FT                   EKQYTNWQKNIIPLAKQLENGYFTQQTLKKLM"
FT   gene            396254..397309
FT                   /locus_tag="LEUM_0437"
FT                   /note="LactoCOG number LaCOG00935"
FT   CDS_pept        396254..397309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0437"
FT                   /product="nucleoside-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61554"
FT                   /db_xref="GOA:Q03Z18"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z18"
FT                   /protein_id="ABJ61554.1"
FT                   /translation="MQRSAKIGIGVAAVVVIGGGIYAATQKSSTKSTGYAVALVTDGGG
FT                   IDDRSFNQSAWEGLKAYGKANNLEQGKGGYNYFLSSDTSDIKTNLQTAVKGGYKLVYGV
FT                   GFAAAPAVTSVSKANSKTNFAIIDSVVNNKNVASLLFKSEQSSYLAGVAAAKQTKSKTV
FT                   GFVGGIHSDTIDTFEAGFKAGVKDTDSSIKVITQYTDSFTDAAKGKTIAASMVANGADV
FT                   IFQAAGGAGNGVFAEAKAENQKLAANADKKVWVIGVDRDQKTDGNYKDKDGKASNFTLV
FT                   SAVKRVDSAVEDVANKAKNDKFPGGKTITYGLKQKGVSLSKDSASEDVWSAVQTAQKKI
FT                   ISGKITVPVHP"
FT   gene            397567..399009
FT                   /locus_tag="LEUM_0438"
FT                   /note="LactoCOG number LaCOG01165"
FT   CDS_pept        397567..399009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0438"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family / amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61555"
FT                   /db_xref="GOA:Q03Z17"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z17"
FT                   /protein_id="ABJ61555.1"
FT                   /translation="MKKIWIILTTLAVSFIAMASVTTVSAAKPNYIITTDATYPPFDFQ
FT                   DSNNQYTGIDQEILKTIAKREGFTYTLKPMSFNAATQSVTSGQADGIIAGMSITDERKE
FT                   VFDFGTPYYKSGIAWAVKKGSNIKSLSDLKGKTVALKTGTAGADYALSIQKQYGFKVTY
FT                   FNDSDTLYNDVVNDNAQATFGDLPVLQYSIKNGTKLKVMNAKSPYESGWYGFAVKKGQN
FT                   KQLLASFNKGYAAIKKDGTYDKIIKKYLGAPASDFTGKKSDNNSVLGILKANNGAFMRG
FT                   LWQTLLLTILGIILASIWGVILGVMGVSQNSAVRGLSTTLIYIFRGLPLMVLAFFIYIG
FT                   LPGVIGTKIPAFTAGLITLILNEGAYTGAFVRGGFEAVDKGQMEAARSLGFTYNRSMRK
FT                   VIMPQGLKIMVPSFINQFIITLKDTSILSAIGILELTQTGTLIVSRNSQGFRVWAIVAV
FT                   IYLVVITLLTWLSNWVEKRTRA"
FT   gene            399006..399758
FT                   /locus_tag="LEUM_0439"
FT                   /note="LactoCOG number LaCOG01166"
FT   CDS_pept        399006..399758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0439"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61556"
FT                   /db_xref="GOA:Q03Z16"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z16"
FT                   /protein_id="ABJ61556.1"
FT                   /translation="MSEAQTKVKVHVDKVNKSYGSNHVLRDISLDINENEVVVMIGPSG
FT                   SGKSTFLRMLNQLETPDNGTIVVDGYDLSHKGTDINKVRENIGMVFQSFNLFNNYTVLE
FT                   NIMLAPVELGKMDKEKAEKKARELLETVGLAEKADVSVNSLSGGQKQRIAIARALAMEP
FT                   DIMLFDEPTSALDPEMVGDVLDVMKNLAGSGMTMIIVTHEMGFAKQVADRVVFFESGKI
FT                   QESGVPEQVFNAPKNERLQEFLSKVMHA"
FT   gene            399825..401270
FT                   /locus_tag="LEUM_0440"
FT                   /note="LactoCOG number LaCOG01165"
FT   CDS_pept        399825..401270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0440"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family / amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61557"
FT                   /db_xref="GOA:Q03Z15"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z15"
FT                   /protein_id="ABJ61557.1"
FT                   /translation="MFKKGFILAVTLVVALLSFSLAADCIHADKPHYTISTDATYPPFD
FT                   FQDKNNDYIGIDQDILKEIAKRENFTYTLKPMSFTSAAQLVANGQADGIIAGMAITDER
FT                   KEVYDNSTPYYKTGVAWIVKKGSEIKSLKDLKGKTVALKTGTAASEYGKSLQRKYGFNI
FT                   KYFNDTDTMYNDVVVGNSAATFEDMPVIQYAIKNGVKLKVMNANNPGNAGSYGFFVKKG
FT                   ENKELLASFNRGFASIKKDGTYDKIIKKYLGATQSTFTGSKKNNNSVLGILKANDGAFL
FT                   KGLWLTIELTVLAIILASIWGVILGVMGVSQNSAVRGLSTTLIYIFRGLPLMVLAFFIY
FT                   IGLPGVIGTKIPAFTAGLITLILNEGAYTGAFVRGGFEAVDKGQMEAARSLGFTYNRSM
FT                   RKVIMPQGLKIMVPSFINQFIITLKDTSILSAIGILELTQTGTLIVARNSQGFRVWAII
FT                   AIIYLIIITLLTWLSNWAQKKIQ"
FT   gene            401312..402335
FT                   /pseudo
FT                   /locus_tag="LEUM_0441"
FT   gene            402393..404186
FT                   /locus_tag="LEUM_0442"
FT                   /note="LactoCOG number LaCOG01135"
FT   CDS_pept        402393..404186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0442"
FT                   /product="oligopeptidase F, Metallo peptidase, MEROPS
FT                   family M03B"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61558"
FT                   /db_xref="GOA:Q03Z14"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z14"
FT                   /protein_id="ABJ61558.1"
FT                   /translation="MSEKQLLRNQVPENLTWDLSSIFPTDEAWETAFNETRKSAQALSK
FT                   YAGHVGDSADVLKEALEADLAVERQFEKVYVYAHQIYDQDTTNQKYSAYNARVQGLYAE
FT                   LSANTAFFQPEVLALSNETLDAYLARAGLKKYAHFFDVLKARKPHTLPAEQEALLAGAS
FT                   DIFNASEQTFGALDNSDIVFGDVHTETGEIVPLTNGLYSLLLESKDRSLREEAFTTLYD
FT                   SYIALQNTFASTLSSHVKGHNFLAKTRHYDSARQAAVTANDIPESVFETLTKTVDANLP
FT                   LLHRFVSLRKKILNVDDVHSYDLYVPLVDEINFEVTYEKAKDIVLAALAPLGEDYIAIV
FT                   QKAFDERWIDVVENKGKRTGAYSSGSYDTKPFILLNWQNNLNNVYTLAHEMGHSVHSYF
FT                   TRHNQEYHYGDYPIFLAEIASTTNEGLLTDYLLKTNDDPKFQAYVLNQYLDGFKGTVFR
FT                   QTQFAEFEQWIHEQSAAGVALTADEMSTFYGSLNQKFYGSDLFPDEAIAYEWARIPHFY
FT                   YNFYVYQYSTGEAAATTLAERILTQNGAEDYKNYLKAGNSDYALNVIKKAGVNMSQPDY
FT                   LNEAFKVFEERLNEFEKIMLK"
FT   gene            404297..404686
FT                   /locus_tag="LEUM_0443"
FT                   /note="LactoCOG number LaCOG00936"
FT   CDS_pept        404297..404686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0443"
FT                   /product="cytidine deaminase"
FT                   /EC_number="3.5.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61559"
FT                   /db_xref="GOA:Q03Z13"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z13"
FT                   /protein_id="ABJ61559.1"
FT                   /translation="MAPRKLVDVANQALNDTYTPYSHFPVGAALLGENGEIFKGVNIEN
FT                   VSFGLTNCAERTAIFTAIAAGQRHFHGLVISGRTDEPIAPCGACRQVMVEFFDPDMPIW
FT                   LINDQGKEIETNIAELMPGSFNSLQ"
FT   gene            404703..405143
FT                   /locus_tag="LEUM_0444"
FT                   /note="LactoCOG number LaCOG01769"
FT   CDS_pept        404703..405143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0444"
FT                   /product="purine deoxyribosyltransferase"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61560"
FT                   /db_xref="GOA:Q03Z12"
FT                   /db_xref="InterPro:IPR007710"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z12"
FT                   /protein_id="ABJ61560.1"
FT                   /translation="MSQIYLAGPFFSDEQIDRVKRIEAALDSNPTVTDYYSPRKHQKTE
FT                   NPEFTSPWAAEVFQRDIKNVTDADIILSIIDYRDNDADSGTAFEQGMAWVQKKPIIVFN
FT                   ELKFPVNLMLSESLTAYITNSDDIATYDFDQTPKLPFTGELF"
FT   gene            405143..406072
FT                   /locus_tag="LEUM_0445"
FT                   /note="LactoCOG number LaCOG01668"
FT   CDS_pept        405143..406072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0445"
FT                   /product="Lactate dehydrogenase related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61561"
FT                   /db_xref="GOA:Q03Z11"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z11"
FT                   /protein_id="ABJ61561.1"
FT                   /translation="MKKVLVANMTSQKAVDYLESKGYQVIKNDQASDDDFLGHADVDGI
FT                   LIMMHPFGESLMSKMPNLKVVARHGVGYDNVDLDAASAHDIVVTNTPGANATAVAETAM
FT                   MHILMAGRLFYQRRQAITDNANKRYLAAHHGQELTGKTVGIIGYGHIGQEINRMLTGFN
FT                   VKVLAYARHQHEVTNGRMATLDEIYEQADFVVTALPATPETKHMINASVFRKMKKSAVL
FT                   VNIGRGALVDERALVEALTNEEIAGAGVDVVEKEPITAENPLLHLPNAFVTPHVAMISK
FT                   EAMDNVALKAAEDIVRVLEGERAVFQVN"
FT   gene            406092..406460
FT                   /locus_tag="LEUM_0446"
FT                   /note="LactoCOG number LaCOG01461"
FT   CDS_pept        406092..406460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0446"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61562"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z10"
FT                   /protein_id="ABJ61562.1"
FT                   /translation="MVKKTKNTENTLCKNFTCTFELLGRKWNGLIIETLLISGAKRFLE
FT                   ISRAVSGCSDRVLVERLKELEAANIVIRQTYKDSNLIEYKLTEAGEAMRPMMTAIHEWS
FT                   DQFNNVANLEEPDSATKF"
FT   misc_binding    406483..406705
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="T-box leader, riboswitch"
FT   gene            406737..407813
FT                   /locus_tag="LEUM_0447"
FT                   /note="LactoCOG number LaCOG01294"
FT   CDS_pept        406737..407813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0447"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61563"
FT                   /db_xref="GOA:Q03Z09"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z09"
FT                   /protein_id="ABJ61563.1"
FT                   /translation="MVTILKGKNMGLIEDLTALKNSAVERINDKNADIEQLRVKLLGKK
FT                   GELTGLLKGMKDVAAENRKMVGEVGNDVRQTITELLKQKKQAQEEYALNQQLLAEKIDV
FT                   TLPGSAHQVGQPHVLQQIIDEIEQHFLGLGFEIIDDTVDSPEVETDEYNFERENLPKDH
FT                   PARDMQDTFYITPEILLRTQTSPVQSRSLEKHDFSKGPLKMIAPGKVYRRDTDDATHSH
FT                   QFHQVEGMVVGENITMADLKGTLLSIMQELFGEKHQIRMRPSYFPFTEPSVEVDVSWNE
FT                   VTPDMNPEDIEWIEVLGAGMTHPNVLKMDGIDPEKYSAFAFGLGPDRFAMLKYGVDDIR
FT                   QFYLNDVRFLSQFNRKGN"
FT   gene            407816..410272
FT                   /locus_tag="LEUM_0448"
FT                   /note="LactoCOG number LaCOG01293"
FT   CDS_pept        407816..410272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0448"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61564"
FT                   /db_xref="GOA:Q03Z08"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z08"
FT                   /protein_id="ABJ61564.1"
FT                   /translation="MKTSLTWINEYLDNAIDLHPKSVSDLAEKVERTSVEIDSNTTIAS
FT                   GQNGLVVAKILSVIPHPDSDHMVITQVEAGEPEPIQIVTGAPNVAEGQMVILAKVGAHI
FT                   INRENGELIELNAVKLRGEFSYGMLVALQEIGFSDKIAPKAFEAGIYVFNETDDVKPGD
FT                   DALVALGMDEPVLDTDLTPNRADMLSMIGTAYEFGAMLNKPVTLPSFELVEYEQTADSQ
FT                   VSVQIDDQELVSKYALRVVNNVTIKDSPLWLQKRLWNAGMRPINNIVDITNYMMLTYGQ
FT                   PLHAFDLDKLNGSDIYVRRAKDGEKLVTLDGEERSLRSGEDIVIADESEGLMLAGVMGG
FT                   MGSEIDNNTKNIVIESAIFNPSLVRATARRHNLHSEASSRFERGLNWDETLNALDHAAS
FT                   LVDELADGQVARGQIVAADDVRKDIRLSLSIQRVNNILGTSLETDEIANIFDKLNFVYE
FT                   KNDEKIVVDVPARRADISIEADLIEEVARLYGYDNLPVTLPYGPTTSGKLSREQRQIRA
FT                   SRHIMESLGLNQAISYVLTTSEKAQLFAENKADGVVTLNYPMSSDRTTARQNLLAGLLD
FT                   DVSYNVSHFVPNVALYEQGRVFIANEPNEQPKEIEHIAGVVTGNLQKSSWQESKQEKAV
FT                   DFYDIKGIVENYLDQIGVDNVRYVATERHESMHPGQTADIYIGEQYVGFVGQIHPKITK
FT                   KQKLAPVFGFELNLFTVFNHVTDSIQFNPISRFPQISRDAALLVDQATTNSEISATIVE
FT                   TAGEHLVDVTLFDVYTGNNLPESKKSLAYTLTYQDSDGTLLETDVNSDFEHIMSELQSK
FT                   FNVEIR"
FT   gene            410353..411639
FT                   /locus_tag="LEUM_0449"
FT                   /note="LactoCOG number LaCOG00220"
FT   CDS_pept        410353..411639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0449"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61565"
FT                   /db_xref="GOA:Q03Z07"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z07"
FT                   /protein_id="ABJ61565.1"
FT                   /translation="MAKIIVHGGKRIRGEVTIGGAKNSTVALIPAAILADTPVKFDTVP
FT                   QILDVKNLQLILQAMNVTSKFENGVLDIDPTRIEESDLPSGAIKSLRASYYFMGALLGR
FT                   FGRATVTFPGGDNLGRRPIDQHIKGFEALGAVVTESNDIIHIDATDHGLIGARIALDTV
FT                   SVGATINIVLAAVRAKGQTVIENAAREPEIIDIATFLNNMGANIRGAGTDTIRIAGVPT
FT                   LKARNTHTVIPDRIEAGTYMSMAAAYGDGVTIKNVIPEHLESYTSKLIEMGVNLDIGED
FT                   AVHVYKSDALKPVAIKTMPYPGFATDLQQPITPLLLIAQGESTIIDTIYPKRVKHIAEL
FT                   RRMGGDIASAKPGEIKINQSPRLVGTDVEAAEIRAGAALVIAAIMADGETIINNADHIL
FT                   RGYDRIQEKLTSLGADINIEGIDLINLMP"
FT   gene            411732..411998
FT                   /locus_tag="LEUM_0450"
FT                   /note="LactoCOG number LaCOG01045"
FT   CDS_pept        411732..411998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0450"
FT                   /product="LSU ribosomal protein L31P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61566"
FT                   /db_xref="GOA:Q03Z06"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03Z06"
FT                   /protein_id="ABJ61566.1"
FT                   /translation="MQAEIHPDYRQVVFIDASTGKKFLSASTVTSNDTTDFEGKEYPAI
FT                   RMDITSDSHPFYTGKQKFTQADGAVDKFNKKFAGFGFKNNEDK"
FT   gene            412038..413429
FT                   /locus_tag="LEUM_0451"
FT                   /note="LactoCOG number LaCOG00797"
FT   CDS_pept        412038..413429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0451"
FT                   /product="23S rRNA m(5)U-1939 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61567"
FT                   /db_xref="GOA:Q03Z05"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z05"
FT                   /protein_id="ABJ61567.1"
FT                   /translation="MYEVKIIARTVLPVKLNQELIVVVDDIRIDGMGIVYVTAKYPLYV
FT                   ADALPGEKVHLLVTQVDKFSGYAKVLDWLESSDKRQNSDRQYLIDAGTAPLVNLKYEAQ
FT                   LELKQAQVKRLFEEQHIDVSVDRTIGMDNPTYYRNKTIVPVKWQNDHLTSGFYKRGTHD
FT                   LVPMDDYFVNDAEIDQAIIVVRNILEKYDITAFDPDLERGAIRYIMIRRGYYSHELMVV
FT                   LVSNEEVISHETEIIADIRNQLTELKSLILNYSPKKDYVLLSPNNRILWGEKAIYDTLL
FT                   GYEFIIGPNSFYQVNPQTTEVLYDLAAQKADLKPTDTVIDAYSGIGTIGISVASRVKKV
FT                   LGVEVVPGAVADAQLNLQVNNISNAEYILADAPVQFKKWQEQGLKPDVVFVDPPRRGLT
FT                   TSLINGTTDMSPEKIVYISCNPVTLSRDAVEIIENGYHIDGSVLPVDQFPQTSHVESIT
FT                   VFRKD"
FT   gene            413431..414759
FT                   /locus_tag="LEUM_0452"
FT                   /note="LactoCOG number LaCOG00246"
FT   CDS_pept        413431..414759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0452"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61568"
FT                   /db_xref="GOA:Q03Z04"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z04"
FT                   /protein_id="ABJ61568.1"
FT                   /translation="MNYSVKKIGQILNATTQIDSKIVTGVSFDSRKVKSGDLFVALVAE
FT                   NDGHDYVQQALTKGATAVLVDDRHQIDSKIPAIIVSDTLLALQQLGEYRRHQINPKVVA
FT                   ITGSNGKTTTKDMASAIMGSQYKTFKTPENFNNEIGVPLTLLTMPDDTEVLVVELGMDR
FT                   PGQLTTLSELVSPDIAIITMIGEAHIEFFKTRENIAKAKLEITKGLKSQGTLLVPYDEP
FT                   LLTNAQVKQNVQTFGQDIKDINSSSSKTIFTYQNTRFAIPLLGRYNIMNALAAISAGIL
FT                   LHIELKNAAEALQHFDLTKNRTEQLTTSHGVNLISDVYNSNPTAVAAVLATLKIIPATH
FT                   KYVVLGDMLELGEQAASLHACLAETVINANVDGVYLVGPLMNKYLYPILQRRFDSAHLH
FT                   QYETDQLAELIKDLQTLGENGDVILLKASHGIHLENVVNALVK"
FT   gene            414783..415925
FT                   /locus_tag="LEUM_0453"
FT                   /note="LactoCOG number LaCOG01855"
FT   CDS_pept        414783..415925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0453"
FT                   /product="Beta-lactamase class C related penicillin binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61569"
FT                   /db_xref="GOA:Q03Z03"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z03"
FT                   /protein_id="ABJ61569.1"
FT                   /translation="MKRSQKQQFKIRKWSVFLILVCTMGLVLWPNQLNNGQYTINPIVD
FT                   DKYSANSMSALKSNISPQNKFAETLDKKLQSENYIGTALIVHHNEIILQKGYGEADEKM
FT                   HRDNDASTLFQLASIEKSMTAVLIMQQIESGKLSFDTKLSDYYPNVVNANRITISDLIT
FT                   MTSGLSQRIQPTTFESEEDNIDFSAVHAVKIGEPGTGIGWSYQPVNYRLLAGILMKLTN
FT                   KTFAVLLNQVFNNTYHLNVRNYQDFINSKHRSIGYDNSYDKAYSENQVAYNRETGTGNV
FT                   AMTTGELYHFYRLMIDKVIIKHPSQLWQTRTGETYAAGMYHEGKYLNAHGILPGFEPTV
FT                   VIRNNGQDAVILLSNQYYKNHSFQPLARELFTKMTAIPTK"
FT   gene            415961..417547
FT                   /locus_tag="LEUM_0454"
FT                   /note="LactoCOG number LaCOG00254"
FT   CDS_pept        415961..417547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0454"
FT                   /product="Superfamily II DNA and RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61570"
FT                   /db_xref="GOA:Q03Z02"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030880"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z02"
FT                   /protein_id="ABJ61570.1"
FT                   /translation="MKFSELGLSQDILDAITTHGYVEATPIQEKTIPLTLAGRDVIGQA
FT                   QTGTGKTAAFGLPILEHIDLNNKNIQALIVSPTRELAIQTAEELKKLGRDKRVDVQVVF
FT                   GGADIRRQIQNLKSHPQILVGTPGRLLDHINRKTVKIDNVRTLVLDEADEMLNMGFLDD
FT                   IEAIISKTPAERQTLLFSATMPPAIKRIGVKFMTNPEHIQIEAKELTTDLVDQYFVRMR
FT                   ENEKFDTMTRIFDVQAPKLAIVFGRTKRRVEELSRGLEARGYHAAGLHGDLTQQMRSRV
FT                   LAQFKSHEINILVATDVAARGLDVKDVSHVYNFDIPQDPESYVHRIGRTGRAGAKGVSV
FT                   TFVAPNEMDYLRAVEDLTKKRMTPLEPASLKDARIGKINNAAGEVAKLIDTTEVSEIQS
FT                   QVDALTAKYSAEQLAAAVLSSVADLEKQNTPVEITRERPLPRRKGGNGGSRGGSRNGGG
FT                   RRNGGGGGYRGNRERRGNGDTRGNDRRRGSGAASSERRFGDYKRRDGRSTESRRNSSGG
FT                   SRREFTVREKD"
FT   gene            417692..418873
FT                   /locus_tag="LEUM_0455"
FT                   /note="LactoCOG number LaCOG00781"
FT   CDS_pept        417692..418873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0455"
FT                   /product="Folylpolyglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61571"
FT                   /db_xref="GOA:Q03Z01"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z01"
FT                   /protein_id="ABJ61571.1"
FT                   /translation="MKTVEDAISYIHNRPKGGQKESLYRMTTLLAALGNPQNDLPYAIH
FT                   VTGTNGKGSVSTMASNILRVAGYDTGLFVSPFITNFRERIQINNEMISKDDLLHATNKV
FT                   AQVLVNVDAELYPDIPVEFEVLTAIMFTYFSSKKLDALVIEVGIGGLLDSTNVMPNTKV
FT                   AVITSVGLDHQKMLGNTITEIASQKAGIIHDDVAVVTGDLPDEARLVIEKKTPHVIKGL
FT                   RHEFQSGLPGEYQIENTATAVAAVRAFAQNISDDTIQKGLEESHFSGRFELIAPNIMVD
FT                   GAHNAQGLRALYKSLSVAYPKGKITLIIGSLMDKNVTAEFNEILRDDRFNIVLVPFTGP
FT                   NGRPSLSIEQTLKQYQVSAMPHWQEAVEKSTADLTVLTGSLYFISEVREQYDR"
FT   gene            418863..420251
FT                   /locus_tag="LEUM_0456"
FT                   /note="LactoCOG number LaCOG00913"
FT   CDS_pept        418863..420251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0456"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61572"
FT                   /db_xref="GOA:Q03Z00"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q03Z00"
FT                   /protein_id="ABJ61572.1"
FT                   /translation="MIDDKLSPRLVLSVLAIGLLGFTDIMLETALNVSFPMLMTEFKVT
FT                   SSTVQWLTSGVILLTSMVVILSPWLKKNFTNRSQFIVATVISIVGVLIDAVSNTFVITL
FT                   FGRLLQGIGGGVGLPLMYNVIFEQVPEKKRGTMVGLGSLIISFAPAIGPAFGGYLTQNY
FT                   GWHMVFWVVLPVQIGSLILGWATIKQVSTIKKEKLDIIGWLLLSLFFVSGIFVIERIST
FT                   HGLVNLLSLLMTLAMFVGIIGYILYAKRVDNPLLSPEIFKFKVFRFGIAAAFVAQIVNL
FT                   TFNYAIPMVLQIVLLKNPQVAGLTLLPGALSYAMMAIISGRLYDRYSARLPITIGVTLM
FT                   FVGTLLIAFIPINLISLTGGFMVIQIGAGFWFGNNMTYSVSSVPVEFQSSGNSIFSATT
FT                   NYSAAVGIALAAGIIATFQKQAINVRELASSTHIGALWTFRVDIVLIVLAAILSLSALG
FT                   SIRK"
FT   gene            420287..420895
FT                   /locus_tag="LEUM_0457"
FT                   /note="LactoCOG number LaCOG00702"
FT   CDS_pept        420287..420895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0457"
FT                   /product="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61573"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YZ9"
FT                   /protein_id="ABJ61573.1"
FT                   /translation="MVKEKVEKFYNLLGYKEKKDIRIFQRYFPNNYNLNELTNDMVEDF
FT                   LSHNPIANEALLLGIEIGKHVAHQRRPQLLNAKYSAEIGRFAQQQIGNLMQEQLSVALL
FT                   DTQLNVIGWEVVFVGTLSQVQASPREIFQRVLKANAFGFMIAHNHPSGNIMPSNADITF
FT                   SQRLATIGHQMDLRLFDSFIVTQNEYWSMSENQQLKKVI"
FT   gene            complement(420919..421887)
FT                   /locus_tag="LEUM_0458"
FT                   /note="LactoCOG number LaCOG01011"
FT   CDS_pept        complement(420919..421887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0458"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61574"
FT                   /db_xref="GOA:Q03YZ8"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YZ8"
FT                   /protein_id="ABJ61574.1"
FT                   /translation="MSQNEQQYLDLAQKILDEGSHKGDRTGTGTRSLFGTQMRFNLAEG
FT                   FPLLTTKKVFFGLIKSELLWFLRGDNNIRFLLEHNNHIWDEWAFKKWIESDKYTGPDMT
FT                   NFGLRSQTDENFAKIYKEQKDIFVNNILNDDEFKEEFGYIGNVYGKLWRSWETNSLTAG
FT                   DETVDQVARLIDQIKETPNSRRLILTAWNAETTPQAPLPSCHVLSQFYVADGKLSLQMY
FT                   QRSGDFFLGVPFNIASYSLLLHMVAAQTGYEVGEFIHTIGDTHIYNNHVDQITEQLSRP
FT                   MHKLPKLWLNPEVKSLFDYTMDDIKILDYDSEPAIKAPVAV"
FT   gene            complement(422088..422564)
FT                   /locus_tag="LEUM_0459"
FT                   /note="LactoCOG number LaCOG00765"
FT   CDS_pept        complement(422088..422564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0459"
FT                   /product="Deoxycytidylate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61575"
FT                   /db_xref="GOA:Q03YZ7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YZ7"
FT                   /protein_id="ABJ61575.1"
FT                   /translation="MADQRISWHQYFIAQAAILSTRSTCTRLHVGAIIVRDHRIIASGY
FT                   NGSVSGTPHCTEVGDLMVDGHCIRAVHAEQNALMQAAKMGITIDGSEVYVTDVPCVQCT
FT                   KLLLQAGISKIYFMRDYRNNTFAEELLAQKGIELKQVPLSALTAQQIDMNQFIV"
FT   gene            422636..423481
FT                   /locus_tag="LEUM_0460"
FT                   /note="LactoCOG number LaCOG00591"
FT   CDS_pept        422636..423481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0460"
FT                   /product="5,10-methylenetetrahydrofolate dehydrogenase
FT                   (NADP+) / methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /EC_number="1.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61576"
FT                   /db_xref="GOA:Q03YZ6"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YZ6"
FT                   /protein_id="ABJ61576.1"
FT                   /translation="MTEILDGKAVAKTINEQTKARVAKQKRPVTLAVIYDPSNDGSQLY
FT                   VGMKSRQAAKLGIVTRDIPISTDATTESVIQLVEELNDDESITGILVQSPLAKGIKERQ
FT                   IFSAVAPHKDADGLGATVQGMLFGDSLENYTVAATPQGVMTLLAQYNISLKGKNAVVVG
FT                   RSQLFGRPMFALLTNADATVTLAHRYTEPTTLKALLKNADIVVVGVGIPNFIQGEDLKK
FT                   GATVIDVGMNVVDGKATGDVNFSSAQGIAGYITPVPGGVGPMTIATLLENTVTLAEQHQ
FT                   "
FT   gene            423590..424531
FT                   /locus_tag="LEUM_0461"
FT                   /note="LactoCOG number LaCOG01431"
FT   CDS_pept        423590..424531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0461"
FT                   /product="Type II secretory pathway/competence component,
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61577"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YZ5"
FT                   /protein_id="ABJ61577.1"
FT                   /translation="MEIDQLLDNAVAEEASDIYILPNDDRFTIKFHAGGSIVTQEYLDN
FT                   KAAEKMISAIKYRAKMNISERRRPQLGRFQKQDIWIRVSTVGDFLNRETVVLRVIYPEH
FT                   NTQNWLAEKQFDDMKLKLPDSGLFLISGPTGSGKTTTLYHLLKSIAENKLVLTIEDPVE
FT                   INAPEFVQLQVNETAGIDYTELIKVALRHRPEILLIGEIRDVKTAQAVIQAALSGHLVF
FT                   STIHAMSTKDVALRLLELGVDKSQLEAALTKIVYQRLVPTIDNKQAAVADVVAGMPLKG
FT                   SPKFTNRWRETLADALKEGKITNETYQKFSAL"
FT   gene            424500..425510
FT                   /locus_tag="LEUM_0462"
FT                   /note="LactoCOG number LaCOG01430"
FT   CDS_pept        424500..425510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0462"
FT                   /product="Type II secretory pathway/competence component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61578"
FT                   /db_xref="GOA:Q03YZ4"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YZ4"
FT                   /protein_id="ABJ61578.1"
FT                   /translation="MKPIKNLARFNKRDQVLFFQELGELLSSGYSIAQSIDILASAHQK
FT                   WQSILSQVQKGLSTGQTFYQALEAFISPNILLQLRLSDQHGDISNTLVRIGQTLAKFQQ
FT                   QQSKLSQVMRYPIILLGILGLLLIGLKCFLYPMINQWRETNQEAINYPYAFIFCTGLLT
FT                   LTFLTLWLWYWHHLSSIQQLNMLAKVPFVGTIVRSIVTYQVSQQLSMLMFSGLTLPEII
FT                   DEVAQQNNKSYAVALAHDIQKHLKLGGNIERYILSQSFVNDSLAGYFIRGHKPKILARY
FT                   LDYYAKTQFKLLMQQTDRFIGTLQPLFFGIIGVAIVGLYMSMLLPMYQTIGGLYQ"
FT   gene            425507..425818
FT                   /locus_tag="LEUM_0463"
FT                   /note="LactoCOG number LaCOG01429"
FT   CDS_pept        425507..425818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0463"
FT                   /product="Competence protein ComGC"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61579"
FT                   /db_xref="GOA:Q03YZ3"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR016940"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YZ3"
FT                   /protein_id="ABJ61579.1"
FT                   /translation="MNIFKKSKKAFTLIEAAIVLFIISLLMLLILPNLNAQRKHAVENH
FT                   ATAMVSTVQTQIDLYQNDHPNQDNVTLAALKSENYLTEKQFQKAQDLKITIVHNEARK"
FT   gene            425802..426203
FT                   /locus_tag="LEUM_0464"
FT                   /note="LactoCOG number LaCOG03131"
FT   CDS_pept        425802..426203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0464"
FT                   /product="Type II secretory pathway, pseudopilin PulG"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61580"
FT                   /db_xref="GOA:Q03YZ2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YZ2"
FT                   /protein_id="ABJ61580.1"
FT                   /translation="MKHVNSGFTLIESAVTLTIVSLLLFVGAQTSARPKIDTQQWLATF
FT                   QTYWQNARLTAQHEQKTVEVIFDKKEVRFNNQVLVYPSGIKKDSQQRINVLTTGYVAPT
FT                   TVTLTGEQTIKLIFSLGGGEYRVETNNSK"
FT   gene            426181..426390
FT                   /locus_tag="LEUM_0465"
FT   CDS_pept        426181..426390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61581"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YZ1"
FT                   /protein_id="ABJ61581.1"
FT                   /translation="MKQIIQNKQSAFVLAESMLALILVSVCMSFEYEQVHQFHIHKSNL
FT                   ERKLKVAERERIDAINQWEGCNEK"
FT   gene            426380..426793
FT                   /locus_tag="LEUM_0466"
FT                   /note="LactoCOG number LaCOG03132"
FT   CDS_pept        426380..426793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0466"
FT                   /product="Competence protein ComGF"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61582"
FT                   /db_xref="GOA:Q03YZ0"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YZ0"
FT                   /protein_id="ABJ61582.1"
FT                   /translation="MKNDGFTLLEALISLLIAALVLTSLQFVVPFLKQISDAPKATVLQ
FT                   TITHQLETQKYTITSATLTSARLKSYEGKDMYLEVKNNKLQISGSGAGQIILMQNVTNL
FT                   AVDDRNNYLNLTITTNKGKFSSILHLKKTVQNE"
FT   gene            426786..427073
FT                   /locus_tag="LEUM_0467"
FT   CDS_pept        426786..427073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61583"
FT                   /db_xref="GOA:Q03YY9"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YY9"
FT                   /protein_id="ABJ61583.1"
FT                   /translation="MNKKNAYVLVPTIFVLGALSALFILQNMAFNQQLRAQTRLIEIAK
FT                   IDKIQMIVSTQVYKNNETKFNFDEAKVTVINKQIKIDLGKRIYQRELLVK"
FT   gene            427111..428100
FT                   /locus_tag="LEUM_0468"
FT                   /note="LactoCOG number LaCOG01349"
FT   CDS_pept        427111..428100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0468"
FT                   /product="Adenine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61584"
FT                   /db_xref="GOA:Q03YY8"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YY8"
FT                   /protein_id="ABJ61584.1"
FT                   /translation="MTQEKIAQYFDALTSASQSLVKDTNISYIDALIEILEDINSQTVH
FT                   REFDKPSNDVVQIIQSTIDMDWSLLSPAEKRKALQLAVLKANREDQTPANYQITPDGIG
FT                   YLLADFINQTARLRDNDTIIDMNVGSGNLLWTINEMLDVTVKRIGIDNDETQLALASAT
FT                   DEIINSDETTLYKEDTISIEEPPKAKVVIADLPVGYYPLQPSDKFITRNQNGRSFVHHL
FT                   LIEKSLDFVADDGWIYLLVPANVLNGDEAKKVLQFVTSRAQLKAFLQLPNEFFQEVRAT
FT                   KAILVLKKQRTKNNEVLMGQYPSLKDLKSLQNFLQEIKAWVKLENEQN"
FT   gene            428163..429422
FT                   /locus_tag="LEUM_0469"
FT                   /note="LactoCOG number LaCOG01348"
FT   CDS_pept        428163..429422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0469"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61585"
FT                   /db_xref="GOA:Q03YY7"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YY7"
FT                   /protein_id="ABJ61585.1"
FT                   /translation="MAKTMAVNAGSSSLKFQLLEMPAEQVIAQGVIERIGMDDAIVTIK
FT                   YGAEINAERLVGHSEDDEHITLSKDGKGKKYENVTAIKNHQQAINFMLQKLTDLGIIKD
FT                   FNEITGVGHRVVAGGEWFNHSVVVTDEVLAKIDRLADYAPLHNPANAMGIRAFQKLLPD
FT                   ALSVAVFDTSFHQTMPDENFLYALPYEYYTRYGARKYGAHGTSHRYVASRAAELLGKDL
FT                   KSLKLITLHLGAGASITAIKDGKSLDTSMGFSPLAGVAMATRSGDVDASLVYYIQEREG
FT                   LSNEEMLNILNKKSGLLGISTISSDMRDLLDVQDTNEHADMAIRIFINRVVKYVGQYVA
FT                   EMGDVDAIVFTAGIGENSVPVRKMIIDKLNYFGVKLDEEKNNVRGKEVEISTNDSKVKA
FT                   LLIPTNEELMIARDVESLKA"
FT   gene            429497..430798
FT                   /locus_tag="LEUM_0470"
FT                   /note="LactoCOG number LaCOG00428"
FT   CDS_pept        429497..430798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0470"
FT                   /product="Aminodeoxychorismate lyase family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61586"
FT                   /db_xref="GOA:Q03YY6"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YY6"
FT                   /protein_id="ABJ61586.1"
FT                   /translation="MQSRKERHQHEIKNAEAIEKGLDPFADTMNSGNKGGSPRKKRKKP
FT                   NRLILLLLLLVIVIGLFFGLKVLLTDNTAALDPNDTTFKTVKIPSGSTPSQMAKALQKQ
FT                   KVIKSSEAFYKYSLKHGAEDLQAGTYKISPSQTVQLIFKQLTMGPNAGPQLGKGYVLVA
FT                   TGQDQAAIAKNVASETKLSQDKVNKAFGDKSIISKMKSKYPDLLKNMSSKSNLADYVYP
FT                   AAYDLNKVTDVTDLMTKLLATSDKQLKSYYKDLNKDGINKPAVITLMATSGKSEFEHRL
FT                   AFVNKIAPYAQTLSKKYGILASISIAQAAHESNWDNSKLSSKYNNYFGVKTQDETAGKS
FT                   VVLETTEYVDGKPETQKARFAVYSDWKDSMKEHAETLVNGNTWNPNQFQDVLDAKNYKE
FT                   AAKALYKDSYATDVNYPKLIINLIETWNLQRFDK"
FT   gene            431182..432147
FT                   /locus_tag="LEUM_0471"
FT                   /note="LactoCOG number LaCOG01531"
FT   CDS_pept        431182..432147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0471"
FT                   /product="Putative glucose uptake permease"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61587"
FT                   /db_xref="GOA:Q03YY5"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YY5"
FT                   /protein_id="ABJ61587.1"
FT                   /translation="MSLAILLALVPALAWGSVGIVNTKMGGTAGQQTLGMTFGALIFGL
FT                   ATMFFFVMPRHIELSSHIWVVGIVSGLVWAVGTAGQFLAIKDLGVSLAIPLSTAGQIVA
FT                   NALMAAAVLGEWKTAKMWAIGVISIITVVIGATLISARDKAKNSAGIEAQEQKKDWTKG
FT                   LIYLIVSTIGFMFYFVLPNFLNKVGYISDAIKARGNGVDYMTAIVGPQAIGQVIGAFLI
FT                   VAFVLKESSIMFKLPTWRNIVTGLVWAAGNIFMFISAANPDVGQTIATTFSQLGIIVGT
FT                   FGGIYILGEKKSSYQMKLIVIGTILVVIGAIIIGNIYTFA"
FT   gene            complement(432229..432711)
FT                   /locus_tag="LEUM_0472"
FT                   /note="LactoCOG number LaCOG00429"
FT   CDS_pept        complement(432229..432711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0472"
FT                   /product="transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61588"
FT                   /db_xref="GOA:Q03YY4"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YY4"
FT                   /protein_id="ABJ61588.1"
FT                   /translation="MSEEKTYPMTAEGRDKLQLELEDLIANQRPEITKRIQIARSYGDL
FT                   SENSEYQSAKDEQAFVEGRIQTLKNMIDNAEIIDSNATAKDEVSLGKTVTFKELPNEEP
FT                   ETYAIVGSVEADPLAGKISNESPMANALIGKKVGETVAVPLPNGISIDVEIINVTK"
FT   gene            complement(432767..435376)
FT                   /locus_tag="LEUM_0473"
FT                   /note="LactoCOG number LaCOG00576"
FT   CDS_pept        complement(432767..435376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0473"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61589"
FT                   /db_xref="GOA:Q03YY3"
FT                   /db_xref="InterPro:IPR018580"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YY3"
FT                   /protein_id="ABJ61589.1"
FT                   /translation="MKSKIKKYTISPLALSFWIPFLVLIGYFAYRKMAPFGSNSILTVD
FT                   LGQQYIDQFAAFKYTILQHPSSFFYSFSNALGGDMLGEWAYYLMSPFNFIFLFVSNANL
FT                   PAAILLVICLKISAAGLSMGYLLKKLHLQHGYYITLFAINFALSGWFVANNLNLLWLDT
FT                   AVMLPLVIYQLEQVFYRQTWWRYSVLLAITIITNYYIGFMVAIFIVLYFLWRLTWPNVK
FT                   HRLTILWHFALGSIIGGALSAWLILPTYFQLTLGKSQYNSEFSFKFDNNPLHLFLKLIP
FT                   GSFDFDQMQSGQANFYVSAFILITLVTFITTRVIHWRVKVGAFAILSFLILATTWAPLT
FT                   LLFHGFQYPVWYPYRFSFLISFFVIYLAAMSWQPTWRPQKITLVLLFVSLVGVAVYAFI
FT                   NNQKTSYTDSNSIAIFIGLALLTLAQFTFKSHDRIWLPILSLITIVSLGANVALTLNHF
FT                   SYLTNTEYQNAIHALTDANQKIKKDRSWYRVAQTFQRTRGDSMMLNYYGGAHFSSALPK
FT                   ATPTFFGNFGQPDGDNYVVYSNGSVLSDAFLGMKYFITANGKDNGDAGQPSQHLIGFRP
FT                   DTKKYNLKATTKTTNVYQNKNALPLAFAASSGALNTKMLFNNPLQNQGNLWQGITGTTT
FT                   STVHVDNFQKSIGHNITAPSMITGSIITRQNAAKPASLDLQFTPTNNDSYYLTIGSGLD
FT                   IKNFDLLINGKVITQFNTYRHTVVVNLATNAKDKLQTITFRLKDTQTLALTNVTLYHID
FT                   NERIANDSTNLKQNGLKISKRSQRRIEGTIKTTTKKPLVMTTIPSIPGWQVKVDGKTVK
FT                   TTKVANYFIAVKTKPGLHKISFVYTPPLFYYGVIISLLALLLLLIINRKSIAKKIHT"
FT   gene            complement(435465..436082)
FT                   /locus_tag="LEUM_0474"
FT                   /note="LactoCOG number LaCOG01986"
FT   CDS_pept        complement(435465..436082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0474"
FT                   /product="Saccharopine dehydrogenase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61590"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YY2"
FT                   /protein_id="ABJ61590.1"
FT                   /translation="MTKNILILGANGQIAKIVVDILANTDTKITLTSLHARPEKSIKSL
FT                   DATKEENLVRALKDIDIVYANIGAEGRQKNAANALVNAMHTAGVKRLIWVATIGIYNEI
FT                   ATETADIWRNILGTPDNENTYMGDQAAAAKRIEESQLDYTIIRPNELTDDNKMQQVNVQ
FT                   TDPHEKIIGGPITRTSVAEFIAQLLLNPEQHIAESVAISSTK"
FT   gene            436207..437358
FT                   /locus_tag="LEUM_0475"
FT                   /note="LactoCOG number LaCOG02047"
FT   CDS_pept        436207..437358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0475"
FT                   /product="Predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61591"
FT                   /db_xref="GOA:Q03YY1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YY1"
FT                   /protein_id="ABJ61591.1"
FT                   /translation="MSLTYQKLLVAVPLILRGGDVPTIVGEAGIGKSALVAEIAKKLGA
FT                   KLFTTVVSLSEKGDLAIPIPPLNETSFLQTKNYGRLADIKFGYTHTLIQIIEQAEVEPD
FT                   RTIIWFLDEFNRGSQAVQGELMNLVLQRQINDLVLPDNVKLILAENPDDSMQGFENAEY
FT                   AVQTSDAAIKDRTTRLVMTVSVRDWLQWAASGKKRPHIHDLVRQFIAENAELLYPKNRD
FT                   IDLNPTPRAWQRVSDNLFQLQKLTNEQQDELLFDIVAGDLGDNCATQFVTFVQEKTTSL
FT                   TAEDVFDSLPSGPKLPQTIREKFESFSEIQKLNVMKTLLLTADMRLDNNAGRFSELLNL
FT                   IAPDGQYALVKQMTSAPILDDLYASDNHYANVLYQQIMDIATR"
FT   gene            437355..438512
FT                   /locus_tag="LEUM_0476"
FT                   /note="LactoCOG number LaCOG02046"
FT   CDS_pept        437355..438512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61592"
FT                   /db_xref="InterPro:IPR018698"
FT                   /db_xref="InterPro:IPR025154"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YY0"
FT                   /protein_id="ABJ61592.1"
FT                   /translation="MKSENDNLIIDGIKTLLDVSPLYGNIVMNLVREVNPQAANPLALK
FT                   WQGHHWYLLVNPNLLTARFTSHNQVAAALAHEALHVIWQHPTRYAKEREHNQMVDIGTD
FT                   LAVNQYLPRDLGELPGAISFQTINELYHINLPHNQDSSTYISLLSEVDQKNSRAKKRAL
FT                   PKHTEWQSASNSIEEAESALKNVIKKANDDTKYAGRGNVSGAVLQQISEVVVPKRNWKS
FT                   ILRSGISQAPNKKKDSRARFNRRQAYRLDLPGEISRYDTEIAVFIDNSASISNSQASEF
FT                   LANAMQITKQFDINVHFFSFDTKVHQIKNIKTWQRHAGGGTTFQSIFDALPALKFFPLQ
FT                   TLVVIFTDGDGEKELIQTKFKHVYWLLPEGQTLSIPSPFGKVITL"
FT   gene            438509..438799
FT                   /locus_tag="LEUM_0477"
FT                   /note="LactoCOG number LaCOG02045"
FT   CDS_pept        438509..438799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61593"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YX9"
FT                   /protein_id="ABJ61593.1"
FT                   /translation="MKLKPRDLKSFIDKDIRYKRAEALLIGQWESLLLSEPWDMPMITR
FT                   ADVSFAKTLSEANVVKTDVDLSTFKGVQKFISHNNSRLSPDVVKLLKEPFL"
FT   gene            438796..439302
FT                   /locus_tag="LEUM_0478"
FT   CDS_pept        438796..439302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61594"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YX8"
FT                   /protein_id="ABJ61594.1"
FT                   /translation="MKINLVLAPEQPVSELLTLQSAQPQNVFYLGKISQLAGTNLLIID
FT                   AQNVVAKFARPIGFESRAVIGQFKGNVIHQIAFQAKDNNDELIAKLLTGNAIMAQNDNG
FT                   KSEYMIWSFWSTHDELARFLASEIYQQMHALMKNAYTTTYQHVTDQSQLSLTTKMRDFD
FT                   KGWWG"
FT   gene            439418..439480
FT                   /locus_tag="LEUM_0479"
FT   CDS_pept        439418..439480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61595"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YX7"
FT                   /protein_id="ABJ61595.1"
FT                   /translation="MQNMNQKQNSSQALLLLLML"
FT   gene            439653..440828
FT                   /locus_tag="LEUM_0480"
FT                   /note="LactoCOG number LaCOG01977"
FT   CDS_pept        439653..440828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0480"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61596"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YX6"
FT                   /protein_id="ABJ61596.1"
FT                   /translation="MKKIVIIGAAFIVAIGGIVAFGVVNKSSKASTSNVIKIGGVFDTS
FT                   GDASSYGKAEQDGANFATKQINANGGVKVNGKSYKFKIINKDAKTDNTETASVTSSLIN
FT                   KEKVSAIVGPVITSGVQAAVPVATQGKTPMISPTAGADNITLQKNGNVQPYVFRAQYKN
FT                   SFMGTKMAQFATETLKAKNIVIFQDNSSDYGTGITSAFKKAFKGNVVDVESYQEGTKDF
FT                   QAVLTKIKDKKFDAIAINGYYTEGGAILKQMRDMGIDVPVIGPDGIGDPKTAEIAGNKN
FT                   TSNVYYAAHFSVDAPATKVSAPFAKAYKKAYGKYPSQFTALAYDSVRMIKAAIENENST
FT                   SKSAITKGLANLKNFDGVTGKMSIDKDHNPVKSMVMVGMTDGKESSAVVVK"
FT   gene            440886..441764
FT                   /locus_tag="LEUM_0481"
FT                   /note="LactoCOG number LaCOG01976"
FT   CDS_pept        440886..441764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0481"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61597"
FT                   /db_xref="GOA:Q03YX5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YX5"
FT                   /protein_id="ABJ61597.1"
FT                   /translation="MTTFIQQLINGLMLGSVYALLALGYTMVYGIIKLINFAHGDIYML
FT                   GAYFGYFFIKVLHLNFFIALILAMAVSAIIGVVIEYIAYRPLRHSPRIAVLISALGISF
FT                   LLENGMTYLYGSDQRSFPQAIKTVQYHFYGIQVSNIQLIIAVTSIVLMLLLTYIVKNTK
FT                   MGRAMRAVSADPDAASLMGININHTISFTFAIGSALAAAGGVLIGLYYNSIDPLMGMTP
FT                   GLKAFVAAVLGGIGIIPGAAVGGWLIGILETMVQATAFSDYKDAIVYAMLIVILLIKPT
FT                   GILGKNKREKV"
FT   gene            441764..442738
FT                   /locus_tag="LEUM_0482"
FT                   /note="LactoCOG number LaCOG00898"
FT   CDS_pept        441764..442738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0482"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61598"
FT                   /db_xref="GOA:Q03YX4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YX4"
FT                   /protein_id="ABJ61598.1"
FT                   /translation="MDQAHIKYTLSWASLAAMGFILIFVAQMLGLIGHYGITTIVLIGI
FT                   NIIAALGLNLVVGISGQFSLGHAGFMAIGAYATALVMEVVPGIIGFILGMAAGIVVSGV
FT                   IALIVGIPTLRLRGDYLAIATLGFAEIIRIVIMNLKITNGPAGIFGIAPFVSWQLVYIL
FT                   AVITLIIVVNFVRSMPGRAIIAVRDNEIAAESLGINTTKYKVIAFVTGALFAAMAGSLR
FT                   ASFIQSIAPKDYAFMQSIMILIIIVIGGIGSMSGTVVTAIALGVLDTMLQNFGSLRMVI
FT                   YAVILIAVMLVRPQGIFGSRELSLKKWLFDEGDGHGSDNTENA"
FT   gene            442710..443495
FT                   /locus_tag="LEUM_0483"
FT                   /note="LactoCOG number LaCOG01975"
FT   CDS_pept        442710..443495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0483"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61599"
FT                   /db_xref="GOA:Q03YX3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YX3"
FT                   /protein_id="ABJ61599.1"
FT                   /translation="MAQTILKTRDLSIRFGGVTAVDGVNIEAAENELIGLIGPNGAGKT
FT                   TLFNLLTGVYSPSEGEVLLFDGQQLANVNRQSPAKRARLGVARTFQNIRLFESRTVLEN
FT                   VMIAMNSSTQAHVFSSLFRLPSFYKNEEQLKNEARKLLSIFDMLEVQDTLATNLPYGQQ
FT                   RRLEIVRALATKPKILFLDEPAAGMNPQETADLTRLIKQVQQEFKMTIILIEHDMNLVM
FT                   AVSERLYVLEYGKLLASGTPLEIQQNADVIRAYLGENNE"
FT   gene            443492..444205
FT                   /locus_tag="LEUM_0484"
FT                   /note="LactoCOG number LaCOG01974"
FT   CDS_pept        443492..444205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0484"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61600"
FT                   /db_xref="GOA:Q03YX2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YX2"
FT                   /protein_id="ABJ61600.1"
FT                   /translation="MSALLTVENLNVSYGAIKAVQDVNFVVNNNEIVSLIGANGAGKTT
FT                   ILRTISGLEKPTKGRILFENQNILTMNSERIVSSGVAQVPEGRRVFSGMTVQENLQLGT
FT                   FTRGKGINLKDEYTLIYDQFPILKERRNQDAATLSGGEQQMLAMGRALMAKPKLLLLDE
FT                   PSMGLAPLFIEKVFDIIKNVNAQGMTVLIIEQNANQALKIADRGYVLESGKITMTGTGA
FT                   ELLASDDVRKAYLGG"
FT   misc_binding    444243..444333
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="THI element, riboswitch"
FT   gene            444478..445257
FT                   /locus_tag="LEUM_0485"
FT                   /note="LactoCOG number LaCOG00856"
FT   CDS_pept        444478..445257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0485"
FT                   /product="Hydroxyethylthiazole kinase, sugar kinase family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61601"
FT                   /db_xref="GOA:Q03YX1"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YX1"
FT                   /protein_id="ABJ61601.1"
FT                   /translation="MNITDIRTKSPLVLTYANFVTPQFVANVVNVVGASPLMSRELAEF
FT                   KELAGIANAVIINTGTLQKVEINDIIKLSQEAYQLGKPVVLDPVAVSVPFRSKAITQFL
FT                   ASGHVDVIRGNAAEIAWFADIDFASQGIDATGKGDVIEIAQRAAKKTGAVIALSGACDV
FT                   VSDGQYTQTLDINVEQLSSIVGTGDALSSLIGAFIADGLKVPNVMNAMATFKLAGQKAA
FT                   TKTNQPGSFTNQLLDELFVIDNIDVQNFVKESVLNHG"
FT   gene            445250..446083
FT                   /locus_tag="LEUM_0486"
FT                   /note="LactoCOG number LaCOG00855"
FT   CDS_pept        445250..446083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0486"
FT                   /product="Hydroxymethylpyrimidine/phosphomethylpyrimidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61602"
FT                   /db_xref="GOA:Q03YX0"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YX0"
FT                   /protein_id="ABJ61602.1"
FT                   /translation="MVNKTPQVLTIAGMDSSGGAGVSADLKTFAAQGVYGANVIVALTA
FT                   QNTMGVQQVSMTSPSMIHAQLKSVADDLKISAVKSGMLGDVPTVEAVAEFLQQADFGNY
FT                   VLDPVMVAKGGAHLLSDEAIVAIKSSLIPLATLITPNMPEAEVLSGSNITNHEDVMQSA
FT                   SKIQQLGVENVLLKGGHASGKDVYDYILLADGSHFWLKSSRVDTIRTHGTGDTISAAIT
FT                   ARLALGDDMKTAIIRAKAYVDATIREGIDVGHGHGPLNHQARVTDRHFPEVLENV"
FT   gene            446076..446714
FT                   /locus_tag="LEUM_0487"
FT                   /note="LactoCOG number LaCOG00854"
FT   CDS_pept        446076..446714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0487"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61603"
FT                   /db_xref="GOA:Q03YW9"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YW9"
FT                   /protein_id="ABJ61603.1"
FT                   /translation="MFDPSILVNYFVLGTQDTNGERHFFEVLEEALQSKISVFQYREKG
FT                   QLALSGSEKLRVAKKVRQLTADYHVPLIIDDDIQLAHEIDAEGVHFGQKDGDIINNIQL
FT                   AGNLAVGVSVSNDSQYKRIENIKGIDYIGIGPVFATVSKADANPEIGVEGLKYLTSKSK
FT                   WPSVAIGGISEINLSSVLSTGVNGAAVISMISQSANISATLKYWRSLHL"
FT   gene            446834..448240
FT                   /locus_tag="LEUM_0488"
FT                   /note="LactoCOG number LaCOG01992"
FT   CDS_pept        446834..448240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0488"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61604"
FT                   /db_xref="GOA:Q03YW8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YW8"
FT                   /protein_id="ABJ61604.1"
FT                   /translation="MSYQTINPFNDEVIQTFDNHDDAYVEKAIAEGHALYKKWRNDPAS
FT                   SRAEILNKIADLMEEDADHLAKVLTIEMGKRFVEAQGEVALSVSIARYYAKNGADFLKP
FT                   EPIKSSMGDAQVISRPTGVLMMVEPWNFPYYQIIRVFAPNYIAGNPMLLKHASNTPMAA
FT                   SEFEKIVERAGAPTGAFANLFIDYDQVNKIIADDRVQGVALTGSERAGQLIAAEAGKNM
FT                   KQSSLELGGSDPFIVLEDADLSEIKKIIGGARLYNAGQVCTSSKRFIVTEKNYDAVLTM
FT                   LKDAFAEAKLGDPLLEDTTLAPLSTSKAKKNLTKQVKAAVDAGATLEYGSVVQDKPAAL
FT                   FDPVILTGITKDNPAYYQEFFGPVGQVYKVKDEEEAITLANDSNYGLSGVVFGGSPEHA
FT                   TEVASRIETGAVYVNSFGGTLPELPFGGVKNSGYGRELGRFGIETFVNKELIVTKKEPI
FT                   DLDNAFGGFV"
FT   gene            448352..449092
FT                   /locus_tag="LEUM_0489"
FT                   /note="LactoCOG number LaCOG00335"
FT   CDS_pept        448352..449092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0489"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61605"
FT                   /db_xref="GOA:Q03YW7"
FT                   /db_xref="InterPro:IPR010406"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YW7"
FT                   /protein_id="ABJ61605.1"
FT                   /translation="MTSMQRSFTCFVDGEEKNVVDGVLLAELDIELQQKIKHDFPDSML
FT                   ADFICFDHLLQYRLEKIDKMILEKHRTNKHINNKLTHILTDKSFKVVNVNKHQRESYTF
FT                   GQKIADNVAHFGGSWGFIIVSICAMIMWIITNVFQLFNMHFDPYPFILLNLFLSMVAAL
FT                   QAPLILMSQNRSSDYDRLHADNDYHVNLKTEEEMRVLHAKIDRIIQKDNPDLFEIQKMQ
FT                   TKMLGELQKQVNELHSHQKIKNVD"
FT   gene            complement(449142..450953)
FT                   /locus_tag="LEUM_0490"
FT                   /note="LactoCOG number LaCOG01926"
FT   CDS_pept        complement(449142..450953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0490"
FT                   /product="oligoendopeptidase F"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61606"
FT                   /db_xref="GOA:Q03YW6"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR011977"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YW6"
FT                   /protein_id="ABJ61606.1"
FT                   /translation="MTYSQKWNLENIFPGGITSPQLTQKYELIAKQINDFTDMIADYSL
FT                   AQDKYFTVLADLADLAQNIGAGIGTANIFVNGWSSVDYGNSVYAPHFNKLGNLWVSFSS
FT                   PLNAFQKLLSKLDDETFEKAITTSRLAPIAFYLTELRTDAKRLLDDKTETLINKFDLDG
FT                   QQAWSQHYDTISASLSMSYTDENNKTRQISAGQALNMLDGEPDNEVRANLMTNYEKMWA
FT                   KAENLTSDTLNHLAGFRLTNQEAHGRQSHLEQPLELNRMSRGTLDAMWQVVDANKSMFK
FT                   PYFERKKQLLGLKSIGWQDQVAPLTNIGDYKPSDVSYDDAAKFIIEQFGKFSPKMATFA
FT                   QKAFENNWIESENRPGKQPGGYMESVPDLHESRIFLTYTGSVNDAATIAHELGHAFHSA
FT                   QLTDLPFWRDAYAMNVAETASTFAELIVNDANVKEAKTDAEKIVLLDAKMTNPIAMFLN
FT                   IHARFLFEDSFYTERKHGLVTPQRLNQLMDNAQKEAFDGILDVRHPHFWSSKLHFFIDS
FT                   VPFYNFPYTFGYLFSSSIYAQAQKDGDNFEEKYIALLRDTANMTSEELAKKHLGVDLTK
FT                   PEFWQTGADLVKKDIDEFLSLSEQFIK"
FT   gene            451111..452040
FT                   /locus_tag="LEUM_0491"
FT                   /note="LactoCOG number LaCOG00073"
FT   CDS_pept        451111..452040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0491"
FT                   /product="hydrolase of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61607"
FT                   /db_xref="GOA:Q03YW5"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YW5"
FT                   /protein_id="ABJ61607.1"
FT                   /translation="MKRKYKWLIGCLVFIAILLLSAGMYFFHVAEVRDVAADKPDKLRA
FT                   KTNSLYHYEHDFLSREKQTWTQKTSDNLKLIAWYVPAEKKTGKTAILAHGWHNNKTTMA
FT                   IYGELFHELGYNVLIPDNRAHGDSQGEMIGYGWLDRRDYIGWLNQILENNGQKSDIVMY
FT                   GMSMGAATVLSTSGENDLPNQVKAIIADSSYTSVIEEIKHEAGDMYGLPWFPLVNVVSG
FT                   ISKVRAGYSYEEASPLRQVEKNTRPTFFIQGGADTFVPTKMVYPLYNASRGPKQLWITK
FT                   GSKHVQSFHDYPVAYRSKIKAFLEKYDK"
FT   gene            complement(452099..452503)
FT                   /locus_tag="LEUM_0492"
FT                   /note="LactoCOG number LaCOG00962"
FT   CDS_pept        complement(452099..452503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0492"
FT                   /product="Fe2+/Zn2+ uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61608"
FT                   /db_xref="GOA:Q03YW4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YW4"
FT                   /protein_id="ABJ61608.1"
FT                   /translation="MTDQKLRTILQEHGLKATYQRMAVLEYLATNKTHPTAEMIHEDLN
FT                   NISLATVYNTLDKLIETGLIIAIDIHDDGKRHFDYYGEPHYHIINQQTSEIIDADNFDM
FT                   APLFDAARKASGLNITGYHIEIFGVNPEDS"
FT   gene            452626..453312
FT                   /locus_tag="LEUM_0493"
FT                   /note="LactoCOG number LaCOG00961"
FT   CDS_pept        452626..453312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0493"
FT                   /product="Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61609"
FT                   /db_xref="GOA:Q03YW3"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YW3"
FT                   /protein_id="ABJ61609.1"
FT                   /translation="MSEKSEKTSFMQRNNIIRAAVMGANDGILSVSGIVLGVAGATSHT
FT                   DTILLAGFAGMLAGTVSMAMGEYVSVNSQHDAQEKVRQIQTRAVANDYDGEFEFVQKKY
FT                   EETGISSTLAQQATQEMMSKDPLVTSVRERYGFSLNQELSAGHAALASLVSFPIGSILP
FT                   MVAISIAPQGTREIATFIAVIVALAITGYAAAQVNGANKKHSVIRNVIAGIFTMIVTFL
FT                   IGSLFR"
FT   gene            453327..454010
FT                   /locus_tag="LEUM_0494"
FT                   /note="LactoCOG number LaCOG00960"
FT   CDS_pept        453327..454010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0494"
FT                   /product="Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61610"
FT                   /db_xref="GOA:Q03YW2"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YW2"
FT                   /protein_id="ABJ61610.1"
FT                   /translation="MEKVKKHETMDERLNAIRAGVLGSNDGILTVVGVLFSVAAATTNQ
FT                   FAIFIAGLADLVSCALSMASGEYASVSSQSDSEKVAVETEKELLKTDMPGQHRCVRDFY
FT                   MERGVSEKTASAIADELLQKKPLETVLSVKYDITLGHYMSPWSAAWSSLFSAALGGAFP
FT                   LLTLLIVSGKYQFVATIAATVVAVALTGFLSAKISNGLVKRAVIRNIIIGLITIAIHFG
FT                   IGKIF"
FT   gene            454088..454948
FT                   /locus_tag="LEUM_0495"
FT                   /note="LactoCOG number LaCOG00410"
FT   CDS_pept        454088..454948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0495"
FT                   /product="Ribonuclease BN-like family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61611"
FT                   /db_xref="GOA:Q03YW1"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YW1"
FT                   /protein_id="ABJ61611.1"
FT                   /translation="MNKKIMHKWRVLDARLKISTLTTFFTRSQIGYVGPTFAYYALLTV
FT                   FPILMGAALIVSFTSISTADLLAMMRNVLPKNIENIVIPIMESVLSSRSTSLLSFSVLF
FT                   TIWSISRVIAVFRQSFNAIADVKEHINSLFTRAFSFIWLLFILTLFALLMVGSNVLTIV
FT                   IQHLPYSEWTNFLQHQTRWFIWLGIWLALVMMNFFLPAKDARAPFRFVLVGSFLELVML
FT                   NLLNRGFTFYAQFALGKYDFYQSVSSMIAMLIWLNLIATILVLGYVVIKWLSVINWRKE
FT                   DVSKQ"
FT   gene            454932..455525
FT                   /locus_tag="LEUM_0496"
FT                   /note="LactoCOG number LaCOG01160"
FT   CDS_pept        454932..455525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61612"
FT                   /db_xref="InterPro:IPR009403"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YW0"
FT                   /protein_id="ABJ61612.1"
FT                   /translation="MFRNSDFDIFEDKTLNGRMEKIRTIIDPKFEEFASIALPILNTNG
FT                   QEWYAHVAKHLRRTTYAPDNTWVAFAPNKRGYKMLPHFELGIWEDNVYFYLAVEENMKP
FT                   DQTNVITQKLREVSPLVRELPDSYRLSQDHMVNKTYSLLQYDDSIERYESVKHSEVLIG
FT                   VEIKRGDKLWDGDGIVDTLVLAMKNLLPIYEKIK"
FT   gene            complement(455569..457656)
FT                   /locus_tag="LEUM_0497"
FT                   /note="LactoCOG number LaCOG00278"
FT   CDS_pept        complement(455569..457656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0497"
FT                   /product="sodium/proton antiporter, CPA1 family"
FT                   /note="TC 2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61613"
FT                   /db_xref="GOA:Q03YV9"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YV9"
FT                   /protein_id="ABJ61613.1"
FT                   /translation="MTALYTLALLLIGVIGTNLIKQFFPKIPEPFILIIVGIFLSFTPI
FT                   FQNFELEPEFFMLMIIAPLMFLDGQKQSFSKIKKRFSIIFLLSVVLAVATAIVVGLIAN
FT                   RVEVQWTLPLAIALAAIVVPTDAVAVKSMTSSVDMPNGVGEALELESLFNDATGLVLLD
FT                   LALSVLEQGKFSLIAGIGHFLFVAVDGALIGVIAGFLLVTIRTNITFRTVSPETTIIPI
FT                   SLLTPFIVYFLAESFGTSGILAVVATGIVHNWESNKLRLTSTRVQLTSNTIWESISNVL
FT                   NSIVFIILGISLPIVWQEIIHMGLVGIMQLLGLSILIYIAMYAVRYIWAFREDNQSANT
FT                   FFDSHSNPKQHRFLSHIFAISGVHGTMTLAMAFSLPLTIANHAFPYRAELIVVATLIIL
FT                   ISMLMSAIILPIALPKKAVTYTKADLENTRNKMVDYASLKVSETTANPAVREAIMIQLQ
FT                   SQKGWLNDNHSTRNYNSQKYNSLLNNTKDFIIHYLHSDSVEQKYSSEVIDAYEKILNRL
FT                   KISSFFQHSPLQRFFHYVKARYRHIKWHVRNGQITKKQRLKGRKKWAKEHQGSAQQWQN
FT                   IHEGLLLLNNDVIGEVNQHFDNLLRNSLENDTDDHQYISYVRQRFDRYFNLIKREYNQE
FT                   TPTINTDLYIQAFQFEYNYIQQASSTGIIPNTLAAVLYNEINEAQTLELQQINQIEAMN
FT                   S"
FT   gene            complement(457702..458679)
FT                   /locus_tag="LEUM_0498"
FT                   /note="LactoCOG number LaCOG02245"
FT   CDS_pept        complement(457702..458679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0498"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61614"
FT                   /db_xref="GOA:Q03YV8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YV8"
FT                   /protein_id="ABJ61614.1"
FT                   /translation="MTINVIAEMARVSKTTVSRFLNGKFDNMSEATKERIAETIAELDY
FT                   HPSRQAQALKAKNSLLIGISVADISNMYTSRLLKGISDYFQNTIYQVLIMDGDNSIERE
FT                   YSNLEKMVTERIDGIILQPLVHQPDHYQLLIDENIPVVQVDRYTEPFTWPAVVSDNFQK
FT                   SLEVADLMKSKNYEEIIVLSNHINGVSSRMNRYNGLKTGIENTNITIKLIEIDDNKDWQ
FT                   NTLQSMLESPTKKALYALNGQVLWEIVRFLKKHHIAIPDDVGVIGYDDDMFADMISPEI
FT                   TSVSQNPQEIGRTAAANLMQIMNDKTTLSKTIRIPSTIQMRESL"
FT   gene            458811..459065
FT                   /locus_tag="LEUM_0499"
FT                   /note="LactoCOG number LaCOG02246"
FT   CDS_pept        458811..459065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61615"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YV7"
FT                   /protein_id="ABJ61615.1"
FT                   /translation="MEKEQLHIDPEKFALQFLESFKLNFDAKNLEGMAKQQLAAYLSAY
FT                   FLVEKFNKIEGENFDRSQPNLSDLGFDELLKHVTELNKY"
FT   gene            459076..459819
FT                   /locus_tag="LEUM_0500"
FT                   /note="LactoCOG number LaCOG02069"
FT   CDS_pept        459076..459819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0500"
FT                   /product="Sugar phosphate isomerase/epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61616"
FT                   /db_xref="GOA:Q03YV6"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YV6"
FT                   /protein_id="ABJ61616.1"
FT                   /translation="MRKEQIVLNNLVFMNDHEKGMQQLEMLKKAVSFGVSSVELRREYF
FT                   DDIVKETPAIAQYAVDNKLRLFYSVPDEVFVNHRLNPKLAQYYNEAQALGIYAIKFNIG
FT                   DFETLSSEDVSELNQLLARGIQTNIENDQTQVSGKIKAIEKFMSAVTENNLDIRYVYDM
FT                   GNWRYVGEDEVVAAEKLTQYVRYIHVKDDQGHGDNLVTVPLNEGDIAWQSILNILPSNV
FT                   PVAVEYPTVNDKVIQDGVQALAIFN"
FT   gene            459835..461112
FT                   /locus_tag="LEUM_0501"
FT                   /note="LactoCOG number LaCOG02247"
FT   CDS_pept        459835..461112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0501"
FT                   /product="H+/gluconate symporter related permease"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61617"
FT                   /db_xref="GOA:Q03YV5"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YV5"
FT                   /protein_id="ABJ61617.1"
FT                   /translation="MTNIIISILLLLTFVGFIYYIVKGGNLVIGFFVMALLWSVIGLVP
FT                   FDQVVQKVIAEPALNYGPTIIYIVFGSWFGRVLVDSGIAGSISAQTERVGRKAPIFATI
FT                   LVVLVTALIFSSAYGVGSVIAIGVILIPILLSIGVPKKVAIPAFTMAIGAPMYINVVLF
FT                   NQIKAFFPSVSFSGKYLIFGLAAMGVQLLGVIVFILLNSKSIKNGEIETIDDSKQATFQ
FT                   KTHPITFIIPVLPVALNMFFHWDAIPALLLATIIALLLTGQMKSYKGLVAFINKTVSQA
FT                   INDISGLIIFLMALVMFAGAATMNVPHFKSMIEVILPSSPLVLAIAIGILAPLALFRGP
FT                   LHVWGAGAATAAVLAATGTFQPIFLLPLLYTASIMAVSIDLTQSWNTWALTYSKLETKE
FT                   YLKMGIPVMWVVSFVNELLVYGFFGH"
FT   gene            461134..462096
FT                   /locus_tag="LEUM_0502"
FT                   /note="LactoCOG number LaCOG01066"
FT   CDS_pept        461134..462096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0502"
FT                   /product="2-dehydro-3-deoxygluconokinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61618"
FT                   /db_xref="GOA:Q03YV4"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YV4"
FT                   /protein_id="ABJ61618.1"
FT                   /translation="MSEILTLGEPVVTFASTDLNKGLVDSINYYKFLGGAELNVMIGAT
FT                   RLGHNTEYISQVGADPLGQFTIKEIARYNVGNHYIATDEGNWTAFQLKELVDQGDPSTF
FT                   NFRRNSAAAHFDKSLIDQVDFSDVKIAHLSGIFPAISLQAREAFRYFAEQLIDHGIRTT
FT                   FDPNLRPALWESREVMIETINDLAKYGEIVLPGIDEGEILIGSRDPETIADFYLNNSDR
FT                   TQTVVVKIGSDGAYVKNKSGESYIVNGFKVEKVVDTVGAGDGFALGLITGLIEGLTMAD
FT                   AVRRGNAVGALQVQTPGDNDGYPTQEELEAFLADNKKEA"
FT   gene            462098..463042
FT                   /locus_tag="LEUM_0503"
FT                   /note="LactoCOG number LaCOG01668"
FT   CDS_pept        462098..463042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0503"
FT                   /product="Lactate dehydrogenase related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61619"
FT                   /db_xref="GOA:Q03YV3"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YV3"
FT                   /protein_id="ABJ61619.1"
FT                   /translation="MTKQVFLPDDIPAVGKKILEEAGLEVVVGSGRDHEKMKAEGVEAS
FT                   AVLIGTQKFDADIMDAMPNLKVIARNGVGYDAVDVDAATQRGIYVVNTPKALSGSVAET
FT                   AVSELLAISKNLYQDSKAIHDDNWNYRKAHPGRDIEGKTVGILGFGRIGQQVAKKLSGF
FT                   DVKVIAFDPFAKDVPGVELVDRETIFKTADYVMVHLPALPETQHSIGADEFKLMKNDAF
FT                   LINMARGSILVESDLVLALKSGEIAGAALDVFEEEPLPVTNPLVALENVLLTPHIASNT
FT                   VETKARMAVDATNDIVRVLSGKNPESAVNKIGK"
FT   gene            463124..465658
FT                   /locus_tag="LEUM_0504"
FT                   /note="LactoCOG number LaCOG00215"
FT   CDS_pept        463124..465658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0504"
FT                   /product="lysyl aminopeptidase, Metallo peptidase, MEROPS
FT                   family M01"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61620"
FT                   /db_xref="GOA:Q03YV2"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YV2"
FT                   /protein_id="ABJ61620.1"
FT                   /translation="MTQFTRLYNNFQPEHYDIYLDINRETKQFNGRTKISGNALVNNIA
FT                   LHQKNLQIQSVHINEKEIPFVIDDNADLIKISTETIGQIDITVTYKATLTDTMMGIYPS
FT                   YYELDGVKKQIIGTQFETSFARQAFPSVDEPEAKATFDLSIKFDEQPNETILANMPEIR
FT                   TENGVHYFDTTVRMSTYLVAFAFGELQSKQTVTNTGVKVGVFSTKAHAPKELDFALDIA
FT                   KRSIEFFEDFYQTPYPLPHSWQLALPDFSAGAMENWGLVTYREAYVLLDPENSALNTKQ
FT                   IVATVIAHELAHQWFGDLVTMKWWDDLWLNESFANMMEYVAIDAIEPDWHIWESFQTSD
FT                   VVSALKRDSTDGVQSVHTQVEHPADIDALFDPAIVYAKGARLLVMVRSLIGDKALREGL
FT                   KRYFARHRYANAAGADLWEALGEASGQNIKAVMDSWLEQPGYPVVSAKVIDGQLTISQE
FT                   QFFIGEYEESDRQWQIPLNSNYDVAPQILSSKRVVIGDYAQLRESVGTPFRLNDGNDSH
FT                   FVVKYDAQLLKDILEHLDELDNISQRQILQDLHLLADGRQITYADIVPLLVNFAHKDAM
FT                   LVNAVLYSILSDLKKFVTPNSAEEKALKEFYDVLSRKQVKRLGWAGQSGESYDNQLTRP
FT                   YVLNASLYAENPDTIATAHELFEKNSDNLQNLSADIRHFVLANELKHFGNTSLFEQLLT
FT                   TYRKSSDANYKADLRSALTSTPKPDLIVKLIDQLKDADTIKPQDLRGWVYGLLVNDKSQ
FT                   QLVWDWVREQWQWLEDTIGGDMEFTMYITVIAIVFHTPERLAEFKAFFEPKLNTPGLTR
FT                   EITMDIKVISSRVGLIAAEKDGVNKAISEAIK"
FT   gene            465801..467573
FT                   /locus_tag="LEUM_0505"
FT                   /note="LactoCOG number LaCOG00663"
FT   CDS_pept        465801..467573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0505"
FT                   /product="Predicted oxidoreductase; Myosin-crossreactive
FT                   antigen ortholog"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61621"
FT                   /db_xref="GOA:Q03YV1"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YV1"
FT                   /protein_id="ABJ61621.1"
FT                   /translation="MYYSNGNYEAFATPRKPKNVDQKSAYIVGSGLAGLATAVFLIRDG
FT                   HMKGESIHIFEELPLAGGSLDGIQRPNVGFVTRGGREMENHFECLWDLYRSVPSLEIPG
FT                   ASYLDEYYWLDKDDPNSSNCRLIYDRGNRVPNDGDYTLGKSSEEIIKLIMTPEAKLGTT
FT                   TIEDYFSEDFFKSNFWIYWATMFAFEKWHSAIEMRRYAMRFIHHIDGLPDFSALKFNKY
FT                   NQYDSMVLPLIKYLEDHGVDVQFDSTVDNVMVNFDHGNKVVKELQLTVAGKPETKQLTA
FT                   NDLVFITNGSITESTTYGSHFEPAPVTNEPGGSWRLWEKLAEQSDEFGHPSVFYQNLPA
FT                   KSWFVSATATIKNTEIDPYIERLTKRDLHDGKINTGGIVTITDSNWLMSFAVHRQPHFK
FT                   QQKPNETTVWIYGLYSDVPGNYVKRTIVESSGQEITQEFLYHLGVPKSKINQLAQQESI
FT                   NTVPVYMPFITSYFMPRVMGDRPKVIPDGSVNLAFIGNFAESPSRDTVFTTEYSVRTAM
FT                   EAVYSLLDVERGVPEVFNSIYDIRELLRAMYYMNDKKPLSEMDLPIPKLIQKVGLKKIK
FT                   GTWLEELLAEAHLL"
FT   gene            467646..469976
FT                   /locus_tag="LEUM_0506"
FT                   /note="LactoCOG number LaCOG01371"
FT   CDS_pept        467646..469976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0506"
FT                   /product="dipeptidyl-peptidase IV, Serine peptidase, MEROPS
FT                   family S15"
FT                   /EC_number="3.4.14.11"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61622"
FT                   /db_xref="GOA:Q03YV0"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR008252"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR015251"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036313"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YV0"
FT                   /protein_id="ABJ61622.1"
FT                   /translation="MINQYGRIAVDSATELEELRAVGFNSEDFETLLRRALTNYKTYEA
FT                   QNDWLREHVATDEQNIFLFLETKQPLTQAVFYCIAAQLLGFTEALAGNGYNGVATFRQL
FT                   GLPIATVNNLRHAWYELLNSHTNNGLLFIDELASQGYFESNNHRLLFNGKSLPTYNTND
FT                   LIRESVWVETSVDTDNDGRFDLVQVDIIRPNTNEKLPVLFTASPYYQGLNEKGNDAKVH
FT                   DVNVPLTRKDTHQSALSNLNQMEETVAKPLARQINGYAEEASVIFTQEAGKPVDLNQYF
FT                   LSRGYAVVYAAGIGTRHSDGMQDTGSPEQVESMKNVVEWLAGNRVAFTDRTSNIAIVAN
FT                   WSNHNIAMTGRSYLGTLATAVATTGVSGLKTVISEAAISNWYQYYRDNGLVVAPGGFPG
FT                   EDMDVLAELVYSRIKDPADWLKTKNQWDDFQANTEKFTDRVNGNYDYYWDTRNYLNQVK
FT                   NIKVDMIMVHGLNDWNVKPRQVYQLWSALRDLPNVKKIYLHQGQHIYINNNRSLDFSDQ
FT                   MNLWLTEKLLDKDVKANEILPTVIWQDNSTEDAWHVLDEWGASKKGKYYIGNNVLTTNQ
FT                   NSGELNFKDWLPENQFAYYCEHFDKWRDDTITGKLPTNQIFKSETYTSERTVDGEILLN
FT                   LRVKSSQNIGLISAMVVDYGNDTYLKETPTNQGVVIDRGVNFSPTDLMSFESEKSSYKM
FT                   ITIGHINLQNRTSPRQNDDLWPNQYVDLHFELQPTYYKMRPGHQLGLIIYATDFEMTIR
FT                   GNQSIAYTIDLSKSSLDVPFTCK"
FT   gene            470118..470603
FT                   /locus_tag="LEUM_0507"
FT                   /note="LactoCOG number LaCOG00313"
FT   CDS_pept        470118..470603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0507"
FT                   /product="PTS system IIA component, Glc family"
FT                   /note="TC 4.A.1"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61623"
FT                   /db_xref="GOA:Q03YU9"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YU9"
FT                   /protein_id="ABJ61623.1"
FT                   /translation="MFGFGKKISEDEHVYAPVTGEVIPLDKVSDPVFAQKMMGDGYAVE
FT                   PNASKIVSPVSGKVTMVQGHAVGLKRFDDLELLVHIGIDTVSLNGKPFTTAVKEGDIVD
FT                   AGDDLVTVNWEQVEEAGLPKTTLVLITNTADKLESITVHYGPAVAGQQLGSAKARRD"
FT   gene            470606..472120
FT                   /locus_tag="LEUM_0508"
FT                   /note="LactoCOG number LaCOG00314"
FT   CDS_pept        470606..472120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0508"
FT                   /product="PTS system IIA component, Glc family / PTS system
FT                   IIC component, Glc family / PTS system IIB component, Glc
FT                   family"
FT                   /note="TC 4.A.1; TC 4.A.1; TC 4.A.1"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61624"
FT                   /db_xref="GOA:Q03YU8"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YU8"
FT                   /protein_id="ABJ61624.1"
FT                   /translation="MAKEDYEGMAQDIIKNVGGKDNVDKVIHCITRLRFYLNDETKANT
FT                   EEMSKVPGIAGAVYNSALGQYQVVIGPAVADVYDKVVEHLGSSVVDNEATNAAVEATKA
FT                   KEQKPKNVLDWFKGAFQTLIGTITGSMIPVIGLLAAGGMLNGFLTLLSDPNLLGLISTK
FT                   SDTFTIIQSMAMAPFYFLPVLVGFTAAQQLKSDPLVVAAIGALLVKPEMIGLSAAKASG
FT                   VLLGMPINAHFFGLPITIPNYAYSIFPIIFAAWLARPIGNWLKDHLPVSIRSIFQPLIT
FT                   IFIVGSVVLVIMGPAITMISSGISVAINALLNFNYALSGLVIGGLYQVLVIFGLHWMVV
FT                   PLIANEIAQTGQSQLNALVNFTMIAQGAGALAVFAKTKIANLKGLAGAGALSAFAGITE
FT                   PAMYGINLKYGRVFWMANLGGATGGLIAGLFNLHMYGFTGSLIGFPSFASPQDNPNNLL
FT                   IFVIASAATIAVSFVAVYLWGFKDSDTEQAAAQVEKKNVFKDAISK"
FT   gene            472134..473783
FT                   /locus_tag="LEUM_0509"
FT                   /note="LactoCOG number LaCOG01583"
FT   CDS_pept        472134..473783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0509"
FT                   /product="alpha, alpha-phosphotrehalase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61625"
FT                   /db_xref="GOA:Q03YU7"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YU7"
FT                   /protein_id="ABJ61625.1"
FT                   /translation="MTELGKHVVYQVYPKSFQDSNGDGVGDLPGIIQRLPYLAKLGVTM
FT                   IWLNPVFPSPQNDNGYDISNYTAIDPLFGTMTDFENLVKEAKTYHMGIMLDMVFNHTST
FT                   DHTWFQKALAGDQKYQDYYYLRPYRDDGHEPTNWVSKFGGSAWAKFGDTNLAYLHLYDP
FT                   TQADLNWHNPAVRQELYDVLNFWLAKGVRGFRFDVINVIGKSEVLVDDETDNGGKFLYT
FT                   DTPIVQDYIQEMNAATFGKYPDVITVGELSSTTVQNTAAYTNPDNKALSMGFNFHHLKV
FT                   DYDHGNKWTKVPYEFESLRHIWHEWSQGLMENHGWPAWFWNNHDQPRAINRFIKTPKYY
FT                   RVGAKMLAMLVHLNRGTPYVYMGEEIGMIDPTYHKIETYVDVESKNAYQMLLKQGLTKQ
FT                   QAFEIVQTKSRDNSRVPMQWRNEDYAGFSTHEPWLQNANYEQINVAQDEKSADSLYAFY
FT                   QNLIRLRQENEVIADGDYTPKYEESEEIIAFERQLAGKHILVVTHFGETPVSISISDEI
FT                   VKNGQVLVTNYPAQPVSGTMLLKPYESFAIAY"
FT   gene            complement(473827..474549)
FT                   /locus_tag="LEUM_0510"
FT                   /note="LactoCOG number LaCOG00312"
FT   CDS_pept        complement(473827..474549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0510"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61626"
FT                   /db_xref="GOA:Q03YU6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR012770"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YU6"
FT                   /protein_id="ABJ61626.1"
FT                   /translation="MIPLYFKIYQQIKDDIRDHTYPAGSFLPSENELVTQFQTSRDTIR
FT                   KALAKLDEEGLIQKQRGKGSQVISHQLRHFPISGLTSFHELEELQHFHVVTEVPVFEHL
FT                   TVTKKTQKTTLFPVGTPLYHIVRVRIIDGIYSVIDEDYIRADIVPGLTKDIAKHSIYAY
FT                   IENTLHLSVAYAEKTITAELVTAMDRKLLVGLPEDENRLIQVESQGHLTDTTYFQRTIA
FT                   RHRPDQFQFNEFARRQTT"
FT   gene            complement(474559..475905)
FT                   /locus_tag="LEUM_0511"
FT                   /note="LactoCOG number LaCOG00717"
FT   CDS_pept        complement(474559..475905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0511"
FT                   /product="HD superfamily phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61627"
FT                   /db_xref="GOA:Q03YU5"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YU5"
FT                   /protein_id="ABJ61627.1"
FT                   /translation="MLKEKLPKEKVLRDPIHNFIHVEDPIILDLINTPEFQRLRRVKQL
FT                   GITSSVFHGAEHSRFGHSVGVYELARRITERFEQYYSDVWEPKERLLTLVAALLHDIGH
FT                   GAFSHTFEHLFHTDHEAMTREIITGDTEIHRVLAQVSPDFPNKVASVIAKTYENPQVVQ
FT                   LISSQIDVDRMDYLLRDAYFTGTKYGEFDIDRILRTMQPTPDGIAFDIAGMHAVEDYIV
FT                   SRYQMYLQVYFHPVSRGMEVLLEHLLQRAQELYRSNTTSEFAENDFVGPLLAPLFSDKK
FT                   LTLSEYLKLDDNVFMTYINIWQSHSDPILSDLSQRFMGRRPLKSMEITDETAPLLEELE
FT                   QLVDNAGFNPRFYTARNNAYDLPYDDYKPNVAKPRTQIDFLLADGSHRELSDMSTLVAA
FT                   IKGKASIDQRFFFPKEMLNIEPDELFADTFKKFRSFIRNNALTTPNPES"
FT   gene            475967..476413
FT                   /locus_tag="LEUM_0512"
FT                   /note="LactoCOG number LaCOG01620"
FT   CDS_pept        475967..476413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61628"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YU4"
FT                   /protein_id="ABJ61628.1"
FT                   /translation="MAIKDQIDVEIHLKTKIRQENDLEEFEFHTNGQLFLKNDTLYLRY
FT                   TEVIENQKTQIMFKFEENRVRMNRSGDILTKFSFVKSQRIPALYQTPTGQMQLETLTTL
FT                   MALNIDHEETHGEVAIDYVLYAMQQIVGQYEIRLQFMPKSSMLD"
FT   gene            476441..477028
FT                   /locus_tag="LEUM_0513"
FT                   /note="LactoCOG number LaCOG00427"
FT   CDS_pept        476441..477028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0513"
FT                   /product="DNA-directed RNA polymerase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61629"
FT                   /db_xref="GOA:Q03YU3"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="InterPro:IPR029757"
FT                   /db_xref="InterPro:IPR038087"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YU3"
FT                   /protein_id="ABJ61629.1"
FT                   /translation="MSLTTLGNHPKEEFALVEIATAILTEHKEAMPFSSLVQEIQEFLE
FT                   VDAETFKSRLSQFYTDLNTDGSFISLGNNEWALRAWYPVDAIDESIHELDDEEDAPKRK
FT                   KSAKKKVNVFADNASDDDVIDYNDDDPEDEDFGTVTDDDTETDDEETEVEVESDDESNE
FT                   IDLSDDESIDANMTELSGGDDLDDLSDGDQEK"
FT   gene            477234..477307
FT                   /locus_tag="LEUM_t0514"
FT                   /note="tRNA_Lys_TTT"
FT   tRNA            477234..477307
FT                   /locus_tag="LEUM_t0514"
FT                   /product="tRNA-Lys"
FT   misc_binding    477483..477758
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="T-box leader, riboswitch"
FT   gene            477783..479192
FT                   /locus_tag="LEUM_0515"
FT                   /note="LactoCOG number LaCOG02420"
FT   CDS_pept        477783..479192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0515"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61630"
FT                   /db_xref="GOA:Q03YU2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YU2"
FT                   /protein_id="ABJ61630.1"
FT                   /translation="MAEKQNRELSRDLSSRQMQMIALGGTIGVGLFMGSSATIKWTGVS
FT                   VLLAYAIAGLVLYLVMRALGEMLYVDPSVGSFANYATKYIHPVAGYLTVWANVFQWLTV
FT                   GVSETIAVGMYLDYWFPHIPGWVTGVVVLAMLTAANLVTVKAYGEMETWFSLIKVVTII
FT                   FMIILGLLVIVLGFGNHWQPIGFSNLWTHGPFFAGGVKGFFFALSIVITSYQAIEIIGI
FT                   TAGEADNPQVAIVKSIKSIVARILIFYIGAIFVIITIYPWNELDQVGSPFVETFSRVGI
FT                   TAAAGIINFVMMTAAMSALNSGIFSSSRMLYTLAIGKELSPKFLKLSKHRVPTLPVLAI
FT                   SGGILLGIILNAVLPLFWHGSSSIFVLVYSASTLPGMVPWFVILWSQIKFRKENASQMV
FT                   NHPFKMPFAPYTNYFAILMLLVTLVFMVFNPDTRVPLFIGLGFLVIMSIVFFATRKSHR
FT                   RNSEVSSSKTL"
FT   gene            479274..479816
FT                   /locus_tag="LEUM_0516"
FT                   /note="LactoCOG number LaCOG00223"
FT   CDS_pept        479274..479816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61631"
FT                   /db_xref="GOA:Q03YU1"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YU1"
FT                   /protein_id="ABJ61631.1"
FT                   /translation="MKTKALSASAILLAVIIVMGAIPGIPLGFIPAPIILQNMGIMLAG
FT                   VILGKKYGFFTVLGFLILAALGLPILSGGSGGFVVFIGPTAGYLFSYPVAAFLIGWVTE
FT                   WLEKNNKLSFLTLLITLLIFGMLFILVSGAIGLNIVAHMSLNKALIYQAAFLPGDTIKA
FT                   VLASIIGIILHKRRLTL"
FT   gene            479813..480118
FT                   /locus_tag="LEUM_0517"
FT                   /note="LactoCOG number LaCOG01183"
FT   CDS_pept        479813..480118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0517"
FT                   /product="Zn-finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61632"
FT                   /db_xref="GOA:Q03YU0"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR016694"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YU0"
FT                   /protein_id="ABJ61632.1"
FT                   /translation="MIKGINLDQQGRCKHWHTDVDVVANRCAKCRKYYACYLCHDALNT
FT                   HPFVPVSLDTEETAVYCGVCLHQMTPAQYLHAHYQCPKCHHLFNAQCALHKNTYFC"
FT   gene            480128..481105
FT                   /locus_tag="LEUM_0518"
FT                   /note="LactoCOG number LaCOG01184"
FT   CDS_pept        480128..481105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0518"
FT                   /product="Biotin operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61633"
FT                   /db_xref="GOA:Q03YT9"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YT9"
FT                   /protein_id="ABJ61633.1"
FT                   /translation="MKTTDQLLKYFLKHEGEYLSGETLANRLGVSRAAIWKAVQKLNED
FT                   GHQIDSQHRKGYRYKETGVLSVPAIKALIATNWDIQVFDQLDSSNSYAKEALAAGKIVH
FT                   PTVIIADQQNAAYGRFRRSFVAPEKTGLYLSIALPVMNDRVLEPGLLTTATAVIVRHVI
FT                   ASSLGYQLSFKWVNDLIFNDKKVGGILTEGVLDIESQSLTSLVVGIGLNLIQPINLPDQ
FT                   LDKKVGGIVSDLVFSRNMMIAKLVDEFADMINQYQTGKYLPEYRAHNIVLGHEVVVQYA
FT                   GQKIHGKAVEISNQGALILVTFAGEKITISSGEITKLNVNGKEY"
FT   gene            481322..482935
FT                   /locus_tag="LEUM_0519"
FT                   /note="LactoCOG number LaCOG00334"
FT   CDS_pept        481322..482935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0519"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61634"
FT                   /db_xref="GOA:Q03YT8"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YT8"
FT                   /protein_id="ABJ61634.1"
FT                   /translation="MADKQVKYIFVTGGVVSSLGKGIVAASLGRLLKNRGLKLAIQKLD
FT                   PYINIDPGTMSPYQHGETFVTGDGLETDLDMGHYERFMDINTNMYSNVTTGRIYSEVLA
FT                   KERRGDYNGGTVQVIPHITNAIKEKMQKAAESTDADAVIVEVGGTVGDIESLPFVEALR
FT                   QMKSDLGSENVFYIHTSLIIYLAAAGEAKTKPTQHSVAQLRSLGIQPDMIVLRTQRPLE
FT                   ENLKQKISTFTDVNENAVIESRDVETLYEIPLNLQAQGMDDVVLHKLKLDAPKAEMSDW
FT                   SKMVELIKHPKKTVNVTLVGKYTDLPDAYISVNEALKHAGYAQDADVKINHVKSENVTP
FT                   ENVAELLAGADGVIVPGGFGERGTEGKIQAIRYARENNIPFLGICLGMQLASIEFARHV
FT                   LGYKDANSTELNPNTSAPIIDLMKDQANVENLGGTLRLGLYPAMLLPGTLTAKAYGNQS
FT                   EIEQRHRHRYEFNTQYREEFEKAGMLFSATSPDNRLMEVIEYPKNDFFIAAQYHPEFLS
FT                   RPDRPEGLYHDFVAASIKNS"
FT   gene            483053..484852
FT                   /locus_tag="LEUM_0520"
FT                   /note="LactoCOG number LaCOG00581"
FT   CDS_pept        483053..484852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0520"
FT                   /product="Excinuclease ABC subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61635"
FT                   /db_xref="GOA:Q03YT7"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YT7"
FT                   /protein_id="ABJ61635.1"
FT                   /translation="MLANTTQHIEQKLILLPSEPGSYQMKDQNGKIIYVGKAKNLKNRV
FT                   RSYFKQDHDGKTAELVSKIVDFDFIVTNSDKEAFLLENELIKKYKPYYNIRLKYGTGYP
FT                   YIKITKERNPKMALVNEVKKDGGFYFGPYPNVYAAQETLRFLEKNYPLRRCNGPQGRPC
FT                   LYYNMGQCLGACFRDVPVQEYNDQISRIKKFLDGDTKIVKKQIAEKMQVAASSLEFERA
FT                   ADLRDQLKYIDETVESQRVLSKDTTPRDLFNYYMDKGWMTVEVFFLRQARLIRQFKRTF
FT                   SIVGEADEEVSSFIQQFYSQKNIQKPREVLVPKGIDTKALSAVLEVPVRIPVRGEKREL
FT                   LDLAAKNARIVLEEKFRLMQLNERKTTGAMKEITDALQIPMGHRIEAFDHSHTQGVEIV
FT                   SAMVVFDDGIPNKTEYRKYKIKSTDHANEWAETQEVIRRRYSRLLREDGDFPDLILMDG
FT                   GEIQLHAAQEVLEDELGLTNIPIAAMVKNDKHKTADLIDGVTNQIVTLDKQSEGFFLIQ
FT                   RVQEEVHRFAISFHRQLRSKNSLASRLDTIQGVGPKTRQKLLREFGSLPKITAASVSDL
FT                   VDIGINEKLARVIHLSLSAGDNS"
FT   gene            485018..486337
FT                   /locus_tag="LEUM_0521"
FT                   /note="LactoCOG number LaCOG01036"
FT   CDS_pept        485018..486337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0521"
FT                   /product="Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61636"
FT                   /db_xref="GOA:Q03YT6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR015349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036346"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YT6"
FT                   /protein_id="ABJ61636.1"
FT                   /translation="MAFVDQAQIEVKAGKGGDGIVSFRHEKFVAMGGPFGGDGGHGGSI
FT                   IFKVDEGLRTLMDFRYNRHFKAQPGGNGGTKGMTGASADNRVVKVPQGTTVSDADTGEV
FT                   LADMLENGQELVVAKGGRGGRGNIHFATPANPAPELSENGEPGQIRNLKLELKVLADVG
FT                   LVGFPSAGKSTLLSVVSNAKPKVAAYHFTTLSPNIGMVRLDDDRDFVMADLPGLIEGAS
FT                   QGIGLGFQFLRHVERTKVILHLVDMSGIEGTDPYTQYRKILDELQQYDETILNRPQIVV
FT                   PTKMDMPDSEENLAKFRKEVATDSGLPIQPEIVPISSITRDGVKDLMRLTADMLATAPA
FT                   PESYRPETKNDTSEKSYTFKPETHDFTVEWIADEERWLLSGAEIEKLFLMTNIQRDATI
FT                   MRFARQLRHMGVDDKLREAGAKDGDDVRINNSDFVFEFSE"
FT   gene            486520..488205
FT                   /locus_tag="LEUM_0522"
FT                   /note="LactoCOG number LaCOG00801"
FT   CDS_pept        486520..488205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0522"
FT                   /product="Acetolactate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61637"
FT                   /db_xref="GOA:Q03YT5"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012782"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YT5"
FT                   /protein_id="ABJ61637.1"
FT                   /translation="MANKKYGADIVTDSLVNHGVDLVFGIPGAKIDRLFETLEHPAEGQ
FT                   RVPKLVVARHEQNAAFMAQAFARITGKTGVVIATSGPGVGNLATGLMTATAESDPIVAI
FT                   GGQVPRNDLYRLTHQSTNSVALFSPITNLASEIQDPNNISEIIANAFAAANGAKKGATF
FT                   VSLPQDVDDAQVTIEALPKITPAQQGAAAIKDIDWLAEQIKAAKLPVLLVGSRGSDDAT
FT                   VTALHQLLKQTTLPVVETFQGAGVISRELEPETFFGRIGLFRNQTGDKLLKQSDLVITL
FT                   GYDAIEYEPRNWNKENTLNIVALDTTPVQIDNNFVPQRQLVGDLAQSLRLLIERLNGYE
FT                   LPTTSKEVLKKLKADLRASDEPSYTPAQGNLNHPLDVIKSIQAHVTDDMTVSTDIGSHY
FT                   IWMARHFKSYVARHYLISNGMQTLGVGLPWALAAAMVRPNAKSVSVSGDGGFFFSAMEL
FT                   ETAVRLGLNTVHIVWNDNAYYDMVKFQEEMKYNGQSAGVKFGNIDLVKYAESFGAKGLR
FT                   VETPDDLDTVLDEAFSTQGPVVVDIPVDYSHNYELGSQLIGSEG"
FT   gene            complement(488720..489949)
FT                   /locus_tag="LEUM_0523"
FT                   /note="LactoCOG number LaCOG02248"
FT   CDS_pept        complement(488720..489949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0523"
FT                   /product="PepS aminopeptidase, Metallo peptidase, MEROPS
FT                   family M29"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61638"
FT                   /db_xref="GOA:Q03YT4"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YT4"
FT                   /protein_id="ABJ61638.1"
FT                   /translation="MSLETKLNKYAELIVKKGVNVQPGQTIILYAAVDEAYFARKIVAE
FT                   AYKAGAHEVVMEWSDQTIAKEFLNHTSLDRLKEVPNYQVTKANELMDKYASRISLISQD
FT                   PDGLADVDAERLATLTKANQKALFRVREATMKDDISWLVVAAAGQEWAEKVFPDLKGQD
FT                   AVNRLWEEILKDVRIDDDSDAVDNWDLHINKLKNKADWLNEQNFKELHYKNAKSAFTIG
FT                   LAEGHVWEAAYSQDKAGNIFIPNMPTEEVFTAPDNRNIHGHVAATLPLSYQGNVIENIE
FT                   LDFEDGRIVKAQATSGLDVLEKIINTDEGSKSLGEVSLVPDPSPIAQSGILFYNTLFDE
FT                   NASDHLAIGAAYASNISGGKTEKPENLAKRGWNISDEHVDFMIGSNDMDIDGVTQDGEV
FT                   VPVFRSGDWA"
FT   gene            490094..490831
FT                   /locus_tag="LEUM_0524"
FT                   /note="LactoCOG number LaCOG01725"
FT   CDS_pept        490094..490831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0524"
FT                   /product="Lyzozyme M1 (1,4-beta-N-acetylmuramidase)"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61639"
FT                   /db_xref="GOA:Q03YT3"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YT3"
FT                   /protein_id="ABJ61639.1"
FT                   /translation="MENVFASASQYKTKKLLTFTSWLLILSGIVCSFTVWVFAKPVVTQ
FT                   TNAIPSGFSVQGVSINQTSNYVDFNNLASNGVSFVYMRTTSGSSVMDGGYKSSFSRAKS
FT                   AHLKVGTIHVYDASVTAATQAQYYIDNVGNNIGELPIAISVTADQISTATSKQRLASLV
FT                   QILASHYNHDMIIYTTPNVQKKLSSTISKTKYWLIEDNTKNTDSKNLFIQYDEDQTIGS
FT                   GLKAIKMPTTVFNGTQKQFEVYK"
FT   gene            490828..491832
FT                   /locus_tag="LEUM_0525"
FT                   /note="LactoCOG number LaCOG01015"
FT   CDS_pept        490828..491832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0525"
FT                   /product="Predicted dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61640"
FT                   /db_xref="GOA:Q03YT2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YT2"
FT                   /protein_id="ABJ61640.1"
FT                   /translation="MIKLGIIGTSWITAMLIDAAIKTKAYDLTTVYSRSQASGEKFLAS
FT                   LDLDTDNVDVVTTLSDLYQNIDVVYIASPNALHFEQAKVAIQSGVHVIVEKPSFSNPTE
FT                   FEKIESLLATHPDVRLFEAARHVHQPNFKAIQETVAKMDQLQGATLVYQKYSSRYNAYL
FT                   AGQEPNVLTREFSAGALYDLGVYPIYAALAVYGAPNAVQYLPRLLRNGADGSGVANLFY
FT                   DNFNVTVIFGKTSNSYLPSEFYGLKDTISVSNIAELEKVTYYDGEGNNNHLGDVPEENP
FT                   MIRESQDFANIINDPTKNHAEYSQWFQLAKQVNQTLFDLRQSAGIEFPADIKE"
FT   gene            491834..493129
FT                   /locus_tag="LEUM_0526"
FT                   /note="LactoCOG number LaCOG01727"
FT   CDS_pept        491834..493129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0526"
FT                   /product="Superfamily II DNA and RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61641"
FT                   /db_xref="GOA:Q03YT1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YT1"
FT                   /protein_id="ABJ61641.1"
FT                   /translation="MKPELLEKFNASFDTPTPIQSAVWQRLTDGDSIFGLAPTGTGKTL
FT                   AFVLPVLSRIDTNLKRTQVLILAPSQELAMQTTQVAREWGNAVGASVASLIGGANGRRQ
FT                   ADKIKKDKPHIVVGTLGRVLTMVDGGVLKLDHIATVIFDEADAMLTEERHDSLHELADK
FT                   LPSHIQLGLFSATSGVDLNYVSDTFEQKVHPISVGTDAPVSIKHEFQYVDQRAKEKVLI
FT                   QLARNNQQALVFFNTISALVNMQATLRHAHVSVMSIGSNDKRQVQRADALRLFKKGEVT
FT                   LLLVTDVAARGLDIEDLPLVVNAQLPQRKKTYVHRTGRTGRMGKIGRVLNLGNDHDIRD
FT                   LKRELGDSFNLDKAENLFEKSIKSQENTVTKDTNTNNVSSVSKAKKSSSAAPLVTKKEV
FT                   IVEPTTKVKKKKRAKSSKDKGKPKWAKNGKTK"
FT   gene            493320..494153
FT                   /locus_tag="LEUM_0527"
FT                   /note="LactoCOG number LaCOG00257"
FT   CDS_pept        493320..494153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0527"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61642"
FT                   /db_xref="GOA:Q03YT0"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YT0"
FT                   /protein_id="ABJ61642.1"
FT                   /translation="MPELPEVETVRRGLEKLIIGSKIIDVQLPYPKVITGDGQQFITGV
FT                   MNTEFKQIDRRGKYLLLRLANNHTIVSHLRMEGQYSVESLETVPYKHTEIVFELSDKRA
FT                   LFYNDTRRFGRMALTTTGFENTEVPSLSKLGPEPTEEQLTLSYMMAIFSKSRRPVKTFL
FT                   LDQTQIAGIGNIYADEVLWQSKIHPKTPANVLDEVQLSVLRANIISEIKRAIKHHGTTV
FT                   HSFSNVFGEVGKFQNELQAYGHAGEPCLRCNTPMVKIKVGQRGTTFCPFCQVEKD"
FT   gene            494155..494889
FT                   /locus_tag="LEUM_0528"
FT                   /note="LactoCOG number LaCOG00094"
FT   CDS_pept        494155..494889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0528"
FT                   /product="Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61643"
FT                   /db_xref="GOA:Q03YS9"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YS9"
FT                   /protein_id="ABJ61643.1"
FT                   /translation="MNQEPISIIDVKRDAKKLMKGRLGTAIKINIIAIIVTVTTLSMMT
FT                   FTVYAMIKDTNLMSSADVSSTTTSLGLNPSEVIVSVLQDAAGLTFMWSVSWTIIDWFNN
FT                   PKKNPRFIQTFQIFNNGKFPQSLLLTVVQSMLTFLWTMLFTIPGLIKHYSYAQTYFSYK
FT                   LDLDAGKQANALTDYITRSRKIMNGRKWELFLLDLSFIGWHLLGILTAGLAYIYVIPYL
FT                   NATKVAYSRRLFKLNNEVSEEQ"
FT   gene            494890..495510
FT                   /locus_tag="LEUM_0529"
FT                   /note="LactoCOG number LaCOG00444"
FT   CDS_pept        494890..495510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0529"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61644"
FT                   /db_xref="GOA:Q03YS8"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YS8"
FT                   /protein_id="ABJ61644.1"
FT                   /translation="MLTIGLTGGIATGKSTVSALLRQAGFPIVDADIVAREVVEPGTPT
FT                   LEKIKLAFGPGIIDNGVLDRRKLGQIVFEDGAQLKKLNDIMQPAISSAMADKINFWRLQ
FT                   NVPILVLDVPLLFERDYDKNKSVDKIIVVTASKEIQLFRLENRDQLSNMEARNRVKAQL
FT                   PMSQKIARADYVIDNNGRIEELQEQVTVLIKKIKEIASTHDAK"
FT   gene            495497..496786
FT                   /locus_tag="LEUM_0530"
FT                   /note="LactoCOG number LaCOG00512"
FT   CDS_pept        495497..496786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0530"
FT                   /product="replicative DNA helicase loader DnaB"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61645"
FT                   /db_xref="GOA:Q03YS7"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YS7"
FT                   /protein_id="ABJ61645.1"
FT                   /translation="MMQNDGTIEFHAKAGVFVQSNTPITLTDLDRAFDLYTPFIGATGY
FT                   ALYHMLVRELPYNTRLDAREDHNFILDSLNVSLPDFVKVRRRLEAVGLLTTLYTEDALG
FT                   EIYTYQLFAPLDVDSFFKEKLLAGLLFKYVGEERYLTLQKRYATQGQPNVKGDNISAKF
FT                   LQVFKHDTATSLPTVEVKASHGKIEIEDDFNFENFTGLVRGTTIEKLAQHRDFLVSMHV
FT                   IYGVDEVTLAGYTSQAISLDTHDVDEKILQQVMRQNRTTVVAEPVVSQPVQQNRSREML
FT                   QLVQDAKTLAPNAFIEDVKFKKGGGFVTRNEYYFISKMIKDVRLKAEVVNMLVWYELGK
FT                   RNRDTVNVDTAETIANSWLKMHVNSAEAALDAIEKYQPSRPTKRNYTKKVTRVEPKMPS
FT                   DTPQNKPATSVDEVAEALAELKKLNIKTKN"
FT   gene            496794..497741
FT                   /locus_tag="LEUM_0531"
FT                   /note="LactoCOG number LaCOG00513"
FT   CDS_pept        496794..497741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0531"
FT                   /product="replicative DNA helicase loader DnaI"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61646"
FT                   /db_xref="GOA:Q03YS6"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR009928"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YS6"
FT                   /protein_id="ABJ61646.1"
FT                   /translation="MQNLSEVLKQFQQQYANKANLSDIIESIGKDQDIRSFWNEHQDEL
FT                   NSDAFQLKMGDLYEYIQQKKRIAAGEKVLYPGYYPQLTIEKGYPIVHYVADEKTRKQLM
FT                   QREKLTLYKIPKSVRSADWSTIGQEIIDHAQEEQGKTEAFVSLNKILKSLTSTVQNNFV
FT                   QGIYLYGDFGVGKTYMMGALANALAVNNIGVMLLHFPSFISDLKATFDHKNESLDELLS
FT                   KAKSVSVLILDDVGADTLTAWSRDSILGIILEYRMQNELTTFFTSNFDANGFEQYLSQT
FT                   REGNEPIKAARLMQRVKFLAKPVQMTGKNKRLEN"
FT   gene            497738..498823
FT                   /locus_tag="LEUM_0532"
FT                   /note="LactoCOG number LaCOG00560"
FT   CDS_pept        497738..498823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0532"
FT                   /product="Predicted multitransmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61647"
FT                   /db_xref="GOA:Q03YS5"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YS5"
FT                   /protein_id="ABJ61647.1"
FT                   /translation="MIFLKKTKNYWFVAIAVIAAWFLLRSDSFLYQEPVGQVTHVKVQA
FT                   KQKTTDEHNNTDNIYHQQLTVKLLNRNKIIKLTNQYTDSQTVTHKYKVGDQLLLTGHAG
FT                   HFRIISLKRDAVIGSLVVLLLGLLLIYGKWRATSWLTLSLVANVILFAIALYIDVHLKN
FT                   PNVILIFSILAIVVASLSLVLVLGRTLQMVVTLLATLLSTVLTMFIMFAALKITGNEGV
FT                   HFETMSYVTQVPVTLFIAQTIIGVLGAVMDEAADIVAALFGLRREKIERHFKDYWHAGM
FT                   NVGRDIMGTLINVLFMIFIAETMPMVFLMLRNGNNWPYILDQIMNLGILQTVISGIGIV
FT                   LAVPVTSALVGWIAERYKVVD"
FT   gene            498823..499599
FT                   /locus_tag="LEUM_0533"
FT                   /note="LactoCOG number LaCOG00561"
FT   CDS_pept        498823..499599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0533"
FT                   /product="Predicted multitransmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61648"
FT                   /db_xref="GOA:Q03YS4"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="InterPro:IPR014564"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YS4"
FT                   /protein_id="ABJ61648.1"
FT                   /translation="MNAIGLLIIILFILMVFVGGVQGMKAFVGLVLNFIVIFILMILIN
FT                   WQFNAYIVTALMSVIILALAIYLGAENQFVTNTAFKTSLIVVSILMVVAILVQHLGQFQ
FT                   GFATENSEELEGLSLNVGLPFTKVAVIVMVISILGAVAEAAMAIVADLNEVIERTPNLS
FT                   KKSLYAHAHIIGGQILGTAINTLFFGVLGANLPLLIWFIRLRYSIAMFFNAKLLMMEVV
FT                   TMLLGMLGILMSIWVASRLVVHGYVKIQSKNMRKGE"
FT   gene            499640..499942
FT                   /locus_tag="LEUM_0534"
FT                   /note="LactoCOG number LaCOG01677"
FT   CDS_pept        499640..499942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61649"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YS3"
FT                   /protein_id="ABJ61649.1"
FT                   /translation="MKETFDLIERITRNDGSSYFELGNIPHNGRAEYAAEHGFIQSVQI
FT                   LKVNIPRSTHVEKVEEYINSHYKLLPLEYDGWEEWVKTPEIEEELQRILLDNRLG"
FT   gene            500070..500140
FT                   /locus_tag="LEUM_t0535"
FT                   /note="tRNA_Cys_GCA"
FT   tRNA            500070..500140
FT                   /locus_tag="LEUM_t0535"
FT                   /product="tRNA-Cys"
FT   gene            500479..502509
FT                   /locus_tag="LEUM_0536"
FT                   /note="LactoCOG number LaCOG01514"
FT   CDS_pept        500479..502509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0536"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61650"
FT                   /db_xref="GOA:Q03YS2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YS2"
FT                   /protein_id="ABJ61650.1"
FT                   /translation="MITLNDNVNILPGVGPKRLDALHEIGIFTIEDLINYFPFRYEDLG
FT                   ERLPSETLDGEKATFKGIVSTPAVVTRFGKRSQTRFGLMIEHENVRVSFFNQPWIAQNV
FT                   EVGQEVAVYGTYDAAKASLTGMKVISKASNEFDPIYPSSKQISAKTIRHLIEIAWADVR
FT                   GTVGSLVPDKIRQKYRLLDRNTQIENMHFPADMEQAKLARRSIAFEEFFIFQMRLQLLK
FT                   LADKNFSGEGINYDSKALNKFEAGLPFTLTGAQQKVVSEILTDQKRPVHMNRLLQGDVG
FT                   SGKTVVAAIALYAVVTAGMQAALMAPTEILAQQHAINLALMFEKSGVDIRIELLTSGMK
FT                   AAARRQLLEDLADGTIDILVGTHALLQPDVMFHHLGLAVIDEQHRFGVNQRAKLRENGV
FT                   NPDILAMTATPIPRTLSITTYGEMDVSIIDQLPNGRKQIQTRKISHNQLDSAINFLKQQ
FT                   LSEGAQAYVVTPLIEESEALDVQNAQAMYEALQLELPNDTIGLLHGRLSNDEKKALMAD
FT                   FKRNKIQVLVATTVIEVGVDVPNASIMLIMDADRFGLAQLHQLRGRVGRGTRQSYTILV
FT                   ADPKTDYGRARLDAMVETTDGFILAQKDLELRGSGDILGTKQSGVPEFAVGDPIKDLKM
FT                   MEVAQQEAISMVSTDDWDKSSENQELVDYLSRTMAHYRHLD"
FT   gene            502589..503617
FT                   /locus_tag="LEUM_0537"
FT                   /note="LactoCOG number LaCOG00039"
FT   CDS_pept        502589..503617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0537"
FT                   /product="phosphate:acyl-[acyl carrier protein]
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61651"
FT                   /db_xref="GOA:Q03YS1"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YS1"
FT                   /protein_id="ABJ61651.1"
FT                   /translation="MKIAIDAMGGDYAPMEIVKGVEIARDRYPDIEFLLFGTSEQVKPL
FT                   VKDWSHITLIPTTEVIEMGDEPVKAMRRKKDSSMVRAANAVKAGEADALFSAGNTGALL
FT                   SSAIFLIGRIKGVDRPALATALPSFAGENDQFVFMDLGANAESKASHLYQYGILGSFYA
FT                   SHVLGINDARVRLLNNGAEEDKGDEVHKIAHQLMKNSQSFNFLGNVEARELLEGTADVV
FT                   VADGFSGNAALKATEGTALMMLKQIKQAIMQTGLRGKMGGLLLKPAFKDIQKKLDYNEA
FT                   GGAVILGVNAPVVKTHGSAKANAVANTMGQIKKMIEKNLVPDIRTYIADHKDELQAAKN
FT                   EL"
FT   gene            503685..503933
FT                   /locus_tag="LEUM_0538"
FT                   /note="LactoCOG number LaCOG00528"
FT   CDS_pept        503685..503933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0538"
FT                   /product="Acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61652"
FT                   /db_xref="GOA:Q03YS0"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YS0"
FT                   /protein_id="ABJ61652.1"
FT                   /translation="MAMEKEAIYNMMADEIAERFNVKRDTITPDLNFLTDIDADSIDFV
FT                   ELVLEVEDMFNVEISDDDAENLVTLQQTVDYIVEHQN"
FT   gene            504119..504571
FT                   /locus_tag="LEUM_0539"
FT                   /note="LactoCOG number LaCOG00199"
FT   CDS_pept        504119..504571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0539"
FT                   /product="Zinc-dependent metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61653"
FT                   /db_xref="GOA:Q03YR9"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YR9"
FT                   /protein_id="ABJ61653.1"
FT                   /translation="MTDNELQNLVEKISFDIFDRPFQHHATFNSHLRTTGGRYLLKTHD
FT                   LEFNPKMVTLEDFNKIIKHELVHYHLHLRHQGYQHKDSDFKQLLVRVGGIQYAPDIGER
FT                   QSSKCQWLYRCENGHDIIRKRRFQTERYRCGQCQARIKFIGKLSNK"
FT   gene            504616..505449
FT                   /locus_tag="LEUM_0540"
FT                   /note="LactoCOG number LaCOG01757"
FT   CDS_pept        504616..505449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0540"
FT                   /product="Predicted hydrolase of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61654"
FT                   /db_xref="GOA:Q03YR8"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YR8"
FT                   /protein_id="ABJ61654.1"
FT                   /translation="MIKLILSDLDETLLDDDGTINSQNVTAVQKFVKNGGYFVPNTGRS
FT                   YKSVFGTLKDLGLNKQNKQYVVSYNGGAIVEIHEDGGEKIIVQHGMDLELAKKIFSLGQ
FT                   IQADIDTHIYTIDTLFIYNISKNDEQYMRERSVPYQEMANDKLDFLSNEKTIMKVIFEH
FT                   RDPDVLQKIADTVNAQLADRVLTTFSSNRYVEFNPKGSDKGSAGLELADMLGISRNEVA
FT                   ALGDNLNDAAQIKAAGVGVAVANAKPEIKEMADLVLSKTNNEGAVAEFINEHTRK"
FT   gene            505450..505656
FT                   /locus_tag="LEUM_0541"
FT   CDS_pept        505450..505656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61655"
FT                   /db_xref="GOA:Q03YR7"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YR7"
FT                   /protein_id="ABJ61655.1"
FT                   /translation="MGNLITRIILSVVSFALFVLIFLLSDQQNWPLWVTITLVAVLFIV
FT                   FNICFVWLYWQKKKRTLDEDDDA"
FT   gene            505649..506383
FT                   /locus_tag="LEUM_0542"
FT                   /note="LactoCOG number LaCOG01370"
FT   CDS_pept        505649..506383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0542"
FT                   /product="Predicted metal-dependent membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61656"
FT                   /db_xref="GOA:Q03YR6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YR6"
FT                   /protein_id="ABJ61656.1"
FT                   /translation="MLETTNEVRPKSLLLRIINVVFTLFLIVVAPIPLVLATKTDNIFL
FT                   QILCAATMFIFYIGIGFYAYRLLRKNVPGPVFTKPDIRNWRGLWWLVGMWFVMIAIEMI
FT                   LAQLRVQLTGVTTTENQEAINELTSNLNVTMVAMVIYGTFLAPVVEELVFRGLILNYFF
FT                   RKSWWWANIILSGAVFALPHMDTIPTNLADTLSYVIYASMGMVLAYIYKKTGDLKNSIA
FT                   VHMLNNGITMIPLLVVAIMNAI"
FT   gene            complement(506424..507521)
FT                   /locus_tag="LEUM_0543"
FT                   /note="LactoCOG number LaCOG01085"
FT   CDS_pept        complement(506424..507521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0543"
FT                   /product="Xaa-Pro aminopeptidase, Metallo peptidase, MEROPS
FT                   family M24B"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61657"
FT                   /db_xref="GOA:Q03YR5"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YR5"
FT                   /protein_id="ABJ61657.1"
FT                   /translation="MNAEKISALTSWLTKQELSGAIITNYHSVAYLSGFESDPIERVLA
FT                   LVLLENSEPFLFGPALEVNSMKESGWRYAAFGYEDHENPWLKLTNHIRTLTNGKKFAIE
FT                   ADNLTVARLKLLQTAFPDGEFSIDITDQINQLRLIKTPDEIAHMKAAGRDADRAFEIGF
FT                   NALESGISELAVAAELEYELKKAGVSSMSFETLVQFGAHAADPHGSTSTNTLNTGEMAL
FT                   FDLGTMTEGYASDATRTVAFGNVSNEAKKIHAITLEAQLTAQSQAKIGMTASELDAIAR
FT                   NIITKSGYGQYFNHRLGHGLGSSVHEFPSIMAGNDMILEEGMVFSIEPGIYVPGVAGVR
FT                   IEDSGYMSKEGFIPYTHTTKELLQF"
FT   gene            507722..508729
FT                   /locus_tag="LEUM_0544"
FT                   /note="LactoCOG number LaCOG01084"
FT   CDS_pept        507722..508729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0544"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61658"
FT                   /db_xref="GOA:Q03YR4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR006377"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YR4"
FT                   /protein_id="ABJ61658.1"
FT                   /translation="MQKKQTATIYDVASRVGVSLATVSRVVNGNSNVRESTKRKVLDAI
FT                   EELGYHPNAVARGLASKKTTTIGVVMPDVTDMYYSELARGIDDVANMYHYDVLLTNTDE
FT                   DPVRETMAINNLASKQVDGIIFMGNELDREVLKTISSVDAPVVLAGSIDAEKVLPSVNI
FT                   DYIAATKEAVEMVVKNGHERVALVTGPMEYAINKQHRLVGYQAGLEAAGQEFDEDLLFA
FT                   SHQDYSAGYQIADKIFATNATAAIVHDDEVALGIMNYMRDQGKSVPEDFEIITSNDTKF
FT                   AIVTRPALTSIGQPKYDIGAVAMRMLTKLMNNEVVDNMQVTLPHTFEKRGTTIN"
FT   gene            508838..510703
FT                   /locus_tag="LEUM_0545"
FT                   /note="LactoCOG number LaCOG01418"
FT   CDS_pept        508838..510703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0545"
FT                   /product="peptidoglycan-N-acetylmuramate
FT                   O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61659"
FT                   /db_xref="GOA:Q03YR3"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YR3"
FT                   /protein_id="ABJ61659.1"
FT                   /translation="MESPKRRYIKGFDGLRALAVIGVILFHLMPTKFVGGWFGVPLFFV
FT                   ISGYLITDQLIQEFDRNHKIAIFKFYKRRLKRLYPALVAMMLIVTAVILLFDHQLVYNL
FT                   RPTVETNLLYVFNFWAIGHGPSYFQQFGGASPFTHLWSLSIEGQFYFIWPLVVWAILRL
FT                   GLKRINIASVLILLSLISAILMAVLYDPTAINRVYYGTDTRLFAILLGTALAFVWPSIK
FT                   LSNHVSSKVQRYLNIAGFCSFLLWGLGTLWLNGQHPATYYGLMYLLTIASTVLVAVTAH
FT                   PASWHAKILDNKLLNYLGKRSYSIYLYQLPVFVFYEKFIPHYQPNVLNILIEIALVLLL
FT                   SELSYRYVENLFRRNGENLRQVGHWLVQSRNRFFLILTPALIFLLFIGHGLASQNAGQP
FT                   QPQTELQKKLLKNKLAVKKSNQIAQKSAKHSSKQSSNKNMSAADKKVIATYDLNAAQYM
FT                   SFKNMSFTAIGDSVMLDSAPYLQDINPKIVVDAKVGRQAYEAPNLVKKMARNDELAPNV
FT                   IVGLGTNGEIRRQDLDRMMKTFGTKRQVYWINNLVQSKPWQKDNNDMLAKANNDYKNLH
FT                   IIDWYRLAKKHSDWFADDGVHQGPLGARNYVRLIVEKTGDVNKIK"
FT   gene            510817..512163
FT                   /locus_tag="LEUM_0546"
FT                   /note="LactoCOG number LaCOG02021"
FT   CDS_pept        510817..512163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0546"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61660"
FT                   /db_xref="GOA:Q03YR2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YR2"
FT                   /protein_id="ABJ61660.1"
FT                   /translation="MFKNIRKLTPFSLALLSIAFIMSISQSTMTTAYPILMKSFNVNAS
FT                   TVQWLTTGFMVAMTLVMPLSPWLLDNVSLRKLLNGIVALFLLGTFLAMVTPNFTGIIIG
FT                   RLLEGLAVGALFPTFQSVIMENTDKNQRGLAMGVVGLVMGSALAVGPIISGVVLQWISW
FT                   RALFMLFFVILLILIIVLQNKIENTHTMKPSEFDWFSAITLLGFGGILYDISIIPTSGI
FT                   NFSWWLILIISVSLLAIFIVRQVKLPQPFLDLAVLKYRGYVPAMFLTGLSYSGLIIATV
FT                   LMPLFYQKVFHFSPLWSGLLMVPAAIFLSQLNPRSGAMLNRIGLKKLVYIGMAMMLVGY
FT                   AILGTLGSFSWIACLIAAMLLEGGNAFIMMPAITAANNALPKNLVSHGTAIITTMRQVI
FT                   GAGSVVVASILITAINTNSSFVHALLMTSRWFIVVPLIGLLLTVRIKSN"
FT   gene            512336..513292
FT                   /locus_tag="LEUM_0547"
FT                   /note="LactoCOG number LaCOG01282"
FT   CDS_pept        512336..513292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0547"
FT                   /product="sodium/proton antiporter NapA, CPA2 family"
FT                   /note="TC 2.A.37.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61661"
FT                   /db_xref="GOA:Q03YR1"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YR1"
FT                   /protein_id="ABJ61661.1"
FT                   /translation="MINVLLLITVTLFFGKVAVKLGLSEVIGQLLAGIVLGMSFLNVVH
FT                   STHLVHVLSEIGIFILMLSSGLASDMKTMKKYVKASSLIAIMGVVIPMIAFPIAFILMG
FT                   YSVSVSLFSGIVFSATSISITLAVLAEQKKLTSAVGAIILSAAIIDDVISLLAVTLFSV
FT                   FIGNGGFNMSSLLPLIAFVIGIFLRKTLIADQIFENTNRVGQWIFYPMFFGSIGLNVSI
FT                   GQLNNKIVAIVLFILLAIITKFVGSWIGAKISGLNDTAAKAIGAGMVSRGEMALVITQI
FT                   GLSSQVISAAVSGELILVIIFSTLIAPILMKPLFANI"
FT   gene            513401..514321
FT                   /locus_tag="LEUM_0548"
FT                   /note="LactoCOG number LaCOG00629"
FT   CDS_pept        513401..514321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0548"
FT                   /product="permease of the drug/metabolite transporter (DMT)
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61662"
FT                   /db_xref="GOA:Q03YR0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YR0"
FT                   /protein_id="ABJ61662.1"
FT                   /translation="MKKQGIICGVLSATLFGISGILASILFRNQNINPEWLVGVRMSLS
FT                   GIILLIVLFCFSGRRVFEIWLNKRDVVLIILYGIVGVLLAQSSFFLSVYFGDAATATIL
FT                   QSLGPTIIVILLSLATRTLPSRLDIWSILIALTGVFLLITNGNINQLVVNSKALFWGIL
FT                   SAFGLAAYTLIPKPLLEKQSPLVVVAWGLLVGGTAENFFHPIWYIPSQVSTKDWIIMVF
FT                   IIIAGTLLPYALYVMSLSQLKPTTASLLSTIEPMVATLLSVTLLHVHLRMFQVLGILFI
FT                   ISTIFLISLPLERIFKKRLSDPKIN"
FT   gene            514401..515120
FT                   /locus_tag="LEUM_0549"
FT                   /note="LactoCOG number LaCOG00830"
FT   CDS_pept        514401..515120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0549"
FT                   /product="Alpha-acetolactate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61663"
FT                   /db_xref="GOA:Q03YQ9"
FT                   /db_xref="InterPro:IPR005128"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YQ9"
FT                   /protein_id="ABJ61663.1"
FT                   /translation="MTTIYQHGTLAQLVARQMSGTITVAEMLEHGDTGIGTFEGLNGEA
FT                   IFLNGEAYQADSTGKVHHITDKQTTLPFASIHFDQPEASQKLPFKKIKYSNLTQNLKDE
FT                   QLFNVFSALKLHGEFAHVHVRIVTKQEKPYPSLLQVAEQQPEFKADNITGTLVGYYAPK
FT                   VFGGPTAAGWHLHFLSDDLTFAGHVLDFEATDVDGTLEVFDNFLQHLPINNADFRSMNQ
FT                   DIAGLDKAIEASEGGKN"
FT   gene            complement(515191..516045)
FT                   /locus_tag="LEUM_0550"
FT                   /note="LactoCOG number LaCOG01475"
FT   CDS_pept        complement(515191..516045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0550"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61664"
FT                   /db_xref="GOA:Q03YQ8"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YQ8"
FT                   /protein_id="ABJ61664.1"
FT                   /translation="MANNIIAQLRAQRKQYNTTEQKLIDFIINHVSEAREANIQEMSEL
FT                   SGVSTATISRFVKKIGLESFREFSVSLASAATQMAASVDLFGEIADTDDTIAVAQKVFG
FT                   GAENALAATVSNLTATQLDEATLALISARRVGFFGIGGSSIVAFNAYHKFLRTPIDVIA
FT                   HPDYDVQLMQAVKLNSNDTAVVISHSGRNKDTLLIAKKLHEQHVKIIAVTSFKDSPLAK
FT                   LADLVLLSLAEEVNFRSESMSSLIAQLTIIDTLFTLVGSHLSQDTQSVVDTMRDVIEET
FT                   RSH"
FT   gene            516175..517083
FT                   /locus_tag="LEUM_0551"
FT                   /note="LactoCOG number LaCOG01474"
FT   CDS_pept        516175..517083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0551"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61665"
FT                   /db_xref="GOA:Q03YQ7"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YQ7"
FT                   /protein_id="ABJ61665.1"
FT                   /translation="MKFAMIGLGKMGLNLVKNAVDNGHEVVAFDLNADFVKEATDYSAS
FT                   VEAASDIDDMLSKLPSPKAVWVMVPAGVPTNSTIDTLIEKMDKGDIIIDGGNSNYKDNL
FT                   EQNKRTSAAGIKFFDAGTSGGMNGARNGGNFMIGGDDAEAWKIIEPLFKSISEEDGYLY
FT                   TGRLGSGHYLKMVHNGIEYGMMQAIAEGFEVLEASQFDYDYEAVSKLWNHGSVIRSWLM
FT                   ELAEEQFAKDPHLDAIAGRMHSSGEGKWTVQESLDLDVPAPVIYLSLAMRYRSLQDDTF
FT                   TGKVVSALRNGFGGHAMDAAK"
FT   gene            517191..518729
FT                   /locus_tag="LEUM_0552"
FT                   /note="LactoCOG number LaCOG01473"
FT   CDS_pept        517191..518729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0552"
FT                   /product="gluconate kinase, FGGY family"
FT                   /EC_number="2.7.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61666"
FT                   /db_xref="GOA:Q03YQ6"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006002"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YQ6"
FT                   /protein_id="ABJ61666.1"
FT                   /translation="MEYMIGVDIGTTSTKAVLFDDKNVVVASANKSYALYRDLPDMAEE
FT                   DLDELFEALVSALSEVVRVADLNKGNQITAVSFSSAMHSLIAFDEDWNPLTRAITWADT
FT                   RAVKYTEELKANGIGQQIYKNTGTPIHPMAPLSKLLWLKSEHTDIYQKAAHYLGIKEYL
FT                   FHRLFGSNKMDISIASGTGLFNIFNLDWDDQALSVTGVRKEQLPQPVEPYEYETSMFEK
FT                   YAALIGLPANTPFVYGAGDGPLSNLGVNAVKPGVAAITIGTSGAIRVVSEQPVIDPKGR
FT                   TFTYALDKDNWVVGGPVNNGGDVFRWARDNMFDAEKSTAALLGKDSYDLLTEIAERIPA
FT                   GSEGLIFHPYLGGERAPIWDANARGSFFGLNHGHTRAHMLRAVLEGITFNVFMVSLALE
FT                   EVVGDLKSIQATGGFARSPLWRQMFADIFEQPVTVPEAFESGALAAVIVAQKALGKIDS
FT                   LYEIEKYIGAANTYFPEPKNFEAYRELAPIFIRLSRQLQTEYQNIANYQRKHSK"
FT   gene            518831..520201
FT                   /locus_tag="LEUM_0553"
FT                   /note="LactoCOG number LaCOG01745"
FT   CDS_pept        518831..520201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0553"
FT                   /product="H+/gluconate symporter related permease"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61667"
FT                   /db_xref="GOA:Q03YQ5"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YQ5"
FT                   /protein_id="ABJ61667.1"
FT                   /translation="MLIVSILILLILIAKLKLNTFVSLIITAFILALLLGMKPMEIPSA
FT                   VLGSEGVGNILGPNSVIFIFGGMIGRLVADAGGSYRIAKTLIDWFGVKRLQWAVLIASF
FT                   IIGISMIFGVGMVLLIPIVFAVAIEAGVPLLYLGISMTAALSSAQGFLPPQPAPTAVAS
FT                   ALGANIGMMLIFGLIVSVITAVVAGPAFTKLAQKYAPDAFQFKTEIEAVGPAKKYDLDA
FT                   TPKFGLSVLTSVFPLIFMIIATIYKLIYTGGVTPKNPNTIDQIVEFVANPAVAMTIALV
FT                   FAIFTMGIWQKKTMVEVGKSLNEGMSAVAGILLIVGGGGALRGVLVTSGLSDKIATIFQ
FT                   AGGAMSPIAIVLFAWAVAAVLRVSVGSATVAGMTAAGIVTGILAANPGNTLLPVFVALA
FT                   IGAGSLIASHVNDAGFWIFKEFFDLSVKQTFQIWTVLETIISVTGLIIILILTSVFA"
FT   gene            520425..521855
FT                   /locus_tag="LEUM_0554"
FT                   /note="LactoCOG number LaCOG00065"
FT   CDS_pept        520425..521855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0554"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61668"
FT                   /db_xref="GOA:Q03YQ4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YQ4"
FT                   /protein_id="ABJ61668.1"
FT                   /translation="MSESKTRTGWLHKATPASFTTSDRHLRKTLGVKEMLALGIGTIVS
FT                   TAIFTLPGIVAANHAGPAVAISFVIAAIVSGLAAFAYAEFASALPFAGSAYSWANVVFG
FT                   EVFGWIAGWALLAEYFIAVAFVASGWSANFKLFLGSHNLVLPKALAGSFAAGNGGVIDI
FT                   ASLFAVLIVAVLLWRGTNTTARVENVLVVGKVLVILIFIGVGLTAIHPGNYVPFIPAHK
FT                   AGTDFGGWSGIFAGASQIFLAYIGFDSIAASSAEAKDPKKTMPRGIIGSLIVATILFVT
FT                   VALVLVGMFHYTEYKDNAAPAAWALLHSGHEFTSNLLSVVALIGMFTAIIGMMLAGSRL
FT                   LYAFGRDGLLPSFLGKVNDKGLPNNALLVLSVIAILIGSVFSFTELAGLISAGTLIAFI
FT                   IVSLGIYALRPREGKDIQEPGFKMPFYPVMPALAALGSGFIFYELDNQAKIYAFGWFVV
FT                   GIIIYAVYGSKHSKLSQK"
FT   gene            521930..523264
FT                   /locus_tag="LEUM_0555"
FT                   /note="LactoCOG number LaCOG01800"
FT   CDS_pept        521930..523264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0555"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61669"
FT                   /db_xref="GOA:Q03YQ3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YQ3"
FT                   /protein_id="ABJ61669.1"
FT                   /translation="MSKNKEILEEEKIHLANATRVKYFDIVIDHGKGAIITDADGHEYI
FT                   DLLASASATNTGHSHPKVVEAITSQAQKLIQYTPAYFANTVTAKLADRLVNVAPGNFQK
FT                   QVAFGNSGSDANDAIIKFARGYTGRQYVVSFTGAYHGSTYGSLSISGVSLNMTRKIGPL
FT                   LPNTVKVPFPDQTQRIAGESDNDFSERLFKQFKLPFETYLPADEVALVIIEPIQGDGGI
FT                   IKAPQHYVELVYEFTREHGIVFAVDEVNQGLGRTGKMWSIDHFGIAPDLMSVGKSIASG
FT                   LPLSAVIGRKEIMDSLQAPANVYTTAGNPVTAAAALATLDVIEEENLVARSRQLGELAK
FT                   AFFESAAKRYAFIGDVRLYGLNGGIDIINDHGEPDNEATNKLIYRIFELGAIMISLRGN
FT                   TLRFQPPLVIQEEELQRAFEILEKAFSDLASGKIALPKTDNHIGW"
FT   misc_binding    523288..523508
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="T-box leader, riboswitch"
FT   gene            523521..526202
FT                   /locus_tag="LEUM_0556"
FT                   /note="LactoCOG number LaCOG01132"
FT   CDS_pept        523521..526202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0556"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61670"
FT                   /db_xref="GOA:Q03YQ2"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YQ2"
FT                   /protein_id="ABJ61670.1"
FT                   /translation="MKDLSSAEIRQMFLDFFASKGHEVVPSKNLIPQDDPTLLWINSGV
FT                   ATLKKYFDGTVVPNNPRITNSQKAIRTNDIENVGKTARHHTLFEMMGNFSIGDYFKEQA
FT                   IPWAWELLTSPEWYGLDAEKLYVTVYPKDQEARKIWEEKTSLPDGHIYEVEDNFWDIGE
FT                   GPSGPDSEIFFDRGSSFQDLPDDDPEMYPGGENERYLEIWNLVFSQFNHLPGLTDNSQY
FT                   PELPHKNIDTGMGLERVVSVFQNGRTNFDTDLFLPIIRATEKLSNQFTYDDSQDSEVNT
FT                   SFKVIADHIRAITFAIGDGALPSNEGRGYVIRRLLRRAVLHGQKLGIKGQFLTNLVPIV
FT                   GDIMESYYPEVKANTAKIQKTVAAEEKRFNATLTGGLSLLNDVIKEAKKTGQTQISGAD
FT                   AFKLSDTYGFPLELTQEQAEDAGLTVDVDRYNDELQAQRVRARAARSNTKSMGVQNAVL
FT                   TDLRVDSKYVGWSQTEVNHAEIVAIIGEDEQGVDALLDNADVDATVQVAFDVTPFYAEM
FT                   GGQVPDFGDVLNTNGDVIAHVTDVQTAPNGQHIHTVDVISSFTLGDKVDLKVDMARHIA
FT                   VSKNHTATHMLDQSLRNVLGGDVHQAGSLVEPEYLRFDFNNEGPVSSEDLDKIESMMNQ
FT                   EIAKNLPVTWLETDIESAKKLGAVAVFGEKYGDQVRVVSIGDFNKEFDGGTHANSTAEL
FT                   GLFKIVSESGIGAGVRRIEAVTGLQALSQYKAQEKALKEIATALKAQKLTDAPEKVYDL
FT                   QADLRTVQRHAESLEAKLANATAGEIFNDVKTVNGHTYITAQLQVSGMDGLRQVADNWK
FT                   ENYPSDVLVLATVADEKVSLIVAAAPDANQSGIKAGELIKSIAPHIGGGGGGRPDMAQA
FT                   GGKKPAGIPDAFAAVSAFLADK"
FT   gene            526299..526550
FT                   /locus_tag="LEUM_0557"
FT                   /note="LactoCOG number LaCOG00085"
FT   CDS_pept        526299..526550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61671"
FT                   /db_xref="InterPro:IPR009309"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YQ1"
FT                   /protein_id="ABJ61671.1"
FT                   /translation="MTVGDETAIFDFGNQMPKDIHETLEIVYSSLEEKGYNPINQIVGY
FT                   LMSGDPAYIPRLNDARNLIKRHERDEIIEELVHAYLKK"
FT   gene            526550..526981
FT                   /locus_tag="LEUM_0558"
FT                   /note="LactoCOG number LaCOG00086"
FT   CDS_pept        526550..526981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0558"
FT                   /product="RNase H-like ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61672"
FT                   /db_xref="GOA:Q03YQ0"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YQ0"
FT                   /protein_id="ABJ61672.1"
FT                   /translation="MRILGLDVGSRTVGVSVSDPMGWTAQGVEIIRINEDEKEFGIDRL
FT                   GEIIKEKNATGVVLGLPKNMNNSEGPRAEASRNYAKLIEKTFGLPTDFQDERLTTVEAE
FT                   RMLIEEANISRKKRKKVIDKIAAEFILQNYLDSKGKLTK"
FT   gene            527058..527357
FT                   /locus_tag="LEUM_0559"
FT                   /note="LactoCOG number LaCOG00087"
FT   CDS_pept        527058..527357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61673"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YP9"
FT                   /protein_id="ABJ61673.1"
FT                   /translation="MSENNAEVQKITLIDESGDEALYEVLFTFHSDEYNKDYILLVPEG
FT                   IEDDEEVDIQAYIFNPDENGDATEEELIQIEDDKEWDMVEEVLNTFLEDDSNFN"
FT   gene            527562..529040
FT                   /locus_tag="LEUM_0560"
FT                   /note="LactoCOG number LaCOG00472"
FT   CDS_pept        527562..529040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0560"
FT                   /product="cytochrome bd quinol oxidase subunit 1
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61674"
FT                   /db_xref="GOA:Q03YP8"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YP8"
FT                   /protein_id="ABJ61674.1"
FT                   /translation="MVTLVGILDLARFQFAMTTIFHFFFVPMSIGLAVVVASMETMYVI
FT                   KKEEVYKKMAQFWSKIFLLSFAVGVVTGIIQEFQFGMNWSAYSRYVGDIFGAPLAIEAL
FT                   VAFFAESTFIGLWSFTWDRFKPAIHVIFIWIVAIASSLSALWILAANSFMQNPVGYAID
FT                   NNMGRAELTSIFALMTNQQLWIEFPHVLMGTFVAGGFIIAGMSAFKLLKLKKDDVQVDF
FT                   FRKSINIALAVGLIGVGGTVITGDRHAFELQSMQPMKYAAMEGVDETMDSSKRADKAQP
FT                   WSLLSVTNPKTHKVIARIEVPYVLSILGNHSLTGGTTVGTTELNKQFEKKYGKTHDGIK
FT                   DYYVPENTLFYAFRVMAVGAGLLGMVALVALWFNRRKTNLILTQRWFLWILGIMTFFPF
FT                   VVNTAGWLVTELGRYPWVVYGLMTIADAVSPNVSAASLLISNIVYFLTFASLGGVMIWL
FT                   SRRVLHDGPDAEKEEELSPRDPYEDLAGSEEAAR"
FT   gene            529037..530050
FT                   /locus_tag="LEUM_0561"
FT                   /note="LactoCOG number LaCOG00473"
FT   CDS_pept        529037..530050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0561"
FT                   /product="cytochrome bd quinol oxidase subunit 2
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61675"
FT                   /db_xref="GOA:Q03YP7"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YP7"
FT                   /protein_id="ABJ61675.1"
FT                   /translation="MSFLQILWFVLIAILWSGFFFLEGYDFGIGMQFIFNSRNQDDREA
FT                   LYESIGPHWDANEVWLITAGGAMFAAFPYWYASLFSGFYLLLFIVLMALIYRGVSFEFR
FT                   EHMPTIQGSQLWERFIAISSFIAPFFLGMIFTAMVSGMPMDAKGNLSAGFFDYVTPFTL
FT                   VGGIAVTLMSYVHGLNYTRLRIIGDIRTRAMAQLKVLYPILLAGEALFAILLFFYTDFF
FT                   QTKLLWTLIILVAIVLSTVIGWYLTVNKKKEVFPFILSGLTLVEVVILIFVGLFPRLMV
FT                   ANNPLHSLKIINASSSPYTLKVMSFVVLTALPLTLGYQIWSFWVFRKRIVADKVVE"
FT   gene            530162..531889
FT                   /locus_tag="LEUM_0562"
FT                   /note="LactoCOG number LaCOG00474"
FT   CDS_pept        530162..531889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0562"
FT                   /product="Cytochrome bd biosynthesis ABC-type transporter,
FT                   ATPase and permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61676"
FT                   /db_xref="GOA:Q03YP6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YP6"
FT                   /protein_id="ABJ61676.1"
FT                   /translation="MIDKRLFALPGIISSLVILVILTGIQAFSIIFQGVFLARAIADLW
FT                   QGKSIDQTLINVLFFAFSFLVRQLLIVLKNNYMSKFADRTVENYRIQLLAKYAEIGPSI
FT                   IKQSGTGNAVTTLGAGLDNVKNYFQLLLIKVFDLSIIPWLILLYIVYLKWEQGLFLLLV
FT                   FPVVILFFIILGLAAQSKADAEFANFKNLNNRFVDALRGLPTLKQLGLSQSYGDEIYNI
FT                   SEDYRKTTMRTLRIAITSTFALDFFTTLSVAIVAVFLGMDLMNAKMALFPALTILILAP
FT                   EYFLPLRNFADDYHATLNGKNSLTDVLEVIDTKIVGPQDELQLNKWQAESELSLNAVQF
FT                   SYDSKVTLKDISLHAKGYQKIALVGESGSGKSTLLSILGGFLQPEQGTININGQEIKHL
FT                   TQQQWQKQFFYMPQTPYIFHESLRDNIRFYAPSASDEAINEAVEKAGLSSLIDELPAGL
FT                   NTVIGESGRQLSGGQAQRVALARMLLDSSRKVLLFDEPTAHLDIETEIDLKRTMSTILD
FT                   KHLVFFATHRLHWLDQMDLVIVIRDGRIVETGVPGVLLADTNSALNALRHELHKGGLK"
FT   gene            531886..533610
FT                   /locus_tag="LEUM_0563"
FT                   /note="LactoCOG number LaCOG00475"
FT   CDS_pept        531886..533610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0563"
FT                   /product="Cytochrome bd biosynthesis ABC-type transporter,
FT                   ATPase and permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61677"
FT                   /db_xref="GOA:Q03YP5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YP5"
FT                   /protein_id="ABJ61677.1"
FT                   /translation="MKRLKKLLSQDRWILPSLRQQKSGLFWSIFLNFMITFAAGALMFV
FT                   SGFLISRSAQHPSNILIIYVPIVLTRAFGIARPVFRYAQRLVSHNWVLRVVSKTRKRLY
FT                   ESAASTASSIRGQLQTGEVLSLLADDLDRLQNLYLRTLFPLGSGMVLYLFLTIAIGTIN
FT                   WLFMLWWFVMLAVILVIVPLLSLAVNYKGVQQQKKLQQSLYIDATDAILGLQDWVLSGR
FT                   QEDLVQNQGETMSRLAHVKNQSMKFGWWRDFVIQVLVLILTITTLMWATNQFSDSSSTV
FT                   NYIAAFTLAIFPLIDSFIAVNQGVSESSFYEDSIVRLNDLPEPTLLQETRHTTNSAVIN
FT                   FNQVTFKYGDKTIVDNLSFEVQPKEKIALLGRSGAGKTTLLKLLAGDIQSSLGEVTIDE
FT                   TPVQNLQGSMSSLVAVLDQQAYLFDTTIMNNVRMGNIHATDEQVQKVIEQAGLQPLINS
FT                   LTNGYYTQMQEAGTRFSGGERQRFALARIMLQDAPIVVLDEPTVSLDPKTEYEVLSQIF
FT                   SVLKDRTIIWVTHHLTGIENVDKVYFLENGKFTLSGSPAELHQTSARFKQLLLMDQY"
FT   gene            533610..534248
FT                   /locus_tag="LEUM_0564"
FT                   /note="LactoCOG number LaCOG00918"
FT   CDS_pept        533610..534248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0564"
FT                   /product="N-acetylmuramidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61678"
FT                   /db_xref="GOA:Q03YP4"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YP4"
FT                   /protein_id="ABJ61678.1"
FT                   /translation="MAKKKRRRSKKGLQKQRLRMLCGLLVALVILAAITSNTAIYERPQ
FT                   NNQINTNSEEAKKVAWINELAPYARELQEKYGVLASISIAQAILESDWHTSTLSTKYNN
FT                   LYGIKADAGQKSAVLPTQEYVNGEWITIQGRFAAYDSWQESMKAHAKLLHDGTSWNAKQ
FT                   YQHVLDADDYASAAKALTQDGYATDPNYAKKLITIIQTWHLERFDATKK"
FT   gene            complement(534272..534769)
FT                   /locus_tag="LEUM_0565"
FT                   /note="LactoCOG number LaCOG00497"
FT   CDS_pept        complement(534272..534769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0565"
FT                   /product="Acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61679"
FT                   /db_xref="GOA:Q03YP3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YP3"
FT                   /protein_id="ABJ61679.1"
FT                   /translation="MKLRPLEKRDLPYIYEQENSRKVMALWFEEPYTSFDELQILYDRH
FT                   ILDQTERRFVVEENDRFIGVVELMDIDTLHRHTEIQIIIHSEFQGHGYAQAAMRAGIEY
FT                   AFTVLNMHKVYLYVDVNNSAAIHIYKKIGFIPEGTLRQHFFAEGEYHDSLMMGIFPHEF
FT                   TF"
FT   gene            534905..537205
FT                   /locus_tag="LEUM_0566"
FT                   /note="LactoCOG number LaCOG00750"
FT   CDS_pept        534905..537205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0566"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61680"
FT                   /db_xref="GOA:Q03YP2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YP2"
FT                   /protein_id="ABJ61680.1"
FT                   /translation="MKNGKIKEVIFTSKDIKMPIETLIQGMNDKQSEAVQTTEGPLLIM
FT                   AGAGSGKTRVLTHRIAHLVQDKNVYPWRILAITFTNKAAREMRERIAQLVDPEIAREIW
FT                   VSTFHAMAVRILRRDGERIGLARNFTIIDTSAQRTLMKRVINDLNLDTNQYDPRTILGT
FT                   VSNAKNDMLTAKAYAKQAGNVYEETVAEVYAAYQAELRRAQSVDFDDLIMSTIDLFKQA
FT                   PDVLERYQNQFEYLHVDEYQDTNDAQYTIVNLLAKRSRNLAVVGDADQSIYGWRGANMN
FT                   NILNFEKDYPDAHTVLLEQNYRSTQNILDAANAVINNNNERIDKSLWTENGKGDKITYY
FT                   RAQTERDEANFVLANIQKSRQEKNAAYSDFAVLYRTNAQSRGIEEALVKANMPYTMVGG
FT                   HKFYERKEILDIMSYMNLMTNPADNAAFERVVNEPKRGIGATSINRLRDFANRMNLSYM
FT                   GAIENIELAPEITAKAASKLIQFAEMMHNLRQQTEFLTVTELAELAMTKSGYRQKLAEK
FT                   NDPESQGRLENLEEFLSVTKEFDSKYNPDDPESVDPMTDFLSSTALMSDLDDFEEGDGA
FT                   VTLMTLHAAKGLEFPVVFLVGMEEGIFPLSRAMMDDDQLEEERRLAYVGITRAMKKLYL
FT                   TNAFSRLLYGRTQANEPSRFIDEISSDLLDTQYGGTSSSSSDRAFPFDKKMQRATATTY
FT                   KAASPVTKMTSGTTGADSTVWQPGDKVSHKKWGIGTIVSVSGSAQDQELKVAFPSEGVK
FT                   QLLAAFAPIKRAE"
FT   gene            537202..537690
FT                   /locus_tag="LEUM_0567"
FT                   /note="LactoCOG number LaCOG01705"
FT   CDS_pept        537202..537690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61681"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YP1"
FT                   /protein_id="ABJ61681.1"
FT                   /translation="MTTLIIIRGNSGSGKTTLAHQLHRVLPDSLLISQDIVRREMLNVK
FT                   DQVGNLSISLIEQLLEFGNQQEQFVILEGILKNSVYGPMIRKQIQYFSQVVTVYYQLSL
FT                   NETVRRHCTKQVTDFTPNDLTRWYQRDDSLRVEGEMIFDESVSLMMAEKQILTKINKY"
FT   gene            537699..539741
FT                   /locus_tag="LEUM_0568"
FT                   /note="LactoCOG number LaCOG00307"
FT   CDS_pept        537699..539741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0568"
FT                   /product="NAD-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61682"
FT                   /db_xref="GOA:Q03YP0"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YP0"
FT                   /protein_id="ABJ61682.1"
FT                   /translation="MLPDFTPIEKLTTQDAQQETARLQKQLVQYGTAYYEDDAPLVEDY
FT                   IYDALYARLVALEEKFPQYVIPDSPTQNVGSADTKSELQKVVHPAPMLSLGDVFSLDEL
FT                   NDWDARTTKSLGNQAPYNLELKIDGLAVALTYVDGQLVQASTRGNGIVGEDVTANVKTI
FT                   KAIPKKLTEPLTIEVRGEIYMPKASFAALNKQREADGLEPFANPRNAAAGSLRQLNVKI
FT                   TKSRNLAAFVYYTAEPEMLGVTTQSGALERFAELGLPTDTHNRVINKMADIADYIDEYT
FT                   SERESLSYGIDGVVVKVNQLDLQFDLGNTVKIPRWAIAYKFPPEEALTIVCDIEWTVGR
FT                   TGAVTPTAVMDPVLLAGTTVQRASLHNPDYLREKDIQIGDTVTLHKAGDIIPEIGQVIL
FT                   EKRPTDSETYQVPTICPACESNLVHIEGEVALRCINPFCSAQIQEGLTHFASRNAMNID
FT                   GMGPRVVGQLLKAGYIKDVASIYRITVEQLLTLDKFQEKSAVKLIDAINSSKENSLERL
FT                   LFGLGIRMVGAKAARLIAEKFRTLSAVSEASVEDIANINGIGHTIAQSIVQYFSTPESK
FT                   QLLVELASSGVNQSYLSDTVIDENSFFYGKKVVLTGKLEQSSRPAATKWLQDHGANVAG
FT                   SVSVKTDLVIAGEAAGSKLDKASQLGVTVWTEQQFVDEQVKEDGK"
FT   gene            539741..540883
FT                   /locus_tag="LEUM_0569"
FT                   /note="LactoCOG number LaCOG01724"
FT   CDS_pept        539741..540883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61683"
FT                   /db_xref="GOA:Q03YN9"
FT                   /db_xref="InterPro:IPR011426"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YN9"
FT                   /protein_id="ABJ61683.1"
FT                   /translation="MKRIGFRGYIAIVVGILIIAVGILYFFNVNRVTLTTSKKTSGVQL
FT                   TQSTPGQYQTVIKNGRYLVSAARGITSTSETNSLDVKNFESSLLDLAKTHFKTSSYIFQ
FT                   EGQYLSSSTVSSLLERKSSSNSDGLNPEDNGKTDSSRNPIYVQTLTEQDFMTKDGDDLK
FT                   LAGMVIGVAMNTQDEYQKEQYGATYTQNISDADRIAYGKKIAPEIIKKVREQKGVDSDT
FT                   PIVIAMYANSKTDSLAPGNFYAESTSSSGTDLKEWTSINQKSIVLPKESTDTSSLGSEA
FT                   NTSFANFKNDVSNFFPNIAGATAVANFKSGTLSSMKVTVTTQFYSQTEIESFATYVSQS
FT                   ALKYLPTNVPIRIIIKAANEMQAILIRNSGDKTFTTTILD"
FT   gene            complement(540911..541603)
FT                   /locus_tag="LEUM_0570"
FT                   /note="LactoCOG number LaCOG01747"
FT   CDS_pept        complement(540911..541603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61684"
FT                   /db_xref="InterPro:IPR009459"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YN8"
FT                   /protein_id="ABJ61684.1"
FT                   /translation="MANTSPVWVYYKNIATGDELHEPTRLDGEAGAPYEIAILDIVNYQ
FT                   YIDTSGSLTGLFGSLPQSLELYYRPQEWQAVHRINMFIETVTSVQVFLEPDNLSNVTTN
FT                   LNPNTFWATQLRAISGNGQFWYQIGDYHWIRYDATQMKLSDTAPEVENINYFNDAEKSK
FT                   SNQPNAVVNFLPDQSIEVYAEPYGLPIGSVSDSDFVAITEEIHDDNNIVWYKIATKGWI
FT                   NSIYINKL"
FT   gene            complement(541682..543736)
FT                   /locus_tag="LEUM_0571"
FT                   /note="LactoCOG number LaCOG00369"
FT   CDS_pept        complement(541682..543736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0571"
FT                   /product="ATP-binding subunit of Clp protease and DnaK/DnaJ
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61685"
FT                   /db_xref="GOA:Q03YN7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YN7"
FT                   /protein_id="ABJ61685.1"
FT                   /translation="MAQQDSFGFGNLDEMFRAMNEQMAQAQGQQNTQAQKNNNGNKKRR
FT                   LLDEFGINLTKQARDGKLDPVIGRDNEVARTIEILNRRTKNNPVLIGEPGVGKTAIVEG
FT                   LAQAIVAGKVPEKLQHKEVIRLEMSALVQGTSMRGQFEARMRELMKEVTNSDDVILFID
FT                   EIHEIMGAGNAEGGMDAGNILKPALARGEFQLIGATTLNEYRKIEKDGAIARRFQPVQV
FT                   EEPSKEETITILEGISERYEKYHYVTFSDSALQAAVELSDRYIPERFLPDKAIDLLDEA
FT                   GSRKNLTMKVADPKTIQVNIEAADKLKQEAIDKEDFEKASYWRDQVNQLESQKAQVEAH
FT                   PEMSKPQTVTEQDILKIVEDKTDIPVGALKENEANQLKDLDKNLSKHVIGQDEAVEKLA
FT                   KAIRRNRIGLTKSGRPIGSFLFVGPTGVGKTETAKQLAKEMFGSKDAMIRFDMSEYMEK
FT                   HTVSKMIGAPAGYVGYEEAGQLTEQVRRRPYSLVLFDEVEKAHPDVMNMFLQILDDGRL
FT                   TDAQGHIVSFKDTVIIMTSNAGSTDTGNTPVGFAQVDQQNRLMQRLENYFRPEFLNRLD
FT                   DIIDFQPLSQDHLLKIVDLLLTDMNENLSDNDLHIDLSTAAKQKLVELGYDPAMGARPL
FT                   RRVMQDKIADGIADFYLEHPDVHHLQADIVHNEFVISEVKPEPVTVNKI"
FT   gene            543922..544095
FT                   /locus_tag="LEUM_0572"
FT                   /note="LactoCOG number LaCOG02250"
FT   CDS_pept        543922..544095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61686"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YN6"
FT                   /protein_id="ABJ61686.1"
FT                   /translation="MDYTQALNDLRDGKIDEIEVTPAVFPEFQKAWANFAYQNTIRGIA
FT                   HAHGKVTYVRSN"
FT   gene            544192..545199
FT                   /locus_tag="LEUM_0573"
FT                   /note="LactoCOG number LaCOG01891"
FT   CDS_pept        544192..545199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0573"
FT                   /product="Actin-like ATPase for cell morphogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61687"
FT                   /db_xref="GOA:Q03YN5"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YN5"
FT                   /protein_id="ABJ61687.1"
FT                   /translation="MAFSFGQKNVGIDLGTANTYVYIEGRGIILREPSVVARNTQTNEV
FT                   VAVGSEAKDMLGRTPASIAAIRPMRDGVIADYDTTVAMIRYYLQKALGGRIGKPYVTIG
FT                   VPSGVTAVERRAVIDAARVAGARDAYVIEEPFAAAVGAGLPVMDPTGSMVVDMGGGTTD
FT                   VATISLGGIVSSRSIRIAGDKLDEAIANFVRNKYNVTIGEPTAERLKIEIGAASLALAR
FT                   TLPNATVRGRDLLTGLPKTIDVTAEDVATSIQEPVQEIVAAIRETLESTQPELAADVID
FT                   HGMILTGGGALLRDIEKIIQDATKVPVLIANEPLDAVAIGTGEALKSIDVMRQK"
FT   gene            545361..546218
FT                   /locus_tag="LEUM_0574"
FT                   /note="LactoCOG number LaCOG01506"
FT   CDS_pept        545361..546218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0574"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61688"
FT                   /db_xref="GOA:Q03YN4"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YN4"
FT                   /protein_id="ABJ61688.1"
FT                   /translation="MKKIFSSRTLVSIIVAFIVIVSLIAGSNWWAKRTNTPPFLQRFGN
FT                   DLAGGVSRIIAVPTTAVGRTANSISNLLDTFEENKRLKSKIDEFAQDKVHLQTVEEENK
FT                   SLKQQLKLKATLTDYKTVSAVTISRSPTTWQSQLVIDEGSNSGLKKGMPVLAGAGIIGR
FT                   ISEVNTTNSKVALISDTSSDANRFAIKIKGDDGDVNGIVTSFNREKNQLIMGQVTSNNK
FT                   ISKGDLVETSGLGGVIPAGLYVGKVASVTTDDYGLSKKIYIEPAADLGNITTVMVAISQ
FT                   IGAN"
FT   gene            546218..546745
FT                   /locus_tag="LEUM_0575"
FT                   /note="LactoCOG number LaCOG01505"
FT   CDS_pept        546218..546745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0575"
FT                   /product="rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61689"
FT                   /db_xref="GOA:Q03YN3"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YN3"
FT                   /protein_id="ABJ61689.1"
FT                   /translation="MAFWQLTRLRVIYPVLLFLILFVDGTFMSSMGGLFTQFPWHILPT
FT                   LTLGWLFLGVQFDVENELPLWFYIVVIGILFDMYYTGIFGTYTFAFIAAVAVMKQLHKV
FT                   LDERLVSGLLLYLAGLLIYLLISYVSGFVTGIANVSMLSFLLYEVLPTVILNLVFAAAS
FT                   YYPVWSLFQFLR"
FT   misc_binding    546793..547039
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="T-box leader, riboswitch"
FT   gene            547232..547873
FT                   /locus_tag="LEUM_0576"
FT                   /note="LactoCOG number LaCOG01888"
FT   CDS_pept        547232..547873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0576"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61690"
FT                   /db_xref="GOA:Q03YN2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YN2"
FT                   /protein_id="ABJ61690.1"
FT                   /translation="MSYLTTILPSLLAGLKTTLGVFFLTIIGSVPLGILVSLGMKSPYF
FT                   TIRWLINGYIWIMRGTPLLLQLIFIYYGLGMMGIAFPRFEAAIIAFIINYAAYLAEIFR
FT                   GGLQSVPRGQYDAAKVLGFSKIQTFFKIILPQVIKIVVPSFGNEVINLVKDTSLVYVIG
FT                   LGDILRAGNIAASRDVTLMPYLLVGLIYLIMTAVVTLLLRRSETVLNTWR"
FT   gene            547878..548516
FT                   /locus_tag="LEUM_0577"
FT                   /note="LactoCOG number LaCOG01887"
FT   CDS_pept        547878..548516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0577"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61691"
FT                   /db_xref="GOA:Q03YN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YN1"
FT                   /protein_id="ABJ61691.1"
FT                   /translation="MLEIKNLTKKYDQNVIFKSLNLTVHDGEVLSIVGPSGIGKTTLIK
FT                   IMAGLETADDGEIILNGENIDIKGESSDTNIGMIFQDFNLFPNYTVIDNITLAPINVNK
FT                   QSSSKAVEQGQELLESLGMLDKANLFPYQLSGGQKQRAAIARALAMNPKILAYDEPTSG
FT                   LDEASTHQVADVVKTLKKRGVTQVIITHDQPFAEMVSDRVFDFATEVKR"
FT   gene            548516..549370
FT                   /locus_tag="LEUM_0578"
FT                   /note="LactoCOG number LaCOG01886"
FT   CDS_pept        548516..549370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0578"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61692"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YN0"
FT                   /protein_id="ABJ61692.1"
FT                   /translation="MPSMKKKIVVNSIVGILFIALVVMAALSLSNNSQKSKSTEQTVVK
FT                   TDQWSRIKREKQITIGLDDTFVPMGFRDKSGKLVGFDVDLATAVFKSLGIKVKWQPIDW
FT                   SMKETELNTGNIDAIWNGYTITDDRKKKVAFSTPYHKATQVLVTLKKSNINKFSDMQDK
FT                   VLGDQTASSGDQTFAQYPKVLKQYVKDQKVIGYDTFDKAFNDLNASRIDGLLIDEDYAR
FT                   YYVAHQSNPNDYTITTGGFPVNDNAVGFRKADKKLRQAVNKELKTYKKDGRLQKYSTKW
FT                   FGN"
FT   gene            549453..550907
FT                   /locus_tag="LEUM_0579"
FT                   /note="LactoCOG number LaCOG00668"
FT   CDS_pept        549453..550907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0579"
FT                   /product="Phosphatidylserine/phosphatidylglycerophosphate/
FT                   cardiolipin synthase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61693"
FT                   /db_xref="GOA:Q03YM9"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="InterPro:IPR030874"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YM9"
FT                   /protein_id="ABJ61693.1"
FT                   /translation="MLRTSFWIVILIALVINTIISFIAVFRQKREIATIWAWMLVLLLL
FT                   PVVGFAIFFLAGSRISSKKIFRLRTQEQRGLDQIALNQKKQLQDIENLLPIPYSATELL
FT                   KLFLSSDRAVLTRGNKITIFSDGQKKFDKLFSDIRAAKEHIHLEYFSIFDDKIGHQLVD
FT                   LLTEKAGEGVEVRVIYDQFGSHGQHPKMYRQLRAAGGVAVPFLMRRFQLLTLRFNFRNH
FT                   RKIAIIDGKIGYIGGFNVGDQYIGESKKFGYWRDTHTRIIGDAVLSLQSRFLMDWNATA
FT                   EGRELLTQTTKYFPENFSLPGKSMVQIVSSGPDDDMKQIKQGYMRMFSSARESISIQTP
FT                   YFIPDGPVLETLEVAILSGVKVKLMIPNQPDHPLVYRATEYYAQELIDLGATVYRYDGG
FT                   FLHSKVVIIDNEVATVGSANMDIRSFSLNFEGNAFIYDPDFAADLEDLFEQDVLKSTKL
FT                   TMEYFEKQSAWMKFKQKFSRLFSPIL"
FT   gene            550904..552169
FT                   /locus_tag="LEUM_0580"
FT                   /note="LactoCOG number LaCOG01315"
FT   CDS_pept        550904..552169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0580"
FT                   /product="Predicted Zn-dependent peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61694"
FT                   /db_xref="GOA:Q03YM8"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YM8"
FT                   /protein_id="ABJ61694.1"
FT                   /translation="MKKTIINHGANLVILPTTQFKTLHIAVDFSTAVEPENISARALVS
FT                   YLTAVSSARYKTQQQVAQKTIDLYGAQYQTDVFRIGQTHHVRFTLQIPAPTYIVGGKQL
FT                   LTEAFDFLREMIFNPLTENHAFNEQVFANEQQSLINELASVKDDKSRYAVAKLREITYD
FT                   KSGMRVSASGNEETVAHLNPSGVYQAYQNMINDDAMNIVVLGDINQQQIISLLEKWPIV
FT                   PHQAKEEKEPFYRQASRLHLSELVEHKTSINQAMLTMAYQLNVKPFDDQRFAVMVMNSL
FT                   LGGTPLSKLFMNVREKESLAYSIYSRWQHDTGFLTIAAGLDTTKVRQTDTMIQEQIKAV
FT                   QEGDFDNQTVDAIKMSLISDYLSQRDSPASQMEVAFSRLLTRRETSEQEWIDRVKSVTA
FT                   DDIQNAAQKISLQSRYILLPEV"
FT   gene            552171..553442
FT                   /locus_tag="LEUM_0581"
FT                   /note="LactoCOG number LaCOG01314"
FT   CDS_pept        552171..553442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0581"
FT                   /product="Predicted Zn-dependent peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61695"
FT                   /db_xref="GOA:Q03YM7"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YM7"
FT                   /protein_id="ABJ61695.1"
FT                   /translation="MKTKHYLKLKEDVITETLDNGLSIVMVPKSNYHKTFAVLTTAYGA
FT                   LEQKFAIDDAQPIQIPAGTAHFLEHKLFEKENEDAFARFGELGADANAFTNAYQTSYLF
FT                   STTQNLIPALTHLLDFVQTPYFSKQTVEKEQGIIGQEIQMYDDDPNWALYMGLLNTLYP
FT                   DSSIAKDIAGTRETIATITPELLYAIHSAFYQPTQLTLHIVGHFNPEEILAVVKDNQFK
FT                   KDLRPKKLTRFQEKNLPAKEQQSERYFNVSRPKVAFGIRLDQNQVAGIEATKRILIADI
FT                   LDDLLFGEQTDWYQNLYSHGIIDTEFNTSFDIIKHYQYVSFFAETDDYDILTQEIQSQI
FT                   DDYQNVLENQQNAFESLRRATVGEGIQKLNSLENMALQGDDVLFGTNLFDKIELLQDLT
FT                   FDDILVTADKIYRNATLQRFVLHK"
FT   gene            553457..554332
FT                   /locus_tag="LEUM_0582"
FT                   /note="LactoCOG number LaCOG01313"
FT   CDS_pept        553457..554332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0582"
FT                   /product="Xre-like DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61696"
FT                   /db_xref="GOA:Q03YM6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YM6"
FT                   /protein_id="ABJ61696.1"
FT                   /translation="MNETLTNQIGEQLKAARLEKQLSLDDIQEITKIQRRYLSAIEENN
FT                   LSVLPGDFYVRAFIRQYALAVGLHPDELLGETKPISMSRTSDLSRAHRDNDGIVRAGID
FT                   NTPTARSRLANSMPTIGLGLLILVALIVIWFVLTHIGTNSQQTSNGGNISVSTSEVSKS
FT                   SSKSSASKSSASSSSEESSILDLGTPETNTSLQTTIYNLSNENTKKHTVVITAKNTGTS
FT                   VKVNDASSNILLNETLASGSKTVEIPSGTTAFNLQFSNVNNASVTVDGQNVEVSGATTS
FT                   FWNVLFNLNK"
FT   gene            554343..554924
FT                   /locus_tag="LEUM_0583"
FT                   /note="LactoCOG number LaCOG01312"
FT   CDS_pept        554343..554924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0583"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /EC_number="2.7.8.5"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61697"
FT                   /db_xref="GOA:Q03YM5"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YM5"
FT                   /protein_id="ABJ61697.1"
FT                   /translation="MNLPNKLTVFRIILIPVFILLLTVPYAWSNISFLGATMPVNWLIA
FT                   AVVFAIASATDFLDGQIARSQHLVTNFGKFADPLADKLLVMTALIFLTSFNVVPAWMTA
FT                   VIVIRELAVTGLRTLIVENNGKVLAAQMPGKIKTFSQMFAIFFLYIHNAPFSIINFPIG
FT                   DVLLWVAVIFTIYSGIDYFWQNRNVFSDGM"
FT   gene            555064..556221
FT                   /locus_tag="LEUM_0584"
FT                   /note="LactoCOG number LaCOG00258"
FT   CDS_pept        555064..556221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0584"
FT                   /product="RecA protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61698"
FT                   /db_xref="GOA:Q03YM4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YM4"
FT                   /protein_id="ABJ61698.1"
FT                   /translation="MVAKKTTKKDDQAKKDGRRAALDEALKKIEKNFGKGSVMTLGDNA
FT                   LTQIETIPSGSVKIDVALGVGGYPKGRIIEVYGPESSGKTTIALHAVAEVQKQGGTAAY
FT                   IDAENALDVKYAEALGVKKDELLLSQPDTGEQGLEIADALVQSGAVDMIVVDSVAALVP
FT                   RAEIEGEMGDAHVGLQARLMSQALRKLAGTLNRTGTIAIFINQIREKVGVMFGNPETTP
FT                   GGRALKFYSTVRLEVRRSTQIKDGTDVTGNLTKVKIVKNKVAPPFKVAEVDIMYGHGIS
FT                   QTGEILDLAVDQDIIDKAGAWYAYEGERIGQGREKAKDYLDDPEHAALRQELYVKVRQA
FT                   YGIDSNANGTAVSNTEAQAEKSDEQINLPDLDTTTDDSLTDEPIV"
FT   gene            556304..556996
FT                   /locus_tag="LEUM_0585"
FT                   /note="LactoCOG number LaCOG01660"
FT   CDS_pept        556304..556996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0585"
FT                   /product="DNA-binding response regulator, OmpR family
FT                   (Rec-wHTH domains)"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61699"
FT                   /db_xref="GOA:Q03YM3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YM3"
FT                   /protein_id="ABJ61699.1"
FT                   /translation="MTKILVVDDETAIATLLQYNLQQNGYEVTVASDGLSAYQKAKEQQ
FT                   FNAILLDLMLPEMDGMTVLKQLRQDKVSTPIILVTAKGDEFDRVLGLELGADDYITKPF
FT                   SPREVVARLKAVLRRSQVSTDTNKTDEMVISIQDLLINDSKKTVMKENIVLSLTPREYD
FT                   LLLYFAQRLGRVIDRETILTAVWGYEYTGESRMVDMHISNLRDKIESNPKAPKILKTVR
FT                   GFGYTMTN"
FT   gene            557237..558145
FT                   /locus_tag="LEUM_0586"
FT                   /note="LactoCOG number LaCOG01129"
FT   CDS_pept        557237..558145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0586"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61700"
FT                   /db_xref="GOA:Q03YM2"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YM2"
FT                   /protein_id="ABJ61700.1"
FT                   /translation="MNKKIVGIIGGIVVIAAGIALYTSANDKSSDNKTSTTSSSNVSGK
FT                   VLSLGSTALQPLAEQVAKSFQEKNPNVTITVQGGGSGAGLSQVSDGSAQIGNSDVFAEE
FT                   KDGIDATKLVDHKVAVVGIAPVVNSDVQITSLTKEQLRNIFTGKVTNWKEVGGNDEKIV
FT                   VINRATGSGTRAVFEKNILDGQDAVQATEQDSNGTVQKIVKTTPGSISYLAFAYLDSDG
FT                   IKALDLNKVHPNKKNVEDNSWPIWAYEHMYTKGKPTGATKSFLEYFTTKEVQKNIVPKL
FT                   GYIGLTDMKVTRDASGKVTDK"
FT   gene            558310..558570
FT                   /locus_tag="LEUM_0587"
FT   CDS_pept        558310..558570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61701"
FT                   /db_xref="GOA:Q03YM1"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YM1"
FT                   /protein_id="ABJ61701.1"
FT                   /translation="MSHNQLYILVIIFFVVANFEVWFLNFWQNKETAELTIMKNRMIAT
FT                   SAGETPRGVLAEPTSPYYELLEHSMNYKVMFAIRNIVPIVK"
FT   gene            558588..559568
FT                   /locus_tag="LEUM_0588"
FT                   /note="LactoCOG number LaCOG01661"
FT   CDS_pept        558588..559568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0588"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61702"
FT                   /db_xref="GOA:Q03YM0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YM0"
FT                   /protein_id="ABJ61702.1"
FT                   /translation="MASLPVGVINVSRHHMIDVFNQTAADMLGVEMPEVPILDSLVIRQ
FT                   FTLSEIINHTFNTNQRQHSILNLMIDGEARQYDVSTLFHQSGSNAEVMVMLYDLTEVLK
FT                   LERMQADFLANASHEFKTPLTAITGFVETLQGDAGADEETRTQFLQIVADEAKRLSALV
FT                   NDILSLSRMQHKVDEKISNLEISAIVEQQLEKIDTKTITVHNDIAPDFSVSGIASDVST
FT                   IVQNLLTNSVKYNKIDGEVWISAYKDTQQWQIKVSDSGIGIPLNQQSRIFERFYRGDES
FT                   RQRKIASGTGLGLAIVNEIVNQHNGEINIKSQVGVGTTISVILPL"
FT   gene            559710..560591
FT                   /locus_tag="LEUM_0589"
FT                   /note="LactoCOG number LaCOG01129"
FT   CDS_pept        559710..560591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0589"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61703"
FT                   /db_xref="GOA:Q03YL9"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YL9"
FT                   /protein_id="ABJ61703.1"
FT                   /translation="MSKSYRGSIVFTIVAVAVAAALGTAYAMRDKSASNTSITAVGSTA
FT                   LQPLVEAAGEEYAKDNIGTFINVQGGGTGTGLSQVSQGAVDIGNSDVFAEEKDGIDAKE
FT                   LVDHQVAVVGIAPLLNKHNGVKNLTTKQLIAVFTGKVTNWKEVGGNDQKIVIINRAAGS
FT                   GTRATFEQWGLNGAQSTEAQEQDSSGMVRSIVSTTPGAISYAAFGYIDDSVVAAKVNGV
FT                   KPTKQNVVSGKYAIWSYEHVYTKGKPSEPVAKFLKYLTSKKVQSTLVSKLGYISIHDMK
FT                   ISRDVNGQVTRK"
FT   gene            560644..561567
FT                   /locus_tag="LEUM_0590"
FT                   /note="LactoCOG number LaCOG01128"
FT   CDS_pept        560644..561567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0590"
FT                   /product="phosphate ABC transporter membrane protein 1,
FT                   PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61704"
FT                   /db_xref="GOA:Q03YL8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YL8"
FT                   /protein_id="ABJ61704.1"
FT                   /translation="MDNITKKLMQRSESTHKDTFGRAVSLTALALIGIVVVAIFAFVLS
FT                   RGLSTFFRDGVNVKDFLFGTTWNPSVTNPATKQPYIGALPMIIGSFLVTFLAAVVATPF
FT                   AIGTSLFMTEIAQKRGAKIMQPIIELLVGIPSVVYGFIGLTVVVPFIRNITGGSGFGIL
FT                   SGTIVLFVMILPTITSMTVDTLKSVPRYYRESALAIGATRWQMIYKVVLRSATPGIMTA
FT                   IVFGMARAFGEALAVQMVIGNAALMPTGLTTPASTLTSVLTMGIGNTVMGSLQNDVLWT
FT                   LAMILLLMSLVFNLIVRAIGRRGAMK"
FT   gene            561567..562451
FT                   /locus_tag="LEUM_0591"
FT                   /note="LactoCOG number LaCOG01127"
FT   CDS_pept        561567..562451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0591"
FT                   /product="phosphate ABC transporter membrane protein 2,
FT                   PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61705"
FT                   /db_xref="GOA:Q03YL7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YL7"
FT                   /protein_id="ABJ61705.1"
FT                   /translation="MNAKTADKIATGVIYAISGIVALILFAMLAFILVQGVPHLSWHFL
FT                   TSPARAFEAGGGIGIQLFNSFYLLILAMLISFPIALGAAIYLNEYAQKNHFTAIIRTAI
FT                   EILSSLPSVVVGLFGFLLFVVQFKLGFSILSGAIALTLFNLPLLTRSIETSLAQIPDLQ
FT                   REAGAALGLSRWETVLHVILPAAVPSIVTGVVLSAGRVFGEAAALIYTAGQSAPALNFA
FT                   DWNPFNISSPLNPMRPAETLAVHIWKINSEGIMPDVSAVSAGASAVLIIVVLLFNFSAR
FT                   KLGMKLYKKLTSA"
FT   gene            562459..563301
FT                   /locus_tag="LEUM_0592"
FT                   /note="LactoCOG number LaCOG01126"
FT   CDS_pept        562459..563301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0592"
FT                   /product="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61706"
FT                   /db_xref="GOA:Q03YL6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YL6"
FT                   /protein_id="ABJ61706.1"
FT                   /translation="MINSNTDLKPASEFIRENAPERFIYKMDTEKHEIALSTHDLQVFY
FT                   GDNLALSEGDLQFERYKITSLVGASGSGKSTFLRSLNRMNDGVATVNGNIMYRGLDINT
FT                   KKIDVYEMRRHIGMVFQRPNPFAKSIYDNITFALTSRGNYTKQQLDEVVETSLKQAALW
FT                   DQVKDELNKSALALSGGQAQRLVIARALALKPDILLLDEPSSALDPISSAQVEDTLLKL
FT                   KDQYTIIIVTHNMQQAARISDYTAFFHMGKVIEYDLTRKIFTRPKVALTNDYISGNFG"
FT   gene            563298..564068
FT                   /locus_tag="LEUM_0593"
FT                   /note="LactoCOG number LaCOG01125"
FT   CDS_pept        563298..564068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0593"
FT                   /product="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family"
FT                   /note="TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61707"
FT                   /db_xref="GOA:Q03YL5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YL5"
FT                   /protein_id="ABJ61707.1"
FT                   /translation="MTDNKEKTILSTRDVHLWYGKKEALHGIDLDFPEKGITALIGPSG
FT                   SGKSTYLRAINRMHDLEDNVTVTGSFKFKDTDIYAPTTDTVDLRKRIGMVFQQPNPFPF
FT                   STYENVAFGLRLAGVKDKAVLDEAVEKALKQSSVWDEVKDNLHKSALGLSGGQQQRVSI
FT                   ARVLATSPELLLLDEPTSALDPVSSHNIEETLLKLRDDYAMIIVTHSMSQASRISDRTA
FT                   FFLSGDLIEVDETKHIFLDPAKKETQDYVSGRFG"
FT   gene            564127..564801
FT                   /locus_tag="LEUM_0594"
FT                   /note="LactoCOG number LaCOG01124"
FT   CDS_pept        564127..564801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0594"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61708"
FT                   /db_xref="GOA:Q03YL4"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YL4"
FT                   /protein_id="ABJ61708.1"
FT                   /translation="MRRLFDEELADLDSSFTEMGMLVSQTIQKAVQSFVDHDREGARKI
FT                   LENDHQINEREAAIEKKTFEMIALYQPVTTDLREIVTILKAVSVLERMGDQARNIANST
FT                   IRVKGTKHIASVEQELGEMGEMVATMVSEVMDYYVKNDALGAEAIADKNSVLTQSAAKV
FT                   RTDSVNGMKEDAELVDSAADYLVIAGYLKRIGDYTTDIAEWIVYKRTGKIIELNPGYNF
FT                   FI"
FT   gene            complement(564889..565989)
FT                   /locus_tag="LEUM_0595"
FT                   /note="LactoCOG number LaCOG01181"
FT   CDS_pept        complement(564889..565989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0595"
FT                   /product="transporter, YbiR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61709"
FT                   /db_xref="GOA:Q03YL3"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YL3"
FT                   /protein_id="ABJ61709.1"
FT                   /translation="MINTLKRILTDKTFFITLILSILSLCFGQVKSTDIDFKTIISLSS
FT                   LLIIIAIYQDLGILKFIANYIVSKCHSTRLVFLVLLLCSFFGSMLFTNDVAILTLIPIF
FT                   FNISKRIPFPKIFAISLLTIYANLGSSFTPFGNPQNIYIVSFYKLSVIDFLGMSIPFGL
FT                   ISLITLLFSVLFIKNKQIEKQSSNIISINRTKTVWLLLASIVVLLGILSVIPVIISLLI
FT                   SLLSGLTLSKKIFKRVDYAVILTFINFFIIVGAISRINFVSGLITNHTNNALSTFISAI
FT                   VTSQLISNVPAAVLLSKFTNHVYALFLGVSVGGLGTIIASLANLLALRQYAGYSQNRSN
FT                   FQFFKTFTLLNMIFLVLFIVVGIVLL"
FT   gene            566370..566726
FT                   /locus_tag="LEUM_0596"
FT                   /note="LactoCOG number LaCOG01662"
FT   CDS_pept        566370..566726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0596"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61710"
FT                   /db_xref="GOA:Q03YL2"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YL2"
FT                   /protein_id="ABJ61710.1"
FT                   /translation="MRFIVRLAINMLTFLLLSMIFPSGFRVDSWGAALLAAFVLSILNA
FT                   IIKPILTILTLPLTILTFGFFAIVVNAMLLEVTADLVGGFEFSSFGWAMIIALIVSIIN
FT                   TFLTKDLHVQVERH"
FT   gene            566728..567693
FT                   /locus_tag="LEUM_0597"
FT                   /note="LactoCOG number LaCOG00413"
FT   CDS_pept        566728..567693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0597"
FT                   /product="Hpr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61711"
FT                   /db_xref="GOA:Q03YL1"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YL1"
FT                   /protein_id="ABJ61711.1"
FT                   /translation="MAQNSVTVKQLVENTRLKIVAGEQYLDREITTADISRPGLEMTGY
FT                   FNYYAPERIQLLGITETSFSERMSHDELLLVFRRMADEKTPAFVISTGLPISDELNQAA
FT                   DEAHIPILSSTLTSSRILSNMTYYLGGELAPRKNVHGVLIDVHGLGVLITGDAGIGKTE
FT                   SALELIQQGKARLVADDRVDIYQEDEERLIGEPNGVLRNMMEVRGVGIIDVQQVYGAVS
FT                   VRSHATIALNIHLSNGKIGEANFDRLGDDNDSLEILGVKIKRMVVPVTPGRNTASVIDA
FT                   ASVKFRTANMGIDALKTLEERMTAEMEKNEKIDAGDEKND"
FT   gene            567686..568696
FT                   /locus_tag="LEUM_0598"
FT                   /note="LactoCOG number LaCOG00905"
FT   CDS_pept        567686..568696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0598"
FT                   /product="glycerol 3-phosphate dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61712"
FT                   /db_xref="GOA:Q03YL0"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YL0"
FT                   /protein_id="ABJ61712.1"
FT                   /translation="MTKIAVLGGGSWGTALANVAAENNNDVRLWTRTATQADEINSQHT
FT                   NQKYLPDAKLSSELMATSNMALAVMDAEIVLTVVPTKVVREVARQLADVLNKQDHQVIL
FT                   AHATKGLEQVTYKRVSEMLAEEVPAKYRSTLAMISGPSHAEDVIKHDLTSVSIASENEE
FT                   AAKLLQQVFANSSFRPYTNHDLLGSELAAALKNIIAIGSGALIGLGYGANAQAALLTRG
FT                   LSEMRALGQAMGAQPETFLGLAGIGDLIVTGMSPNSRNYRAGKQLGEGKSLQEIQDDMG
FT                   MVIEGVSTTKAVYEFSQHHHVEMPITAGIYRILYENEPLRDVISDLMSRPLRSED"
FT   gene            568719..569594
FT                   /locus_tag="LEUM_0599"
FT                   /note="LactoCOG number LaCOG00906"
FT   CDS_pept        568719..569594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0599"
FT                   /product="UDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.9"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61713"
FT                   /db_xref="GOA:Q03YK9"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YK9"
FT                   /protein_id="ABJ61713.1"
FT                   /translation="MKPVRKAIIPAAGLGTRFLPATKALAKEMLPIVDTPTIEYIVREA
FT                   IESGIEDIVIVDGKSKRSIEDHFDSNPELENNLREKGKDELLKLVEETTDINMYFIRQS
FT                   HPKGLGDAVLTAKAFIGDEPFVVLLGDDLMQDEVPLTKQLIQRYEETGESTLAVMKVPH
FT                   DQVSEYGVIDPAAQVDKGGLYRVKSFVEKPKPEDAPSDLAIIGRYLLTPEIFEELENTK
FT                   PGKGNEIQLTDAIDSLNNRQHVYAHEFKGSRYDIGSKIGFLETNIEFGLKHPQTKDALR
FT                   AYIKELASKL"
FT   gene            569708..570661
FT                   /locus_tag="LEUM_0600"
FT                   /note="LactoCOG number LaCOG00651"
FT   CDS_pept        569708..570661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0600"
FT                   /product="Thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61714"
FT                   /db_xref="GOA:Q03YK8"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YK8"
FT                   /protein_id="ABJ61714.1"
FT                   /translation="MSEELKEYDVVVIGAGPAGMTAATYASRANLSVLMLDRGIYGGQM
FT                   NNTAEVENYPGFDSILGPDLAEKMYSSSTQFGAEYGFGSVESIEVEDYRKIIHTDMGTY
FT                   AAKAIIIATGSEHIHLDVTGEDKYQGRGVSYCAVCDGAFFRDEDVLVIGGGDSAIEEGL
FT                   YLTNLAKSVTVLHRRDKLRAQQIIQNRAFDNSKMKFEWHTEVVAITGDDDKVTGVDVIN
FT                   NQTNEKRHIDASGVFIYVGLKANTQGFENLNITDPEGWIVTDDKMQTSIPGVFAVGDVR
FT                   VKDLRQITTAVGDGSLAGQGVYDYISSLPATEKIAE"
FT   gene            complement(570708..571091)
FT                   /locus_tag="LEUM_0601"
FT                   /note="LactoCOG number LaCOG02251"
FT   CDS_pept        complement(570708..571091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0601"
FT                   /product="methylmalonyl-CoA epimerase"
FT                   /EC_number="5.1.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61715"
FT                   /db_xref="GOA:Q03YK7"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YK7"
FT                   /protein_id="ABJ61715.1"
FT                   /translation="MAFADYYSGLQHVGIPSSSLEQSEAFWTKLGFKKTGDFPAGNVIF
FT                   MQRENLVIETWSGDEVAGKPGAINHISMDTTDADAAFDAAKAEGFTLIDSEVQHLPFWD
FT                   KGIKFFNLQGPDGVIVEFCEIVK"
FT   gene            complement(571142..571879)
FT                   /locus_tag="LEUM_0602"
FT                   /note="LactoCOG number LaCOG02252"
FT   CDS_pept        complement(571142..571879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0602"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61716"
FT                   /db_xref="GOA:Q03YK6"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YK6"
FT                   /protein_id="ABJ61716.1"
FT                   /translation="MTQNETKTKSSRTISMSLSITYFTISLVINAMGNVLTLVTSDHIH
FT                   PAFLGSAYWTAAEANLGHAILGNNSLALFWAFLVLGMLISFLNAFLMKKLDWKRILGNF
FT                   IFMLPFSIFIQWFSNIFNQIMPDAKSLPMVILYIVINFVGVALIGTAISIYQRVNLVLH
FT                   PADDLMQILRFKYFKGSAFKAMWASYIPPTIFAIIAFIITFPNLYNFGLGTLFAFLFQG
FT                   GITGIADKLVFRNLDHQAVDVGE"
FT   gene            complement(571882..572898)
FT                   /locus_tag="LEUM_0603"
FT                   /note="LactoCOG number LaCOG02253"
FT   CDS_pept        complement(571882..572898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0603"
FT                   /product="Threonine dehydrogenase related Zn-dependent
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61717"
FT                   /db_xref="GOA:Q03YK5"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YK5"
FT                   /protein_id="ABJ61717.1"
FT                   /translation="MEALVLTGTKKLEVKDIDRPKVLPNEVLIHTAFAGICGTDHALYA
FT                   GLPGSADAVPPIVLGHENSGVVAEIGSAVTNVKVGDRVTVDPNIYCGQCKYCRTARPEL
FT                   CENLSAVGVTRDGGFEEFFTAPASVVYPIPDNVSLKSAAVVEPISCAVHGIQLLKVTPY
FT                   QKALVIGDGFMGELFVQILQAYGIHQVDLAGIVDEKLAMNKEKFGVKNTYNTMKGDKIP
FT                   EGEYDVIIEAVGLPQTQEAAIEASARGAQVLMFGVGGPDAKFQMNTYEVFQKQLTIQGS
FT                   FINPNAFEDSLALLSSGKLNVEALMSHELDYKTVDDFVNGKLGVVSKAVVKVGGEEA"
FT   gene            573045..574022
FT                   /locus_tag="LEUM_0604"
FT                   /note="LactoCOG number LaCOG01077"
FT   CDS_pept        573045..574022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0604"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61718"
FT                   /db_xref="GOA:Q03YK4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YK4"
FT                   /protein_id="ABJ61718.1"
FT                   /translation="MVAKLSDVAALAGVSVTTVSRVINSYGSLSQKTIDKVHAAMRELH
FT                   YQPNAMARSLQGKSSQFIGLILPNMENPFFTALANEIEQLLFLKGYKVIIAVSANNVEK
FT                   EQQYLQMLAANQVEGIITSSHNLDIEEYQNTYLPIVSYDRYLSDDIPIVSEDNEEGGYL
FT                   AGKYLLSTGARRLLILSDDDGSKSPTHIRYDGFLRATKDSSAKVFQENFNLEGFASKED
FT                   LDKMINYVIKDDIDGVFAYNDVGAIQLQNALRKIGKRVPEDVKIIGYDGTPIVRQLHPD
FT                   LPTVVQPVKQAAKVLIDVLFAVIENPGEKPQNNELLGVELFQPE"
FT   gene            574075..574734
FT                   /locus_tag="LEUM_0605"
FT                   /note="LactoCOG number LaCOG01164"
FT   CDS_pept        574075..574734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0605"
FT                   /product="Uncharacterized membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61719"
FT                   /db_xref="GOA:Q03YK3"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YK3"
FT                   /protein_id="ABJ61719.1"
FT                   /translation="MFINILATMPEWITHLIGSDTEFSISTFIVMFLLIFVETAGILTG
FT                   FIPGDAILITVGGLAGTHHNIFELGLVILVFAVASFLGDGVNYWFGAYITKQFGKIPII
FT                   KKHVHGELVEQIAGNFHPKRWLLFIVLGRFLPFIRVAVPLLAHRLGLAFLNYLRMSAFA
FT                   SFLWSLVMVSIGYFIGHLEIPRRISIALIIIMAVVFIVILRSPKCRQRIIQLFIRK"
FT   gene            574777..576477
FT                   /locus_tag="LEUM_0606"
FT                   /note="LactoCOG number LaCOG01664"
FT   CDS_pept        574777..576477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0606"
FT                   /product="alpha-phosphoglucomutase"
FT                   /EC_number="5.4.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61720"
FT                   /db_xref="GOA:Q03YK2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YK2"
FT                   /protein_id="ABJ61720.1"
FT                   /translation="MSYKEALKKWQEATLPDYLAADLEKYTPDQQEDAFYQNLSFGTAG
FT                   MRGVLGAGTNRMNVFTVRQVTEALARYIDEQGSDAKKRGVAISFDSRHFSPEFASNAAQ
FT                   VLSAHGIKSFLFSSLRPTPELSFTVRELHAFAGIMITASHNPKEYNGYKVYGEDGGQMV
FT                   PEAVDAVVNELANITDIFNIALDEDNKNVQIIDDEIDNKYLKKMETVTVNADLVAKEGA
FT                   SLKFVYSPLHGTGQYIGEKALQQAGFTNYTIVKEQAVIDGDFPTVKKPNPEDAAALSLA
FT                   IEYAKRDGADAVVATDPDADRMGAAVKLADGTFQILTGNQIAAVLVNYLLTAKKDTNTL
FT                   PTNGSIVTSIVSSRFASKVAESFGVETADVLTGFKYIAATIDQFEETKSNTFLFGFEES
FT                   FGYLVKPFSHDKDAIQALVLFAEVAAYYKSQGKTFADGLYELFEKFGYFEEKTISLDFP
FT                   GIHGNDEMAAIIAGFRDNQPAEIGGVKVARVQDFSTSVETSKDGSTAKLSQPKANVLKY
FT                   WLDDGSWVALRPSGTEPKLKFYIGVESESQQESQAKIDIISADLMKRAK"
FT   gene            576601..576960
FT                   /locus_tag="LEUM_0607"
FT                   /note="LactoCOG number LaCOG00608"
FT   CDS_pept        576601..576960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0607"
FT                   /product="LSU ribosomal protein L19P"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61721"
FT                   /db_xref="GOA:Q03YK1"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YK1"
FT                   /protein_id="ABJ61721.1"
FT                   /translation="MRQNTILENVTSAQLRTDIPAFRAGDTVKVYAKIVEGSRERVQLF
FT                   EGVVIKRKGAGIQATYTVRKISSGVGVERTFPLHSPRVEKIEVTRFGQVRRAKLYYLRA
FT                   LQGKAARIKERRRDV"
FT   gene            complement(577309..578022)
FT                   /locus_tag="LEUM_0608"
FT                   /note="LactoCOG number LaCOG01882"
FT   CDS_pept        complement(577309..578022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0608"
FT                   /product="Predicted hydrocarbon binding protein, V4R
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61722"
FT                   /db_xref="InterPro:IPR019642"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YK0"
FT                   /protein_id="ABJ61722.1"
FT                   /translation="MDINDYDKILQTNFQVNSFALSLLRDGLLKNLLQEDYPHILYWAG
FT                   KEIARQFPTDTLSTVKEFFANAAFGDLEIKSQNSKNQRWELTGDLVRQRLALNKNADFS
FT                   LEAGFLAQQLEVQTGAIAEANFKYLKKNEGVSFEVITDLSETVNVDDLRQRAAARDSFL
FT                   DRTHATTEKATVVEVRDNDDISREQSITDSLLAFKFDETVMPTEESSGLSALSGEEIDP
FT                   FNVPTSTENSQSPFK"
FT   gene            578071..578946
FT                   /locus_tag="LEUM_0609"
FT                   /note="LactoCOG number LaCOG00871"
FT   CDS_pept        578071..578946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0609"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61723"
FT                   /db_xref="GOA:Q03YJ9"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YJ9"
FT                   /protein_id="ABJ61723.1"
FT                   /translation="MLAFFIILVIINYMIKNNPIGLVDSGIGGLTVVKESQKQLPNEQL
FT                   IYIGDTARMPYGPRSEKEVIDYTFQMAHYLVNEQNIKMLVIACNTATARALSQLREQLC
FT                   IPVIGVIQPGAEAAVSISQNKKIGLIATQGTVESQVYNEKMLAIDNNVQITSQAEPEFV
FT                   TLVENNLYQSDEAREVIAHHLSAFKEANIDTLILGCTHFPLLTPFIQEAVGSDVTLVDS
FT                   GAKTVAVMKQYLDELDIHSEVKHNHSDDIYNTTGDKLKFKTIASSWLARNHELDVRHLN
FT                   IVGDHLEEEK"
FT   gene            578943..579548
FT                   /locus_tag="LEUM_0610"
FT                   /note="LactoCOG number LaCOG00870"
FT   CDS_pept        578943..579548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0610"
FT                   /product="Xanthosine triphosphate pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61724"
FT                   /db_xref="GOA:Q03YJ8"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YJ8"
FT                   /protein_id="ABJ61724.1"
FT                   /translation="MKLIIASNNAHKITEIEALLASISIDLPVVSLQEIGDVPEIVEDG
FT                   TTFEENAVKKVETIAKVAPNDYILADDSGMSVDALNGEPGVYSARYAGDHDDQANIDKV
FT                   LQKLAKVPNEQRTAHFNSVIALHSPKGSNLIVNGQVDGYITESERGQDGFGYDPIFFVP
FT                   SMNKTFAEMSASEKNTISHRGLALQELGKKLPVWLKGE"
FT   gene            579548..580084
FT                   /locus_tag="LEUM_0611"
FT                   /note="LactoCOG number LaCOG00869"
FT   CDS_pept        579548..580084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0611"
FT                   /product="Predicted phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61725"
FT                   /db_xref="GOA:Q03YJ7"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YJ7"
FT                   /protein_id="ABJ61725.1"
FT                   /translation="MVKFLIVSDIHSDRKILVDILAQWRDKVDGIFYNGDSELNADDDI
FT                   FAGVSTVIGNMDDDPDFAEARSTVIDGITFFQTHGHLYNATAILKWANLDSMNEAANDA
FT                   HAQVVLFGHTHKEGAVSYDHKLFINPGSTTLPKGSRADLGGTYAVLEVTDDKYIVTFYT
FT                   RQHQAVPHLTVTVNR"
FT   gene            580220..581275
FT                   /locus_tag="LEUM_0612"
FT                   /note="LactoCOG number LaCOG01487"
FT   CDS_pept        580220..581275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0612"
FT                   /product="Holliday junction DNA helicase subunit RuvB"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61726"
FT                   /db_xref="GOA:Q03YJ6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YJ6"
FT                   /protein_id="ABJ61726.1"
FT                   /translation="MTEDNPQFNQWYEQDTEVDHLLRDAAANDEEQRSELSLRPQFLRE
FT                   YIGQEALKEELNVYISAAKQREEALDHVLLFGPPGLGKTTLAMIIANEMNVNIKTTSGP
FT                   AIEKPGDLVALLNELEPGDILFIDEIHRIPTNIEEIMYSAMEDYFVDIMVGQGPTARPV
FT                   HFPLPPFTLIGATTRPGMLSKPLRDRFGIINSLQYYTPEELQQIVVRTADIFNAPIKSE
FT                   GAYEISLRSRGTPRIANRLLKRVRDFAQVEGKDAIDKNIVTIGLDKLRVDNRGLDETDH
FT                   KLLETMIEYYKGGPVGLNTIAANIGEESETLEAMVEPYLLQIGFLQRTPRGRVVTEAGY
FT                   THLGHAYQRKL"
FT   gene            581272..582129
FT                   /locus_tag="LEUM_0613"
FT                   /note="LactoCOG number LaCOG01880"
FT   CDS_pept        581272..582129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0613"
FT                   /product="Predicted phosphoesterase or phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61727"
FT                   /db_xref="GOA:Q03YJ5"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YJ5"
FT                   /protein_id="ABJ61727.1"
FT                   /translation="MTNFIISDTHFNHEKILYFDKSRAVSLQALNIEPTIENMDRYLED
FT                   TWNETVTDEDAVYFLGDLGMFRKKQDFVAQLSRLKGKKVFFKGNHDHSDQIKAAIKTPE
FT                   TNIIEYIETAKAIKINGINVWMSHYAIDLPYPVLSVHGHIHEAEYKQASMVNLSLDSSF
FT                   MQKRRFGQPLTFDELTEELTDRMDKIQNEYAIESDNKRYDRSVERAFDETITINKPTAT
FT                   QRHELALLVDHLNQHDLTYADVLEQLEIPNVNKVLTADELEKVAQTGFEFEKKTGLSGN
FT                   TGSV"
FT   gene            582167..583300
FT                   /locus_tag="LEUM_0614"
FT                   /note="LactoCOG number LaCOG01032"
FT   CDS_pept        582167..583300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0614"
FT                   /product="S-adenosylmethionine--tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61728"
FT                   /db_xref="GOA:Q03YJ4"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YJ4"
FT                   /protein_id="ABJ61728.1"
FT                   /translation="MAFFFANKYVTMEIRLFLKGFDIIMAEEKKYTLSDFDYDLPEALI
FT                   AQTPLKQRDASRLLALNAKTGGYEDKHFYDILDYLNPGDAIVMNNSRVLPARLHGARPE
FT                   TGGHAEVLLLRQDHGDVWETLVKPAKKSPVGSTIVFGDDIENPIMTATVVGELEHGGRY
FT                   IEFHYDGIFMELLNQLGEMPLPPYIKEKLDDQERYQTVYSKVDGSAAAPTAGLHWTPEL
FT                   LDRVRAKGVKTVELTLHVGLGTFRPVDEENIEDHKMHSEFYQLSQEAADELNSVRKHGG
FT                   RIIATGTTSIRTLETIGTKFNGDLTADSGWTDIFIKPGYNWTVVDAFITNFHLPKSTLV
FT                   MLVAAFTGRDNILNAYKHAVDDQYRFFSFGDAMFIHK"
FT   gene            583503..584528
FT                   /locus_tag="LEUM_0615"
FT                   /note="LactoCOG number LaCOG00147"
FT   CDS_pept        583503..584528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0615"
FT                   /product="Glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61729"
FT                   /db_xref="GOA:Q03YJ3"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YJ3"
FT                   /protein_id="ABJ61729.1"
FT                   /translation="MLEKVVLTQIENGSVGQTPHSGYVNGSYHKTAEPANGYLDDGTGK
FT                   YFFKDGKRQSGLQTIGSKTYYFDSVTNLAVKNQLKSVDKHTYYLASDGSVQYRVNGNFQ
FT                   TKLIAHRGASNLAPENSIPAFQLAKGSYGAETDIWLTKDKQWVVSHDGTIDRMTNGHGA
FT                   IKDLTLAQIKQYHIDSGVNVGKYQSLTLPTLKEYLTEMSNNNLRPIIEIKQPASQMSDG
FT                   DVQNLIAAVKNAGLYNNSTIISLQCEALKHVYALDKKISLELLWDSASDPVQLSEKLNE
FT                   LGPKAGLDINGKKLTSQTIQALRQQGRRLNVWTISPSEFPYYIGLGVDEITTDANSFSL
FT                   N"
FT   gene            584604..585194
FT                   /locus_tag="LEUM_0616"
FT                   /note="LactoCOG number LaCOG01488"
FT   CDS_pept        584604..585194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0616"
FT                   /product="Holliday junction DNA helicase subunit RuvA"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61730"
FT                   /db_xref="GOA:Q03YJ2"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YJ2"
FT                   /protein_id="ABJ61730.1"
FT                   /translation="MYEYINGLITNITPSYIVIASRSGVGYRLYSANPYRFEENVESHV
FT                   YVQQIVRENDISLYGFIDADEKALFNKLLNVSGIGPKSALAILANGDAEGLISAVENDN
FT                   VAYLTQFPGVGKKTAQQIVLDLKGKLDELASKTGMVDSSSNPEQSQALDDALEALLALG
FT                   YTAKDVKAVAQIIGRNSDTTDGYIRSALKLLVK"
FT   gene            585435..586067
FT                   /locus_tag="LEUM_0617"
FT                   /note="LactoCOG number LaCOG00338"
FT   CDS_pept        585435..586067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0617"
FT                   /product="Deoxynucleoside kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61731"
FT                   /db_xref="GOA:Q03YJ1"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YJ1"
FT                   /protein_id="ABJ61731.1"
FT                   /translation="MVIITAGMIGVGKTTLTSLIAKHMNTKAFYEPVGDNPVLPLYYSD
FT                   PKQYGFLLQIYFLNRRFDMIKQALADDNNVLDRSIYEDALFTEENHKDGNISDSEMDVY
FT                   TSLLDNMMVELQKMPKKAPDLMVYAETDFETILYRIKKRGRDYEQFDNNEGLRAYYYKM
FT                   WSAYRDWFDAYDASPKIKIDLQTYDLEQADNQKIILEQIDDALKAIR"
FT   gene            complement(586101..586484)
FT                   /locus_tag="LEUM_0618"
FT                   /note="LactoCOG number LaCOG01412"
FT   CDS_pept        complement(586101..586484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0618"
FT                   /product="Large-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61732"
FT                   /db_xref="GOA:Q03YJ0"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YJ0"
FT                   /protein_id="ABJ61732.1"
FT                   /translation="MLSEFKAFIMRGNVLDLAVGVIIGGAFTGLVKSLTTNLIGPIIAF
FT                   ATGGTTDLDQLQLVITKTLTFKYGAFLNDVINFLITAFVVFLIVKFINRLFKANKQEEA
FT                   KANPELEILTEIRDLLDAEKKAQ"
FT   gene            586656..588131
FT                   /locus_tag="LEUM_0619"
FT                   /note="LactoCOG number LaCOG00604"
FT   CDS_pept        586656..588131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0619"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61733"
FT                   /db_xref="GOA:Q03YI9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YI9"
FT                   /protein_id="ABJ61733.1"
FT                   /translation="MDFIKRAGLYLRQKIGRTALITLVMSAIMIFVLAGIIIQSAAIQA
FT                   TNSAKNSAGTTVTLSADREKAFASMRKSQSSSSSSSSSSSNAAPAAITMPSVKIKTAEK
FT                   ISALSNVAGYQYSNSASVNASGFSAVTTSSSSGGGGQGGFGGSSNSGDITISGVSTTAA
FT                   ETNFKSKSYKITSGRGITAADKNTNNVVIESELATSNSLKVGSTIKVKTTDDDAKTYTL
FT                   NVVGIYKAKTSSSSQGGPNMSDPSNTIYTSYTFAGTVNGDTTSVTSVVYTLTDSSKEKA
FT                   FTKQAKKLISSSFSLTSSSETYALLMKPMKNVQSFANKIVWIVGIAGTIILALITVLMI
FT                   RERRHEIGVLMALGESKFKIVLQLFSELFAVLVLSLVIAGVAGNFVGSAVGKQLVSQQT
FT                   TATQSTSTGAGFGGGGGQQSGGGGGSAPSGAGRSGQTSMTASGSQVSNLKTKISAKSMA
FT                   ELGGLGLGIIAIAVVAGSTPIFRLKPKKILSNE"
FT   gene            588192..588854
FT                   /locus_tag="LEUM_0620"
FT                   /note="LactoCOG number LaCOG00605"
FT   CDS_pept        588192..588854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0620"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61734"
FT                   /db_xref="GOA:Q03YI8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YI8"
FT                   /protein_id="ABJ61734.1"
FT                   /translation="MTLAIKDLTHQYNAQEKPLYEHINMSFEPKTLYSIVGQSGSGKTT
FT                   LLSFLAGLDTPSEGTITLDGENISKYGLTKYRNQKVAIIFQSYNLLNYMTAAQNVSSAL
FT                   SMTKSKHTGDKDYIYATLEKLGINRTLADKNVQQLSGGQQQRVAIARALAVDAKIVIAD
FT                   EPTGNLDEENTQEVIKIFQELAHEVGKTVILVTHEPNVAQAADVQISLKNRQFTIVE"
FT   gene            588960..589574
FT                   /locus_tag="LEUM_0621"
FT                   /note="LactoCOG number LaCOG00379"
FT   CDS_pept        588960..589574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0621"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61735"
FT                   /db_xref="GOA:Q03YI7"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YI7"
FT                   /protein_id="ABJ61735.1"
FT                   /translation="MINQKTRYFVITTLFIAIVFLQIFVPWLGLLPLGAFIVGASVTII
FT                   QFTVAIASIILGPKYGAIVGCWWGLLSFANAITHPGTIGSLMFQNPLTAIIPRVLVGLI
FT                   IGYLFNKLLRNQSTAIRTVGLGVLGTTAALINTVGVVLLTTLGFTIMHTNFTGVPTHNI
FT                   LAWLISIVSFNALFEMIVGFILVSIIGSVLLPIAERANIIG"
FT   gene            complement(589604..589679)
FT                   /locus_tag="LEUM_t0622"
FT                   /note="tRNA_Arg_CCT"
FT   tRNA            complement(589604..589679)
FT                   /locus_tag="LEUM_t0622"
FT                   /product="tRNA-Arg"
FT   gene            589787..590401
FT                   /locus_tag="LEUM_0623"
FT                   /note="LactoCOG number LaCOG00379"
FT   CDS_pept        589787..590401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0623"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61736"
FT                   /db_xref="GOA:Q03YI6"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YI6"
FT                   /protein_id="ABJ61736.1"
FT                   /translation="MSNNKTKYLVITTFFMAIILLQVLIPWLGYIPLGAVIVGAQPTII
FT                   QFTVAIAAILLGARRGAFIGGFWGLLTLWQAWSTPGSIGSLMFQNPFTAFIPRILVGLI
FT                   IGMAFNKWLRNKNFGFRTLGLGFLGGLAALINTVGVVLLTVIGFTVMRTNFTGIPNHNL
FT                   LGWLIGIVSFNSIFEIITGIILVAAIGNVLVPIAERAGIKG"
FT   gene            complement(590439..591095)
FT                   /locus_tag="LEUM_0624"
FT   CDS_pept        complement(590439..591095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61737"
FT                   /db_xref="GOA:Q03YI5"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YI5"
FT                   /protein_id="ABJ61737.1"
FT                   /translation="MQRHPFKPSHKVRNAIIIIIIFVAVVVMGFVIVGHQSDNKKATSS
FT                   SKVSHSSSTSSSKKKAKKASTSSDTSNSTSAEESTSVISSSTSVAAAPSVASSEVSQVL
FT                   SSATQDATQTPVQDNSNTSSVSDSSSSSSAASSSTTTFGNWSLATYNEVALGSATYDQI
FT                   RATYGNPTYLTADQKYAYATWQSQSGTKVSIVFTPSGDSNNVQLIASNKTQSGLQ"
FT   gene            591382..593211
FT                   /locus_tag="LEUM_0625"
FT                   /note="LactoCOG number LaCOG01060"
FT   CDS_pept        591382..593211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0625"
FT                   /product="Predicted hydrolase of the metallo-beta-lactamase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61738"
FT                   /db_xref="GOA:Q03YI4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YI4"
FT                   /protein_id="ABJ61738.1"
FT                   /translation="MTDLSIIPFGGVRENGKNMYAVTVNDEIFILDAGLKYPETDQLGV
FT                   DVVVPDFEYLIKNTEKIAGVFLSHGHADAIGALPYFLQQVNVPIFGSELTIELAKLAIK
FT                   DQPALKDYNDYHIINEKSEIDFGNVKVSFFNTTHSIPESLGIVIGTEYGQVVYTGDFKF
FT                   DQTAESYYRTDIPRLVEVGQRKVLALLADAAGTEGGADSVNESKIGDYILETFRDNKKK
FT                   RIIVAAVASNIQRIQQIIDATAATKRKLVLSGNDIENVVRTAIKLKKLQLPLPESQLFV
FT                   SLKNMKSLVAHETVILETGRMGEPIKHLNRMANGEDAHIKIGSDDLVFITTTPSTAMES
FT                   VVAKTRDMIFKQGADVKQISTDMRSSGHASRNDLQMMLNIMQPAYFMPIQGEYRVMSAA
FT                   KDAAEEVNLPEDHILMAMKGDQFKLIDGQFELKDSFAIGETLIDGSGIGDIGNVVLRDR
FT                   RILSEDGVFVSVVTIDRKKRQVVSKPKLTSRGFVYVKANRDLMKEASDLTVKQIEDYLT
FT                   NNKSFDWNELKAGVRDVLSRFLFEQTRRRPMVMPVVMEVNQNRRPNNHKTTPTQSGAQA
FT                   SKKPAQKKLATPNSNKKKVRRPAKKNVQSKTTE"
FT   gene            593317..594240
FT                   /locus_tag="LEUM_0626"
FT                   /note="LactoCOG number LaCOG01865"
FT   CDS_pept        593317..594240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0626"
FT                   /product="BS_ysoA related protein with TPR repeats"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61739"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YI3"
FT                   /protein_id="ABJ61739.1"
FT                   /translation="MDENITPENQELIDRANIETKQKNWHDAAETLATLYEKMQTFKVN
FT                   YRLVTALFMDEQYQLASSYADDFLLEYLDDESNFRMIVALAVQNQNFVYAQQLAVLWDD
FT                   LDVVDEVLKEIRQAEERAQENMKATLDTVARQFYHMSDYDLLAQRDRYESARHLPVAQF
FT                   VVGAKFLLVDPYALPIIRATLLEDLQKLQIDGVVKYRWLDDEIYTIQLSDVMPLTSSAV
FT                   FEAAAATLESRLGQEDPIALEMLAHQMRIELTLLYPRVDIAITDIEKWVDNSIAHYYGR
FT                   SKPDEPENQRQWHEKINALTESFFEN"
FT   gene            594404..595591
FT                   /locus_tag="LEUM_0627"
FT                   /note="LactoCOG number LaCOG01238"
FT   CDS_pept        594404..595591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0627"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61740"
FT                   /db_xref="GOA:Q03YI2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YI2"
FT                   /protein_id="ABJ61740.1"
FT                   /translation="MAKETYVRTKPHVNIGTIGHVDHGKTTLTAAISKVLAEKQGVDAT
FT                   DFAEIDNAPEEKERGITINTSHIEYETEKRHYAHIDAPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLARQVGVDYLVVFLNKTDLVDDEELVELVEMEVRELLSEYDF
FT                   PGDDIPVLKGSALKALEGDPEQVKVIEELMDTVDSYIPEPARETDKPFLMPVEDVFTIT
FT                   GRGTVASGRVDRGVLTTGTEIEIVGLKDEVQKTTVTGIEMFRKTLEEAQAGDNIGALLR
FT                   GVDRSNIERGQVLAKPGSIKTHKKFKAEVYVLTKEEGGRHTPFFTNYRPQFYFHTTDVT
FT                   GVVELPAGVEMVMPGDQVTFEIELISPVAIEQGLKFTVREGGHTVGAGTVTDIED"
FT   gene            complement(595636..595770)
FT                   /locus_tag="LEUM_0628"
FT   CDS_pept        complement(595636..595770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61741"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YI1"
FT                   /protein_id="ABJ61741.1"
FT                   /translation="MAKIVNREEKVSNSFEDLISLPTSESNDETRKAALGHDKDEKKK"
FT   gene            595908..596642
FT                   /locus_tag="LEUM_0629"
FT                   /note="LactoCOG number LaCOG01193"
FT   CDS_pept        595908..596642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0629"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61742"
FT                   /db_xref="GOA:Q03YI0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YI0"
FT                   /protein_id="ABJ61742.1"
FT                   /translation="MTELLNIKNLKKQFGEKIIFDNVNVAVQKGEVISVIGPSGAGKST
FT                   FLRAINMLDAPTSGKVNFEDQDLTNLSEKELDQLREKMGMVFQSFNLFPNLSVIENIKL
FT                   APVKVKNISDKEATKTAEKLLAQVGLADKGTVYPDSLSGGQKQRVAIARALAMSPDVLL
FT                   FDEPTSALDPEMVGEVLGVMKQLAEDGMTMIVVTHEMGFAREVADTVWFMADGGIQEIA
FT                   TPQSFFDKPKTKRAQEFLEKVL"
FT   gene            596652..597341
FT                   /locus_tag="LEUM_0630"
FT                   /note="LactoCOG number LaCOG01508"
FT   CDS_pept        596652..597341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0630"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61743"
FT                   /db_xref="GOA:Q03YH9"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YH9"
FT                   /protein_id="ABJ61743.1"
FT                   /translation="MNKQKKHAGEFAATLIEDGMVVGLGTGSTIAYFLEALAKRIQDEK
FT                   MTIIGVTTSTKTARCAEELGIPIRDIDLVPMIDLTIDGADEVDQHLNGIKGGGAAFLME
FT                   KIVARYSRRVIWIIDEQKLHSKLGQFPLPVEVVAFGSGKLIAELKERHLHPKLRLDNHQ
FT                   QPLVTDLGHYIVDLDLEQIDQPFELGRYLDGQIGIVEHGLFLNVADQVIIGQDEGYRIM
FT                   NNLQKEM"
FT   gene            597416..597856
FT                   /locus_tag="LEUM_0631"
FT                   /note="LactoCOG number LaCOG01933"
FT   CDS_pept        597416..597856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0631"
FT                   /product="nucleotide-binding protein, UspA family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61744"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YH8"
FT                   /protein_id="ABJ61744.1"
FT                   /translation="MAYNNILVAIDGSEVSNTLIKKVVAFAPDSHIDILTVVDTTGGGY
FT                   FGSIAMNEDVVYQMEQTAEKAINESFDYAKSLGHNDVDIHVRFGSPKRVIARDFPKDHH
FT                   NDLIVIGETGLSRLQRAMAGTVPSFVTQVSKVDVLIMRTFEK"
FT   gene            complement(597894..598646)
FT                   /locus_tag="LEUM_0632"
FT                   /note="LactoCOG number LaCOG00267"
FT   CDS_pept        complement(597894..598646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0632"
FT                   /product="Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)-cyclophilin family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61745"
FT                   /db_xref="GOA:Q03YH7"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YH7"
FT                   /protein_id="ABJ61745.1"
FT                   /translation="MMKKFLPHIIMGIILIISIVGILLMTQQKTASTKKDPQLDKVALP
FT                   QLTTKIAKNESKLIMKTTYGDITIKLFNKYTPLAVENFITHAKNGYYNNTSFHRVINNF
FT                   MIQGGDPTGTGSGGQSIWKGKDKNIDSGNGFKNEISTSLYNIRGAVSMANAGTDTNASQ
FT                   FFIVQNPEDVSSGVNPNIYPTKIVNAYKKGGYPSLDGNYTVFGQVIDGMAVVDKIANAK
FT                   VSATSSGEKSKPANPVKITNIEIIKEAQ"
FT   gene            complement(598646..599167)
FT                   /locus_tag="LEUM_0633"
FT                   /note="LactoCOG number LaCOG01532"
FT   CDS_pept        complement(598646..599167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0633"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61746"
FT                   /db_xref="GOA:Q03YH6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YH6"
FT                   /protein_id="ABJ61746.1"
FT                   /translation="MILTSNTFTHQLIEQTVKINDIVLDGTTANGINTRFLATRVGNAG
FT                   KVLSYATTKDNANAAAASLFMSGLSDRVTLLGKTLDDQFINELGSQNQISVAIFDYSDD
FT                   AKNVNDRPANYLQQISYVLPRLTHGGLLIVKFEQVPEAWHEYKNNLLEADYSQASYITR
FT                   FVQTDVIERI"
FT   gene            complement(599151..599804)
FT                   /locus_tag="LEUM_0634"
FT                   /note="LactoCOG number LaCOG00700"
FT   CDS_pept        complement(599151..599804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0634"
FT                   /product="Membrane-associated phospholipid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61747"
FT                   /db_xref="GOA:Q03YH5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YH5"
FT                   /protein_id="ABJ61747.1"
FT                   /translation="MTIQQKKQRLSTVLATILFGIMTFGVLMSPNWFRQFDIFFQQLIQ
FT                   HRGTFTTLFFTYITQAGNMTAIIVVSVIVSIFLAYKHCYRELLFLSVNIIFSAGIITQV
FT                   LKHMITRVRPQPQLIQESGYSFPSGHSMAAILLYGSLIILINYHLKPSLFKTASVIVLT
FT                   SLIIIIPISRVYVNVHYPSDILAGLSLGYVLLFISKYFIFDLKSPTGVLHDSHK"
FT   misc_binding    599860..600087
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="T-box leader, riboswitch"
FT   gene            600145..602571
FT                   /locus_tag="LEUM_0635"
FT                   /note="LactoCOG number LaCOG00566"
FT   CDS_pept        600145..602571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0635"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61748"
FT                   /db_xref="GOA:Q03YH4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YH4"
FT                   /protein_id="ABJ61748.1"
FT                   /translation="MAYDHKSIEAKWQKYWDEHETFRAPDKSEKEKYYVMDMFPYPSGQ
FT                   GLHVGHPEGYTATDIMSRYKRAKGFNVLHPMGWDAFGLPAEQYAIKTGNNPAGFTNKNV
FT                   QVFKNQIKSLGFSIDWSREINTTDPEYYKWSQWIFEKLYEKGLAYEDEIMVNWAPDFPG
FT                   GGIVVANEEVIDGKTERGGYPVYRKPMKQWVLRITAYADRLLEDLEDLDWPEAIKEQQR
FT                   HWIGKSIGASVFFNIADSDKQIEVYTTRPDTLFGAQYMVLSPEHELVDEITTLEQKEAI
FT                   ANYKKEVETKSDLERTDLNKDKTGAFTGAYATNPINGEKLPIWIADYVLSSYGTGAIMA
FT                   VPAHDDRDWEFAKKFNLPIKAVIEGGNVEEAAYTDDGTHINSGFLDGLNKQEAIDKAIS
FT                   WLEEHNAGHQQINYRLRDWIFSRQRYWGEPIPVIHWEDGTQTLVPESELPLRLPEMTQE
FT                   QLKPSGTGESPLANATDWLNVTRKDGVKGRRETNTMPQWAGSSWYFLRYVDPHNSEALA
FT                   DPEKLKYWMNVDLYVGGAEHAVLHLLYARFWHKFLYDLGVVPTKEPFQKLVNQGMILGE
FT                   NHEKMSKSKGNVVNPDEIVNNYGADTLRVYEMFMGPLTQSKPWSEDGVSGSRRWLDRVW
FT                   RLLVDEEDKLRDHVTTVNKGDLDKIYHQTVKKVSEDLENMRFNTAISQLMVFVNEAYKS
FT                   EALPVQYMDGFVQMLAPIAPHLAEELWSKLGHEEDISYVSWPTYDESQLVEDSVEIIFQ
FT                   VNGKVRGKATVARNIDKDAMLDYAKADENVQNFISGKEIRKIIAIPGKFVNIVVG"
FT   gene            602667..604610
FT                   /locus_tag="LEUM_0636"
FT                   /note="LactoCOG number LaCOG01199"
FT   CDS_pept        602667..604610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0636"
FT                   /product="Polysaccharide transport membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61749"
FT                   /db_xref="GOA:Q03YH3"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YH3"
FT                   /protein_id="ABJ61749.1"
FT                   /translation="MTNDQRPEKFNGNSRVDKTDVDGKTLTADEILALAGRHLQEKRNL
FT                   GPKTTRKSRSHATMPQPTEQEILAIKEKNIRARQKIIKKKPNLQVPEQLSTADSSLEKQ
FT                   PTTKESNQATLIKGSAWLSVGNMVSRVLGVVYLIPWMAMLGSYGTRANGLFNQGYTIYA
FT                   IFLAIATFGIPAAISKVVAELAAKNDVYRSRQLTRQSMALGIVLGIVFGLILYFAAPAL
FT                   SNNNADVIPVLHSLAPAVAIFPLMSMIRGLFQGHQLMSISAMSQVVEQIARVIYMLVMA
FT                   VIVLKADPDNWTGVVVQSTFAAFIGAIFSMLVLMWGWVKYRHILSRPVLHSVKHEKART
FT                   LSLVLNILKESWPFIIIGSAITLFQAVDQYSFFSIMNHFFSVSKSDLLEKFSLFSANPN
FT                   KLIMIIVPFSTSIAATALPMLSGSKAALTYETIQDQLKQVLKLFSLIMLPSVLGMYAIA
FT                   EPLYKMFYPIEASNQEGIYMLQYSTILALVFSLFMLLAFVLQALSEVKIVMKAFFVGII
FT                   IKIVLQIPLIRYFEGMGALMTSVIGMFISILYMLDFLQKVYGVSFSMIGKELWQMFMAS
FT                   ALMAIVAYIIVFAMDNFIFPMDTKFSVTVTTFSAVLIGGALLIITYLRMGLGDELLGRR
FT                   MRYIPKILQPKR"
FT   gene            604745..605593
FT                   /locus_tag="LEUM_0637"
FT                   /note="LactoCOG number LaCOG01784"
FT   CDS_pept        604745..605593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61750"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YH2"
FT                   /protein_id="ABJ61750.1"
FT                   /translation="MTDSQTVLQPELINRLDSKIMYLGQLQSAVMNQQVPQVYELLDSK
FT                   KFNEQIRQRPHADSNALLAQMVTDIHDNLAIFLAPELLKYLKQQFSFFDFVATSDEPSI
FT                   YQVYIGTWWDHRQFAILDVLSLTLTINKKIVSEWQETIKLPTGANINDIQIREIKQITN
FT                   GLQTFLDDETKRNLEVQVLNDQLAQLKENKSGLLGRTDKKAREELENKRDLLLASQQRV
FT                   PEVKAKLAEHESEMLQLEKDDALRHLEIEEILSHFDDIDAFIQKVDHLYVDYLKTLLQK
FT                   K"
FT   gene            605595..606509
FT                   /locus_tag="LEUM_0638"
FT                   /note="LactoCOG number LaCOG01785"
FT   CDS_pept        605595..606509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61751"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YH1"
FT                   /protein_id="ABJ61751.1"
FT                   /translation="MNFDTYNYSQQLKKDLEVFQRWQVLIEALSEANQTAEILDITKKI
FT                   LAFDVHKSEIMRVASEHWYPNTHWIAVAFSNLAKMTSLSHTQVILPKMQKVAELHFEEF
FT                   PNAAFQFTKAPLAAGGYYLEEISQNLRVAYWDIVNKRFYLDTVHFMKLVQTEAIQIAGV
FT                   EALTIFQKRLTAISYLLKDNEYSIDIVGLDMTDTQNLMMQQKDLSAEILDSLFVEAAKQ
FT                   NFVLTLLQNDKDGAVLKIGSVSLEIIQYRDQQEHAVWQYDIIDNNKRVTIYTLFQQLPF
FT                   FANWYEKWFNEVGLKDKRAVFVD"
FT   gene            606546..607094
FT                   /locus_tag="LEUM_0639"
FT                   /note="LactoCOG number LaCOG01623"
FT   CDS_pept        606546..607094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61752"
FT                   /db_xref="GOA:Q03YH0"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YH0"
FT                   /protein_id="ABJ61752.1"
FT                   /translation="MTILIIIAIVVIIAVAWVSIYNSLVKTRMQTKESWSQIDVQLKRR
FT                   NDLIPNLVETVKGYAKHESGTLEEVTKLRQEVERAATPADKMVASNQLTGVLSGFFARA
FT                   EAYPDLKANTNFTKLQEELTNTENKIAYSRQLFNSTTALYNTKLQQFPSNIVAGIHHFE
FT                   PSEFLQVPEAEKEVPTVKF"
FT   gene            607094..607987
FT                   /locus_tag="LEUM_0640"
FT                   /note="LactoCOG number LaCOG01624"
FT   CDS_pept        607094..607987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0640"
FT                   /product="Heat shock protein, Metallo peptidase, MEROPS
FT                   family M48B"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61753"
FT                   /db_xref="GOA:Q03YG9"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YG9"
FT                   /protein_id="ABJ61753.1"
FT                   /translation="MLYQQIQSNKRRTIVLLFVFFILVALVGAAVGYLLLNSLETGVVA
FT                   AIVIGAIYTIIMVSNSTNVVMAMNHGHEIKNADQAPELWHTVEDMAMVAQVPMPRVFII
FT                   DDDSPNAFATGNNPEHSAVAATTGLLKIMNRSELEGVIAHEMSHVRNYDIRISTIALAL
FT                   AAAITLLTNIGGNWWFWGSGDRRRNDDRNGGGGLQILLLVFSILMMVLAPLAAAAIQMA
FT                   ISRNREYLADAGSAELTRNPQGLISALRKLGNAQPMKDVDSSSAALYISNPLKNKERLF
FT                   DTHPPIEERIDRLEKM"
FT   gene            608099..609076
FT                   /locus_tag="LEUM_0641"
FT                   /note="LactoCOG number LaCOG01308"
FT   CDS_pept        608099..609076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61754"
FT                   /db_xref="GOA:Q03YG8"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YG8"
FT                   /protein_id="ABJ61754.1"
FT                   /translation="MKNIKINWRKVLLTILIFFASSVVQVVGLNAFLIPNNVFSGGFNG
FT                   IAQLLSLFSQNFFHVSMPTGTFIMIFNIPVGIVGWKMIGGKFTILSFANSLFVSAVQII
FT                   APTQALTTNPLLAALFGGLLIGASIGLAMRYGFSTGGMDIVAMVVQKRTGKSIGALMNV
FT                   INFGVVVIAGSFIGWQNALFTIIGIYATGRVVDTLYTGYQKLTAMIVTSKGDEVVAELH
FT                   KDLIRGITILPSKGAYTKRDSTTLMMVLSRYELFEMQEVVHRADPKAFINLMNTVSVSG
FT                   EFLDADRQLQMKRAVAVPKVETVEAQIEAEQRLEEQLENLDDKK"
FT   gene            609104..609289
FT                   /locus_tag="LEUM_0642"
FT                   /note="LactoCOG number LaCOG00382"
FT   CDS_pept        609104..609289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0642"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61755"
FT                   /db_xref="GOA:Q03YG7"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YG7"
FT                   /protein_id="ABJ61755.1"
FT                   /translation="MPIVQVELLEGRTHEQLAKMVKDITNVIVEDAGASREAVHVILRE
FT                   MPKDHYAVGGVLKSDQ"
FT   gene            609491..610954
FT                   /locus_tag="LEUM_0643"
FT                   /note="LactoCOG number LaCOG00646"
FT   CDS_pept        609491..610954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0643"
FT                   /product="Cell wall-associated hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61756"
FT                   /db_xref="GOA:Q03YG6"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YG6"
FT                   /protein_id="ABJ61756.1"
FT                   /translation="MERLDKKVVASGLSLLGLVGVGSGIAHADDVKSTVNKAVNSVAEA
FT                   AGLIDNKTVNLTQKSLTIPKDKVAHIETPAEKKVSQKATTKLTSYKVKAGDSLWSIAHN
FT                   HNLNVDDLVSENNNSDLISVGQTLNLPTSVGADTQTTVADQSPTDINKSTDSYADSLQT
FT                   AASAPVSEVSAAGNVESTESSVTSSTSSQDSLASSSAAESSVSSTPSSEESTLASTADS
FT                   SVSSGESAPSSSVTESSSVSSGSDEETSSATEATSLTTSSTADVVSETQNTSGNTSLQS
FT                   SETIAASAASDATAYTSSSDSTAADASANINSSYGAAAVSSSDSSAGQQYNQLSSTTNS
FT                   NGSLVNLSTGSVSQIVNSNTTQSMSGNSAAIIALAQQLVAQNIPYVWGGGTPSTGFDCS
FT                   GLVSYVFKNAAGISLPHSSVEQEMYTQKKSVSQAQPGDLLFWGTPGASYHVAIYIGNNQ
FT                   YIAAPKPGLNVRVETISPNFLPSFAGSIK"
FT   gene            611488..611718
FT                   /locus_tag="LEUM_0644"
FT                   /note="LactoCOG number LaCOG00538"
FT   CDS_pept        611488..611718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61757"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YG5"
FT                   /protein_id="ABJ61757.1"
FT                   /translation="MTVEEKFDNAKDKIAGKAKEVEGKVTGDKQRELQGKTQNIFGKAK
FT                   DAVTDIKDAAEEAVKDTIDDYKQDSKKNIDK"
FT   misc_binding    611903..612000
FT                   /bound_moiety="guanine"
FT                   /note="Purine riboswitch"
FT   gene            612223..613365
FT                   /locus_tag="LEUM_0645"
FT                   /note="LactoCOG number LaCOG00149"
FT   CDS_pept        612223..613365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0645"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61758"
FT                   /db_xref="GOA:Q03YG4"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YG4"
FT                   /protein_id="ABJ61758.1"
FT                   /translation="MQKFSSTNKFVPMGLTFEDVKLVDDLQSTVTPESVSVTTSLTPTL
FT                   KLNIPLLSAAMDTVTEARFATALAKLGGLGVIHKNMTISAQADEVRKVKTATFDSADFP
FT                   NAAVDAKGHLLVAGAVGVTNDTVDRVQAMVEAGADAIVLDSAHGHSEGVLRKVSEVRST
FT                   FPNLNIIAGNIATREGAAALYDAGADVVKIGIGPGSICTTRVVAGIGVPQVSAIRDAAL
FT                   EAAARGKKIIADGGVKTSLDIVKAISAGGNAVMLGSMFSGTEETPGEVFEDNGQKYKTY
FT                   RGMGSIAAMENGSKDRYFQGEVNEAKKMVPEGIEARVTYKGDLTTILNAMLVDIHKKMA
FT                   QLGETTIDDLVNHEHIARDSEVFDFEAATDKQKPVVAAQF"
FT   gene            613408..614394
FT                   /locus_tag="LEUM_0646"
FT                   /note="LactoCOG number LaCOG00149"
FT   CDS_pept        613408..614394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0646"
FT                   /product="IMP dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61759"
FT                   /db_xref="GOA:Q03YG3"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YG3"
FT                   /protein_id="ABJ61759.1"
FT                   /translation="MPENTEFIGLGYDQVLLVPGASNVLPYSVTLRTQLSENFELNIPL
FT                   VSEAFGPETDTRVAPTALNGGLGVVAEQEDLSKQVASLQQVKETVVDTDKYPNALVDSQ
FT                   NHLRVAAEVWLVAGAETRVAALVNAGADAIFFYLHETLAKNTRDLIKQIRQAHPDLFIA
FT                   VGVVEDQSIAAALYEAGADTILAGRSVDSSLPNDITYPFLTVTMNIADVAAAYDNKSVI
FT                   AVGGIHYSGDIVKAIAAGADATMVSDLLKGSVLESDGSFKEGDMSIDDAIFQTDGGLRA
FT                   GMGYTGSQTIESLKLNAKIVQITDNGLRESHPHDVEITKQAPNYAKG"
FT   gene            614398..615943
FT                   /pseudo
FT                   /locus_tag="LEUM_0647"
FT   gene            complement(616035..616205)
FT                   /locus_tag="LEUM_0648"
FT   CDS_pept        complement(616035..616205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61760"
FT                   /db_xref="GOA:Q03YG2"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YG2"
FT                   /protein_id="ABJ61760.1"
FT                   /translation="MKKVSVFVLMISLILMFASLISWIMSQPTFAIIASNLGLLILAIS
FT                   YLWENRNNFLK"
FT   gene            617155..617382
FT                   /locus_tag="LEUM_0649"
FT                   /note="LactoCOG number LaCOG00538"
FT   CDS_pept        617155..617382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61761"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YG1"
FT                   /protein_id="ABJ61761.1"
FT                   /translation="MSVEDKFDNAQDKVAGKAKEVEGKVTGDKSREAQGKAQGLFGKAK
FT                   DKLSDAAEAVKDSAEDAVDAVKDGVEKLKK"
FT   gene            617535..618149
FT                   /locus_tag="LEUM_0650"
FT                   /note="LactoCOG number LaCOG00359"
FT   CDS_pept        617535..618149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0650"
FT                   /product="Penicillin-binding protein-related factor A,
FT                   putative recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61762"
FT                   /db_xref="GOA:Q03YG0"
FT                   /db_xref="InterPro:IPR004612"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YG0"
FT                   /protein_id="ABJ61762.1"
FT                   /translation="MTINYPVGTHHGKTLKNNTLRTGKTTKKVLFGKRGMGLEDEINLA
FT                   NDYYLANRLAVVHKKPTPITIVKVDYPARSAAKITEAYFKQASTTDYNGVYQGKYIDFD
FT                   AKETKNKTSFPLKNFHEHQISHLASILSQGGIGFVIIKFTSLNENYVYPASELIQQWQH
FT                   LNGKQSISYQEIVDKSFVVPESLNPSLDYLTAVDKMLEALH"
FT   gene            618171..620363
FT                   /locus_tag="LEUM_0651"
FT                   /note="LactoCOG number LaCOG00358"
FT   CDS_pept        618171..620363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0651"
FT                   /product="Membrane carboxypeptidase (penicillin-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61763"
FT                   /db_xref="GOA:Q03YF9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YF9"
FT                   /protein_id="ABJ61763.1"
FT                   /translation="MANDKANQWSRVNRNHKMYDQYPAQEPPRPPKPNGPKGSGSRKPR
FT                   KTKKKRRWILAIFLWLFTLGLIAGLAGTALFFTYANDAPNITESDLASENSTQLLDSKG
FT                   NVFWSMATQDRDYANSNEIPKQLKQAVVSIEDRRFYKHHGVDPIRIAGAAISNIKGSSL
FT                   GMQGGSTLTQQLVKLSVFSTSTSDQTFKRKAQEAWLALRVEKNFTKNQILTFYMNKVYM
FT                   GHGVYGMKTASEYFYGKALTDLSLPQLALLAGMPQSPTYYDPYLKDTTAAKERRDTVLK
FT                   AMVTYGAITSKQATEAMKVPVSDGLQDLNAKTEAANSTRQVADGYALSVITEAKKLGYD
FT                   TTKAGLKIYTNMDSNLQQSLYDNANDGSVTFSSDDLQIGATMTDPNNGHVIAQIGGRNV
FT                   NTLQALNRATGKNRSSGSSIKPLLDYGPAIEYLNWPTYRTVEDKKYKYNGTNISVYNWD
FT                   KKYMGNITMRTALTQSRNIPAIRTLEEVGGSNAEKFVNGLGITTNSTPGGSMAIGIDVS
FT                   TEQEAAAFGAVANGGVYYKPTYISKIVTADGTTHSYTSSGTRAMKTSTAFMLTDMMKGV
FT                   IKPNATAADAAISGLYQAGKSGLVAYDDNAGMPDKAISDAWFTGYTKSYTLSVWTGFDV
FT                   PSKNYIPWTEQDLPAQYYAKVMAYAMQNKSNTDWTAPDTVTAKVKGNIVEYEVKDASWS
FT                   NGGLPSVNSIAQSGETPSEAGISANSASTGSTTGNN"
FT   gene            620422..620988
FT                   /locus_tag="LEUM_0652"
FT                   /note="LactoCOG number LaCOG00360"
FT   CDS_pept        620422..620988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61764"
FT                   /db_xref="InterPro:IPR010697"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YF8"
FT                   /protein_id="ABJ61764.1"
FT                   /translation="MRLWVTGYRSYELGTFGDKDPKIKVIKYALHQTLKEQVDNGLEWV
FT                   ITGAQLGIEQWTIEVVADMKKDYPQLKLAVMLPFKQFGSQWSEDNQAKLQKLIAQSDFS
FT                   ESVSTKPFQSPIQLKNYQKFMLAHTDGALFFYDTEFEGKTIFDFQVVTKYQTQTPYPLV
FT                   QVDMYQLQEYASELEEKMNENRYDY"
FT   gene            621064..621462
FT                   /locus_tag="LEUM_0653"
FT                   /note="LactoCOG number LaCOG01088"
FT   CDS_pept        621064..621462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0653"
FT                   /product="Cell division initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61765"
FT                   /db_xref="GOA:Q03YF7"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR011229"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YF7"
FT                   /protein_id="ABJ61765.1"
FT                   /translation="MEQVKYTQKDILERVFKQKRMGVGYDPADVDSFLDDIIKDYGAFG
FT                   SRVEQLKSEVARLQVALKDAQDQLVAVKQQQSVAPQQPVQTASQPQPVEDQRQAAVAQQ
FT                   AAVTNLDLIKRVANLERVVFGRDHNSAE"
FT   gene            621520..621853
FT                   /locus_tag="LEUM_s0654"
FT   misc_RNA        621520..621853
FT                   /locus_tag="LEUM_s0654"
FT                   /product="RNA_RNaseP_classB"
FT   gene            622007..623479
FT                   /locus_tag="LEUM_0655"
FT                   /note="LactoCOG number LaCOG01165"
FT   CDS_pept        622007..623479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0655"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family / amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61766"
FT                   /db_xref="GOA:Q03YF6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YF6"
FT                   /protein_id="ABJ61766.1"
FT                   /translation="MNSILKKISIVIMTITMLLPLLAVLPTHADAATTDPALTKIKKKG
FT                   TLVIGLSADYAPFEFHATVNGRDQIVGFDVEMAKKIAKDLGVKPVIKEMGFDGLIGALQ
FT                   TGKIDVIISGINATPEREKVVDFSNSYMKPLQTVMVLKKDASKYSGNLNSFSGKKIGVQ
FT                   KQTTQETYAQESMSGSTIVSLQKVPDLVAQLSTGKIAGIVLNEPISKAYTQQNKAFKII
FT                   YPKPSSGEGAVSIAMPKNSPVLKAKINKSLGNIIKSGELEAYQKRANKLMFADQSFWAK
FT                   YGNLFVKGTLLTLALAAVAVVLGIVLGTVFALFKLSPNAILRIIGNVYVEYVRGTPLLV
FT                   QAFMVFFGTQVIGLNLSAFAAGALAMGLNSAAYVAEIIRSGINSVDFGQTEASRSLGLS
FT                   KGKTMRYVILPQAVKNILPALGNEFVTIIKEGSVVSVIGVGELMFQTGVVQGASFKPFF
FT                   PLVIASLIYFVLTFGISRSLGYAEKRMNRSSR"
FT   gene            complement(623535..624563)
FT                   /locus_tag="LEUM_0656"
FT                   /note="LactoCOG number LaCOG01451"
FT   CDS_pept        complement(623535..624563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0656"
FT                   /product="6-phosphogluconolactonase"
FT                   /EC_number="3.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61767"
FT                   /db_xref="GOA:Q03YF5"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YF5"
FT                   /protein_id="ABJ61767.1"
FT                   /translation="MAVYKILFGTYTKRVSKGIYEAELDTEKKLLQNSTFVGGLTNPTY
FT                   LAISKANKVYAVENRDGQGGVVTFDNSVRPLAEIDAQLSEGSAPAYIGVDEDRQLVYAG
FT                   YYHRGTVEVYRINDDGNLTLTDTWQNKGSGPRPEQGSSHIHFSNLTPDNRLVAVDLGTD
FT                   EVITFDVSDNGKLAEAARFKAEDGFGPRHIRFSPDGQYAYLLGELSSLLSVLKYNSEDG
FT                   SFEHVQTAPTIPSDWTAHNGAAAIRISKDGRFIYVSNRGNNSVAVFKTTNLGSEIERIQ
FT                   LISTEGEFPRDMNWDESEQFLVVANQDTDNVSLYARDDESGELSLLQKDFTVPEGVRVL
FT                   FE"
FT   gene            624742..625896
FT                   /locus_tag="LEUM_0657"
FT                   /note="LactoCOG number LaCOG00799"
FT   CDS_pept        624742..625896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0657"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61768"
FT                   /db_xref="GOA:Q03YF4"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YF4"
FT                   /protein_id="ABJ61768.1"
FT                   /translation="MKKPEQQSWYSRWFSGNDLLNGLIVILLVLLIIFLAWQVRFLFEP
FT                   IRALFTAVGAPIMISGVLYYLLSPIVGLLEKYVHLPRNLSIGVVLIVLLAIIGVAIAAI
FT                   VMVLRNQVIQFIDNWPNYWKTSEAFINETFASEQFKFIRDYLNHTNSDLNQNVLDWSKK
FT                   YLTSGVAGISSFASILTSIGVTIVSTPFILYYMLLDGHKFSSFVSSKFPNNSQLSVRYL
FT                   LTEISKQIAQYIRGQLGVALAVMIMFSIGYTIIGLPYGILLALMAGFFNLIPYVGSIIA
FT                   QVPVFTVALIAGGPKMLILAIIVLAIEQPIEAHVISPKILGEALSIHPVTVIVVLLSSG
FT                   HIFGVLGIVLAVPSYAVAKVFVTHIYDWWRANSDLFEVEEVAEK"
FT   gene            625893..626405
FT                   /locus_tag="LEUM_0658"
FT                   /note="LactoCOG number LaCOG00772"
FT   CDS_pept        625893..626405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0658"
FT                   /product="Predicted rRNA methylase (SpoU class)"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61769"
FT                   /db_xref="GOA:Q03YF3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YF3"
FT                   /protein_id="ABJ61769.1"
FT                   /translation="MTNHIVLFEPLMPANTGNIARTTAGTDAVLHLIEPLGFELDDKHV
FT                   KRAGLDYWDHVKLVKHPSLPDFLDTLAETDNLYLVSKFANQDYTQPNYAQNDTDNYFLF
FT                   GKETTGLPEVFMRQNPEKAIRIPQDDSHVRSLNLSNTVAIVLYEALRQQSFSNLETTHT
FT                   YEQDKLK"
FT   gene            626478..626552
FT                   /locus_tag="LEUM_t0659"
FT                   /note="tRNA_Glu_TTC"
FT   tRNA            626478..626552
FT                   /locus_tag="LEUM_t0659"
FT                   /product="tRNA-Glu"
FT   gene            626705..629071
FT                   /locus_tag="LEUM_0660"
FT                   /note="LactoCOG number LaCOG01090"
FT   CDS_pept        626705..629071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0660"
FT                   /product="DNA segregation ATPase FtsK/SpoIIIE related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61770"
FT                   /db_xref="GOA:Q03YF2"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YF2"
FT                   /protein_id="ABJ61770.1"
FT                   /translation="MATRKTTQRRRTTRGKNSKKKNPLVQNLCFLGGIVLGILGIFKLG
FT                   ILGVFIADIFRFFFGNMYLVILIPMTLFLGYYFITRKTPKIATHFWVGAFMMFIAIETI
FT                   SSLLFFEYTLKNADGYVGEVVRLIGQDFVNQSANTPVGGGIIGAALYHLLFMLMSSIGT
FT                   WIVTIILLFSGIAIFFRIPARDIVQQGVEKAHEGVTHIQEKRANEKPTRQSLFKRDRHK
FT                   KDITDYGDDPLGVSRDDSLSTDVLPKIEKDVNPPSVHENFNEPEIKWNGPIAPQPTKKS
FT                   SKDQAEKTSVSDSEVSTDMLEKENPDYQLPTADLLTQLAPTDQTKEFKGLTDKSRLVHD
FT                   TLQSFGVEAEVTSVSLGPTVTQYELKPGQGVKVNRIANLSDDLALALAAKSIRIEAPIP
FT                   GKPYVGIEVPNDTQATVGFRDMIENAPFDDNPLNVPLGRDVTGNIIMADLSAMPHLLIA
FT                   GSTGSGKSVGLNGIIVSILLRAKPNEVKLMMVDPKVVELSIYNGIPHLLTPVVSEPRKA
FT                   AKSLQKVVDEMENRYKLLAQFGKRNIGEYNAAVEKQNAEAKETDQPIMQPMPYIVAIVD
FT                   EFADLMSTVGNEIEVSIARLGAKARAAGIHMILATQRPDVKVINGTIKSNIPGRIAFRT
FT                   ASGIDSRTILDSNGAEKLLGKGDMIFAPPGKPTQRVQGAFISNTDVTNIVEFVKSQQEV
FT                   QYSDAMTVTDEEIAQDNSENADGNSDDELFQEALQFVIEQQKASTSLLQRRFRIGYNRA
FT                   ARLIDDLEAGGYIGPADGSRPRHVNISDGSSGIES"
FT   gene            629150..629269
FT                   /locus_tag="LEUM_0661"
FT   CDS_pept        629150..629269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0661"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61771"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YF1"
FT                   /protein_id="ABJ61771.1"
FT                   /translation="MALTKNQIAALQNVFDNGILDHDVEALEALKIVLADLKK"
FT   misc_binding    629318..629557
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="T-box leader, riboswitch"
FT   gene            629599..631557
FT                   /locus_tag="LEUM_0662"
FT                   /note="LactoCOG number LaCOG01279"
FT   CDS_pept        629599..631557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0662"
FT                   /product="threonyl-tRNA synthetase / Ser-tRNA(Thr)
FT                   hydrolase"
FT                   /EC_number="6.1.1.3"
FT                   /EC_number="3.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61772"
FT                   /db_xref="GOA:Q03YF0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YF0"
FT                   /protein_id="ABJ61772.1"
FT                   /translation="MAEISLTFPDGAIKKFDEGIKPIGVAESISKSLAKKSVSGKINGS
FT                   YIGMNDVITESGDFQLITTSDSEALDLLRHSASHLLAQALKRIPKFANIHFGVGPFIEN
FT                   GFYYDTDNGAGNQVSIEDFPEIEAIMHKIVKEDLPILSREITRDEALEIFADDPYKVEL
FT                   VNDLPVDEKITIAVQGDHIELDKGGLVPSTGWIKHFKLTSVAGAYWRGDSSNPMMQRVY
FT                   GTAFWKAADVEAEIARREEAKERDHRVIGRDLDLFFTSQEVGSGLPVWLPNGATIRRQV
FT                   ERYITDKELSNGYQHVYTPVLSNLNLYKTSGHWDHYREDMFPPMDMGDGEFLELRPMNC
FT                   PSHIMVFNHKPRSYRELPMRIAELGMMHRYEKSGALTGLSRVREMTLNDGHTFVEPEKL
FT                   EEEFKSILTMMMGVYRDFNIKDYRFRLSYRDPKNTEKYFDDDEMWEKSQKQLKTAMDDL
FT                   GLDYFEAEGEAAFYGPKLDVQTKTALGNEETLSTIQLDFLLPERFDLKYIGRDGLDNHR
FT                   PVMLHRGIVGTMERFTAYLIEMYKGAFPTWLSPLQVQIIPVNLGAHGNYANAVQQKLQD
FT                   AGLRANVETKDAKMGYLIREAQTNKIPYTLVLGDSEVNSNTVTVRKYGDTKTVTMSYDE
FT                   FQYLILSDVSNYSRETE"
FT   gene            631682..633055
FT                   /locus_tag="LEUM_0663"
FT                   /note="LactoCOG number LaCOG00259"
FT   CDS_pept        631682..633055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0663"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61773"
FT                   /db_xref="GOA:Q03YE9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YE9"
FT                   /protein_id="ABJ61773.1"
FT                   /translation="MSDSKGDSNLPKRGLQNRHVQLIAIGGTIGTGLFMGAGNSIHFAG
FT                   PSILLVYLVIGMFMFVVMRAIGELLYADPSQHTFISFITKFLGNRAGFFARWSYWLTVV
FT                   FMGMAELTAVAKYIQFWLPDLPSWLIQIVMLILLTSINLIAVALYGETEFWFAMIKIVA
FT                   ILSLIVTGIIMALTGFETPVGKVAFSNVWHHFELFPNGVGNFINAFQMVMFAFVGMEFI
FT                   GMTTAETENPRSVLPKAINQIPWRILFFYLGALFIIMTIYPWQKIPEDQSPFVMVFQLA
FT                   GVKWAAALINFVVLTSAASALNSVLFSASRNFFALSFQSKAKFLQPFRKTSKTQLPVNA
FT                   VLVTSLMVAFSALISVIPSITNAFSFVTSASTDLFLMIYVLILFAYMKYRKSDSYMPDG
FT                   FLVIAPKTLVPLAILFFSFVFITLFFNPESRLPAIGATIWMVVFGCISMKQPKQALNK"
FT   gene            633178..633852
FT                   /locus_tag="LEUM_0664"
FT                   /note="LactoCOG number LaCOG01164"
FT   CDS_pept        633178..633852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0664"
FT                   /product="Uncharacterized membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61774"
FT                   /db_xref="GOA:Q03YE8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YE8"
FT                   /protein_id="ABJ61774.1"
FT                   /translation="MSFLIDFILHIDVHIGNLVQAFGLWTYLILFVVIFIETGSVIMPF
FT                   LPGDSLLFAAGAIAATPAGLNAGLNHWVFMIVFFLAAVIGDSVNFWIGRTGGYKILHHR
FT                   FFGRFIKEQHIKEAEAFFEKRGAAAIIIGRYMPIVRTFVPFVAGISQFSYKHFLRNSLI
FT                   AAFSWSLIATGAGYMFGNIPFVKAHFSVIILGIALVTLMPTIIGVVRSAMVAKKQKKIM
FT                   SK"
FT   gene            633890..634435
FT                   /locus_tag="LEUM_0665"
FT   CDS_pept        633890..634435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61775"
FT                   /db_xref="GOA:Q03YE7"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YE7"
FT                   /protein_id="ABJ61775.1"
FT                   /translation="MNNLKKLQELTKISTIEIADALDVEVETVEAWQNEEKVPSVSDFE
FT                   ALSGIFSSQLDAQGIDSQSSKHPIHIRLSVDYLLNLGITLSDWITLKWAFEGQWNNDQL
FT                   AIGFFSNNQLVRVISTESEFSDAFAGYLILQTEGEFEPYIDEFDNDREYDWRLLRLNDE
FT                   KFVDVTNDLIAANLPVIS"
FT   gene            634619..635461
FT                   /locus_tag="LEUM_0666"
FT                   /note="LactoCOG number LaCOG01849"
FT   CDS_pept        634619..635461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0666"
FT                   /product="Fructosamine-3-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61776"
FT                   /db_xref="GOA:Q03YE6"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016477"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YE6"
FT                   /protein_id="ABJ61776.1"
FT                   /translation="MDLGNDFVTRLGLEKPHDLEKVRGGDINEAFSIYSNNQRYFLKIQ
FT                   QNAQASFFDHEVAGLKALGEEVTVPAVLAQGQLQGHAYLVLTWINQGNGSQQELAKSLV
FT                   KMHQATAPKFGFDSDNLVDFVPKNNTWQSSWAEFFVKQRLDPLMAQAQKNNFWLTQRGD
FT                   HYSNLRETILNDNHAQTVQPSLLHGDFWAGNFMFNDQGKPVFIDPNVFYGDREYDLAIS
FT                   RVFAGFSPSFYNQYMQEWPLDDGWQKREKWYEFYYILMHFTRFGDIYAPRMNKLLTSF"
FT   misc_binding    635548..635716
FT                   /bound_moiety="lysine"
FT                   /note="Lysine riboswitch"
FT   gene            635800..637092
FT                   /locus_tag="LEUM_0667"
FT                   /note="LactoCOG number LaCOG00873"
FT   CDS_pept        635800..637092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0667"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61777"
FT                   /db_xref="GOA:Q03YE5"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YE5"
FT                   /protein_id="ABJ61777.1"
FT                   /translation="MTYPINEKQHLTVDGVDTIELAKTYGTPLAVYDVTLIRKTMRAFK
FT                   RIFEQENVPYVVSYAGKAFATKAIYQVAAQENIHADVVSGGELYTAIKADFPTQHLSFN
FT                   GNNKSYDELVMAVENGVGTIIVDNFLELQLLSEITAEKNVIQDILLRISPGISAHTHEF
FT                   ISTGQQDSKFGFDLQTGQAKQAYDIAIKDNHLHLRGLHAHIGSQIFDVTGFEKNAALLA
FT                   DTAYSWGWQPEVINTGGGFGIRYTDEDQPLPENEFADAIIRVLKEKATQYDWAMPEIWI
FT                   EPGRSIVGPAGQTLYTVGSRKDIPGIRNYLAVDGGMGDNIRPALYQANYEAVLANQPNA
FT                   KSEEIVRIAGKYCESGDVLVWQEELPATKPGDILSVLATGAYGYAMASNYNRNPRPAVV
FT                   FVENGQHQVVVERETFEHMISLDQDYTLGDK"
FT   gene            637094..637795
FT                   /locus_tag="LEUM_0668"
FT                   /note="LactoCOG number LaCOG00194"
FT   CDS_pept        637094..637795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0668"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61778"
FT                   /db_xref="GOA:Q03YE4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR013710"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR019873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YE4"
FT                   /protein_id="ABJ61778.1"
FT                   /translation="MAENEAQKLINFIANAKKITPVKVTYKGTLATEVPDTVQQFGDES
FT                   FGQLIGDWSEIELLIKNLPSEDVFIENDSRNSAVPLLDKKEINARIEPGAIIRDQVEIG
FT                   DNAVIMLGAVINIGAEIGANTMIDMGAVLGGRAIVGENSHIGAGAVLAGVIEPASAQPV
FT                   RIGNNVLVGANAVVIEGVQVGDGAVVAAGAIVTKDVPANTVVAGVPAKVIKEIDSKTQQ
FT                   KTALIDALRGL"
FT   gene            637795..638949
FT                   /locus_tag="LEUM_0669"
FT                   /note="LactoCOG number LaCOG00195"
FT   CDS_pept        637795..638949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0669"
FT                   /product="Metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61779"
FT                   /db_xref="GOA:Q03YE3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR023905"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YE3"
FT                   /protein_id="ABJ61779.1"
FT                   /translation="MPVNEEDLKTYRRDLHKIPELALAEFKTHRYLLEKIQSWQTNFMT
FT                   IRQVEELPTAMLVKFSGTDPSRTVGYRADIDALPVTEDTGLPFESTHKGVMHACGHDVH
FT                   MSLALGLVQYFSEHQPKDNLIVFFQPAEESKSGGKLAVDLGIFEGEWHPDEFYGIHDQP
FT                   NLPAGTLSTLAGTLFAGTAELEIDIHGQGGHAAYPHLGKDPIVISAELIMLLQTVVSRD
FT                   VDPIEGGVVSLGMISGGFTNNVIPDTVHLAGTVRSMTKDGLDKMTTRIRQIVEGVALAN
FT                   DVKINVRLETGSYLPVENNPDLANNLLSFMEQRQDIAFEEAKPAMTGEDFGYILQHIPG
FT                   VMLWLGVNDNHSLHSAKLNIDEAALLPGFNALKDFIEWRMSQGE"
FT   gene            638952..639818
FT                   /locus_tag="LEUM_0670"
FT                   /note="LactoCOG number LaCOG01062"
FT   CDS_pept        638952..639818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0670"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61780"
FT                   /db_xref="GOA:Q03YE2"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YE2"
FT                   /protein_id="ABJ61780.1"
FT                   /translation="MYEGINLITAIITPFTVNDEIDYESLEKLIEHLLNHGSQGFVIAG
FT                   TTGESPTLSFEEKVELTRFIAKQVGNRALLIANAGSNNTKESVEAAKALSKIEHINGIL
FT                   AVTPYYNKPSQAGMIAHFKAIADASEKPVMLYNIPGRTVVGLTVDSVIELAQHPNINAI
FT                   KETTSTEFVEAEVEGATGFAVYTGEDAMTLSAYTVGGAGTISVASHLYGDEMSELFSAM
FT                   NAGNWREAGRLQRYLTPRMNALFAYPSPTPVKTKLAEKGFVREAVRLPLIPLSDAEKLH
FT                   LNELLEK"
FT   gene            639818..640540
FT                   /locus_tag="LEUM_0671"
FT                   /note="LactoCOG number LaCOG01019"
FT   CDS_pept        639818..640540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0671"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61781"
FT                   /db_xref="GOA:Q03YE1"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YE1"
FT                   /protein_id="ABJ61781.1"
FT                   /translation="MTKIILAGGFGKLGQAIQDNLNEEYEIVGIVSGHQHESKVPVWTS
FT                   LSDINVAADIWLDVSTPATVFDNAMYAIEHNMPLVIGATGLSDEQVAILREQSSKGVLI
FT                   VPNFSLSAVLLMQFSQLAAKYFPDAEIIEAHNPKKVDAPSGTAKQTARLIAKARIAEPT
FT                   STKLAPARGEQIDRVPVHAVRLPGYIAQQSVYFGGVDEQLTLTQSTTSRSAFVPGVIRA
FT                   IEAVKNIDGVVIGLDQII"
FT   gene            640630..641433
FT                   /locus_tag="LEUM_0672"
FT                   /note="LactoCOG number LaCOG01472"
FT   CDS_pept        640630..641433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0672"
FT                   /product="hypothetical protein, RecX family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61782"
FT                   /db_xref="GOA:Q03YE0"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YE0"
FT                   /protein_id="ABJ61782.1"
FT                   /translation="MKKITKISIQKKAGRYNIDLDNQFAFGVAESVLIKFGLAKGRELD
FT                   DELIAEIKHNDSIAKALSIALNFLSHSLHTVKQVKQKMSEKEVSESIQDEVVAQLYEQK
FT                   YIDDLNYAQHYVSTKKIISPKGPNVIKMDLKQAGVNDDDIETALSDYTHEEQIEIAEKL
FT                   ALKSATTYKRESTRAKKQKIVQALATKGFSFDIAEIVVDRVITENDDEIELENIKRQAE
FT                   KSWRRYRNEVPSQRIYKTKNSLYTKGYNAELINVVIHELEVSADD"
FT   gene            641484..642053
FT                   /locus_tag="LEUM_0673"
FT                   /note="LactoCOG number LaCOG00675"
FT   CDS_pept        641484..642053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0673"
FT                   /product="Uncharacterized domain/protein associated with
FT                   RNAses G and E"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61783"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR016882"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YD9"
FT                   /protein_id="ABJ61783.1"
FT                   /translation="MNVDRPSRGPREGDFITIKSYKHDGSLHRTWRDTMVLKTSENSII
FT                   GLNDHTLVTEDDGRRWVTREPAIVYFHKKYWFNIIAMIRDNGVSYYCNLASPYVLDKEA
FT                   LKYIDYDLDIKVFPDGVKHLLDADEYAAHSKKWHYPPEIDKILKAHVKILVDWINEGSG
FT                   PFSQGYVDVWYTRYQYLMQQRLKDRR"
FT   gene            642161..642844
FT                   /locus_tag="LEUM_0674"
FT                   /note="LactoCOG number LaCOG00109"
FT   CDS_pept        642161..642844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0674"
FT                   /product="Membrane-associated serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61784"
FT                   /db_xref="GOA:Q03YD8"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YD8"
FT                   /protein_id="ABJ61784.1"
FT                   /translation="MKALKEQYQTAPITTIIFLVTTFVFLIELVLSRGTTENSEFLINM
FT                   GAKWGPYIQLKHEYWRLLTPVFLHAGFLHIVTNMITLWFIGPLVERAFGSTKFFGLYFF
FT                   GGIIGNIFSYLLAPSSVSVGASTALFAMFGGLILYAIRFKEDPQVKSMGTMLGLFVILN
FT                   LVTGFSSTDIDIWGHIGGLIGGMMFAVMFGFYGRSGKYAIRVRLIMGAITILLIILTFW
FT                   AGLRI"
FT   gene            642841..643047
FT                   /locus_tag="LEUM_0675"
FT                   /note="LactoCOG number LaCOG01351"
FT   CDS_pept        642841..643047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61785"
FT                   /db_xref="InterPro:IPR009256"
FT                   /db_xref="InterPro:IPR023164"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YD7"
FT                   /protein_id="ABJ61785.1"
FT                   /translation="MKTFYDVLQYLKEFGVYIHVGKRLWDIELAALEVDNLYKTDILNA
FT                   KDYATIKLILSHEHTMEVENPSD"
FT   gene            643209..644174
FT                   /locus_tag="LEUM_0676"
FT                   /note="LactoCOG number LaCOG00969"
FT   CDS_pept        643209..644174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0676"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61786"
FT                   /db_xref="GOA:Q03YD6"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YD6"
FT                   /protein_id="ABJ61786.1"
FT                   /translation="MAKDKLIGVDLGGTTIKFAILTDQGEIQQKWSIKTNILDDGAHIV
FT                   PDIVESINHHLDLYQLDKERIIGIGMGTPGTVNRETGTVTGAFNLNWKTEQPVKADIEA
FT                   GTGFTLTIDNDANSAALGEAWKGAGNNDDEVSFITLGTGVGGGLLANGQLIHGTVGAGG
FT                   EVGHMIVEPDGYLCTCGNRGCLEQYASATGVVHLAQNIAEEYVGSSKLKKMIDNGEEVT
FT                   SKIVFDLAKQGDFLANKVVDKVAYYLGYATATMSNILNPSAVVIGGGVAAAGEFLRARV
FT                   EEHWTKFAFPTVRHSTRVKLAELGNDAGVIGAASLARITA"
FT   gene            complement(644230..644829)
FT                   /locus_tag="LEUM_0677"
FT                   /note="LactoCOG number LaCOG00262"
FT   CDS_pept        complement(644230..644829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0677"
FT                   /product="Dithiol-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61787"
FT                   /db_xref="GOA:Q03YD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YD5"
FT                   /protein_id="ABJ61787.1"
FT                   /translation="MLSIYHFDTPLSDNCLITEQYLQKISQQIHRSHHLFFVPLINEPI
FT                   LKMIKDDNSSCADEPTDKASLVYRLTLDFKAAQIEGNKKARALLINLQEALTVGHQKYS
FT                   RNLVINIAKKVGINITDFLYNRNSKETMQAILEDQQLAHGMMPKVQATVAIDDAVDLKT
FT                   QILTDFSVNDLLPAFLPHISDDDASEKNAEASVNLA"
FT   gene            644971..645546
FT                   /locus_tag="LEUM_0678"
FT                   /note="LactoCOG number LaCOG00264"
FT   CDS_pept        644971..645546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0678"
FT                   /product="Uncharacterized protein, RelA_SpoT domain"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61788"
FT                   /db_xref="GOA:Q03YD4"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YD4"
FT                   /protein_id="ABJ61788.1"
FT                   /translation="MDWDHFFIPYIQTVSELKVKLRGLRQQYEKSGEDSSIEFVTGRVK
FT                   SQASIEEKIVRRHLDENRLALDLQDIAGVRIMTKYVEDIYTVVDLLRQRTDFQILEERD
FT                   YVSNAKPSGYRSYHLVIEYPVQMYTGELKVLAEIQVRTMAMNFWATVEHDLRYKHGELN
FT                   EDLANRLTKLSESTFALDQELSEIRAIE"
FT   gene            645543..646337
FT                   /locus_tag="LEUM_0679"
FT                   /note="LactoCOG number LaCOG00265"
FT   CDS_pept        645543..646337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0679"
FT                   /product="NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61789"
FT                   /db_xref="GOA:Q03YD3"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YD3"
FT                   /protein_id="ABJ61789.1"
FT                   /translation="MKIAIFNNHAEHSVIIAKKLILAMKKNNVDIDDRNPDIVVSVGGD
FT                   GTLLGAFQKYVDQTESVRFVGLHTGHLGFYTDWLSTELDQFVDSLIHDNGQKVSYPLLE
FT                   LTVVRTSGESYKFLALNEAVIKQPIGTLVADIYLGGQAFERFRGDGIAVATPTGSTAYN
FT                   KANGGAVLHPSLPAIQMSEIASINNRVFRTLGSPLIVPQDQEIVMKPKSNHFLVMYDQE
FT                   EIKGHNITELRFKVSEKRVHFAQYRHVDFWRRVQNAFISEIE"
FT   gene            646492..647391
FT                   /locus_tag="LEUM_0680"
FT                   /note="LactoCOG number LaCOG00266"
FT   CDS_pept        646492..647391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0680"
FT                   /product="Pseudouridylate synthase, 23S RNA-specific"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61790"
FT                   /db_xref="GOA:Q03YD2"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YD2"
FT                   /protein_id="ABJ61790.1"
FT                   /translation="MKFTWKYSGNEQRKVRTFLQNHGVSHRMFSQMKHNGGAILVNEKP
FT                   VYTSDYLKNGDIVTIVMPTEKSNDLVVPDYKPLDIIFENEHWLVVDKPYGITTVPGHAD
FT                   RLHTLVNQVKGHLETIKADDLVPHVVTRLDRDTSGIVLLAKHRFAHAVLDQQLQDHTVE
FT                   KFYLAYPSGILADDHGDINAPIGRMDGDFIKREVRDDGKPSRTEYWVERRYEDDEQNMT
FT                   RVKVQLHTGRTHQIRVHFANIGHPLVGDTLYGGPAWHGLQRQALHAYHMKFYDPFIEEY
FT                   REFNTPLPDDLKTLRDIE"
FT   gene            647395..648759
FT                   /locus_tag="LEUM_0681"
FT                   /note="LactoCOG number LaCOG00498"
FT   CDS_pept        647395..648759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0681"
FT                   /product="Transcriptional regulator with CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61791"
FT                   /db_xref="GOA:Q03YD1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YD1"
FT                   /protein_id="ABJ61791.1"
FT                   /translation="MEEKSEQLHQNIAHLSDLLHSGQDEAFVTSFNALHDFEMGQVYSG
FT                   LPEQLRAVAWRLLDNETLATVFDNIDVDDEDIDDLLQEMPPQKAVQILRNMYADNEVDL
FT                   LQEMPTRLVATYLSLMPKDEAEDIRKLINYEEQTAGSLMSIEYLAVEADLRVDEVMRLV
FT                   KQQALEAEAINYVYVLDKQERLVGVISLRDLLTHPDDMLVSEITKDRIISVKAGDDQQD
FT                   VAQIVADYNFISIPVTDDNDRLLGVITVDDIVDVIDEEAVEDYSGLAAVNVSQTDDTAW
FT                   HSAIKRIPWLIALLLLGMSTATLISSFDGLVRKASILAVFISLITGTAGNAGTQALALA
FT                   VRRLAVGSSNSAVKNFLSEILAGFLVGTATGFSVFLIVTFWKHNYQLGLAVGIAMAVAI
FT                   MVANLAGYLIPELIDKLGMDPAVASGPFITTLSDLTSVLIYFNIAQLFISHFTGA"
FT   gene            complement(648814..649311)
FT                   /locus_tag="LEUM_0682"
FT   CDS_pept        complement(648814..649311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0682"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61792"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YD0"
FT                   /protein_id="ABJ61792.1"
FT                   /translation="MRALSISPEKLLTMIIGQPITLDISYAGQLLLASTVHQQPNLPSE
FT                   MAGALAEVSDTGQVKFITLVHPFKVINRDELFNIDESNIHREPYNWFGPQALVIEKKMQ
FT                   DFINSYDGPVTEDGAIPRQYIPDNIAEPIILSDKYWQDYASFVNDPDGNFAKQIKPIFK
FT                   II"
FT   gene            complement(649316..650971)
FT                   /locus_tag="LEUM_0683"
FT                   /note="LactoCOG number LaCOG02027"
FT   CDS_pept        complement(649316..650971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0683"
FT                   /product="Adenine deaminase"
FT                   /EC_number="3.5.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61793"
FT                   /db_xref="GOA:Q03YC9"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YC9"
FT                   /protein_id="ABJ61793.1"
FT                   /translation="MTKLVTWHIKNAKILDVFNLKFDDTELWINDNQILYRGKRSDLTA
FT                   ENTFDAGGGYIVPGLIDSHLHIESSLLTPSEFGKLVIPHGITRIFADPHEIASVAGVSG
FT                   IQYMLEDAKQTPLNIHYMLPSSVPATPFEHAGATLHADALKPFYSVPEVNGLAEVMDFP
FT                   AVANLDPDMLQKIKDAEDAGRHVDGHAAGLTPEQLAVYRNVGIDTDHESENAKEALERL
FT                   NAGFSIFVREGTVERDEKAILPAITMANQSHFSFATDDKTANDIQSEGSIDYSVKLAIE
FT                   NGMDPAIAFTIATYNAAQAHKLQNIGALTDGFVADLAVFDDLAHLETPKVMIGGHWYKD
FT                   NQSIVTPLANQSLNFSLTKSDIALPLQSDKPAHIINITPHHITTEHTVEEVPVEQGLFV
FT                   ANETFAKIVVAERYHNLGHGVGIIKGFNMRDGAIASTIAHDSHNVIIAGVNDDDMILAA
FT                   DTLHEIGGGQVVVNHGKITTLPLPIGGLMSDQPFENVIKTNQQLLQAFSEISDVPFDPF
FT                   LTLSFMALPVIPSLKITDQGLFDFEKFDFITVQD"
FT   gene            651180..652985
FT                   /locus_tag="LEUM_0684"
FT                   /note="LactoCOG number LaCOG00701"
FT   CDS_pept        651180..652985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0684"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="2.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61794"
FT                   /db_xref="GOA:Q03YC8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YC8"
FT                   /protein_id="ABJ61794.1"
FT                   /translation="MCGIVGFTSFNQVLPTLLKGLEKLEYRGYDSAGVYVNDGDQGDYL
FT                   VKETGRVADLERATENKNIKGTSGIAHTRWATHGGVSVENAHPHASEDGRFYLAHNGVI
FT                   ENYDELRDTYLQGVKLHSQTDTEVAVQLIDKFAKEENLSAVDAFKKMIALLDGNSAYAF
FT                   LLMDRQEPGIMYTAKKKSPLLIGVSDQGNVVTSDAAAMLDITHDFIELMDDEVAIVEKD
FT                   KVTLFNAQGEPITRLPFHLDIDAAETDKGVYPYYMLKEVDEQAIVTRTLSQYYFDDENN
FT                   IQNIDANIIDAMKAADRLYIVAAGTSYHAGLVGKRYFEQWAKIPTEVHISSEFAYDQPM
FT                   LSQKPFFIFLSQSGETADSREVLDNITKQGYPTLTIANVMNSTLTREADFALPLLAGPE
FT                   IAVASTKAYTAQISVEAILAHAIGHSGLNLKLELAKVAVEMQVIIDQKEDFKAIAESAL
FT                   SGQRSAFYIGRGLDAAVAVEAALKLKEISYVQTEGFAAGELKHGTISLIEEGTPVFALL
FT                   TQAKTAGLVRGEIAQVAARGANTIVIATKELAKTGDAYILPEVNELLMPLLEVIPAQLI
FT                   AYYATLDRGLDVDRPRNLAKSVTVQ"
FT   gene            653103..653882
FT                   /locus_tag="LEUM_0685"
FT                   /note="LactoCOG number LaCOG01436"
FT   CDS_pept        653103..653882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0685"
FT                   /product="Undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61795"
FT                   /db_xref="GOA:Q03YC7"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YC7"
FT                   /protein_id="ABJ61795.1"
FT                   /translation="MALFKTKENTVYDTTQLKIPEHIAIIMDGNGRWAKKRLMPRAAGH
FT                   KAGMNTVKRIASAASDMGVKVLTLYVFSTENWSRPNDEVNFLMQLPIAFFNDFVPDLIK
FT                   NNIRVSVTGNVDALPAATQDAVNRAIEETASGTGMVLNFAMNYGGQIEIVDATKKIAEE
FT                   VAKGHLSPDDINSEVFAAALQTAHLGDLATPDLMIRTSGELRLSNFLPYQAAYAELYFT
FT                   DVLWPDYSSDDLMTAIQSYTKRDRRFGGLNDESEKQA"
FT   gene            653882..654676
FT                   /locus_tag="LEUM_0686"
FT                   /note="LactoCOG number LaCOG01435"
FT   CDS_pept        653882..654676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0686"
FT                   /product="CDP-diglyceride synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61796"
FT                   /db_xref="GOA:Q03YC6"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YC6"
FT                   /protein_id="ABJ61796.1"
FT                   /translation="MKTRVITAVVALIIFVPLLVIGGMPLLILTLAMAVVAMSEILRMK
FT                   HRFFVSAEALLSFVGVIVITLPKSTWQDMPFNINGSVIFYIIVFLLLLHTVLSRNHFNF
FT                   DDAGTLALTIVYVGTGFHYFFQADSKGIATVMFGMLIVWITDSGAYMVGRAIGKNKLAP
FT                   KISPNKTWEGSIGGSMVAIIVIPALFTIFHWLPDYNFIELLAFTAILSIAGQLGDLIES
FT                   GFKRHYGVKDSGNILPGHGGILDRFDSMLIVMPMMAVLGILN"
FT   gene            654730..655983
FT                   /locus_tag="LEUM_0687"
FT                   /note="LactoCOG number LaCOG01434"
FT   CDS_pept        654730..655983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0687"
FT                   /product="site-2 protease, Metallo peptidase, MEROPS family
FT                   M50B"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61797"
FT                   /db_xref="GOA:Q03YC5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YC5"
FT                   /protein_id="ABJ61797.1"
FT                   /translation="MNVTSIIAFIFVFGVLVTVHEFGHFFVAKKSGVLVREFAIGMGPK
FT                   LLSWNRNHTAYTIRILPVGGYVRMAGMDEEPDLDAGQRLRLTFNEQGKVTKIDTQIDEA
FT                   GIGVPFQVDSFDLSDALTLTGYSDNATDMTTVHVDHDATIIEENGVEVQVAPRDVWLQS
FT                   AKVWKRALINIAGPVMNFILALVIFSGVGFAIASVGLNEPIIGTVQKNMPADQAGLKAG
FT                   DEITQIDRVKTTTWDQVANAIGNSKESQLNITVLRNGHKKQVEVRPKTVKINGVQTKQV
FT                   GIIEKTHTDTISRLKYGLINTGATISQIWHALSHLFTGGFSLDKLGGPVSIAKTTSSVA
FT                   KTGFLNILIFMAMLSLNLGIMNLIPIPALDGGKLILNLLEGILRRPLPQSFENAVTIVG
FT                   AVFMIILMIAVTINDILR"
FT   gene            656034..657752
FT                   /locus_tag="LEUM_0688"
FT                   /note="LactoCOG number LaCOG01433"
FT   CDS_pept        656034..657752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0688"
FT                   /product="Prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61798"
FT                   /db_xref="GOA:Q03YC4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03YC4"
FT                   /protein_id="ABJ61798.1"
FT                   /translation="MKQSKLLMPTLRDIPAEAEVKSHQLLLKAGYIRPIAAGMFSYLPL
FT                   AKRVLNKIETIIREEMDKIDANEMLVPEVLPAELWQRSGRYETYGPALYKFKNRQDRDF
FT                   ILGPTHEETFTQLIADEIKSYKKLPLTVYQIQAKFRDENRPRFGLLRTREFIMKDAYSF
FT                   SADQEGLDEAFHNMEEAYTNIFDRLGLEYRAIVGDAGAMGGSDSKEFSAPAAAGEDTIA
FT                   YSDATDYAANLEMAKDFYERRSATAEQLALEKISTPNEKTIDDVATLLDKPKNELVKTI
FT                   MFVADDELVAVVTTGDFEVNEVKVQNYLHADSLVMAEEADVRKAVGAGFGSLGPVGLPE
FT                   EVKLLVDERAADLANFAAGANEDGMHYVNINWNRDVDLLAENVSDFRTVREGDLAIDGK
FT                   GKLQFTSGIEIGHIFKLGTRYSKTLGAQVLDNNGRQTDVIMGSYGIGVSRLLSAIAEQK
FT                   ADEDGLVWPASVAPFDIHIVPINMKDEDQARVAEQLETLLVAQGMEVLVDDRKERAGVK
FT                   FADADLIGLPIRITVGKKADEDVVEVKVRASNTNIEMRVSEVVDSVSVLLNASEK"
FT   gene            657808..662121
FT                   /locus_tag="LEUM_0689"
FT                   /note="LactoCOG number LaCOG01432"
FT   CDS_pept        657808..662121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0689"
FT                   /product="DNA polymerase III catalytic subunit, PolC type"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61799"
FT                   /db_xref="GOA:Q03YC3"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006308"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR024754"
FT                   /db_xref="InterPro:IPR028112"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YC3"
FT                   /protein_id="ABJ61799.1"
FT                   /translation="MKLTQQEQLQHLLTHIQLPEEIHHYFDDGCLSQVDVSVSQKMWLF
FT                   HVEIEQILPVNVYMQFQQYLRTAFTNIAVVQLQITTPVQQVNEEVVNSYWHLALQESSL
FT                   NHATTQQLASNTILKTIETNHFGVAVGASILYRALTAEVIDSIATVYHSFGLPKIKLTP
FT                   KLDEQLEQEIQENVAQHHARAREDLQKAIVANEQSKPKVSSEGVSLALGRKIPADAEIT
FT                   RLDSIDGEENRVVIEGYIFAEEIRELRSGRKLLTLKLTDYSSSISAKKFSNNENDEAVF
FT                   DGLKSGLWVRLSGNIQEDQYARELVMNIYDLQVVDHANRQEVYQGEEKHIELHAHTNMS
FT                   AMDAVTDFSGVAKLAKSWGQTALAVTDTGNVQGFPEASAAGAKNGLKMIYGMEANLVED
FT                   GEPIGFNLDQTELLNKDTIFVAFDLETTGLSAVTDRIIELSAVKMQLGNVIEKFSEYIN
FT                   PGFPLSEFTTKLTSITDAMVANSDTEENIIKRFREWSGNAVLVGHNVTFDVGFMNAAYT
FT                   RYNQPIITNAIIDTLPFTRWLYPDYKSYRLGTIAKRFNINLEQAHRAIFDAETTGHIAW
FT                   RLIKEAHERYNLNRHNELNDRMTEGDAWKHGRPVHATLLVQNATGLKNLYKLVSRSNIE
FT                   FFARVPRIPRSILEQYREGLLVGTGDTSGDVIISLIEKGIQEAEKKAAYYDFIEIQPTA
FT                   NYQPMIESGLIATEEKLQSILKDMVAIGDKLKKPVVVTEDVKYTNPEDKIYRNILIATQ
FT                   PGNPQNRTALPDLNFKTTQELLDDYAFMGADLAKKLVIDNTHLVANMLEDIEPLKSGSY
FT                   PPNIPGAGDELTERTYRTAKQWYGEPIPKEIQARIDQELKAIIGNGFAPHYIIAQRLVA
FT                   KSVKDGYLVGSRGSVGSSFVATMSGITEVNPLPPHYRSAHGDYFELVDPKEYESGYDLP
FT                   EKEDPNHPGEFLIGDGQNIPFETFMGFTGNKVPDIDLNFSGDYQPIAHNYMKVLFGEHN
FT                   VYRAGTIATVAEKTAFGYVKAYEREHDQHYRGAEIERLAQGMTGVKRTTGQHPGGILIV
FT                   PREYEVYDFTPIQYPADDQKSLWQTTHMDYHSIHDNLLKMDILGHDDPTMVRTLKDMSG
FT                   IDPQSIPANDPGVLSLFTSTEALGVTPEQIFSNTGTLGLPEFGTNFVRGMLTETQPHTY
FT                   SELLQISGLSHGTDVWVGNANELIENGTATIGTVIGTRDKIMTDLINWGVPAADAFNIM
FT                   EKVRKGKGITEEYQKQLREEKIPEWYIQSMLKIKYMFPRAHAAAYVLMALRIAYFKVYF
FT                   PTIYYATYFSVRADAFDIVAMSRGKDATKAAIQKLKSLGNDATVGDKNLLTVLEMANEA
FT                   LERNITFAMVDLNKSEALEWVIDGDTLIPPFVSLPGLGDNVAKQIVAARTEKPFISKED
FT                   LKKRGKVSQTIIEFMTLHSVLDGLPDENQLSLFDF"
FT   gene            662195..662602
FT                   /locus_tag="LEUM_0690"
FT                   /note="LactoCOG number LaCOG00941"
FT   CDS_pept        662195..662602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0690"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61800"
FT                   /db_xref="GOA:Q03YC2"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YC2"
FT                   /protein_id="ABJ61800.1"
FT                   /translation="MKHEWHQKVAGYYEYVLNIMMILIGIVIFGFLIREIWNLAQMLSI
FT                   KNISGHFTELAEQILIVFLFFEFLGIGREYFVKDAHISTDNFLYIGVTAIVRAMLVYHD
FT                   QTYKTLMLAAAIFLLISAQAIYRYFRPKYRS"
FT   gene            662733..663644
FT                   /locus_tag="LEUM_0691"
FT                   /note="LactoCOG number LaCOG01076"
FT   CDS_pept        662733..663644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0691"
FT                   /product="Sugar kinase, ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61801"
FT                   /db_xref="GOA:Q03YC1"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YC1"
FT                   /protein_id="ABJ61801.1"
FT                   /translation="MTKNIVVLGSLNVDNIMKMPRMPLVGETMALTEVTTAPGGKGANQ
FT                   AVAASRQGANVSFIGAVGNDANGQFMRATLLTNGVNVDAVSTNSDVPTGSAYIMLQESG
FT                   ANTILIHGGANQALTIEDINTALIAQADVLIAQFEVPFEVILAAFKIAKKNNVQTILNP
FT                   APAVYELTPELMAVTDIVLPNETEAQLLTGINVINDEGVLNRVSDALQAKGVQRSIITL
FT                   GEAGSFIADGQKRWWVQPEKVDAQDTTAAGDTFIGTLASVIAPDFSNLDDAVQRANIAS
FT                   AIAVTRPGAIPSIPTDKEVDNY"
FT   gene            663644..665056
FT                   /locus_tag="LEUM_0692"
FT                   /note="LactoCOG number LaCOG01801"
FT   CDS_pept        663644..665056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0692"
FT                   /product="tRNA and rRNA cytosine-C5-methylase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61802"
FT                   /db_xref="GOA:Q03YC0"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR027391"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031340"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YC0"
FT                   /protein_id="ABJ61802.1"
FT                   /translation="MLPEDFKNKYNRILGDEYEDFLLSFDEPVQKAYRVNPLKPYPVIS
FT                   DTEDHGNLPYGKWGHFGAVNGHSVDHVTGVVYSQEPSAQFVGEVVRPNPGERVLDLAAA
FT                   PGGKSTHLAAFMGQKGLLWSNEIFLNRAKILSENIERMGIKNAIVSSHTPAELSSKLPG
FT                   FFDKILLDAPCSGEGMFRKDPGAIAYWHEHYPAENATRQREILTEAVKMLRPGGQIVYS
FT                   TCTFAPEEDEQIINWLMAAYPEFSLVSIEKPDGANLSDARPEWIDEAFVNGTTEHSATT
FT                   TKDVMKKAARLWPHKLEGEGHFVAKLVKANGDYDDVSVVKPLKNKPLDKQQREILSNFF
FT                   EEALITFDQKANEYVLFGDHLYMAPIGTPDISSMKILRLGLELGLFKKKRFEPAHALAL
FT                   ALNPDEVKQSYEMNPEEWAQFVHGDVIQTRLDLDKGWVLMTANGNGAGWGRYVNGQIKN
FT                   FFPKGLRFVVKK"
FT   gene            665213..666328
FT                   /locus_tag="LEUM_0693"
FT                   /note="LactoCOG number LaCOG00935"
FT   CDS_pept        665213..666328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0693"
FT                   /product="nucleoside-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61803"
FT                   /db_xref="GOA:Q03YB9"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YB9"
FT                   /protein_id="ABJ61803.1"
FT                   /translation="MNRSTKIFTGLAAAAVIAGGIYAATSHNSSSSKNANKSATLGLVL
FT                   DVGGVDDHSFNQSAWEGAKSYAKENNLKAGQNAAVTYFNTKSQSDLNQNFNLATKSKKY
FT                   DIVYGIGYSLNQSISKSAKLNPKQKFVLVDDIVKNRKNVASVMFRSEQSSYLAGVAAAT
FT                   KAKENGEKTVGFIGGIHGNIIDAFDAGFEAGVKATDSSLTVQKQYADSFSDSAKGKTIA
FT                   AAMYASGIRTIFAAAGFVGNGAFAEAKAENTKLDADSKDRLYIIGVDRDQKSDGSYTSK
FT                   DGKKVTSTMASSITSVGDGVKNIADKYNKDKKFPGGKTIAYGLDDHGVYLTKSELTKSQ
FT                   KAAVKKAERSIINGKITVPNHPKGSQFNQNF"
FT   gene            666479..666823
FT                   /locus_tag="LEUM_0694"
FT                   /note="LactoCOG number LaCOG01237"
FT   CDS_pept        666479..666823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0694"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61804"
FT                   /db_xref="InterPro:IPR014965"
FT                   /db_xref="InterPro:IPR035942"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YB8"
FT                   /protein_id="ABJ61804.1"
FT                   /translation="MAFDKTVTIPGDKTYKLSNNIKKYTLGDLGFITNKAGVHILHRAL
FT                   EPEKALDNAIQLKVSINQELTGFKMSTVSAGDVVRVDIFKNNNAAELVKLYYFFVNELI
FT                   ERGVLEEINE"
FT   gene            666868..667521
FT                   /locus_tag="LEUM_0695"
FT                   /note="LactoCOG number LaCOG01149"
FT   CDS_pept        666868..667521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0695"
FT                   /product="Phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61805"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YB7"
FT                   /protein_id="ABJ61805.1"
FT                   /translation="MTKFYFVRHGQTEWNLERRFQGGHGDSELLPSSYNDMKKVGKFLS
FT                   KIKFDHIYASPIRRARITAINIAKQLKYKPALSLRSNLAEVGLGAWEGELVANVKEQYA
FT                   SSFDNYRNDLDKFEGKEFGGEGYTKAEARFVRFIKATANNFPESNILIVSHGMELSFGI
FT                   NGLLKQHRMSIRERGGLTNTSTTILSTTDGENFVIEDWNNTSYLNKKQDDSTTI"
FT   gene            667521..669908
FT                   /locus_tag="LEUM_0696"
FT                   /note="LactoCOG number LaCOG01148"
FT   CDS_pept        667521..669908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0696"
FT                   /product="ATP-dependent DNA helicase, RecD/TraA family"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61806"
FT                   /db_xref="GOA:Q03YB6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YB6"
FT                   /protein_id="ABJ61806.1"
FT                   /translation="MAYPEKQLDKITGTLQNVIFSSTESYFKILSVHIEESTLEDWQEP
FT                   EMIATGTFADVQEGSVYGFYGQLVRHPKYGQQFKVDHYENELPPDENGLIKYFASGQFT
FT                   GIGKKTAEKIVNHLGLNAVNLILDDAKILDGIVKAETARKLARTLRLNLGLERLFQIGN
FT                   QFGIGADIAGRLYDQYGNEAQDILTQDPYRLVFEFDGISFKKADDIGHKVGVDKFDERR
FT                   MQAAVYATIMNVTFQYGHMFLSHDQLLLSVEQMLHQNNTEMSNQIQKAIQSLIESNILV
FT                   NDDGRYYAKRLYIAEKETAINLKRLLNTSSPLNITANDIDESFVTPGKMTLDQIQVEAV
FT                   KTGLKSQIFLLTGGPGTGKTTIIRTMVATWKKMIQNRAKFADNTKDFLKNYQVRMASPT
FT                   GRAAKRMTEVTGYDASTIHRLLGIADLDEPEFNADNPIAGGLLIIDEASMLDIELTSKL
FT                   LAAVPNGMKVIIVGDSDQLPSVGPGNVLEDLVSSGDITHIELEVIYRQGRGSSITELAT
FT                   HIKNGELPADFLENQPDRSSFMVNSEQASQAIEQVVALAIKKGYTQDDLQILTPMYKTS
FT                   AGVIALNQMAQKLFNPLKSNQKSLQFGMTIFRKGDKVLQLENDSERDVYNGDMGKIIAV
FT                   QYKSDIGNDDNEDRLIIDFDGKELAYPKKNLNQLSLAYATTVHKAQGNEFQLVIMVLTN
FT                   HFGLMLNRNLLYTGITRAKEALILVGEYTAFERASRTLVPKRFTFLQQRLSHSKTEVNE
FT                   HDSSDESETIPEKTPHLTTTMVISSAVNPMIGMENITPYDFM"
FT   gene            669958..670929
FT                   /locus_tag="LEUM_0697"
FT                   /note="LactoCOG number LaCOG00564"
FT   CDS_pept        669958..670929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0697"
FT                   /product="Phosphoribosylpyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61807"
FT                   /db_xref="GOA:Q03YB5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YB5"
FT                   /protein_id="ABJ61807.1"
FT                   /translation="MTPAYELFNLGSNDELAGEISTILGVPLAPIDIKTFADNEIYERI
FT                   ENTVRGRNVYVIQGITAPVNDNFMKLMIFIDAARRASANSINVIIPYFGYARSDRKARS
FT                   REPISARMIANMLESQGVKRVMTMDLHADQVQGFFDIPVDHLLAMPALGHYFYANDLLG
FT                   DDLVVVAPDHSSVARARKFAKLLHADWALVDRRVDSVRPNTPYQITGNVAGKRAILIDD
FT                   IIDTGTSMVLASEAAANAGAIEIYAVATHAVLSDNAVDHLEKAPIDHVVVANTVEIAEH
FT                   KNMSKLKVLSVAESFAEAIRRINVFESIEDVLKSPDNLDVML"
FT   gene            670926..671816
FT                   /locus_tag="LEUM_0698"
FT                   /note="LactoCOG number LaCOG02040"
FT   CDS_pept        670926..671816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0698"
FT                   /product="Lysophospholipase L1 related esterase"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61808"
FT                   /db_xref="GOA:Q03YB4"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037461"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YB4"
FT                   /protein_id="ABJ61808.1"
FT                   /translation="MKIVDLESFLSPEWGKTSNGFVTTQFGAALEFMVQGAQEVTLKFA
FT                   KKYEGLSLVLSLNGENWHEINVENNVLKLSVTDGHYILLVRSISGNQMTLWTNPITLVS
FT                   GQIDSGELAPIATDVNYITFIGDSITAGEEMIEHEPHPELSYPELIAEMLHKPLARIGY
FT                   GGSGLTPSAPFQEPTAVEALWHVAPNVERPRASSDLVIVNYGTNDYNYGATVQDFCFGL
FT                   RVYLLELIKRFHDAKIVLLVPFNGAFKKVFEQEIKRFDCFVLLDTTPWKISPQQVHPNI
FT                   LEHERVAKLLLGGLI"
FT   gene            671818..672810
FT                   /locus_tag="LEUM_0699"
FT                   /note="LactoCOG number LaCOG01326"
FT   CDS_pept        671818..672810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0699"
FT                   /product="Aryl-alcohol dehydrogenase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61809"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YB3"
FT                   /protein_id="ABJ61809.1"
FT                   /translation="MVYAADEQRYEKLPYRRVSDSGLILPAVSFGLWRNLGDQMPLENS
FT                   RNVILKAFDSGIFSFDNASNYGPSNGTAEVTFGNVYRNDLKPYRDELVITTKAGYHMWP
FT                   GPLGEFSGKKTLVAALDLSLQRMGLDYVDIFYAHRWDPNTRLEETARALDLIVKQGKAL
FT                   YVGVSNYTAEQTKAITKIFDELGTPFIGNQVSYNMLNRTAEKDGLLDVLDQNHAGLVAY
FT                   GPLAEGLLTDRYLKEIPADYPIHPTNQFLFKNGKDALIAKLNALNAIAQGRGQKLSQMA
FT                   LAWLLKDERVATVVIGASKVEHLVDNLKFSDNLDFSAAELKEIQAILDK"
FT   gene            673031..674275
FT                   /locus_tag="LEUM_0700"
FT                   /note="LactoCOG number LaCOG00986"
FT   CDS_pept        673031..674275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0700"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ61810"
FT                   /db_xref="GOA:Q03YB2"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q03YB2"
FT                   /protein_id="ABJ61810.1"
FT                   /translation="MTKVLIIGSGAREHALAQTFLKSPQVDEVIVTPGNDGMTDDHLRR
FT                   VEIPVTNLIELRDFANQEHVDLTFVGNEEPLTLGIVDVFTEASLKIFGPTKKAAQLEGS
FT                   KSFTKNILQKYNIPTAQSITVTSFNEANQAIAKFGFPIVFKLDGLALGKGVTIIENAAD
FT                   AQVYLEKLYTQNVDVKLVIEEYLKGVEFSVFTLVGQNGAMTHAPLAQDHKRRFDGDEGP
FT                   NTGGMGAYSPVKWISDQIRQETIETLVNPTVKAMVEEHASFTGVLYTGVMLTEEGPKVI
FT                   EFNVRFGDPEAQVVLPQFEGDFYQLILQLLSGEKPASHWQEEEVYVGVVLAAKGYPERP
FT                   QKGAIVPQIPLVTNYAGVKLANTVLHANGGRVATVIAHDKNVKLAQEKVYNVLDKTPMD
FT                   LQYRHDIAYQAVQKL"
FT   gene            674288..675952
FT                   /locus_tag="LEUM_0701"
FT                   /note="LactoCOG number LaCOG00645"
FT   CDS_pept        674288..675952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LEUM_0701"
FT                   /product="Formate-tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:LEUM_0701"
FT                   /db_xref="EnsemblGeno