(data stored in ACNUC7421 zone)

EMBL: CP000425

ID   CP000425; SV 1; circular; genomic DNA; STD; PRO; 2438589 BP.
XX
AC   CP000425; AAGO01000000-AAGO01000201;
XX
PR   Project:PRJNA401;
XX
DT   15-OCT-2006 (Rel. 89, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 11)
XX
DE   Lactococcus lactis subsp. cremoris SK11, complete genome.
XX
KW   .
XX
OS   Lactococcus lactis subsp. cremoris SK11
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Lactococcus.
XX
RN   [1]
RP   1-2438589
RX   DOI; 10.1073/pnas.0607117103.
RX   PUBMED; 17030793.
RA   Makarova K., Slesarev A., Wolf Y., Sorokin A., Mirkin B., Koonin E.,
RA   Pavlov A., Pavlova N., Karamychev V., Polouchine N., Shakhova V.,
RA   Grigoriev I., Lou Y., Rohksar D., Lucas S., Huang K., Goodstein D.M.,
RA   Hawkins T., Plengvidhya V., Welker D., Hughes J., Goh Y., Benson A.,
RA   Baldwin K., Lee J.H., Diaz-Muniz I., Dosti B., Smeianov V., Wechter W.,
RA   Barabote R., Lorca G., Altermann E., Barrangou R., Ganesan B., Xie Y.,
RA   Rawsthorne H., Tamir D., Parker C., Breidt F., Broadbent J., Hutkins R.,
RA   O'Sullivan D., Steele J., Unlu G., Saier M., Klaenhammer T., Richardson P.,
RA   Kozyavkin S., Weimer B., Mills D.;
RT   "Comparative genomics of the lactic acid bacteria";
RL   Proc. Natl. Acad. Sci. U.S.A. 103(42):15611-15616(2006).
XX
RN   [2]
RP   1-2438589
RG   US DOE Joint Genome Institute (JGI), The Lactic Acid Bacteria Genome
RG   Consortium and Fidelity Systems Inc.
RA   Lucas S., Copeland A., Detter J.C., Glavina del Rio T., Pitluck S.,
RA   Grigoriev I., Rokhsar D., Slesarev E.A., Pavlov A., Karamychev V.,
RA   Polouchine N., Shakhova V., Kozyavkin E.S., Makarova K., Koonin E.,
RA   Mills D.A., Richardson P.;
RT   ;
RL   Submitted (23-JUN-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 0bc86df91d51f48eb3ca28beda1564dd.
DR   BioSample; SAMN02598527.
DR   EnsemblGenomes-Gn; EBG00001190324.
DR   EnsemblGenomes-Gn; EBG00001190325.
DR   EnsemblGenomes-Gn; EBG00001190326.
DR   EnsemblGenomes-Gn; EBG00001190327.
DR   EnsemblGenomes-Gn; EBG00001190328.
DR   EnsemblGenomes-Gn; EBG00001190329.
DR   EnsemblGenomes-Gn; EBG00001190330.
DR   EnsemblGenomes-Gn; EBG00001190331.
DR   EnsemblGenomes-Gn; EBG00001190332.
DR   EnsemblGenomes-Gn; EBG00001190333.
DR   EnsemblGenomes-Gn; EBG00001190334.
DR   EnsemblGenomes-Gn; EBG00001190335.
DR   EnsemblGenomes-Gn; EBG00001190336.
DR   EnsemblGenomes-Gn; EBG00001190337.
DR   EnsemblGenomes-Gn; EBG00001190338.
DR   EnsemblGenomes-Gn; EBG00001190339.
DR   EnsemblGenomes-Gn; EBG00001190340.
DR   EnsemblGenomes-Gn; EBG00001190341.
DR   EnsemblGenomes-Gn; EBG00001190342.
DR   EnsemblGenomes-Gn; EBG00001190343.
DR   EnsemblGenomes-Gn; EBG00001190344.
DR   EnsemblGenomes-Gn; EBG00001190345.
DR   EnsemblGenomes-Gn; EBG00001190346.
DR   EnsemblGenomes-Gn; EBG00001190347.
DR   EnsemblGenomes-Gn; EBG00001190348.
DR   EnsemblGenomes-Gn; EBG00001190349.
DR   EnsemblGenomes-Gn; EBG00001190350.
DR   EnsemblGenomes-Gn; EBG00001190351.
DR   EnsemblGenomes-Gn; EBG00001190352.
DR   EnsemblGenomes-Gn; EBG00001190353.
DR   EnsemblGenomes-Gn; EBG00001190354.
DR   EnsemblGenomes-Gn; EBG00001190355.
DR   EnsemblGenomes-Gn; EBG00001190356.
DR   EnsemblGenomes-Gn; EBG00001190357.
DR   EnsemblGenomes-Gn; EBG00001190358.
DR   EnsemblGenomes-Gn; EBG00001190359.
DR   EnsemblGenomes-Gn; EBG00001190360.
DR   EnsemblGenomes-Gn; EBG00001190361.
DR   EnsemblGenomes-Gn; EBG00001190362.
DR   EnsemblGenomes-Gn; EBG00001190363.
DR   EnsemblGenomes-Gn; EBG00001190364.
DR   EnsemblGenomes-Gn; EBG00001190365.
DR   EnsemblGenomes-Gn; EBG00001190366.
DR   EnsemblGenomes-Gn; EBG00001190367.
DR   EnsemblGenomes-Gn; EBG00001190368.
DR   EnsemblGenomes-Gn; EBG00001190369.
DR   EnsemblGenomes-Gn; EBG00001190370.
DR   EnsemblGenomes-Gn; EBG00001190371.
DR   EnsemblGenomes-Gn; EBG00001190372.
DR   EnsemblGenomes-Gn; EBG00001190373.
DR   EnsemblGenomes-Gn; EBG00001190374.
DR   EnsemblGenomes-Gn; EBG00001190375.
DR   EnsemblGenomes-Gn; EBG00001190376.
DR   EnsemblGenomes-Gn; EBG00001190377.
DR   EnsemblGenomes-Gn; EBG00001190378.
DR   EnsemblGenomes-Gn; EBG00001190379.
DR   EnsemblGenomes-Gn; EBG00001190380.
DR   EnsemblGenomes-Gn; EBG00001190381.
DR   EnsemblGenomes-Gn; EBG00001190382.
DR   EnsemblGenomes-Gn; EBG00001190383.
DR   EnsemblGenomes-Gn; EBG00001190384.
DR   EnsemblGenomes-Gn; EBG00001190385.
DR   EnsemblGenomes-Gn; EBG00001190386.
DR   EnsemblGenomes-Gn; EBG00001190387.
DR   EnsemblGenomes-Gn; EBG00001190388.
DR   EnsemblGenomes-Gn; EBG00001190389.
DR   EnsemblGenomes-Gn; EBG00001190390.
DR   EnsemblGenomes-Gn; EBG00001190391.
DR   EnsemblGenomes-Gn; EBG00001190392.
DR   EnsemblGenomes-Gn; EBG00001190393.
DR   EnsemblGenomes-Gn; EBG00001190394.
DR   EnsemblGenomes-Gn; EBG00001190395.
DR   EnsemblGenomes-Gn; EBG00001190396.
DR   EnsemblGenomes-Gn; EBG00001190397.
DR   EnsemblGenomes-Gn; EBG00001190398.
DR   EnsemblGenomes-Gn; EBG00001190399.
DR   EnsemblGenomes-Gn; EBG00001190400.
DR   EnsemblGenomes-Gn; EBG00001190401.
DR   EnsemblGenomes-Gn; EBG00001190402.
DR   EnsemblGenomes-Gn; EBG00001190403.
DR   EnsemblGenomes-Gn; EBG00001190404.
DR   EnsemblGenomes-Gn; EBG00001190405.
DR   EnsemblGenomes-Gn; EBG00001190406.
DR   EnsemblGenomes-Gn; EBG00001190407.
DR   EnsemblGenomes-Gn; EBG00001190408.
DR   EnsemblGenomes-Gn; EBG00001190409.
DR   EnsemblGenomes-Gn; EBG00001190410.
DR   EnsemblGenomes-Gn; EBG00001190411.
DR   EnsemblGenomes-Gn; EBG00001190412.
DR   EnsemblGenomes-Gn; EBG00001190413.
DR   EnsemblGenomes-Gn; EBG00001190414.
DR   EnsemblGenomes-Gn; EBG00001190415.
DR   EnsemblGenomes-Gn; EBG00001190416.
DR   EnsemblGenomes-Gn; EBG00001190417.
DR   EnsemblGenomes-Gn; EBG00001190418.
DR   EnsemblGenomes-Gn; EBG00001190419.
DR   EnsemblGenomes-Gn; EBG00001190420.
DR   EnsemblGenomes-Gn; LACR_r0025.
DR   EnsemblGenomes-Gn; LACR_r0552.
DR   EnsemblGenomes-Gn; LACR_r0554.
DR   EnsemblGenomes-Gn; LACR_r0555.
DR   EnsemblGenomes-Gn; LACR_r1817.
DR   EnsemblGenomes-Gn; LACR_r2176.
DR   EnsemblGenomes-Gn; LACR_r2177.
DR   EnsemblGenomes-Gn; LACR_r2179.
DR   EnsemblGenomes-Gn; LACR_r2448.
DR   EnsemblGenomes-Gn; LACR_r2449.
DR   EnsemblGenomes-Gn; LACR_r2451.
DR   EnsemblGenomes-Gn; LACR_r2491.
DR   EnsemblGenomes-Gn; LACR_r2492.
DR   EnsemblGenomes-Gn; LACR_r2494.
DR   EnsemblGenomes-Gn; LACR_r2569.
DR   EnsemblGenomes-Gn; LACR_r2570.
DR   EnsemblGenomes-Gn; LACR_r2572.
DR   EnsemblGenomes-Gn; LACR_r2606.
DR   EnsemblGenomes-Gn; LACR_r2607.
DR   EnsemblGenomes-Gn; LACR_r2609.
DR   EnsemblGenomes-Gn; LACR_s1521.
DR   EnsemblGenomes-Gn; LACR_t0019.
DR   EnsemblGenomes-Gn; LACR_t0020.
DR   EnsemblGenomes-Gn; LACR_t0021.
DR   EnsemblGenomes-Gn; LACR_t0022.
DR   EnsemblGenomes-Gn; LACR_t0023.
DR   EnsemblGenomes-Gn; LACR_t0024.
DR   EnsemblGenomes-Gn; LACR_t0026.
DR   EnsemblGenomes-Gn; LACR_t0045.
DR   EnsemblGenomes-Gn; LACR_t0108.
DR   EnsemblGenomes-Gn; LACR_t0124.
DR   EnsemblGenomes-Gn; LACR_t0158.
DR   EnsemblGenomes-Gn; LACR_t0261.
DR   EnsemblGenomes-Gn; LACR_t0287.
DR   EnsemblGenomes-Gn; LACR_t0296.
DR   EnsemblGenomes-Gn; LACR_t0297.
DR   EnsemblGenomes-Gn; LACR_t0471.
DR   EnsemblGenomes-Gn; LACR_t0490.
DR   EnsemblGenomes-Gn; LACR_t0553.
DR   EnsemblGenomes-Gn; LACR_t0556.
DR   EnsemblGenomes-Gn; LACR_t0557.
DR   EnsemblGenomes-Gn; LACR_t0558.
DR   EnsemblGenomes-Gn; LACR_t0559.
DR   EnsemblGenomes-Gn; LACR_t0560.
DR   EnsemblGenomes-Gn; LACR_t0561.
DR   EnsemblGenomes-Gn; LACR_t0562.
DR   EnsemblGenomes-Gn; LACR_t0563.
DR   EnsemblGenomes-Gn; LACR_t0564.
DR   EnsemblGenomes-Gn; LACR_t0565.
DR   EnsemblGenomes-Gn; LACR_t0566.
DR   EnsemblGenomes-Gn; LACR_t0567.
DR   EnsemblGenomes-Gn; LACR_t0568.
DR   EnsemblGenomes-Gn; LACR_t0569.
DR   EnsemblGenomes-Gn; LACR_t0650.
DR   EnsemblGenomes-Gn; LACR_t0653.
DR   EnsemblGenomes-Gn; LACR_t0753.
DR   EnsemblGenomes-Gn; LACR_t1131.
DR   EnsemblGenomes-Gn; LACR_t1753.
DR   EnsemblGenomes-Gn; LACR_t1806.
DR   EnsemblGenomes-Gn; LACR_t1827.
DR   EnsemblGenomes-Gn; LACR_t2169.
DR   EnsemblGenomes-Gn; LACR_t2170.
DR   EnsemblGenomes-Gn; LACR_t2171.
DR   EnsemblGenomes-Gn; LACR_t2172.
DR   EnsemblGenomes-Gn; LACR_t2173.
DR   EnsemblGenomes-Gn; LACR_t2174.
DR   EnsemblGenomes-Gn; LACR_t2175.
DR   EnsemblGenomes-Gn; LACR_t2178.
DR   EnsemblGenomes-Gn; LACR_t2373.
DR   EnsemblGenomes-Gn; LACR_t2450.
DR   EnsemblGenomes-Gn; LACR_t2493.
DR   EnsemblGenomes-Gn; LACR_t2523.
DR   EnsemblGenomes-Gn; LACR_t2563.
DR   EnsemblGenomes-Gn; LACR_t2564.
DR   EnsemblGenomes-Gn; LACR_t2565.
DR   EnsemblGenomes-Gn; LACR_t2566.
DR   EnsemblGenomes-Gn; LACR_t2567.
DR   EnsemblGenomes-Gn; LACR_t2568.
DR   EnsemblGenomes-Gn; LACR_t2571.
DR   EnsemblGenomes-Gn; LACR_t2604.
DR   EnsemblGenomes-Gn; LACR_t2605.
DR   EnsemblGenomes-Gn; LACR_t2608.
DR   EnsemblGenomes-Tr; EBT00001768759.
DR   EnsemblGenomes-Tr; EBT00001768761.
DR   EnsemblGenomes-Tr; EBT00001768763.
DR   EnsemblGenomes-Tr; EBT00001768764.
DR   EnsemblGenomes-Tr; EBT00001768767.
DR   EnsemblGenomes-Tr; EBT00001768769.
DR   EnsemblGenomes-Tr; EBT00001768770.
DR   EnsemblGenomes-Tr; EBT00001768771.
DR   EnsemblGenomes-Tr; EBT00001768772.
DR   EnsemblGenomes-Tr; EBT00001768774.
DR   EnsemblGenomes-Tr; EBT00001768776.
DR   EnsemblGenomes-Tr; EBT00001768778.
DR   EnsemblGenomes-Tr; EBT00001768780.
DR   EnsemblGenomes-Tr; EBT00001768781.
DR   EnsemblGenomes-Tr; EBT00001768782.
DR   EnsemblGenomes-Tr; EBT00001768783.
DR   EnsemblGenomes-Tr; EBT00001768785.
DR   EnsemblGenomes-Tr; EBT00001768786.
DR   EnsemblGenomes-Tr; EBT00001768787.
DR   EnsemblGenomes-Tr; EBT00001768789.
DR   EnsemblGenomes-Tr; EBT00001768790.
DR   EnsemblGenomes-Tr; EBT00001768791.
DR   EnsemblGenomes-Tr; EBT00001768792.
DR   EnsemblGenomes-Tr; EBT00001768793.
DR   EnsemblGenomes-Tr; EBT00001768794.
DR   EnsemblGenomes-Tr; EBT00001768797.
DR   EnsemblGenomes-Tr; EBT00001768798.
DR   EnsemblGenomes-Tr; EBT00001768800.
DR   EnsemblGenomes-Tr; EBT00001768802.
DR   EnsemblGenomes-Tr; EBT00001768803.
DR   EnsemblGenomes-Tr; EBT00001768804.
DR   EnsemblGenomes-Tr; EBT00001768805.
DR   EnsemblGenomes-Tr; EBT00001768806.
DR   EnsemblGenomes-Tr; EBT00001768808.
DR   EnsemblGenomes-Tr; EBT00001768810.
DR   EnsemblGenomes-Tr; EBT00001768812.
DR   EnsemblGenomes-Tr; EBT00001768813.
DR   EnsemblGenomes-Tr; EBT00001768814.
DR   EnsemblGenomes-Tr; EBT00001768815.
DR   EnsemblGenomes-Tr; EBT00001768816.
DR   EnsemblGenomes-Tr; EBT00001768817.
DR   EnsemblGenomes-Tr; EBT00001768818.
DR   EnsemblGenomes-Tr; EBT00001768819.
DR   EnsemblGenomes-Tr; EBT00001768820.
DR   EnsemblGenomes-Tr; EBT00001768821.
DR   EnsemblGenomes-Tr; EBT00001768822.
DR   EnsemblGenomes-Tr; EBT00001768823.
DR   EnsemblGenomes-Tr; EBT00001768824.
DR   EnsemblGenomes-Tr; EBT00001768825.
DR   EnsemblGenomes-Tr; EBT00001768826.
DR   EnsemblGenomes-Tr; EBT00001768827.
DR   EnsemblGenomes-Tr; EBT00001768828.
DR   EnsemblGenomes-Tr; EBT00001768829.
DR   EnsemblGenomes-Tr; EBT00001768830.
DR   EnsemblGenomes-Tr; EBT00001768831.
DR   EnsemblGenomes-Tr; EBT00001768832.
DR   EnsemblGenomes-Tr; EBT00001768833.
DR   EnsemblGenomes-Tr; EBT00001768834.
DR   EnsemblGenomes-Tr; EBT00001768835.
DR   EnsemblGenomes-Tr; EBT00001768836.
DR   EnsemblGenomes-Tr; EBT00001768837.
DR   EnsemblGenomes-Tr; EBT00001768838.
DR   EnsemblGenomes-Tr; EBT00001768839.
DR   EnsemblGenomes-Tr; EBT00001768840.
DR   EnsemblGenomes-Tr; EBT00001768841.
DR   EnsemblGenomes-Tr; EBT00001768842.
DR   EnsemblGenomes-Tr; EBT00001768843.
DR   EnsemblGenomes-Tr; EBT00001768844.
DR   EnsemblGenomes-Tr; EBT00001768845.
DR   EnsemblGenomes-Tr; EBT00001768846.
DR   EnsemblGenomes-Tr; EBT00001768847.
DR   EnsemblGenomes-Tr; EBT00001768848.
DR   EnsemblGenomes-Tr; EBT00001768849.
DR   EnsemblGenomes-Tr; EBT00001768850.
DR   EnsemblGenomes-Tr; EBT00001768851.
DR   EnsemblGenomes-Tr; EBT00001768852.
DR   EnsemblGenomes-Tr; EBT00001768853.
DR   EnsemblGenomes-Tr; EBT00001768854.
DR   EnsemblGenomes-Tr; EBT00001768855.
DR   EnsemblGenomes-Tr; EBT00001768856.
DR   EnsemblGenomes-Tr; EBT00001768857.
DR   EnsemblGenomes-Tr; EBT00001768858.
DR   EnsemblGenomes-Tr; EBT00001768859.
DR   EnsemblGenomes-Tr; EBT00001768860.
DR   EnsemblGenomes-Tr; EBT00001768861.
DR   EnsemblGenomes-Tr; EBT00001768862.
DR   EnsemblGenomes-Tr; EBT00001768863.
DR   EnsemblGenomes-Tr; EBT00001768864.
DR   EnsemblGenomes-Tr; EBT00001768865.
DR   EnsemblGenomes-Tr; EBT00001768866.
DR   EnsemblGenomes-Tr; EBT00001768867.
DR   EnsemblGenomes-Tr; EBT00001768868.
DR   EnsemblGenomes-Tr; EBT00001768869.
DR   EnsemblGenomes-Tr; EBT00001768870.
DR   EnsemblGenomes-Tr; EBT00001768871.
DR   EnsemblGenomes-Tr; EBT00001768872.
DR   EnsemblGenomes-Tr; EBT00001768873.
DR   EnsemblGenomes-Tr; LACR_r0025-1.
DR   EnsemblGenomes-Tr; LACR_r0552-1.
DR   EnsemblGenomes-Tr; LACR_r0554-1.
DR   EnsemblGenomes-Tr; LACR_r0555-1.
DR   EnsemblGenomes-Tr; LACR_r1817-1.
DR   EnsemblGenomes-Tr; LACR_r2176-1.
DR   EnsemblGenomes-Tr; LACR_r2177-1.
DR   EnsemblGenomes-Tr; LACR_r2179-1.
DR   EnsemblGenomes-Tr; LACR_r2448-1.
DR   EnsemblGenomes-Tr; LACR_r2449-1.
DR   EnsemblGenomes-Tr; LACR_r2451-1.
DR   EnsemblGenomes-Tr; LACR_r2491-1.
DR   EnsemblGenomes-Tr; LACR_r2492-1.
DR   EnsemblGenomes-Tr; LACR_r2494-1.
DR   EnsemblGenomes-Tr; LACR_r2569-1.
DR   EnsemblGenomes-Tr; LACR_r2570-1.
DR   EnsemblGenomes-Tr; LACR_r2572-1.
DR   EnsemblGenomes-Tr; LACR_r2606-1.
DR   EnsemblGenomes-Tr; LACR_r2607-1.
DR   EnsemblGenomes-Tr; LACR_r2609-1.
DR   EnsemblGenomes-Tr; LACR_s1521-1.
DR   EnsemblGenomes-Tr; LACR_t0019-1.
DR   EnsemblGenomes-Tr; LACR_t0020-1.
DR   EnsemblGenomes-Tr; LACR_t0021-1.
DR   EnsemblGenomes-Tr; LACR_t0022-1.
DR   EnsemblGenomes-Tr; LACR_t0023-1.
DR   EnsemblGenomes-Tr; LACR_t0024-1.
DR   EnsemblGenomes-Tr; LACR_t0026-1.
DR   EnsemblGenomes-Tr; LACR_t0045-1.
DR   EnsemblGenomes-Tr; LACR_t0108-1.
DR   EnsemblGenomes-Tr; LACR_t0124-1.
DR   EnsemblGenomes-Tr; LACR_t0158-1.
DR   EnsemblGenomes-Tr; LACR_t0261-1.
DR   EnsemblGenomes-Tr; LACR_t0287-1.
DR   EnsemblGenomes-Tr; LACR_t0296-1.
DR   EnsemblGenomes-Tr; LACR_t0297-1.
DR   EnsemblGenomes-Tr; LACR_t0471-1.
DR   EnsemblGenomes-Tr; LACR_t0490-1.
DR   EnsemblGenomes-Tr; LACR_t0553-1.
DR   EnsemblGenomes-Tr; LACR_t0556-1.
DR   EnsemblGenomes-Tr; LACR_t0557-1.
DR   EnsemblGenomes-Tr; LACR_t0558-1.
DR   EnsemblGenomes-Tr; LACR_t0559-1.
DR   EnsemblGenomes-Tr; LACR_t0560-1.
DR   EnsemblGenomes-Tr; LACR_t0561-1.
DR   EnsemblGenomes-Tr; LACR_t0562-1.
DR   EnsemblGenomes-Tr; LACR_t0563-1.
DR   EnsemblGenomes-Tr; LACR_t0564-1.
DR   EnsemblGenomes-Tr; LACR_t0565-1.
DR   EnsemblGenomes-Tr; LACR_t0566-1.
DR   EnsemblGenomes-Tr; LACR_t0567-1.
DR   EnsemblGenomes-Tr; LACR_t0568-1.
DR   EnsemblGenomes-Tr; LACR_t0569-1.
DR   EnsemblGenomes-Tr; LACR_t0650-1.
DR   EnsemblGenomes-Tr; LACR_t0653-1.
DR   EnsemblGenomes-Tr; LACR_t0753-1.
DR   EnsemblGenomes-Tr; LACR_t1131-1.
DR   EnsemblGenomes-Tr; LACR_t1753-1.
DR   EnsemblGenomes-Tr; LACR_t1806-1.
DR   EnsemblGenomes-Tr; LACR_t1827-1.
DR   EnsemblGenomes-Tr; LACR_t2169-1.
DR   EnsemblGenomes-Tr; LACR_t2170-1.
DR   EnsemblGenomes-Tr; LACR_t2171-1.
DR   EnsemblGenomes-Tr; LACR_t2172-1.
DR   EnsemblGenomes-Tr; LACR_t2173-1.
DR   EnsemblGenomes-Tr; LACR_t2174-1.
DR   EnsemblGenomes-Tr; LACR_t2175-1.
DR   EnsemblGenomes-Tr; LACR_t2178-1.
DR   EnsemblGenomes-Tr; LACR_t2373-1.
DR   EnsemblGenomes-Tr; LACR_t2450-1.
DR   EnsemblGenomes-Tr; LACR_t2493-1.
DR   EnsemblGenomes-Tr; LACR_t2523-1.
DR   EnsemblGenomes-Tr; LACR_t2563-1.
DR   EnsemblGenomes-Tr; LACR_t2564-1.
DR   EnsemblGenomes-Tr; LACR_t2565-1.
DR   EnsemblGenomes-Tr; LACR_t2566-1.
DR   EnsemblGenomes-Tr; LACR_t2567-1.
DR   EnsemblGenomes-Tr; LACR_t2568-1.
DR   EnsemblGenomes-Tr; LACR_t2571-1.
DR   EnsemblGenomes-Tr; LACR_t2604-1.
DR   EnsemblGenomes-Tr; LACR_t2605-1.
DR   EnsemblGenomes-Tr; LACR_t2608-1.
DR   EuropePMC; PMC2519355; 18539796.
DR   EuropePMC; PMC2639077; 19129208.
DR   EuropePMC; PMC2827410; 20078865.
DR   EuropePMC; PMC2962554; 20847124.
DR   EuropePMC; PMC3187148; 21803900.
DR   EuropePMC; PMC3208561; 22073223.
DR   EuropePMC; PMC3569286; 23405300.
DR   EuropePMC; PMC5372332; 28356072.
DR   EuropePMC; PMC6458302; 31019500.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01743; leu-phe_leader.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000425.
DR   SILVA-SSU; CP000425.
DR   StrainInfo; 348311; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2662180
CC   Source DNA and bacteria available from Bart Weimer
CC   (milkbugs@cc.usu.edu)
CC   Contacts: Bart Weimer (milkbugs@cc.usu.edu)
CC             Larry McKay (lmckay@umn.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Annotation done by Kira Makarova and Eugene Koonin
CC   Finishing done by Fidelity Systems Inc. (Gaithersburg)
CC   http://www.fidelitysystems.com
CC   Project Information available at:
CC   http://genome.jgi-psf.org/mic_home.html
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2438589
FT                   /organism="Lactococcus lactis subsp. cremoris SK11"
FT                   /sub_species="cremoris"
FT                   /strain="SK11"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:272622"
FT   gene            144..1508
FT                   /locus_tag="LACR_0001"
FT                   /note="LactoCOG number LaCOG00001"
FT   CDS_pept        144..1508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0001"
FT                   /product="ATPase for DNA replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71638"
FT                   /db_xref="GOA:Q033I4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q033I4"
FT                   /protein_id="ABJ71638.1"
FT                   /translation="MASLNENQKFWARVTELARQSIGKQAYDFFIEPAQLMSVEQDTAN
FT                   ILLDSGMKKDYWKKQSDLITTAGFEVFGRMIDYELYANDELTDIELRRLNNQSPVDEPL
FT                   SVAKPTSPLVSGLNEKYNFENFVQGPGNRWTLAAAIAVADKPGDTYNPLFIYGGAGLGK
FT                   THLMHAIGNQILTDNPTARIKYVSSENFVNDYVNATRKNQMESFENTYRNLDLLLLDDV
FT                   QFFSDKEGTKNEFFNTFNALYDKGSQIVLTSDRIPQELNNLEDRLVSRFSWGLTTDITA
FT                   PDYETRMAILLIKSESSHLEFPSETLSYIAGQIDSNVRELEGALNRVEFVARANGISIV
FT                   DIETASQALRSLKNATQQSLSNLTIKKIQDEVANYYHISFSDLVGPKRPKEIAFPRQIA
FT                   MYLVRELLGTSLPAIGTAFGGRDHTTVMYAYKQISDKMKNDMDVQKDIDSIKRKF"
FT   gene            1665..2807
FT                   /locus_tag="LACR_0002"
FT                   /note="LactoCOG number LaCOG00002"
FT   CDS_pept        1665..2807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71639"
FT                   /db_xref="GOA:Q033I3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q033I3"
FT                   /protein_id="ABJ71639.1"
FT                   /translation="MIKFSINKTAFQNALKITKQAIGSKVTIPALTKLKIEVEEKGITL
FT                   IGSNGQISIKNFLPADNKDASMLISGTGSVLLEAAFFENVVSQLPEVTLDFIEKEQKQV
FT                   LLTSGKSEITLKGLDSEIYPHLQEISEGSSLKMKVKVLKEIFTETVFAVSTQENRPIFT
FT                   GVHLETLSTGELKAVATDSHRMSQRLLPLEDTDLKFDVILPSKSINSFKNVFTNDEEEI
FT                   EIFISGSQMLFQNETISYYSRLIEGSYPDTNRLIPNEADYTLDLVFDAAQLRHTMDRAR
FT                   LLTIMTTNGTVKLTVSGDSVVTTANSPEVGSVHEELTALSKEGNDLSISFNPEYLIDAL
FT                   KVIKAPEVRIRFISNIRPFTLQPRNEESGFVQLITPVRTN"
FT   gene            2913..6212
FT                   /locus_tag="LACR_0003"
FT                   /note="LactoCOG number LaCOG00003"
FT   CDS_pept        2913..6212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0003"
FT                   /product="DNA helicase/exodeoxyribonuclease V, subunit B"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71640"
FT                   /db_xref="GOA:Q033I2"
FT                   /db_xref="InterPro:IPR014141"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q033I2"
FT                   /protein_id="ABJ71640.1"
FT                   /translation="MEILYTEITQDLTEGLLEIALEELEKNRKVYYIVPSSMSFEKEKE
FT                   ILERLAKGSDTAVFYLLVTRFKQLPYYFDKREKATMKTELGTVGLSMLFRRILRSFKKD
FT                   EIPLYFSLQDSAGFLEMLIQLRAELLTANLSVENLPDNPKNQELKKILTTFEAELSVEY
FT                   ANYSEFGDFTNRLADGEFDQQLKDVTIIIDGYTRFSAEEELFIESIQEKVARFVVGTYS
FT                   DENSLTAGSETIYVGTSQMITRFRNKYPVELRKIASSSVNEVYSKLTRMLDLDSRFVIT
FT                   DEKIELKAEDEKYFRIWEAENQKVEIERVAKEIRQKISQGAFFKDFTVLVGDPAAYEIT
FT                   LKEIFDLYEIPFFYAQEESMSQHPLVIFFESLFAIKKNNYRTDDVVNLLKSKVYTDVNL
FT                   DEEVIDYFEYYVQKYKISGRKKFTEEFIESEFSQIELVNEMREKLLGSESPLQVFLGNN
FT                   RQKTGKKWVSDLQALLENGNVMANMNAYFSAAELQNEHQMADKHEQVWQMLISTLNEFF
FT                   AVFSDEKLKSVEFLDILLAGLKNAKYRQIPANVDVVNVKDYELVEPKTNNYIYAIGLSQ
FT                   TNFPRIKKNSTLLSDEERLEINQTTDENQFIEQLNVANYQKNQFTVLSLINSAKESLVL
FT                   SMPQIMTNEQGEFSPVFQLFLKDADEKILQKIQGVNLFESLEHIGNSRSVIAMIGQIER
FT                   ELVESEETNEDKRVFWSSIFRILVKSNADFQKILLDLAKDIDTVNLAPDTLEQIYGDKI
FT                   YASVSSFERFYNCEYQYFLENTLSLETFENIDINSKIVGNFFHEVFEKVMKETDLSAEN
FT                   FDEKLTLFLQEVDKNYSRYFTQDATARFTWSNLEEIVRQTATVLKATVSTDELKTLLTE
FT                   SSFGLSKSELGNFSVDDIYLRGRIDRLDQLSTDYLGVIDYKSSAHSFKLQEAYDGLSLQ
FT                   FMTYLDVIKQAFPNQKIWGALYLQFKNQPINLSEINQLSEIANILKESMRYDGLVLEDA
FT                   AEQIKGIENIALKNTNSYNEEEFEQLLKLNEEHYRAAGQRLKNGKIAINPIMKRSEGID
FT                   QSGNVRGCRYCPLKSICRFEANIHMNEHSREIGQKSQAEILAELKGEGRDE"
FT   gene            6205..9816
FT                   /locus_tag="LACR_0004"
FT                   /note="LactoCOG number LaCOG00004"
FT   CDS_pept        6205..9816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0004"
FT                   /product="DNA helicase/exodeoxyribonuclease V, subunit A"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71641"
FT                   /db_xref="GOA:Q033I1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q033I1"
FT                   /protein_id="ABJ71641.1"
FT                   /translation="MSEVKLTPEQNEAIHSSGKNILVSASAGSGKTFVMAQRIVEKVKQ
FT                   GIEIDRLFISTFTKKAASELRMRLERDLKKARQESSDDEEAHRLTLALHNLSNADIGTM
FT                   DSFTQKLTKANFNRVNIDPNFRILADQTESDLIRQEVFEQLVESYLSADESLNISKDKF
FT                   EKLIKNFSKDRNILGFQKVVYTIYRFASATENPISWLENQFLKGFETYKSLTDLSEDFT
FT                   VNVKENLLTFFELLENSLTNGVIAKKGAGRDKANLILDNKNELLEAISKKDFVTFTALF
FT                   LSIDTDIRVGSSKDETLSALKKDFSAQKQDLVGSKSKPGELRKFVDKIKHGQLIEKYQK
FT                   QAFEIASDLQKFIIEFYKTYLERKKNENAFEYSDIAHFAIEILEENPDIRENLREHYDE
FT                   IMIDEYQDTSHTQERMLELLSNGHNLFMVGDIKQSIYGFRLADPGLFLEKYKSYDQAEN
FT                   PNQLIRLKENFRSRGEVLNFTNDIFKHLMDEKLGEMTYGKEKALVQGNISDYPVEAEKD
FT                   FYPELLLYKENTSEEEIEDSEVKISDGEIKGAAQEIKKLIESGVEPKDIAILVRSKSNN
FT                   NKIEDILLSYDIPVILDEGRVDFLKSMEVLIMLDILRAIDNPLYDLSLVAMLRSPLFGF
FT                   NEDELTRISVQGSRDLRFWDKILLSLKKEGKNPELINLSLEQKLKAFNQKFTEWRKLVN
FT                   QIPIHRLLWKIYTETYYFDYVGALKNGEMRQANLQALSVRAESYESSGYKGLFKFVRLI
FT                   NKFMEQNNDLASVNIKLPQNAVRVMTFHKSKGLEFDYVFLMNLQSRFNDRDLKEDVILS
FT                   REHGLGMKYIADLKAEPDVITDFPYALVKMETFPYMVNKDLKQRAALSEEMRVLYVAFT
FT                   RAKKKLYLVGKIKDTDKKAGLELYDTATLEGKILSDKFRNSSRGFQHWILALQNATKLP
FT                   MKLNVYTKDELETEKLEFTSQPDFKKLVEESEKFDNIMSFSDEIKEAQKIMNYQYPHQA
FT                   ATELSSIQTPSQVKKRSYEKQLQVGEVQPVSEFVRVKNLDFSDFGSKKITAAEIGSATH
FT                   SFMQYADFSQADLFSFQATLDEMGFDEKIKNQIDITKILTLFDTEFGKFLSENVDKTVK
FT                   EAPFSMLRTDEFAKEQYIVRGICDGFVKIADKIILFDYKTDRFTNVSAISEIKERYKDQ
FT                   MNLYSEALQKAYHVNQIDKYLILLGGPRKVFVEKLDD"
FT   gene            9851..10051
FT                   /locus_tag="LACR_0005"
FT                   /note="LactoCOG number LaCOG00005"
FT   CDS_pept        9851..10051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71642"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:Q033I0"
FT                   /protein_id="ABJ71642.1"
FT                   /translation="MLDYKIGSIVEMKKPHACTVKATGKKANAWEITRLGADIKIKCTN
FT                   CNHEVMMSRFDFNKKIKKVLK"
FT   gene            complement(10059..10616)
FT                   /locus_tag="LACR_0006"
FT                   /note="LactoCOG number LaCOG00006"
FT   CDS_pept        complement(10059..10616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0006"
FT                   /product="Transcriptional regulator, xre family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71643"
FT                   /db_xref="GOA:Q033H9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q033H9"
FT                   /protein_id="ABJ71643.1"
FT                   /translation="MLGENLQKARLSKNLTQEEVAKELYFSRQAISRWESNKTEPNLET
FT                   LIALAELYDSDLLAFAKGIEPQKRKKHINLFAGFGLLFFNFVLGVWLIIATALILLAFY
FT                   AIVLALFLAPFIMIFAVLTHNPHITFGNVTGATGFNWPYWVIAIIACSLMVLVSPFIWR
FT                   FTKLLYFWLLKYLKFNLKSVYN"
FT   gene            10900..12015
FT                   /locus_tag="LACR_0007"
FT                   /note="LactoCOG number LaCOG00007"
FT   CDS_pept        10900..12015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0007"
FT                   /product="Predicted GTPase, probable translation factor"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71644"
FT                   /db_xref="GOA:Q033H8"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q033H8"
FT                   /protein_id="ABJ71644.1"
FT                   /translation="MALTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGMVE
FT                   VPDERLNKLTELIKPKKTVPTTFEFTDIAGIVKGASRGEGLGNKFLANIREVDAIIHVV
FT                   RAFDDENVMRENNREDAFIDPMADIETINLELILADLESVNKRYARVEKIARTAKDKDA
FT                   VAEFNVLKKLKPVLEDGKSARTIDFDEDETKVLKSLFLLTSKPVLYVANVSEDEVGEPD
FT                   NIEYVKQIRDFAATENAEVAVISARVEEEISELEDDEKAEFLEAIGLKESGVDMLTRAA
FT                   YHLLGLATYFTAGEKEVRAWTFKRGMKAPQMAGIIHTDFEKGFIRAVTMSYDDLLKYGS
FT                   EKAVREAGRLREEGKEYVGQDGDIMEFRFNV"
FT   gene            12127..12450
FT                   /locus_tag="LACR_0008"
FT                   /note="LactoCOG number LaCOG00006"
FT   CDS_pept        12127..12450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0008"
FT                   /product="Transcriptional regulator, xre family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71645"
FT                   /db_xref="GOA:Q033H7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q033H7"
FT                   /protein_id="ABJ71645.1"
FT                   /translation="MEISEIIKENRKLKNLSQEELAKELHISRQSILKWETGKSLPTTD
FT                   QLILLSEIFDCSLDTLLKGDKKMEEKVKHEIDDKRTLKLIYKVGWGFIVPLLFILKFVL
FT                   HLF"
FT   gene            12882..13856
FT                   /locus_tag="LACR_0009"
FT                   /note="LactoCOG number LaCOG01500"
FT   CDS_pept        12882..13856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71646"
FT                   /db_xref="UniProtKB/TrEMBL:Q033H6"
FT                   /protein_id="ABJ71646.1"
FT                   /translation="MVLAKNKKIMISTISLVILSLVCFKENLPAQASTKSLDTGESFTE
FT                   VYNKDNGFYLNSPFYDISKVSKSFYVGESGTINQVKVLPIYNMTPKSSVNFYQNTATNN
FT                   LIGATLPSLFTGAIALTQAGQYTAQKAGTATVALTYMLSSDFKKELLSKYPDAWTNIAP
FT                   ASYGSPDFMYAKYSNQTFYVTIKEHTVPLYRMYNPNSGEHFYTENSFERDSLVKAGWNY
FT                   EGVAEESPIKTVYNQAVYRVYNPNAGDHFYTENKAEVAHLVSLGWRAEGIAFYSSTSNE
FT                   TPIYRLYNPNATVGTHFYTQSSVERDSLVRAGWHYEGTAWYGG"
FT   gene            14033..14599
FT                   /locus_tag="LACR_0010"
FT                   /note="LactoCOG number LaCOG00008"
FT   CDS_pept        14033..14599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0010"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71647"
FT                   /db_xref="GOA:Q033H5"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q033H5"
FT                   /protein_id="ABJ71647.1"
FT                   /translation="MTKMIVGLGNPGDKYEKTKHNMGFMALDLLANELNVDFKEEKPFM
FT                   SLVASTFVNGEKLFLVKPLTFMNESGRAVAPLLKYYNIDEADLTVMHDDLDSPVGRVRL
FT                   RQKGSSGGQNGIKSVITHVGSQTFNRVKIGIGRPKHGMTVVNHVLSGFDNEDKEIAQDG
FT                   IFKAVDAMKFYLENGDFQKTMNKFN"
FT   gene            14600..18088
FT                   /locus_tag="LACR_0011"
FT                   /note="LactoCOG number LaCOG00009"
FT   CDS_pept        14600..18088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0011"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71648"
FT                   /db_xref="GOA:Q033H4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q033H4"
FT                   /protein_id="ABJ71648.1"
FT                   /translation="MNIIEFFDQNWQLQKWQQGFSKRERTLLTGLSGTAKSLVMANAYE
FT                   NVAEKYIIVTDSQFHANELYDELSTLLGEEKVFQFFSDDNIYAEFALASKDRVAYRLEA
FT                   LNFLLDEKSTGFLVVPFLALRSYLPSPENFLENYLLLTSGDEYDLSNLVNLLSNAGYEK
FT                   TQRVMTPGEFSMRGDIVDIYPLDAENPVRLEFFGDEVDTIRSFDVESQRSLTSLERLEI
FT                   YPASDFILTDNEFDKGAKSLTEMTNLLTDPSAKSYMEEVISAAQNHYYHKDLRKFAEYF
FT                   YDKKTSLLNYFPKNVQIFIDDFQKVNEINNKLEMELADFILSEKAMERGFEGQTYLLDT
FT                   MAKVRNYKPATFFSNFQKGLGNLRFEQLYNFKQHSMQQFFGQLELFYTEVERFIKQEFT
FT                   VVLAVSSEKLRKSLHELDLSLQEVDRESIQVGKVNLIDLQLSNGFNFLDEKLVVMTEHE
FT                   IFGKMRKKKARKLNITNAERLKDYNELAVGDFVVHKNHGIGKYLGLQTLEVGGMHRDYL
FT                   TIQYQNGDTISVPVDHLDLLSKYTAGEGKSPKINKLNDGRWRKTMSSVSKQVEDISDDL
FT                   IKLYAERQAKKGFAFSPDDASQEEFDSGFSYVETEDQIRSINEIKHDMELERPMDRLLV
FT                   GDVGFGKTEVAMRAAFKAINDGKQVAVLVPTTVLAEQHFNNFTERFINFGVNVEVLSRF
FT                   QTKTQQTEILAKLKKGRVDLIIGTHRLLSKDVEFFDLGLMIIDEEQRFGVKHKERLKEL
FT                   KTQVDVLTLTATPIPRTLHMSMLGIRDLSVIETPPTNRYPVQTYVMETNYGVVRDAILR
FT                   EISRGGQVYYVYNRVDTIEQKVSQLEELIPEARIGFIHGQMTEVQLENTLLAFIAGDYD
FT                   VLVATTIIETGVDIPNSNTLFIENADMMGLSQLYQLRGRVGRSNRVAYAYFMYRPEKIL
FT                   SEVSEKRLEAIKGFTELGSGFKIAMRDLSIRGAGNLLGSEQSGFIDSVGFDLYSQLLEE
FT                   AIHTKLGTSKQKRTSNVEISLELDAFIPAYYISDERQKIEIYKRIRQIDSREIYEELQE
FT                   ELVDRFGEYPDEVAYLLEIGLLKHFADNALVEKIEKSRFEITVTLEKVANTTYDPQDYF
FT                   KALAKTSMKASVGEKYGKMTFRLKIENRNSVVLLSEIMNFVEELSTIRDSYDKVR"
FT   gene            18405..18674
FT                   /locus_tag="LACR_0012"
FT                   /note="LactoCOG number LaCOG00010"
FT   CDS_pept        18405..18674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0012"
FT                   /product="Ribosome-associated heat shock protein implicated
FT                   in the recycling of the 50S subunit (S4 paralog)"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71649"
FT                   /db_xref="GOA:Q033H3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q033H3"
FT                   /protein_id="ABJ71649.1"
FT                   /translation="MRLDKFLKVSRLIKRRPVAKEVADKGRIKINGKLAKSSSDVKFND
FT                   TIEIRFGNKIVEVRVTELKEFTRKEDADKMYELISETRITEEIE"
FT   gene            18705..19079
FT                   /locus_tag="LACR_0013"
FT                   /note="LactoCOG number LaCOG00011"
FT   CDS_pept        18705..19079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0013"
FT                   /product="Septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71650"
FT                   /db_xref="GOA:Q033H2"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:Q033H2"
FT                   /protein_id="ABJ71650.1"
FT                   /translation="MAKQVIQLNNKYSQNQKKRNLTVVPKRKHLGLILIVAILLFSLTS
FT                   MSLIKSYETLHKQVALEQNAKKQYESLSKEVTIKKAEINKLQDPNYLQKFARSDGQEYS
FT                   QSDEKVFTTDSPLIGNNGSN"
FT   gene            19079..19402
FT                   /locus_tag="LACR_0014"
FT                   /note="LactoCOG number LaCOG02365"
FT   CDS_pept        19079..19402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71651"
FT                   /db_xref="GOA:Q033H1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q033H1"
FT                   /protein_id="ABJ71651.1"
FT                   /translation="MIGQVENITRFGLFVKISADELTDEIKKSTDKTVSKNSGLLRWSQ
FT                   FPKNHPKVQIGDLIGVEVFKVHEDGKIDLNYQEKNFKNVYAEFLESSQQRITELEQKNR
FT                   ELN"
FT   gene            19543..20880
FT                   /locus_tag="LACR_0015"
FT                   /note="LactoCOG number LaCOG00012"
FT   CDS_pept        19543..20880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0015"
FT                   /product="Beta-lactamase class A"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71652"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR025987"
FT                   /db_xref="UniProtKB/TrEMBL:Q033H0"
FT                   /protein_id="ABJ71652.1"
FT                   /translation="MLGKVLIMQKQRIKINSGVALVMLLMIIPGFFAFPQSRYFADKAV
FT                   SKPKNIVVADKVTEKETWDSIPPRAVALQDLELYEDEQLTKSVGKLSAKTQLDISEIAG
FT                   KAFKLKDGKYILDDKKNIISDVTISRENTNRTIYTNKSVNVFYNPVTTYDNQVMTRLNG
FT                   THQILADKIAKTNWGTYYEISLESGQKGWVSEDDISLENPKIQQVQTLLNKKYNDKKYS
FT                   IYVKELNDKFTAGVNQNQEMYSASLSKIPILYWTQKRLNEGLASLDDKLLYTPAINTFY
FT                   GSYKPEGTGNLPKTADNKYYSLQDIINRTAKLSDNVGSNMLAYYETQEFNPNYQKEINK
FT                   IAGQEWNPKERNASAQMVGKMLEALYNEGGASFNALFDTDFDDVKIKAAIPKNVPVAHK
FT                   IGGADTDNHDAAIIFTSEPYLLVIETNGGSDDEIKNISQDVYGVMK"
FT   gene            20877..22145
FT                   /locus_tag="LACR_0016"
FT                   /note="LactoCOG number LaCOG00013"
FT   CDS_pept        20877..22145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0016"
FT                   /product="tRNA(Ile)-lysidine synthetase, MesJ"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71653"
FT                   /db_xref="GOA:Q033G9"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q033G9"
FT                   /protein_id="ABJ71653.1"
FT                   /translation="MTPAQLKFLKIVTKEKYFAENSKILLALSGGKDSMTLFNWLYELR
FT                   AKLHIELGIAHINHGLRPESDFEEQSLRKMASDLEIPIFVDRFSGEFTEQKAREFRYHF
FT                   FEKIMIAENYDVLLTAHHQGDVVETVLMRQITGRPLRSLQGIADCQPFAKGQLIRPLLK
FT                   FTKEELDAAVFYEDSTNQGVDYFRNRIRNQLIPELTKENPQFSQAISDLSSEIKMALTV
FT                   INQRISELEIIDEKISYHKFISQTKELQHFILQAFFAQYPEIKVSKKKFEEILHIIRRP
FT                   QQYSAQLNKDFQFVKTKDHFYIEKRKLITASLEILSENPNDTSFMEVYLPLEGQLEIRK
FT                   RQPGDQILINGHHKKLRKFFIDNHVPLQARENPLIFVEKKLYAIVGVACSDLSKALKND
FT                   KIRRILWVKPSIGEEINDARKKS"
FT   gene            22126..22677
FT                   /locus_tag="LACR_0017"
FT                   /note="LactoCOG number LaCOG00014"
FT   CDS_pept        22126..22677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0017"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71654"
FT                   /db_xref="GOA:Q033G8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q033G8"
FT                   /protein_id="ABJ71654.1"
FT                   /translation="MLEKNLDKAIEKVLVSEEEIIEKSKELGEILTKEYEGKNPLVLGI
FT                   LRGSVPFLAELIKHIDCHLETDFMTVSSYHGGTKSSGEVKLILDVDTAVKGREILIVED
FT                   IIDTGRTLKYLKELLEHRGANVKIVTLLDKPEGRIVEIKPDYSGFTIPNEFVVGFGLDY
FT                   EENYRNLPYVGVLKPEVYSK"
FT   gene            22883..24970
FT                   /locus_tag="LACR_0018"
FT                   /note="LactoCOG number LaCOG00015"
FT   CDS_pept        22883..24970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0018"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71655"
FT                   /db_xref="GOA:Q033G7"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q033G7"
FT                   /protein_id="ABJ71655.1"
FT                   /translation="MNNNKQPRQGNFVKNILMWVILAIVVVVGFNFFFSSNQSGVDKIS
FT                   YSQLMTKLDDNNIENVTMQPSDSLITVTGEYKKPVKVKGKNNFPLLGNTTSEVKNFQAY
FT                   IIPTDSVVKDIQNAAKSNDVKLSVVQASSSGMWVQILSYIIPMILFVGIFWLMMGGMGA
FT                   RGGGGGGNPMSFGKSRAKQQDGKTSKVRFADVAGSEEEKQELVEVVDFLKNPKKYHDLG
FT                   ARIPAGVLLEGPPGTGKTLLAKAVAGEAGVPFYSISGSDFVEMFVGVGASRVRDLFENA
FT                   KKTAPSIIFIDEIDAVGRQRGAGLGGGNDEREQTLNQLLVEMDGFQDDGNSVIVIAATN
FT                   RSDVLDPALLRPGRFDRKVLVGAPDVKGREAVLKVHAKNKPLASDVDLHTVATQTPGYV
FT                   GADLENVLNEAALVAARQNKKEINAADIDEGMDRAMAGPAKKDRIQSMREREIVAYHEA
FT                   GHAIVGLVLENGSTVRKVTVVPRGRIGGYMLALPDEEIMQPTNLHLQDQLASLMGGRLG
FT                   EEIVFGVATPGASNDIEKATHIARSMVTEYGMSKKLGMVSYEGDHQVFIGRDYGQTKTY
FT                   SEATAVMIDDEVRRILGEAYDRAKEAIETHREQHKAIAQALLKYETLDAKQIMSLFTTG
FT                   KMPDEAAASEVPEPKTFEESLKDANANVDDFSNINIYNGEEKTDSKPEENKEKSEDETA
FT                   N"
FT   gene            25190..25261
FT                   /locus_tag="LACR_t0019"
FT                   /note="tRNA_Glu_TTC"
FT   tRNA            25190..25261
FT                   /locus_tag="LACR_t0019"
FT                   /product="tRNA-Glu"
FT   gene            25267..25356
FT                   /locus_tag="LACR_t0020"
FT                   /note="tRNA_Ser_TGA"
FT   tRNA            25267..25356
FT                   /locus_tag="LACR_t0020"
FT                   /product="tRNA-Ser"
FT   gene            25367..25440
FT                   /locus_tag="LACR_t0021"
FT                   /note="tRNA_Met_CAT"
FT   tRNA            25367..25440
FT                   /locus_tag="LACR_t0021"
FT                   /product="tRNA-Met"
FT   gene            25446..25518
FT                   /locus_tag="LACR_t0022"
FT                   /note="tRNA_Phe_GAA"
FT   tRNA            25446..25518
FT                   /locus_tag="LACR_t0022"
FT                   /product="tRNA-Phe"
FT   gene            25530..25600
FT                   /locus_tag="LACR_t0023"
FT                   /note="tRNA_Gly_TCC"
FT   tRNA            25530..25600
FT                   /locus_tag="LACR_t0023"
FT                   /product="tRNA-Gly"
FT   gene            25615..25688
FT                   /locus_tag="LACR_t0024"
FT                   /note="tRNA_Ile_GAT"
FT   tRNA            25615..25688
FT                   /locus_tag="LACR_t0024"
FT                   /product="tRNA-Ile"
FT   gene            25709..25791
FT                   /locus_tag="LACR_r0025"
FT   rRNA            25709..25791
FT                   /locus_tag="LACR_r0025"
FT                   /product="5S ribosomal RNA"
FT   gene            25813..25886
FT                   /locus_tag="LACR_t0026"
FT                   /note="tRNA_Asn_GTT"
FT   tRNA            25813..25886
FT                   /locus_tag="LACR_t0026"
FT                   /product="tRNA-Asn"
FT   gene            26036..27859
FT                   /locus_tag="LACR_0027"
FT                   /note="LactoCOG number LaCOG01578"
FT   CDS_pept        26036..27859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0027"
FT                   /product="Phosphotransferase system, mannitol-specific IIBC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71656"
FT                   /db_xref="GOA:Q033G6"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q033G6"
FT                   /protein_id="ABJ71656.1"
FT                   /translation="MTDTVSLKVRVQKLGTALSNMVMPNIPVLIAWGVLTMFFIPDGFT
FT                   PNKTFAAMVSPMLAFLIPLMIGYTGGKNIYELRGGVVGAIATFGSIIATASISVGGLNA
FT                   KGNVPMILGAMILGPFGAWLIKKFDEYIQPHIKAGLEMLINNFSAGLVGFGLSLFAVKV
FT                   VGPLVAWLTDVMGHGVDFLISNHLIPLANLFIEPAKILFLNNVINQGILSPLGIQQVSE
FT                   NGKSLLFLLEANPGPGLGILIAFMLFGKGSAKATAPGAILIQFVGGIHEIYFPYVMMKP
FT                   ALFFAVMAGGVSGTLTNNLLGSGLAAPASPVSIIAITGMASGKSAGGFANVLCVWAGIA
FT                   VAAIVSFLVAAFILKRDKSMIDDSAFENAKVGVATDKAVSKGQDSVSNIVTDRVDFSAI
FT                   KHIIFACDAGMGSSAMGASILRNKVKKAGLGQDVTNVAIANLKAGFDTIVVTQEELAPR
FT                   AATMAPDAHRYSVANFLNSPRYDEIISNLMNTDEAVSEPIIADDLVSREEIDLNQIDEV
FT                   VFAHDGLHIGSSTMGKETLQAIFSRHDVKIPISDVEFIGLGAFNAKNIMIVTKEEFTTV
FT                   AKQKAPNAQHLSVESLITTPEYINMVNRMNK"
FT   gene            27919..29853
FT                   /locus_tag="LACR_0028"
FT                   /note="LactoCOG number LaCOG00016"
FT   CDS_pept        27919..29853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0028"
FT                   /product="transcriptional antiterminator, BglG family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71657"
FT                   /db_xref="GOA:Q033G5"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013199"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:Q033G5"
FT                   /protein_id="ABJ71657.1"
FT                   /translation="MFLTSREQKLIHTFLKRGTLTIPEMMEITGTSRRTLYRDLNNLQK
FT                   SLPEEISLQTSEEGYFIKGDIKQLSQAHELVEYTMTERLYGEILLLIENKASILSLTDY
FT                   FGISQPTVTNDLRQLEQTLLENEISLIRERGLKIEGLEENIRSVFVAAIYNSASLQELI
FT                   SNQLSDNKLLSILDLDKFKQAYDAFESLILPEDMTDKVRVLMELFLVTTLIRIDEGHFI
FT                   TSESLSSPSKGALNFVNKLLTALSVTKFVVSEITYLASVYEILYFGFGRELLFMEKFDT
FT                   DFSYKIRQIIDRVSTKLEIEFGKDDRLYGLLYAHLKESEMLPILFPKKENDFIKKIKKD
FT                   NPEIYKAVNESLKLIFDKNFSEMEITFVTLHFVSTLERSDLVLPLRSALVSNRGRISCE
FT                   FVMSNLRKNFPFLKKIDLIQNSVKVVKSQYDVIFTTEKEFDYLYINPMLDQKNLDDIRH
FT                   QLRHIQQKSRTLTIDSKEQRNFLNLNDLFTTGNEILSTFEIKTLSNQPNLSDTVKQIAK
FT                   TVNEDDGELAELIEARFRETHLAIPETNIALFHAVHSSISSPLFKIYELSQEIEGMAMD
FT                   HQMIKINRVLLLLAPPEVPEYVSYLLGKLSSSIIENKLYTRIYDSGNYEIVSELLREII
FT                   IEAVKQYGD"
FT   gene            29900..30331
FT                   /locus_tag="LACR_0029"
FT                   /note="LactoCOG number LaCOG00017"
FT   CDS_pept        29900..30331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0029"
FT                   /product="PTS system D-mannitol-specific IIA component, Fru
FT                   family"
FT                   /note="TC 4.A.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71658"
FT                   /db_xref="GOA:Q033G4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q033G4"
FT                   /protein_id="ABJ71658.1"
FT                   /translation="MEIQKDLIKINQNFSNKEEAINYCGKLLVDGGYVNSNYVSAMLDR
FT                   DKELSVYMGNFIAIPHGTDSAKKEVLKTGVIIVQVPRGVNFGTEENPKLATMLFGIAGI
FT                   EDEHLDLIQKISIFCADVDNVVKLADAQSVEEIAKYFEN"
FT   gene            30480..31646
FT                   /locus_tag="LACR_0030"
FT                   /note="LactoCOG number LaCOG00018"
FT   CDS_pept        30480..31646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0030"
FT                   /product="D-mannitol 1-phosphate 5-dehydrogenase"
FT                   /EC_number="1.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71659"
FT                   /db_xref="GOA:Q033G3"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q033G3"
FT                   /protein_id="ABJ71659.1"
FT                   /translation="MKKAVHFGAGNIGRGFIGEILSKNGFEIYFVDTNKAIIDELNTRH
FT                   SYEIGIASSSPEKISVSGLFGINNGENPEDVIEAIAQADIVTKAIGPNILPYIAELVAK
FT                   GIQKRKEENKQVQIDIIACENMIGGSEFLEKKVAEYLSDSDKVYLANYIGFPNAAVDRI
FT                   VPGQKHEDLLYVEVEPFCEWVIDESQIKNKSFKLEGVHYANNLEPFIERKLFSVNSGHA
FT                   TVAYSSAYKGYKIILEGLQHKEILSALKGVQKETRALLLAKWPQYFTEEDLMSYHQMII
FT                   SRFANPKIIDEVTRVARTPIRKLGYDERFIRPIRELNERGLSYQNHLDIVGKIFAYQDE
FT                   NDSQSVQLQEKLSTMDLQRLIEEVTGLSNKKIILEIELVIKKYKNDSK"
FT   gene            31752..32015
FT                   /locus_tag="LACR_0031"
FT   CDS_pept        31752..32015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71660"
FT                   /db_xref="UniProtKB/TrEMBL:Q033G2"
FT                   /protein_id="ABJ71660.1"
FT                   /translation="MCELFHFFDRLYLYCIGVHETFGSVIPRTKVGEADAKREHPPSVL
FT                   AGSIHGGAHGIQSVFFCVLVKPQKPVKFFNRFFEKMMSTKSQ"
FT   gene            complement(32064..32333)
FT                   /locus_tag="LACR_0032"
FT   CDS_pept        complement(32064..32333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71661"
FT                   /db_xref="UniProtKB/TrEMBL:Q033G1"
FT                   /protein_id="ABJ71661.1"
FT                   /translation="MIILFINSINFHACFFNFCIEGEKTEKIDFIIFKSEKKRLKSLFP
FT                   FFYSDFFRNTVIKIAAISFLKSKSLTHRKSKIILLQEPKKAAYQ"
FT   gene            complement(32305..33135)
FT                   /locus_tag="LACR_0033"
FT                   /note="LactoCOG number LaCOG01138"
FT   CDS_pept        complement(32305..33135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0033"
FT                   /product="alpha/beta hydrolase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71662"
FT                   /db_xref="GOA:Q033G0"
FT                   /db_xref="InterPro:IPR010315"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q033G0"
FT                   /protein_id="ABJ71662.1"
FT                   /translation="MNRGRKNKTQKLIIITMILVLVLSLILSYGSIKYKSEQKTAQNQV
FT                   PFILIPGTGANGDRFDSFMNKLMKKVGKRDVLKINVKTDGTTQYTSSLTKKSNNPFIVI
FT                   SFSDSSEKGVDKQAEWTEIAMKKAHQLYSFKAYNALGHSNGGLVWTIFLEKEAQKPTSQ
FT                   MKNLITLGTPYNYLDPKANPYPDRASLTETDMLKRMVNKREKIPHNLKMISIAGNYKDN
FT                   SDGVVPLTSSLSSSKIYKKEIDSYSEKIVSGSNAQHDQLTENQEIIDYIVHKFY"
FT   gene            33891..34142
FT                   /locus_tag="LACR_0034"
FT                   /note="LactoCOG number LaCOG03050"
FT   CDS_pept        33891..34142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71663"
FT                   /db_xref="UniProtKB/TrEMBL:Q033F9"
FT                   /protein_id="ABJ71663.1"
FT                   /translation="MVVVFNKSGILTLPITPMGKIEGDIIIIPQEEIQSVTFKKGLLAY
FT                   KMVVTTKDNEVPDFRVNKTMIGYGAQKKELGSLLEKYK"
FT   gene            34547..34849
FT                   /locus_tag="LACR_0035"
FT                   /note="LactoCOG number LaCOG02692"
FT   CDS_pept        34547..34849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71664"
FT                   /db_xref="UniProtKB/TrEMBL:Q033F8"
FT                   /protein_id="ABJ71664.1"
FT                   /translation="MKKIILSSFAVFSILLLSACSTNQALKPESSSSKISQNDNSKYDS
FT                   VISDLKSELADKSEYKWVFKIEHNITNADISKGVMINIAPEKYDDSKELKNTYID"
FT   gene            35076..35429
FT                   /locus_tag="LACR_0036"
FT   CDS_pept        35076..35429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71665"
FT                   /db_xref="GOA:Q033F7"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="UniProtKB/TrEMBL:Q033F7"
FT                   /protein_id="ABJ71665.1"
FT                   /translation="MKFLILIDRIYSKIMIFFLLLSIPFTAFSIYLYLNLPNIIPVQFG
FT                   LRFEPSNWGNKATIFIFPLIFLILPTFMSRKSISSQEKLLTRSASAEIITIVILTFLLI
FT                   MMIGVYYLYFRML"
FT   gene            35551..35709
FT                   /locus_tag="LACR_0037"
FT                   /note="LactoCOG number LaCOG02691"
FT   CDS_pept        35551..35709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71666"
FT                   /db_xref="UniProtKB/TrEMBL:Q033F6"
FT                   /protein_id="ABJ71666.1"
FT                   /translation="MRKGDIIILSDGQKATVIFGDESNYQYSCIVKLEDGQLMVVEEKN
FT                   ISLPSLN"
FT   gene            complement(35769..36623)
FT                   /locus_tag="LACR_0038"
FT                   /note="LactoCOG number LaCOG00439"
FT   CDS_pept        complement(35769..36623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0038"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71667"
FT                   /db_xref="GOA:Q033F5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q033F5"
FT                   /protein_id="ABJ71667.1"
FT                   /translation="MSAADMAQTIQTLALNVRLSCQLLDVPESSYYQRINRHPSKTQLR
FT                   RQYLSLKISQLFNANREIYGAPKIHHLLLKQGEKVGLKLVQKLMKQLQLKSVVIKKFKP
FT                   GYSLSDHINRKNLIQTEPTKKNKVWSTDITYIPTQQGWAYLSTIMDRYTKKVIAWDLGK
FT                   RMTVELVQRTLNKAIKSQDYPEAVILHSDQGSQYTSLEYEELLKYYGMTHSFSRRGYPY
FT                   HNASLESWHGHLKREWVYQFKYKNFEEAYQSIFWYIEAFYNSKRIHQSLGYLTPNQFEK
FT                   VSA"
FT   gene            complement(36620..36880)
FT                   /locus_tag="LACR_0039"
FT                   /note="LactoCOG number LaCOG00049"
FT   CDS_pept        complement(36620..36880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0039"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71668"
FT                   /db_xref="GOA:Q02W89"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q02W89"
FT                   /protein_id="ABJ71668.1"
FT                   /translation="MQKRYSKEFKETLIAFYHSGQSVTQLSKEYDVAPATIYKWIDLYS
FT                   KSNESSVSKADFLELKRQLAKVKEERDILKKVLTIFAEKKK"
FT   gene            37363..37815
FT                   /locus_tag="LACR_0040"
FT                   /note="LactoCOG number LaCOG00025"
FT   CDS_pept        37363..37815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0040"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71669"
FT                   /db_xref="GOA:Q033F3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q033F3"
FT                   /protein_id="ABJ71669.1"
FT                   /translation="MLIIRNYEPKDLEEIIRLFKKTIFEINIADYDLAQVEAWSKVDKL
FT                   SFNDNLLATNSRIVVNQDEIVGFGNIDDRGYIDLFYISADYQRQGVGQQLLKDLEKSSQ
FT                   ALMFSVNSSITAKAFFEKMGYQELKQNLVYLRGQEFINYTLLKKAK"
FT   gene            37900..38142
FT                   /locus_tag="LACR_0041"
FT                   /note="LactoCOG number LaCOG00026"
FT   CDS_pept        37900..38142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0041"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71670"
FT                   /db_xref="GOA:Q033F2"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:Q033F2"
FT                   /protein_id="ABJ71670.1"
FT                   /translation="MTTKTVNKHLFVWLGSFLFGGLGVDRFMRGQIGVGICKLLFNGFT
FT                   LGIWSLVDWIIAMVKAYSTYNDTEDITFINGGYSR"
FT   gene            complement(38236..38847)
FT                   /locus_tag="LACR_0042"
FT                   /note="LactoCOG number LaCOG02379"
FT   CDS_pept        complement(38236..38847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0042"
FT                   /product="Sulfate permease related transporter (MFS
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71671"
FT                   /db_xref="GOA:Q033F1"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q033F1"
FT                   /protein_id="ABJ71671.1"
FT                   /translation="MTHIPLSALAGVLIMTALRMNEWEAIHFLFKNKLKSGMIEFFVTM
FT                   IITVIFDLSTAILAGIIVGFLLFILKISQIEINSSQIEPERISQNHHEVFSEWTVIYIS
FT                   GPLFFLNSSKLKQVIDALPTNTNIVLSLRGVPMIDVTSIKLLIDIYSVFHEENRQIVFA
FT                   SMNGKLKESFRRTGLINLVGEEAIYPSVNEFLLDLVDKKN"
FT   gene            complement(38844..39854)
FT                   /locus_tag="LACR_0043"
FT                   /note="LactoCOG number LaCOG02379"
FT   CDS_pept        complement(38844..39854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0043"
FT                   /product="Sulfate permease related transporter (MFS
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71672"
FT                   /db_xref="GOA:Q033F0"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniProtKB/TrEMBL:Q033F0"
FT                   /protein_id="ABJ71672.1"
FT                   /translation="MIKQFLGIINSEFKDYNRRKFLQDLMAGITVAAVALPLALAFGVS
FT                   SGTTAAAGLITAIVAGLIISSFSGAFYQISGPTGAMAAILISLIGKYGMNGIFIATFMA
FT                   GIFLLLAGIFRLGNLISLIPSPVITGFTSGIAIIIASGQIKNFFGIEHFTGSFFDLMKF
FT                   IGGLHIDYPSTIIGILTILLMIFYPKSWGKKFPASLLAILLSTLAVLALKLNVPVVGKI
FT                   PTTLIPQAHLRLTEINLQDMKTLLIPAISITVLGMTESLLCGASAGRATNHPMDNNQEL
FT                   VAQGIGNIFIPFFGGIPATAAIARTSVAIKAGAQTRLTGITRSFYFYQCSCLPHL"
FT   gene            40064..40585
FT                   /locus_tag="LACR_0044"
FT                   /note="LactoCOG number LaCOG00027"
FT   CDS_pept        40064..40585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0044"
FT                   /product="Predicted acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71673"
FT                   /db_xref="GOA:Q033E9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q033E9"
FT                   /protein_id="ABJ71673.1"
FT                   /translation="MIIKTINLEDYKEVAELIRESFSQSEHGYGNEAELVDKIRNEEGY
FT                   IKDLEIVAFEDGKITGHGLLSEVSIVNQSQSFKGLVLAPLDVLPAYQGKGIGAAILLEL
FT                   EKRAKILDYSFISILGHESYYPRFGYVPASQYQIQAPFEVPNENFMIKELIDGRLEGKS
FT                   GVIQYSEAFN"
FT   gene            40828..40900
FT                   /locus_tag="LACR_t0045"
FT                   /note="tRNA_Lys_CTT"
FT   tRNA            40828..40900
FT                   /locus_tag="LACR_t0045"
FT                   /product="tRNA-Lys"
FT   gene            41047..42222
FT                   /locus_tag="LACR_0046"
FT                   /note="LactoCOG number LaCOG00028"
FT   CDS_pept        41047..42222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0046"
FT                   /product="aromatic amino acid aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.57"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71674"
FT                   /db_xref="GOA:Q033E8"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q033E8"
FT                   /protein_id="ABJ71674.1"
FT                   /translation="MDLLKKFNPNLDKIEISLIRQFDQQVSSIPDIIKLTLGEPDFYTP
FT                   EHVKQAGIAAIENNQSHYTGMAGLLELRQAASEFLLKKYGLFYVAEDEILVTVGVTEAI
FT                   SSVLLSILVAGDEVLIPAPAYPGYEPLITLAGGSLVEIDTRANDFVLTPEMLDQAIIER
FT                   EGKVKAVILNYPANPTGVTYNREQIKALAEVLKKHEVFVIADEVYSELNYTDQPHVSIA
FT                   EYAPEQTIVLNGLSKSHAMTGWRIGLIFAARELVAQIIKTHQYLVTSASTQSQFAAIEA
FT                   LKNGADDALPMKKEYLKRRDYIIEKMSALGFKIIEPDGAFYIFAKIPADFEQDSFKFAV
FT                   DFAKENAVAIIPGIAFGQYGEGFVRLSYAASMDVIEQAMARLTDYVTKKRG"
FT   gene            42320..43075
FT                   /locus_tag="LACR_0047"
FT                   /note="LactoCOG number LaCOG00029"
FT   CDS_pept        42320..43075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0047"
FT                   /product="DNA replication and repair protein RecO"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71675"
FT                   /db_xref="GOA:Q033E7"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q033E7"
FT                   /protein_id="ABJ71675.1"
FT                   /translation="MRDAETQGLVLYSRNYKEKDKLVKIFTESFGKRMFFVKNFGKSSY
FT                   ASSLQAFTDGKLTATINDGGFSFIEDVSEVVVYKNISADIFINAHASYIISLADAAISD
FT                   NQYDPALYGFLKRSLELLDQGFDMEVVTNIFELQVLHRFGVSLNFSECAFCHKTVGPFD
FT                   FSYKFSGCLCPRHFDEDLRRSHLDPNVIYLINLFQEISLDELKKISIKAEMKAKIRQFI
FT                   DGLYDEYVGIHLKSKKFLDGMSGWADIMK"
FT   gene            complement(43227..44645)
FT                   /locus_tag="LACR_0048"
FT                   /note="LactoCOG number LaCOG00030"
FT   CDS_pept        complement(43227..44645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0048"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71676"
FT                   /db_xref="GOA:Q033E6"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q033E6"
FT                   /protein_id="ABJ71676.1"
FT                   /translation="MVVGAQATEVDLVIIGSGPGGYVAAIRAAELGKKVTIIEKDNVGG
FT                   VCLNIGCIPSKALINIGHHYQESLEEEKGENPFGLSVGNVKLNWESAQKWKQDKVVNQL
FT                   TGGVKMLLKKHKVDVIQGTAEFIDNNTINVEQEDGFQLLQFNDVIISTGSRPIEIPSFP
FT                   FGGRIIDSTGALSLPEVPKHLIIVGGGVIGSELGGAYRMLGSKITIVEGLDHILNGFDK
FT                   EMSDIIANRVKSAGSEIFTSAMAKSATQTDKDVTLTFEVDGKEQTVTGDYLLVSVGRRP
FT                   NTDLIGLNNTDVKLTDRGLIEVDDSYATNVPHIYAIGDVVPGPMLAHKASFQAKVAAAA
FT                   IAGAEDDVDLHVALPAVAYTTTELATVGETPESVKDRKDVKISKFPFAANGRAISMNDT
FT                   TGFLRLITETKEGALIGAQIVGPGASDLISGLSLAIENGLTSKDISLTIQPHPTLGEAI
FT                   MDTAELADGLPIHV"
FT   gene            complement(44864..46450)
FT                   /locus_tag="LACR_0049"
FT                   /note="LactoCOG number LaCOG00031"
FT   CDS_pept        complement(44864..46450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0049"
FT                   /product="acetoin/pyruvate dehydrogenase complex, E2
FT                   component, dihydrolipoamide succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71677"
FT                   /db_xref="GOA:Q033E5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q033E5"
FT                   /protein_id="ABJ71677.1"
FT                   /translation="MTEIFKMPDIGEGMHEGDIANWLVKVGDVVKEDDPIAEVQNDKLM
FT                   QEILSPYSGTVTKLFVEEGTTVEVDSPLVEFDGDGSGTSAAAPSAQETASSDAPSGNAQ
FT                   IFTMPDIGEGMHEGDIANWLVKVGDEIKEDDPVAEVQNDKLMQEILSPYSGKVTKLFVE
FT                   AGTTVEVGAPLIEYNGNGESSSNPAPAASPAPIAEAPKTAAAPTDAPLTKTTSTGHILA
FT                   MPSVRHYARKAGIDLTQVPATGRHGHTTLADVKAFESGSVAPIAPVAPESAPVAPAPKA
FT                   DKATEKAPTVKSVAGDRREAMNPTRKVVSKVMTAQHTHIPPVTNFDQVEVSKLVKHRAV
FT                   FKEVAAKQDIKLTYLAYVAKALATTAHKFPEINASVDYDKQEIVYHEHVNLGIAVNAPT
FT                   GLYVPVIHEAETKSILEIAKEIAELATATREGTLKPQQMQGSTITISNIGSARGSWFTP
FT                   IINGSDVVILGLGSIVKEPIVNGEGEIVVGQNMKLSMTYDHRLIDGMLGQTSLNYLKSL
FT                   LADPEFMLMEI"
FT   gene            complement(46443..47423)
FT                   /locus_tag="LACR_0050"
FT                   /note="LactoCOG number LaCOG00032"
FT   CDS_pept        complement(46443..47423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0050"
FT                   /product="acetoin dehydrogenase complex, E1 component, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71678"
FT                   /db_xref="GOA:Q033E4"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q033E4"
FT                   /protein_id="ABJ71678.1"
FT                   /translation="MAVKTYIAAITEALDLALEKDKDALIFGEDVGQNGGVFRATDGLQ
FT                   AKYGEDRVFNTPLAESGIGGMAIGLATQGFHPIMEIQFGTFIFEVFDSIAGQMSRTRYR
FT                   FNNTRSNNIVVRTPYGIGTKTPEMHADSIEGLFSQLPGVRVVMPSNPADAKGLLLASIE
FT                   NNDPVIFLENLHLYRSLKGEVPEGYYTTPLDQAAVAKEGSDVSIIAYGGTVPLALKAAE
FT                   QLEKDGIKAEVIDLRTVAPLDIASIGKTVEKTGRVVVVQEAQRTAGIAVNVMAEISERF
FT                   VLNLKAPIGRVTGPDSIFPFAQAENDWAVKAEDIVNKVKEVVDYD"
FT   gene            complement(47426..48550)
FT                   /locus_tag="LACR_0051"
FT                   /note="LactoCOG number LaCOG00033"
FT   CDS_pept        complement(47426..48550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0051"
FT                   /product="acetoin dehydrogenase complex, E1 component,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71679"
FT                   /db_xref="GOA:Q033E3"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q033E3"
FT                   /protein_id="ABJ71679.1"
FT                   /translation="MPNSEQILDFKAQLSLQDTAFPMLQILNEEGKIVDEEGLKRAGLS
FT                   DEKLVELFKSMLFARQVDIRSMKLAKQGRMGFFGPHAGQEASQMASGFAFTDEDWLFPG
FT                   YRDLPQIYAKGWPIWKGLLWSRGHQLGNEYTTDDGKPVNSWFPQIIIGAQYVEAAGVAL
FT                   GLKKRKKDAVAFVYTGDGGSSQGDTYEGINFAGAYKAPLVAFIQNNGYAISTPRSLQSA
FT                   APHLAAKGWAAGAPSIVVDGMDAIAMYLASKEARAWAVAGNGPVVIEAITNRLEPHSTA
FT                   GDDPLRYRTKEDIEAWWKKEPLVRMRNFLTEKGLWDTDKEEAYVAELDARIDADIKKAN
FT                   NVEKQKISSFIKNTLEVPSQAMAEQIAKFESEGK"
FT   gene            complement(48639..49640)
FT                   /locus_tag="LACR_0052"
FT                   /note="LactoCOG number LaCOG00034"
FT   CDS_pept        complement(48639..49640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0052"
FT                   /product="lipoate-protein ligase"
FT                   /EC_number="6.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71680"
FT                   /db_xref="GOA:Q033E2"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="UniProtKB/TrEMBL:Q033E2"
FT                   /protein_id="ABJ71680.1"
FT                   /translation="MQFINYLGQDAYTNIAMDSWLLYNLKPTEPVFALWQNKRAVIVGR
FT                   NQNTFAEVNQDYIDSHDVQVVRRVSGGGAVYHDEGNICFTFFVPVENSGSVNFKKFVQP
FT                   MYEALHAVGIKAEITGRNDLEVEGKKISGNAQRYAGGYLMHHGTLLWDTDVEAMIRSLN
FT                   VSDEKFVSKAAKSVRARVGNIKEFAPDELSLGSFIEALKYYLTDEGKDGELVLTDEQLD
FT                   SIKKTRDEQFATWDWNYGESPKFSFQNHAKFTGGAIDIQVNVENGKITEINFQGDFLGV
FT                   RDWRDIKDQFIGVEFEPAAVLQVLEANKDGQYFGTIQNTELSEMFKADYRVD"
FT   gene            complement(49833..50687)
FT                   /locus_tag="LACR_0053"
FT                   /note="LactoCOG number LaCOG00035"
FT   CDS_pept        complement(49833..50687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0053"
FT                   /product="Glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71681"
FT                   /db_xref="GOA:Q033E1"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q033E1"
FT                   /protein_id="ABJ71681.1"
FT                   /translation="MNFLSSVFNKILTQLDKKRVNKFKTEQPLKPNLNSKTLVFAHRGS
FT                   KSNNPENTLAAFREAIRVQSDGIELDVHLSLDNELIVIHDEKIDRTTNGKGLVRKMTSA
FT                   DIQKFDAGSWYHPNFADEKIPRLSEVLKLLTDLSFNGYLNIEIKTDKFNYPGIEKKISE
FT                   LMTESKWPFIYIYSSFNLQSLKRIHELEPKIEINYLTKNILHLKKRQEGILTDFITGIH
FT                   PRRNYALKHPLLLKASNRPFRLWTVNQESEMRKAFQQNVAGIITDYPEQALKIRQQIQE
FT                   QPK"
FT   gene            complement(50687..50785)
FT                   /locus_tag="LACR_0054"
FT   CDS_pept        complement(50687..50785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71682"
FT                   /db_xref="UniProtKB/TrEMBL:Q033E0"
FT                   /protein_id="ABJ71682.1"
FT                   /translation="MKNLIYKFADKFVRGFFESSSAKLIQKLKGNI"
FT   gene            complement(50766..51501)
FT                   /pseudo
FT                   /locus_tag="LACR_0055"
FT   gene            complement(51467..51793)
FT                   /locus_tag="LACR_0056"
FT   CDS_pept        complement(51467..51793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71683"
FT                   /db_xref="GOA:Q033D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q033D9"
FT                   /protein_id="ABJ71683.1"
FT                   /translation="MESAKRYALVGNILQTIYFIFLFIAGSLNTFTKFFHLVILANVGV
FT                   RGVFSVIPLLILVILSWYAASRLEDATWRMVLLIVAIIAISGSGSLIPGILFIVAFFKS
FT                   GKKA"
FT   gene            complement(51850..52740)
FT                   /locus_tag="LACR_0057"
FT                   /note="LactoCOG number LaCOG03011"
FT   CDS_pept        complement(51850..52740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0057"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71684"
FT                   /db_xref="GOA:Q033D8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q033D8"
FT                   /protein_id="ABJ71684.1"
FT                   /translation="MTYNSTLPKVFVYLLTTIETLYQTRVPLEVQNRKNVHLATSDCLV
FT                   IACYLWGVLHFSETLKAKHQLAQSLFPNFLEYSRFVRRCNALLPSIQVIRQALVFKEVE
FT                   GMSVSIIDSFPIPLCQPIRNFRSKGLGDYANVGYNATKGQYFYGCKCHALVSESGYVID
FT                   YTITPASMADSSMTEEVLSQFGTPTVLGDMGYLGQSLHDRLELEGIDLITPVRKNMKQK
FT                   KILFPNFSKRRKVIERVFSFLTNLGAERCKSRSPQGFQLKLEMILLAYSLLLKSAKSLE
FT                   PETLRYSIGYQVIAK"
FT   gene            complement(52893..53918)
FT                   /locus_tag="LACR_0058"
FT                   /note="LactoCOG number LaCOG00037"
FT   CDS_pept        complement(52893..53918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0058"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71685"
FT                   /db_xref="GOA:Q033D7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:Q033D7"
FT                   /protein_id="ABJ71685.1"
FT                   /translation="MTKPTILTGDRPTGKLHIGHYVGSLQNRVKMQNEDKYNMFVFLAD
FT                   QQALTDHAKDPELIRQSVGDVALDYLAAGLDPEKSTIFIQSQIPELAELSMYYMNLVSL
FT                   ARLERNPTVKTEIAQKAFGESIPAGFLVYPVSQAADITTFKATHVPVGNDQKPMIEQTR
FT                   EIVRSFNNAYHTDILVEPEGIYPENEAAGRLPGLDGNAKMSKSLGNGIFLADDMDTLKK
FT                   KVMSMYTDPDHIKVEDPGKIEGNMVFHYLDVFGKAEDAEQIAEMKAQYQAGGLGDVKTK
FT                   RFLLEVLERELSPIRERRIEFAQNMDYVYDMLKAGSLKAEAVASQTLDEVKNAMGINYF
FT                   R"
FT   misc_binding    complement(53988..54246)
FT                   /bound_moiety="uncharged Trp tRNA"
FT                   /note="T-box leader, riboswitch"
FT   gene            54417..54854
FT                   /locus_tag="LACR_0059"
FT                   /note="LactoCOG number LaCOG02380"
FT   CDS_pept        54417..54854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0059"
FT                   /product="Predicted redox protein, regulator of disulfide
FT                   bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71686"
FT                   /db_xref="GOA:Q033D6"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q033D6"
FT                   /protein_id="ABJ71686.1"
FT                   /translation="MANKSKASAHWEDTLENGFGTISAESSQIFTETPYNFKARSESQA
FT                   HITTPEELLGAAHAACFSMAFSMVLGQKGLVAKSIDTTADVTFETTADGPAITKIKLTN
FT                   HSVIPGISEADFQEIAKIVKESCPVSKALATVNIELEATLG"
FT   gene            55016..56329
FT                   /locus_tag="LACR_0060"
FT                   /note="LactoCOG number LaCOG00038"
FT   CDS_pept        55016..56329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0060"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71687"
FT                   /db_xref="GOA:Q033D5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q033D5"
FT                   /protein_id="ABJ71687.1"
FT                   /translation="MKENKLLSPAAIFLLGVNSIIGSGIFLLSGKIYEDAGIWSLLAIL
FT                   FAGLSIFVIAFAYANMSKIYSKNGGGLVYAKETFGRFPGFIVGMVTWLLGTVTLTTEVS
FT                   ALLTALKMILPNLNSRLTGLIIILVLGLISYFGSSIIAGLDNLTSFVKILLVLVFVCTC
FT                   FWLVRAVNFTSPHLLTVSSANLGGFKGFLSAYGTVFFFFTGFSFLPVNAEKMKNPAKNL
FT                   PKMMALVMLTCLTVYLIIQAITIGALGPELTKTLVPAATAFSRVVGAIGIPLFVIGICF
FT                   SIFGVIVATTFNTPTILASLAQAHEDVPMFVAKNNRFGTPSWAIILTTLCAMGLFLSGN
FT                   YVFLSGLTVFMSFVQYLSTGLANIKKKFLWIGIGSVLFSLVLLTSFTLSVLLLGLGIII
FT                   LLVIIYFVVKLDDDEREKWLKEHQEKSKAAAVNTVKRL"
FT   gene            complement(56408..57403)
FT                   /locus_tag="LACR_0061"
FT                   /note="LactoCOG number LaCOG00039"
FT   CDS_pept        complement(56408..57403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0061"
FT                   /product="phosphate:acyl-[acyl carrier protein]
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71688"
FT                   /db_xref="GOA:Q033D4"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q033D4"
FT                   /protein_id="ABJ71688.1"
FT                   /translation="MKIAIDAMGGDFAPENIVKGVNLAKKELSDVTFQLYGDGAKIRQF
FT                   LDDETAIEIIETTEVIDFHDDPVAAIKSKKDSSLVRAVTAVKKREADAVLSAGSTGALL
FT                   TAGLMLVKRIKQVSRPALMSTLPTADGRGFDMLDLGANTENTAHHLVDFAILGSYYAEN
FT                   VRGIEKPRVALISNGSEESKGSPTVKEAHEILSAMTEINFIGNIESRDLLSGGADVVVT
FT                   DGFTGNAILKAIEGTATVLMKEIKSAIMAGSVTTKIGGVLIKKPLSGLKDLMSTDGAGG
FT                   AAFVGLKAPVVKAHGNSSELAIASALKQIHKMLESDVSGKLVKHFENMDK"
FT   gene            complement(57506..58318)
FT                   /locus_tag="LACR_0062"
FT                   /note="LactoCOG number LaCOG00040"
FT   CDS_pept        complement(57506..58318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0062"
FT                   /product="Predicted hydrolase of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71689"
FT                   /db_xref="GOA:Q033D3"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q033D3"
FT                   /protein_id="ABJ71689.1"
FT                   /translation="MTKNLKLFATDMDGTFLRNDHSYNHKKLAELIKEIQDRNLLFAAS
FT                   SGRSLLGLTEVFAEYKDQMAFVAENGGVVAYKGEILFAKNLTVAQTQELIDDLQEMPFS
FT                   PKSDYLISGLKGAYYPEGISKEYLTHAKLYYPNCQLYHQLDEIDDKLLKVTTNFPEDHV
FT                   RDCEQWITDRLSFVRATTTGFTSIDIVPNGISKASGLAHLLAHFNWLPENLAVFGDQMN
FT                   DLEMFEYAGSSFAVSNAAPEILAQADKVILSNDEDAVLVEIENILNEQ"
FT   gene            complement(58767..60404)
FT                   /locus_tag="LACR_0063"
FT                   /note="LactoCOG number LaCOG00041"
FT   CDS_pept        complement(58767..60404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0063"
FT                   /product="ATPase component of ABC transporter with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71690"
FT                   /db_xref="GOA:Q033D2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q033D2"
FT                   /protein_id="ABJ71690.1"
FT                   /translation="MLTVSDISLQFSDRKLFDEVNIKFTPGNCYGLIGANGAGKSTFLK
FT                   ILDGEIQPTTGHISMGPNERMSVLRQNHYDYEDQTPLDVVMMGNEKLFAINQEKNAIYM
FT                   NPDATDDDFMKAAELEAEFGEMGGYEAEADAARLLQNLGIKAEQHTDLMANLTSGEHVK
FT                   VLLAKALFGKPDVLLLDEPTNGLDIQAIAWLEDFLINFENTVIVVSHDRHFLNNVCTYM
FT                   ADLDYGKIKLYPGNYDFWKESSELALRLQGDQNRKAEEKIAELKEFIARFSANASKSKQ
FT                   ATSRKKMLDKIEVEEFVPSSRKYPFVGFEQEREIGNDLLRVENLSVAIDGEMIIENISF
FT                   ILNPGDKTVFIGQNDIQQTTLLRALMDDVEDNWTVTGDIKWGVTSSRSYLPKDNSKDFD
FT                   SNEPILDWLRQFVLTKEEDDNTYLRGFLGRMLFKGEESLKAVNVLSGGEKVRVMLSKMM
FT                   LQRANVLVLDDPTNHLDLESISALNDGLKSFKGSILFASHDHEFINTIANHIVVLGKSG
FT                   VIDRIGETYDDFLDNAEVQEKVKELWAD"
FT   gene            60904..61158
FT                   /locus_tag="LACR_0064"
FT   CDS_pept        60904..61158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0064"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71691"
FT                   /db_xref="GOA:Q033D1"
FT                   /db_xref="InterPro:IPR008024"
FT                   /db_xref="InterPro:IPR038972"
FT                   /db_xref="UniProtKB/TrEMBL:Q033D1"
FT                   /protein_id="ABJ71691.1"
FT                   /translation="MKKKVYRNTAAFKLLAWGSFALFVILILIGLYTLKEPLMVKGYYL
FT                   MGTVGVISSAFTIVKVTRDDQEDDERYNEMFRAVKQEQE"
FT   gene            complement(61277..62101)
FT                   /locus_tag="LACR_0065"
FT                   /note="LactoCOG number LaCOG00424"
FT   CDS_pept        complement(61277..62101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0065"
FT                   /product="Short-chain dehydrogenase of various substrate
FT                   specificities"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71692"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q033D0"
FT                   /protein_id="ABJ71692.1"
FT                   /translation="MKTVIITGASNGMGYKAAKVFASKGWKVFAGARRVEKIPTDQNIV
FT                   GLKLDVTDSASNHAFIAEILKQTQQIDVLINNAGYGEFGPAEEIPMENVRKQFETNFFG
FT                   AVELTQLVLPTMRAQKSGRIINISSIGGDLYMPLGSYYHATKAALQQWSDALDVEIKDF
FT                   GAQSIIIQPGGTASSWGEIAIGNALKNLKKDSFYQPLVEKIQGALSGNASVGATSLDLA
FT                   ELFYKAATDQNPKRRYFNSFGDRPVVHIARAHPRLFSRLATFMLNRVAKKKA"
FT   gene            complement(62261..62842)
FT                   /locus_tag="LACR_0066"
FT                   /note="LactoCOG number LaCOG00612"
FT   CDS_pept        complement(62261..62842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0066"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71693"
FT                   /db_xref="GOA:Q033C9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q033C9"
FT                   /protein_id="ABJ71693.1"
FT                   /translation="MRKIDENKKEAITQAVFQLTKEVGLVGLSIAKVAKIAGVSPATIY
FT                   VYYKDKADMLSQILIGVKDILDEGQEEIILSVSDPLEQFKKLLRHLIDKWTTYPKHAIF
FT                   MRAALENPSEIAPHGIAYSNKRAEVIVALYDRLLDSGKIKPLSQHLLISWTAGGIMNNL
FT                   LYHAQMGTQPDDAEIQQMIELSVDAIKKNL"
FT   gene            complement(63030..63512)
FT                   /locus_tag="LACR_0067"
FT                   /note="LactoCOG number LaCOG02699"
FT   CDS_pept        complement(63030..63512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71694"
FT                   /db_xref="GOA:Q033C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q033C8"
FT                   /protein_id="ABJ71694.1"
FT                   /translation="MTDNKQKNIIKLWQICLVFLFWIGAMFLPGTINQIKFGTNFDLAK
FT                   SRENYFFYLWVQKPVTSTLLILLLLWIILSCLRKWKITPFLSFSFMLLYIYDLFLEFVL
FT                   GRIFVGVSLKLALSPETFIGLWRTLGLGFFLTSLLGSCFSILLFVYLMNLSSLQKS"
FT   gene            complement(63769..65049)
FT                   /locus_tag="LACR_0068"
FT                   /note="LactoCOG number LaCOG00042"
FT   CDS_pept        complement(63769..65049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0068"
FT                   /product="O-acetylhomoserine sulfhydrolase"
FT                   /EC_number="2.5.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71695"
FT                   /db_xref="GOA:Q033C7"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q033C7"
FT                   /protein_id="ABJ71695.1"
FT                   /translation="MTDHNYKFDTLQVHAGQEPDPVTGARAVPLYQTTSFVFNNSDHAE
FT                   ARFALQDPGAIYSRLGNPTNDVFEARIAALEGGSAALGVGSGSASITYAILNIATVGDN
FT                   IVSASTLYGGTYHLFSGTLPKYGITTKFVNPDDPKNFEEAIDEKTKAIYYETLGNPGNN
FT                   VIDYDAVGAIAKKHGIPVIVDATFTTPVTFKPFEHGANVIVHSATKFISGHGTSIGGVI
FT                   VDGGNFDWANGKFPDFTQADESYNGIKFAELGEIAFVTRIRAILLRDTGAALSPFHSWL
FT                   FLQGLETLSLRVERHIANTKKIVDFLDKHPKVELVNHPLLESNAYLALYQKYYPKDAGS
FT                   IFTFELKDKDEKKARDLIDHLEIFSLLANVGDTKSLAIHPASTTHQQLNDEELASAGIS
FT                   KGTIRLSVGIEDVTDLIADLEQALEKI"
FT   gene            complement(65315..66148)
FT                   /locus_tag="LACR_0069"
FT                   /note="LactoCOG number LaCOG00424"
FT   CDS_pept        complement(65315..66148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0069"
FT                   /product="Short-chain dehydrogenase of various substrate
FT                   specificities"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71696"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q033C6"
FT                   /protein_id="ABJ71696.1"
FT                   /translation="MTQKTVAITGASNGMGFEATKLFAKRGWKVYAGARRVDKIPQDGE
FT                   KIRAIKLDVTDSDSNKAFVKQILDEAGHIDVLINNAGYGEYGPAEEIPMDKIRKQFETN
FT                   FFGAVELTQLILPTMRAQNYGRIVNISSIGGDVYMPLGAYYHATKAALQQWSDVLDLEV
FT                   AQFGIRSVCVQPGGTQSSWGNIALENSKKNMSENSAYQPLVNSVASGLDRFMKNSAKAS
FT                   DLAEVFYKAATELKPSLRYLHAFGDKFMVNVARRHPKIFRKALLITMRYFEKHNH"
FT   gene            complement(66497..67387)
FT                   /locus_tag="LACR_0070"
FT                   /note="LactoCOG number LaCOG03011"
FT   CDS_pept        complement(66497..67387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0070"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71697"
FT                   /db_xref="GOA:Q033C5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q033C5"
FT                   /protein_id="ABJ71697.1"
FT                   /translation="MTYNSTLPKVFVYLLTTIETLYQTRVPLEVQNRKNVHLATSYCLV
FT                   IACYLWGVLHFSETLKAKHQLAQSLFPNFLEYSRFVRRCNALLPSIQVIRQALVFKEVE
FT                   GISVSIIDSFPIPLCQPIRNFRSKGLGDYANVGYNATKGQYFYGCKCHALVSESGYVID
FT                   YTITPASMADSSMTEEVLSQFGTPTVLGDMGYLGQSLHDRLELKGIDLITPVRKNMKQK
FT                   KILFPNFSKRRKVIERVFSFLTNLGAERCKSRSPQGFQLKLEMILLAYSLLLKSAKSLE
FT                   PETLRYSIGYQVMAK"
FT   gene            67560..68027
FT                   /locus_tag="LACR_0071"
FT                   /note="LactoCOG number LaCOG02381"
FT   CDS_pept        67560..68027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0071"
FT                   /product="Universal stress protein UspA related
FT                   nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71698"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q033C4"
FT                   /protein_id="ABJ71698.1"
FT                   /translation="MSKNYKKILIAIDGSEQAEAALKEAITLCKRDNAQLFVLHATDKN
FT                   SIYAAGNPVPVVPAPAIPVVPAVPVLEESADNEAKEVLEKASAIINNEVKFEEIRVDGS
FT                   AKNEIVDFAKEHEIDMIVMGSSGKGALDRMLLGSTAVYVVKHAPCSVTIIK"
FT   gene            68154..68351
FT                   /locus_tag="LACR_0072"
FT                   /note="LactoCOG number LaCOG00207"
FT   CDS_pept        68154..68351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71699"
FT                   /db_xref="UniProtKB/TrEMBL:Q033C3"
FT                   /protein_id="ABJ71699.1"
FT                   /translation="MKVTFKTLDGRTMTKEFLTVDEFVMLQNREIPAIDDSEKVLEVVI
FT                   SGQAEEFSGNVADLYFKLSK"
FT   gene            68387..69007
FT                   /locus_tag="LACR_0073"
FT                   /note="LactoCOG number LaCOG00043"
FT   CDS_pept        68387..69007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0073"
FT                   /product="Predicted esterase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71700"
FT                   /db_xref="GOA:Q033C2"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q033C2"
FT                   /protein_id="ABJ71700.1"
FT                   /translation="MTNYVFKAGRKNLAPLLLLHSTGGDEHQLLEIAEMIAPHHPILSI
FT                   RGRVNEQGSNRYFKLRGLGGFTKENFDLDSLDEETNWLTSEVQSLAQKHNLDVQKMIAL
FT                   GYSNGANVALNMFLKGKFNFDKIIAFHGMQLEEFEEAIQLDKKQVFLTYAANDRIVPRE
FT                   NFGDLKGDLEDSGCQIEIFESSLGHQLTQEEVMAAKKWLAKAD"
FT   gene            69075..70244
FT                   /locus_tag="LACR_0074"
FT                   /note="LactoCOG number LaCOG00044"
FT   CDS_pept        69075..70244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0074"
FT                   /product="Lactoylglutathione lyase related lyase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71701"
FT                   /db_xref="GOA:Q033C1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q033C1"
FT                   /protein_id="ABJ71701.1"
FT                   /translation="MTESTKIVAQIPEALTLGGVHHVTAITSSAQKIYDFFTNILGLRL
FT                   AKLTVNQDDYETYHLFFTEEDGHGADMTFFDFKDIPKGNHGVNNIERASFRVPTDASLD
FT                   YWSTRFDNAHVKHGEISSKFGQNTLEFEDFDGQLYQLISDQNNNGDASKGHSWQLSNVP
FT                   QEHGITGLGPVFVKVENAKNLRSILETVFGFRYAGQEGDLHLFEVANGGNGAALILQEA
FT                   GEKESYAYQGYGTIHHLALGTTNPETLNYWIERIKAFRLPHSGLVDRFYFSSEYVRVAP
FT                   GVLFEIATYTPGIGALDMAKSGSGAVDSYEEALITSGFWIDQSKEESGLSLSLPPHLFP
FT                   GDEATKARTAASLRPLDTSDAHRDRTRDELWTVEKVLEHKAGTPVETLK"
FT   gene            70255..70845
FT                   /locus_tag="LACR_0075"
FT                   /note="LactoCOG number LaCOG00045"
FT   CDS_pept        70255..70845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0075"
FT                   /product="Conserved protein/domain typically associated
FT                   with flavoprotein oxygenase, DIM6/NTAB family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71702"
FT                   /db_xref="GOA:Q033C0"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q033C0"
FT                   /protein_id="ABJ71702.1"
FT                   /translation="MKSYQADELDEKTVYKLLSGSIVPRPIAWVTSQNSDGLVNVAPFS
FT                   FFNVASANPPLLSISFTGNKDSLNNLLTTKEAVVHLVNEDNVELMNQTAAPLAKHISEA
FT                   EEFSLELVPSQKVQVPSLKESKVRLETKLYHHLPLGENGHLVLLEVVNFSFADELLDEE
FT                   NFHVNLTKLKPVGRLAGDDYSTLGNRFSLLRPR"
FT   gene            complement(70927..71076)
FT                   /locus_tag="LACR_0076"
FT                   /note="LactoCOG number LaCOG00050"
FT   CDS_pept        complement(70927..71076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0076"
FT                   /product="LSU ribosomal protein L33P"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71703"
FT                   /db_xref="GOA:Q033B9"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q033B9"
FT                   /protein_id="ABJ71703.1"
FT                   /translation="MRVNITLEHKESGERLYLTQKNKRNTPDKLELKKYSKKLRKHVIF
FT                   KEVK"
FT   gene            complement(71106..71279)
FT                   /locus_tag="LACR_0077"
FT                   /note="LactoCOG number LaCOG00051"
FT   CDS_pept        complement(71106..71279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0077"
FT                   /product="LSU ribosomal protein L32P"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71704"
FT                   /db_xref="GOA:Q033B8"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q033B8"
FT                   /protein_id="ABJ71704.1"
FT                   /translation="MAVPARHTSSAKKNRRRTHYKLTAPTVTFDETTGDYRHSHRVSLK
FT                   GYYKGRKVRDTK"
FT   gene            71641..73422
FT                   /locus_tag="LACR_0078"
FT                   /note="LactoCOG number LaCOG00052"
FT   CDS_pept        71641..73422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0078"
FT                   /product="Cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71705"
FT                   /db_xref="GOA:Q033B7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q033B7"
FT                   /protein_id="ABJ71705.1"
FT                   /translation="MKNWKKLILVFVIAGVALIAYFGFNQPFLARLVVTIAGGVLAFSM
FT                   LIEMIKTLRSGSYGVDLLAITAIIATLLVGEYWASLIIILMLVGGESLEDYANGRAHRA
FT                   LAALLDKSPEIAHVQTGDKVVDLPLDHVEIGSVLLIRPMEIIPIDGKLLSEAVVLDEAS
FT                   LTGETKPNELVRGDNVLSGAINGNSSIKIETTFAAADSQFQKIVQLVKETEKTPAQFVR
FT                   LADRYAVPFTIIAYIIAAVAYFISGDPVRIAEVLVVASPCPLILAAPIAFVSGMSRSSQ
FT                   NGSLIKNGTVIEKLAKAQEIFLDKTGTITEGTIKVDSIKPVKSGNEAEILQLVYTVEKS
FT                   SGHILAKAVVEYAETKKIQPLKLTSLTEVAGLGVIGEIDGEEIKIGRSLFAFAPDNLNY
FT                   ETAFYVSKSGKYIGAVTFSDTLRPEAKATIAQMRKIGLENITMLTGDNQLVADKIAKSV
FT                   GIENVYAGLMPDEKLKFIQNATHRPAIMIGDGVNDAPALATADIGISIGVGSGTVASEA
FT                   ADIVLLQNDLRKVTTSIEISRDTLKIAKQAVMIGIVICIILMFIAALGVIPAVIGALFQ
FT                   EIIDVVSILYALRALRG"
FT   gene            73609..74088
FT                   /locus_tag="LACR_0079"
FT                   /note="LactoCOG number LaCOG03051"
FT   CDS_pept        73609..74088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0079"
FT                   /product="Uncharacterized membrane-anchored protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71706"
FT                   /db_xref="GOA:Q033B6"
FT                   /db_xref="InterPro:IPR007136"
FT                   /db_xref="UniProtKB/TrEMBL:Q033B6"
FT                   /protein_id="ABJ71706.1"
FT                   /translation="MLDKKFQWNKVPAIGLLFWLTKLISTRQGESLSDFSSKLFGQQNQ
FT                   MLGAVFTVAWSLILFGIFLFLQLKSEKYRPVFYWLSVALLAVFGTILADGLSGVLGISH
FT                   LFTSLIFAAGMGISFMIWYHLTGTLSIHKIRTLKSELCYWLTVMFSFAMGTALGD"
FT   gene            74088..74456
FT                   /locus_tag="LACR_0080"
FT                   /note="LactoCOG number LaCOG03051"
FT   CDS_pept        74088..74456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0080"
FT                   /product="Uncharacterized membrane-anchored protein
FT                   conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71707"
FT                   /db_xref="GOA:Q033B5"
FT                   /db_xref="InterPro:IPR007136"
FT                   /db_xref="UniProtKB/TrEMBL:Q033B5"
FT                   /protein_id="ABJ71707.1"
FT                   /translation="MADTRTGYNPDPYGLGLGLLNTGLILGLIFVIVLAYRYFGRPAQN
FT                   SLVEILSFWAAYILTRPVGASFADYFGYTWNGGKLENGGMSVIWLVLFVFLIAVILVDF
FT                   HKKLANYFTQKSEKIVSD"
FT   gene            complement(74466..75251)
FT                   /locus_tag="LACR_0081"
FT                   /note="LactoCOG number LaCOG00053"
FT   CDS_pept        complement(74466..75251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0081"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71708"
FT                   /db_xref="GOA:Q033B4"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q033B4"
FT                   /protein_id="ABJ71708.1"
FT                   /translation="MTEEITQLKLSTIVKNPYQPRLVFDEDRLRELANSIKENGVLQPI
FT                   IVRKSKLIGYELLAGERRFQASKLAGLETIPAIIRTYSDEEMMTLSILENLQRENLNPL
FT                   EESKSLAQLSDKLGMTHDEIAKALGKSRSYVSNLIRLLGLPDKILKHVENRTLSPAHAR
FT                   TLLAEKNPKKQLELVDKIINEQLNVRELEAIIYGEEKVTDKSVSNSNINLFTDETEKEL
FT                   MKKLGNKVKIQANKKYQGKLSLHFDNLDELEHLIELLKK"
FT   gene            complement(75306..76565)
FT                   /locus_tag="LACR_0082"
FT                   /note="LactoCOG number LaCOG00054"
FT   CDS_pept        complement(75306..76565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0082"
FT                   /product="Recombination protein MgsA"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71709"
FT                   /db_xref="GOA:Q033B3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:Q033B3"
FT                   /protein_id="ABJ71709.1"
FT                   /translation="MVQNLARRMRPRNIDEIVGQRHLVGKGKIIRRMVETQLLSSMILY
FT                   GPPGIGKTSIASAIAGTMNIAFRTFNATTDTKKRLQEIASEAEFSGQLVLLLDEIHRLD
FT                   KPKQDFLLPLLENGQIILIGATTENPYFSVVPAIRSRVQIFELKALEPEDLESAVNLSL
FT                   QDKERGFDFDVTIDDDALYFLVHSTNGDLRSTFNALELAVLSSNEHRVTLDDMENSLQR
FT                   KAATFDKDGDAHYDLLSALQKSIRGSDVNASLHYAARLIEGGDLQSLARRLTVMAYEDI
FT                   GLANPDAAVHTVTALSAAEKLGFPEARIPLANIIIDLALSPKSNSAYLAMDEALSDLGK
FT                   YGNLAVPSHLQDGHYAGAKELGRSVEYQYAHNFPDHWVNQQYLPDKIKNADYFRPDDMG
FT                   RYEKALHSRKEWINEQKKRS"
FT   gene            complement(76609..77097)
FT                   /locus_tag="LACR_0083"
FT                   /note="LactoCOG number LaCOG02385"
FT   CDS_pept        complement(76609..77097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0083"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71710"
FT                   /db_xref="GOA:Q033B2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="UniProtKB/TrEMBL:Q033B2"
FT                   /protein_id="ABJ71710.1"
FT                   /translation="MEIRKIEPRDFVKVAQLENENWTLASTRHIMDSSAEKIISKIMSG
FT                   TTYLLAEEHGEILGILDYGFRHKSVFGKHIVTFGLMTAKEARGRGIATALINFFIDLAQ
FT                   KEGFKKITIQVMGSNPAALALYNKLGFVEEGRLKKEFFIDGDYVDDCFLAFYLDKSLM"
FT   gene            77270..77737
FT                   /locus_tag="LACR_0084"
FT                   /note="LactoCOG number LaCOG00055"
FT   CDS_pept        77270..77737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71711"
FT                   /db_xref="InterPro:IPR021380"
FT                   /db_xref="UniProtKB/TrEMBL:Q033B1"
FT                   /protein_id="ABJ71711.1"
FT                   /translation="MAKFGFLDVLEEVLEKGFSYDFEMNWDKRNFAVEISFLLEAENTS
FT                   GTLLTDAEGVESDENIVYEDAIIFYNPAKSSFDENDYLAAIPYTDKGLSREFLTYFAQF
FT                   LQESADQGLDDLMDFLADESAEEFSVKWDKEAFESGLSGLSETDFYKYPRY"
FT   gene            77767..79320
FT                   /locus_tag="LACR_0085"
FT                   /note="LactoCOG number LaCOG00056"
FT   CDS_pept        77767..79320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0085"
FT                   /product="ATPase component of ABC transporter with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71712"
FT                   /db_xref="GOA:Q033B0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q033B0"
FT                   /protein_id="ABJ71712.1"
FT                   /translation="MSILNVKNLSHGFGDRAIFEDVSFRLLKGEHIGFVGANGEGKSTF
FT                   MNIITGTLVPDEGKVIWSKKHRVGYMDQHAALGKGKTTREALAEAFQYLFDIEEEINDT
FT                   YLKMAEMSEDEMNAALENVGELQEELDNSDFYLIDAKVEETARGLGLTPLLDKDVAELS
FT                   GGQRTKILLGKLLLEKPDILLLDEPTNYLDEEHILWLKNYLKNYENAFILISHDVPFMD
FT                   EVVNIIYHVHGLGITRYSMGYAEFERVFEEKKAQLEALHNAQVAEQAKLKDFIARKKAN
FT                   VATSGQAKAREKKLAKMEIVETISEKPKPQFDFKFSRKPSRLIFEAKDLVIGYNEPLSS
FT                   EINLKVESGQKIAFIGSNGIGKSTLLKSLMGLIPSLDGEVEKGNFQEIAYYEQEIKNPS
FT                   QKTVLDDLWDEYPSWNQAELRGALARVGLTAKQIESRVYVLSGGEQAKLRFAKLMNTES
FT                   NILILDEPTNHLDVDAKDELKRALIAYPGTVLMVSHEPEFYEGLVSDVINCEEWTTRIL
FT                   "
FT   gene            79395..79679
FT                   /locus_tag="LACR_0086"
FT                   /note="LactoCOG number LaCOG02386"
FT   CDS_pept        79395..79679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71713"
FT                   /db_xref="UniProtKB/TrEMBL:Q033A9"
FT                   /protein_id="ABJ71713.1"
FT                   /translation="MTQTPYPWENPQQDYKVTLAKRRSERRYRSLQLAKALEILLTKFK
FT                   KYNVNKFNSEILDWIEELRNNAEYIDDEDFSSAKKFVAKMKRELKKLEK"
FT   gene            79713..80453
FT                   /locus_tag="LACR_0087"
FT                   /note="LactoCOG number LaCOG00632"
FT   CDS_pept        79713..80453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0087"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71714"
FT                   /db_xref="GOA:Q033A8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q033A8"
FT                   /protein_id="ABJ71714.1"
FT                   /translation="MKASLQNYFDQWESPWMQLYYRMVWEQLSAEISLTDKKILDFGSG
FT                   FGWNANHLADRNSVIAIEPNSEMVKNRQQTNHYQQITGGLSELRKFNDEGFDLIICHNV
FT                   FEYASDERAEILREFDRLLSKNGLISIVKHNYAGALMQKIVFENALDEAHDLLTGSSKT
FT                   NQMFGKIHYYELADLLSTDSSLKIHKTYGLRTFWALQPNEFKIEPDWADKMFKVEWEVC
FT                   DKPEFAAISFFNHLILRKNNDDHL"
FT   gene            80440..80928
FT                   /locus_tag="LACR_0088"
FT                   /note="LactoCOG number LaCOG02387"
FT   CDS_pept        80440..80928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71715"
FT                   /db_xref="UniProtKB/TrEMBL:Q033A7"
FT                   /protein_id="ABJ71715.1"
FT                   /translation="MTIYKFQAELEIIGINPFVALPIDILQHIFIDSGREKSPIAIFGQ
FT                   VNGKDYKQNLMFFKGDWRLYVNTTMLKNSPKRIGELVDFTIAYDSEPRMVKQPQVLSEA
FT                   LAKNLEAKEVFEQLTASKQLEINRYIARLKTDEAIERNVARAIGFLLGKNRFVGRDKP"
FT   gene            80941..81894
FT                   /locus_tag="LACR_0089"
FT                   /note="LactoCOG number LaCOG00057"
FT   CDS_pept        80941..81894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0089"
FT                   /product="[LSU ribosomal protein L11P]-lysine
FT                   N-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71716"
FT                   /db_xref="GOA:Q033A6"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q033A6"
FT                   /protein_id="ABJ71716.1"
FT                   /translation="MNNWNSITIKISREAEEAISALLIEAGSAGVEINDSADYLNHEDQ
FT                   FGEVLPEIEQSELVDITAYYPENMPIVELKAEIEHKIANLADYFSLTGLSVTTNNLSET
FT                   NWAEAWKKYFEPARITHDLTIVPSWTKDYLATGSEKLIRLDPGMAFGTGTHPTTKMSLY
FT                   ALEQVLRGGETLLDVGTGSGVLSVAATYLGAAEIFAYDIDEVAVRVALENIELNPGHEK
FT                   IHVSANNLLEGIDKKADVIVANILADILVLMTDDAFRLVKEEGYLIMSGIIADKADMVI
FT                   ASAENAGFFLETRLIQGEWNCLIFKKTENREGVIGG"
FT   gene            82014..82766
FT                   /locus_tag="LACR_0090"
FT                   /note="LactoCOG number LaCOG00058"
FT   CDS_pept        82014..82766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71717"
FT                   /db_xref="GOA:Q033A5"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q033A5"
FT                   /protein_id="ABJ71717.1"
FT                   /translation="MANQYFVFKELPKIGEKFTIENQAAAHHIFTVMRAQAGDQLRLVF
FT                   EEGKIGLSEIISPADQSVRLIELLTDSSELPVQVTVAVGFPKGDKLDFIVEKSTELGAT
FT                   AIWSAPFKASVSKWDHKKLTKKQEKLEKVALGAAEQSRRQLIPKIQLFDQFSRLTEQFS
FT                   DFDQVLVAYEESAKMGETSMFKQALTELSANQKVLIIFGPEGGISPDEIAKFENLGAKM
FT                   IGLGPRILRAETAPLYALSSISAYFELL"
FT   gene            82796..83752
FT                   /locus_tag="LACR_0091"
FT                   /note="LactoCOG number LaCOG00059"
FT   CDS_pept        82796..83752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0091"
FT                   /product="Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71718"
FT                   /db_xref="GOA:Q033A4"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q033A4"
FT                   /protein_id="ABJ71718.1"
FT                   /translation="MKKRVQSNKKRIRWASVLTVFVLLIGIIAIAFAAVHLLSPKANTS
FT                   QKSSQTSRQEKTKSTVPSSSSQPKETKWLTGTNENQLPILMFHYVTSRADQLPQDSNNI
FT                   NIVTFENELKALKSQGYTTVSGTDAQKILTTKEKPSDKMVWLTFDDGSVTMYTDIFPLL
FT                   KKYNMHATNFIITGFVNKAQGGILSWEQIKEMKASGLVDFGSHTVSHPDLGTQTLEDQR
FT                   PELEQSKADLDKNLNQQTNMICYPAGGYNQNTLSLSTELGYKFGLLDPGRNGVVAQAAK
FT                   ESDGLLTLPRFRMMSSTTAEEMMQMIQPATDYNEKNK"
FT   gene            83953..86175
FT                   /locus_tag="LACR_0092"
FT                   /note="LactoCOG number LaCOG00060"
FT   CDS_pept        83953..86175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0092"
FT                   /product="Guanosine polyphosphate
FT                   pyrophosphohydrolase/synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71719"
FT                   /db_xref="GOA:Q033A3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:Q033A3"
FT                   /protein_id="ABJ71719.1"
FT                   /translation="MPSEPVLTGAEVVNICSEYMNETDLLLVEKALACASLAHADQYRA
FT                   SGEAYFVHPTQVAGILAKLKLDAVTVSCGFLHDVVEDTNFTQGDLQELFGDEIAEIVDG
FT                   VTKLGKVEYKSHEEQLAENHRKMLMAMSKDIRVILVKLADRLHNMRTLKHLRPDKQKRI
FT                   SRETMEIYAPLAHRLGIASIKWELEDLSFRYLEEAEFYRIRGLMNEKRTAREALVTEVI
FT                   GKLQERVEKAGVDAEIYGRPKHIYSIYRKMHDKKKRFDEIYDLIAIRCITETTSDVYTT
FT                   LGYIHDLWKPMPGRFKDYIANPKANGYQSVHTTVYGPKGPMEFQIRTREMHQIAEYGVA
FT                   AHWAYKQGIKSKVDVHEISETLNWIHELVELREEAGDSAEDFVKAVQEDILSDKIYVFT
FT                   PNGEVQELPRGSGPIDFAYAIHTKVGDHATGAKVNGRMKPLSVQLKTGDRVEIITSSSS
FT                   FGPSRDWINLVKTNKARNKIKQFFKNQDKELSVNKGREMLQEALEEAGFVPNQYLDKKH
FT                   LDEVFNKISYRNAEALYAAIGFGELSATTIANRLTENERREAERAKQKAEAEELMKGEV
FT                   KRESSKNIMKIRHDGGVSVSGIDSLLVRIAKCCNPVPGDQIVGYITKGRGVSVHRADCQ
FT                   NVRSMEDFEQRLVEVEWDDSENLVKEYVANIDVYGFNRPGLLNDVMQVLSNSTKNLISI
FT                   NAQPTKDKKMANIHIALGIKNLSDLTLIVDKIKMTPDVYSVKRTNA"
FT   gene            complement(86529..87124)
FT                   /pseudo
FT                   /locus_tag="LACR_0093"
FT   gene            87382..87837
FT                   /locus_tag="LACR_0094"
FT                   /note="LactoCOG number LaCOG00062"
FT   CDS_pept        87382..87837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0094"
FT                   /product="D-Tyr-tRNAtyr deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71720"
FT                   /db_xref="GOA:Q033A2"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q033A2"
FT                   /protein_id="ABJ71720.1"
FT                   /translation="MKIVIQRVKSASVSIDGKIKEKINQGFLLFVGVEDADSNFDLDYA
FT                   VRKIAQMRIFSDEADKMNLSVQDIQGEILSISQFTLYAETKKGNRPSFSAAGKPYFAKA
FT                   MYEKFNDSLAQIVPVKAGVFGADMQVELINDGPVTIILDTKEARKNA"
FT   gene            87830..88834
FT                   /locus_tag="LACR_0095"
FT                   /note="LactoCOG number LaCOG00063"
FT   CDS_pept        87830..88834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0095"
FT                   /product="Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71721"
FT                   /db_xref="GOA:Q033A1"
FT                   /db_xref="InterPro:IPR010617"
FT                   /db_xref="UniProtKB/TrEMBL:Q033A1"
FT                   /protein_id="ABJ71721.1"
FT                   /translation="MPKRLQKSRVKKQAPARSVSKTKTFQSLKKSEQSDQVGEIWQNNI
FT                   IQSLDEDYSKEQARKQQNKKMTERQKRKIEEMQSNPEMIQAREELKEEFLNTHPQYAKM
FT                   TSEELQESMTRHALEDEKLRKQKLRHHIEAFADGIIAVIITIMLLEILVPSGNQGYWGF
FT                   LSSAGIFLVSFVVTANFWFNRHKIFALTEEITEKIIVQDFIFIGLLSLIPLLTKWIMVA
FT                   PTSFSAFNFGLVLIVILLQQELLSYSITKDHFRKMPKSFKFWRRVWTIRLFSTILMNIA
FT                   IMIIAIIFPFYGHWLFVIVPVFNFLFRMVNDRNQEEEVYAATRSIGVPYLKEG"
FT   gene            88837..89460
FT                   /locus_tag="LACR_0096"
FT                   /note="LactoCOG number LaCOG00064"
FT   CDS_pept        88837..89460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0096"
FT                   /product="Predicted hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71722"
FT                   /db_xref="GOA:Q033A0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q033A0"
FT                   /protein_id="ABJ71722.1"
FT                   /translation="MTVKNIIFDLGGVILDLGFTRMINSFEQLGVKDFSSYFNPQKQVD
FT                   FFEELELGLISPDVFYDEFRKATKSQLTDEVIEENWNLILKDFQKERMNLLTDLSADFS
FT                   LYLFSNTNAIHAKCFEQRCIEQMGQPLATYFTKAYYSHELHLRKPTVESFHEVLRQSNL
FT                   KADETLFIDDNADNILGAQAAGLKTYHLKAPEVLTEIDFNKIIY"
FT   gene            89594..90991
FT                   /locus_tag="LACR_0097"
FT                   /note="LactoCOG number LaCOG00065"
FT   CDS_pept        89594..90991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0097"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71723"
FT                   /db_xref="GOA:Q032Z9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q032Z9"
FT                   /protein_id="ABJ71723.1"
FT                   /translation="MGFMRKADFELYRDADKHYNQVLTTRDFLALGVGTIISTSIFTLP
FT                   GQVAAQFAGPGVVFSYLLAALVAGFVALAYAEMSTVMPFAGSAYSWISVLFGEGFGWIA
FT                   GWALLAEYFIAVAFVGSGFSANLQQLLAPLGFHLPKVLANPFGTDGGIVDIISLLVILL
FT                   SAIIVFRGASDAGRISQILVVLKVAAVIAFIIVGITVIKPANYHPFIPPHNPKTGFGGF
FT                   SGIWSGVSMIFLAYIGFDSIAANSAEAKNPQKTMPRGIIGSLLIAVVLFAAVTLVLVGM
FT                   HPYSAYAGNAAPVGWALQQSGYSVLSEVVTAIALAGMFIALLGMVLAGSRLLYAFGRDG
FT                   LLPKGLGKMNARNLPANGVWTLAIVAIVIGAFFPFAFLAQLISAGTLIAFMFVTLGIYS
FT                   LRRRQGKDLPEATYKMPFYPVLPALGFIGSLFVFWGLDVQAKLYSGIWFLIGIAIYFAY
FT                   GNRRKKK"
FT   gene            91161..91802
FT                   /locus_tag="LACR_0098"
FT                   /note="LactoCOG number LaCOG00066"
FT   CDS_pept        91161..91802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0098"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71724"
FT                   /db_xref="GOA:Q032Z8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q032Z8"
FT                   /protein_id="ABJ71724.1"
FT                   /translation="MKEYEKQHRIFYVFLRNLVAFLLFIFNGKSKYYNIDRIPKDENYI
FT                   LVAPHRMAWEPVWFAFATRPKQFIFMAKKELFKGFGGWWIKMCGAFPVDRENPGTKPLK
FT                   HAVKMLKESDKSMIMFPSGSRHSAEMKGGVAVIAKMAKVRIVPAVYQGPLTMKGIFKRQ
FT                   KVAINVGHPIDISDIKKMNEEGIAEVNRRMEVAFAELDKELNPDFHYEAK"
FT   gene            complement(91833..92342)
FT                   /locus_tag="LACR_0099"
FT                   /note="LactoCOG number LaCOG00067"
FT   CDS_pept        complement(91833..92342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0099"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71725"
FT                   /db_xref="GOA:Q032Z7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q032Z7"
FT                   /protein_id="ABJ71725.1"
FT                   /translation="MNSANLDKKISKELHELRHATDNRSQERKWILEQVNDDKLEKEVL
FT                   TLSVVALHILSALTKKDLTGIELATKLSVTRGGVTRAVQNLIKHQFLTTYQADNDKKKI
FT                   YYHITTKGLKVASIHDKMHKIMDLKLGQIFDKYNENEKSIILNFLSDFNLTEGQIFDST
FT                   QTDKKL"
FT   gene            complement(92509..93152)
FT                   /pseudo
FT                   /locus_tag="LACR_0100"
FT   gene            93327..95924
FT                   /locus_tag="LACR_0101"
FT                   /note="LactoCOG number LaCOG00069"
FT   CDS_pept        93327..95924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0101"
FT                   /product="protein translocase subunit secA"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71726"
FT                   /db_xref="GOA:Q032Z6"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032Z6"
FT                   /protein_id="ABJ71726.1"
FT                   /translation="MPNIIRKLVENDKKELKKLNKMALQVESFADEMEHLTDEQLKAKT
FT                   PELKERIAKGESLDDLLYEAFAVCREAARRVLGLYPFHVQIMGGIVLHNGDVPEMRTGE
FT                   GKTLTATMPVYLNALSGKGVHVVTVNEYLATRDMTEMGELYSWLGLTVGLNLNSKSPEE
FT                   KREAYNCDITYSTSAELGFDYLRDNMVTRAVDMVQKPLNYALVDEVDSILVDEARTPLI
FT                   ISGQAESSSALYYRADQFTKTLKGQNLNVATSDYEEGDDYKIDLQSKTISLTEEGIDKA
FT                   EKFFQIENLYDMENVALTHFVDNALRANFIMLHDIDYMVDENQEVLIIDQFTGRTMPGR
FT                   RYSDGLHQAIEAKEAVPIQDESKTMASITIQNYFRMYKKLSGMTGTAKTEEEEFREIYN
FT                   IQITPIPTNRPVQRLDHPDLLYPTLEAKFKAVIDDIKRRHAEGQPILIGTVAVETSELI
FT                   SKKLVEAKIPHEVLNAKNHFREAQIIMNAGQQGAVTIATNMAGRGTDIKLGPGVIDHAD
FT                   PEFRGLAVIGTERHESRRIDNQLRGRSGRQGDPGVSQFYLSLEDELMKRFGSERVSAFL
FT                   DRMRISGEDAVIKSGLITRQIESSQKRVEGNNYDSRKQVLQYDDVIREQREVIYAQRQE
FT                   VILTKEDMTPVLMGMFKRTIDRQVDGHELAGNLKDEETVKDLLQTVQNTMLPEEAIELS
FT                   ELTGLSGQAMKDLIFDKVKSRYASQMEKLADPERQLEFQRAVILRVVDNNWSEHIDALD
FT                   QMRQSVGLRGYAQNNPIVEYQEESYKMYNNMIGAIEFEVTRLMMKAQIQPQTAIRQEAP
FT                   RMTTTASQENITNVGPDTSVSEEISFENVGRNDPCPCGSGKKFKNCHGRTHIA"
FT   gene            96054..97091
FT                   /locus_tag="LACR_0102"
FT                   /note="LactoCOG number LaCOG02563"
FT   CDS_pept        96054..97091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0102"
FT                   /product="3-deoxy-D-arabinoheptulosonate-7-phosphate
FT                   synthase"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71727"
FT                   /db_xref="GOA:Q032Z5"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q032Z5"
FT                   /protein_id="ABJ71727.1"
FT                   /translation="MTFKEISPKINIDAIKMLGHLNSEQQEKKMLRDKELEAIIKGEDD
FT                   RLLLIIGPCSSDNEEAVLEYARRLAKLQEAVKDKIFMVMRVYTAKPRTNGDGYKGLIHE
FT                   PDADGHTDLINGIKMVRDLHYKVITETGLTTADEMLYPENLPMVDDLVSYHAIGARSVE
FT                   NQQHRFVASGIDVPTGLKNPTSGNLKVMFNGIYAAQQSQDFLFGRVEVQTSGNPLAHAI
FT                   LRGGQDENGKYHPNYYTDNLLETIEIYEKMGLKNPFILIDTNHDNSGKKFMEQIRIVRQ
FT                   TLVNRDWDDKIRQNVRGFMIESYLEDGRQDKPEVFGKSITDPCLGWDKTEALVQEIYEA
FT                   ESKNK"
FT   gene            97340..97606
FT                   /locus_tag="LACR_0103"
FT                   /note="LactoCOG number LaCOG00070"
FT   CDS_pept        97340..97606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0103"
FT                   /product="Phosphotransferase system, HPr-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71728"
FT                   /db_xref="GOA:Q032Z4"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q032Z4"
FT                   /protein_id="ABJ71728.1"
FT                   /translation="MASKEFHIVAETGIHARPATLLVQTASKFTSEITLEYKGKSVNLK
FT                   SIMGVMSLGVGQGADVTISAEGADADGAIATIAETMTKEGLAE"
FT   gene            97609..99336
FT                   /locus_tag="LACR_0104"
FT                   /note="LactoCOG number LaCOG00071"
FT   CDS_pept        97609..99336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0104"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71729"
FT                   /db_xref="GOA:Q032Z3"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q032Z3"
FT                   /protein_id="ABJ71729.1"
FT                   /translation="MTTMLKGIAASSGVAVAKAYLLVQPDLSFETKTIADTANEEARLD
FT                   AALATSQSELQLIKDKAVTTLGEEAASVFDAHMMVLADPDMTAQIKAVINDKKVNAESA
FT                   LKEVTDMFIGIFEGMTDNAYMQERAADIKDVTKRVLAHLLGVKLPSPALIDEEVIIVAE
FT                   DLTPSDTAQLDKKFVKAFVTNIGGRTSHSAIMARTLEIPAVLGTNNITELVSEGQLLAV
FT                   SGLTGEVILDPSAEQQSEFHKAGDAYAAQKAEWAALKDAETVTADGRHYELAANIGTPK
FT                   DVEGVNDNGAEAVGLYRTEFLYMDAQDFPTEDDQYEAYKAVLEGMNGKPVVVRTMDIGG
FT                   DKTLPYFDLPKEMNPFLGWRALRISLSTAGDGMFRTQLRALLRASVHGQLRIMFPMVAL
FT                   VTEFRAAKKIYDEEKAKLIAEGVPVAEGIEVGIMIEIPAAAMLADQFAKEVDFFSIGTN
FT                   DLIQYTMAADRMNEQVSYLYQPYNPSILRLINNVIKAAHAEGKWAGMCGEMAGDQTAVP
FT                   LLMGMGLDEFSMSATSVLQTRSLMKRLDSKKMEELSSKALSECATMEEVIALVEEYTK"
FT   gene            99511..99819
FT                   /locus_tag="LACR_0105"
FT                   /note="LactoCOG number LaCOG02389"
FT   CDS_pept        99511..99819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71730"
FT                   /db_xref="GOA:Q032Z2"
FT                   /db_xref="UniProtKB/TrEMBL:Q032Z2"
FT                   /protein_id="ABJ71730.1"
FT                   /translation="MKKLNFFDYWLIGELIFCLILLLILPQQIKLNFWIILTSKETSGS
FT                   VLNIFVLPLIMALPNIIQRSVSKSGIYWSKLRVTTLIFNIILLLLTTFWLLTLPFGQ"
FT   gene            complement(99909..100208)
FT                   /locus_tag="LACR_0106"
FT                   /note="LactoCOG number LaCOG00072"
FT   CDS_pept        complement(99909..100208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71731"
FT                   /db_xref="GOA:Q032Z1"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032Z1"
FT                   /protein_id="ABJ71731.1"
FT                   /translation="MMNMQSMMKQAQKLQKQMQVSQEEIANTTFVGKSAQDLVTVEFSG
FT                   DRTLKSLNINPDVIDPEDPETLQDMVTDAVNDALSQIEKVTEQKLGKFTKGLPF"
FT   gene            100313..100600
FT                   /locus_tag="LACR_0107"
FT                   /note="LactoCOG number LaCOG02384"
FT   CDS_pept        100313..100600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0107"
FT                   /product="Serine
FT                   hydroxymethyltransferase/Phosphoribosyl-dephospho-CoA
FT                   transferase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71732"
FT                   /db_xref="GOA:Q032Z0"
FT                   /db_xref="UniProtKB/TrEMBL:Q032Z0"
FT                   /protein_id="ABJ71732.1"
FT                   /translation="MKLTKNQEELLNLIYQVVLEQTVSPKEREYFIDAKKRIELGKNFD
FT                   SEMSELLKELMYIPNSPVVNQFTEEARKRMLVGPSTGGTTHGFLNYQTKK"
FT   gene            complement(100707..100795)
FT                   /locus_tag="LACR_t0108"
FT                   /note="tRNA_Leu_AAG"
FT   tRNA            complement(100707..100795)
FT                   /locus_tag="LACR_t0108"
FT                   /product="tRNA-Leu"
FT   gene            complement(100880..101815)
FT                   /locus_tag="LACR_0109"
FT                   /note="LactoCOG number LaCOG00073"
FT   CDS_pept        complement(100880..101815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0109"
FT                   /product="hydrolase of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71733"
FT                   /db_xref="GOA:Q032Y9"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q032Y9"
FT                   /protein_id="ABJ71733.1"
FT                   /translation="MKKSLRKRIWTILIAIISVLLILNLGATLYFYQIACVRNNQPIGQ
FT                   VKTSSPNYSLVQKFNKLPKSTETLTNNDLKLDAWYVPAEQKTNNTVIVVHGFRQDKSAM
FT                   RHYGQLFHELGYNVLMPDNRGAGNSQGNFITFGYHDKFDVIAWAKYLTDKNPESHISLY
FT                   GLSMGASTVMMASSEKSLPSSVKNIIEDCGYTNAWDEIVYQAKESYNIPAFPLVYSVSL
FT                   ESKIRQGWFFQEASATKALAKDKLPILLIHGRKDTYVPTSMVYENYKSVKPGTPKEMLV
FT                   VKNAAHARSFETNPTLYRQTISKFMKTYNP"
FT   gene            101956..102414
FT                   /locus_tag="LACR_0110"
FT                   /note="LactoCOG number LaCOG02627"
FT   CDS_pept        101956..102414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0110"
FT                   /product="Surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71734"
FT                   /db_xref="UniProtKB/TrEMBL:Q032Y8"
FT                   /protein_id="ABJ71734.1"
FT                   /translation="MIEKCKEWKKLNMKKGIIAFLTVLTILLTGAVKVSADSTQAEIYR
FT                   LYNKNTGEHFYTSSAFERDSVNKSGWSYEGVGWIAPKKSSTPIYRVFNPNAKGGDHYYT
FT                   KSNYEANQLVKKGWKWDNKGQPVFYSGGNIPVYVAFNPNASSGSHNFT"
FT   gene            102583..103365
FT                   /locus_tag="LACR_0111"
FT   CDS_pept        102583..103365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71735"
FT                   /db_xref="UniProtKB/TrEMBL:Q032Y7"
FT                   /protein_id="ABJ71735.1"
FT                   /translation="MEESNVSKLGPVTVEVSADLNLTGSGRGYHGKLMLGDMNGSNVSF
FT                   GIQYDAKSGLDDGQWGGKGVYLSENVAGGGVHEGGNALYVAYGPAPIGKKVHLSLAYYQ
FT                   SRQLVAFFADGVLMGSQKVSFNATKSTTNAILNQDRTGLTETNALYMISAQGATAFGGD
FT                   SINAVFTNIKTGGVPVGYEDWVDKPGNGALNWWNILAKNYSSTYQSNGIADSQKIPENA
FT                   QVTVNGTCNLPAGYDWDSFPGAKQPTGGIQIPAGIPLN"
FT   gene            103551..103871
FT                   /locus_tag="LACR_0112"
FT                   /note="LactoCOG number LaCOG00074"
FT   CDS_pept        103551..103871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0112"
FT                   /product="Membrane transporter of cations and cationic
FT                   drugs"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71736"
FT                   /db_xref="GOA:Q032Y6"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q032Y6"
FT                   /protein_id="ABJ71736.1"
FT                   /translation="MTWIYLLIAGIFEVVWATTMKLSHRFSNIKFTLLTIIGMVASFGF
FT                   LALALKKLPLGIAYPIWTGIGAVGSILIGLIIFKDKVPPLTWLFIACLVVGIIGIKVTS
FT                   GH"
FT   gene            103994..105157
FT                   /locus_tag="LACR_0113"
FT                   /note="LactoCOG number LaCOG00075"
FT   CDS_pept        103994..105157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0113"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71737"
FT                   /db_xref="GOA:Q032Y5"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q032Y5"
FT                   /protein_id="ABJ71737.1"
FT                   /translation="MKNKKSMMNLAISNLFLVFLGAGLVIPVLPTLKEQMHFSGTTMGM
FT                   MISIFAIAQLIASPIAGALSDKIGRKKLIAIGMIIFSFSELLFGLAQAKTGFYISRALG
FT                   GVAAAMLMPSVTAYVADMTTISERPKAMGLVSAAISGGFIIGPGVGGFIAHFGIRVPFY
FT                   VAAILAFIGFILTITILKEPERTMEANHETEKVSFLDILKNPLFGSLFIIILISSFGLQ
FT                   AFESIYSIMASINFGFSMGEIALVITVSGILALFFQLFLFDTIVNKIGELGLIQLTFFA
FT                   SAIFIAIIAFTKTNLVVALSTFVVFLAFDLFRPAVTTYLSKHAGNRQGAINGLNSAFTS
FT                   FGNILGPMAAGYMFDINHLFPYYISAIILLGTGFLSLFLNRKNWGKA"
FT   gene            105540..105800
FT                   /locus_tag="LACR_0114"
FT                   /note="LactoCOG number LaCOG00049"
FT   CDS_pept        105540..105800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0114"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71738"
FT                   /db_xref="GOA:Q02VB5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q02VB5"
FT                   /protein_id="ABJ71738.1"
FT                   /translation="MQKRYSKEFKETLIAFYHSGQSVTQLSKEYDVAPATIYKWIDLYS
FT                   KSNESSISKADFLELKRQLAKVKEERDILKKVLTIFAEKKK"
FT   gene            105797..106642
FT                   /locus_tag="LACR_0115"
FT                   /note="LactoCOG number LaCOG00439"
FT   CDS_pept        105797..106642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0115"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71739"
FT                   /db_xref="GOA:Q032Y3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q032Y3"
FT                   /protein_id="ABJ71739.1"
FT                   /translation="MSAADMAQTIQTLALNVRLSCQLLDVPESSYYERINRHPSKTQLR
FT                   RQYLSLKISQLFNANRGIYGAPKIHHLLLKQGEKVGLKLVQKLMKQLQLKSVVIKKFKP
FT                   GYSLSDHINRKNLIQTEPTKKNKVWSTDITYIPTQQGWAYLSTIMDRYTKKVIAWDLGN
FT                   RMTVELVQRTLNKAIKSQDYPEAVILHSDQGSQYTSLEYEEFLKYYGMTHSFSRRGYSY
FT                   HNASLESWHGHLKREWVYQFKYKNFEEAYQSIFWYIEAFYNSKRIHQSLGYLTPNQFER
FT                   "
FT   gene            106727..107902
FT                   /locus_tag="LACR_0116"
FT                   /note="LactoCOG number LaCOG00809"
FT   CDS_pept        106727..107902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0116"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71740"
FT                   /db_xref="GOA:Q02ZC5"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q02ZC5"
FT                   /protein_id="ABJ71740.1"
FT                   /translation="MTQFTTELLNFLAQKQDIDEFFRTSLETAMNDLLQAELSAFLGYE
FT                   PYDKVGYNSGNSRNGSYSRQFETKYGTVQLSIPRDRNGNFSPALLPAYGRGDDHLEEMV
FT                   IKLYQTGVTTREISDIIERMYCHHYSPATISNISKATQENVATFHERSLEANYSVLFLD
FT                   GTYLPLRRGTVSKECIHIALGITPEGQKAVLGYEIAPNENNASWSTLLDKLQNQGIQQV
FT                   SLVVTDGFKGLEQIISQAYPLAKQQRCLIHISRNLASKEKRADRAVILEQFKTIYRAEN
FT                   LEMAVQALENFIAEWKPKYRKVMESLENTDNLLTFYQFPYQIWHSIYSTNLIESLNKEI
FT                   KRQTKKKVLFPNEEALERYLVTLFEDYNFKQSQRIHKGFGQCADTLESLFD"
FT   gene            108156..108958
FT                   /pseudo
FT                   /locus_tag="LACR_0117"
FT   gene            108942..110177
FT                   /locus_tag="LACR_0118"
FT   CDS_pept        108942..110177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71741"
FT                   /db_xref="GOA:Q032Y1"
FT                   /db_xref="UniProtKB/TrEMBL:Q032Y1"
FT                   /protein_id="ABJ71741.1"
FT                   /translation="MNKKAKIPLLLVIIFYALYFTLTKVDWMSGDAQWFSKVDSSPISF
FT                   VIKRYETWSSRFWIEGATLIASKHLILFYIFTVILTLLFFYSLSELFSFNEYDSNLVLV
FT                   VFFMALFPVVSLQSAGPIATIVNYIWPSALFLYWLMTDRHRKMKNIGSLQNSLSILFLG
FT                   LAVFNEGLAIILCLYLILCLIVEKKNFFNTYRMICLVISLLSFLNVLLCPGNQNREMLE
FT                   MARWFPTFNHLSFLDKILIQFNNIASNLIVSHNLLEVLVILLFIKAIQRRQRLSIILSG
FT                   AVIMLTSAYHQLISDRLSVIVKESPEKEFNQQIIGTLLKPTLIFATLILLIVLIIILLY
FT                   GKSKTSLMIIASIVITFSSAMAISLSPTLLASADRPLLFLYFALVFNCIFLVNDLSEFN
FT                   ERKASIIMDKSK"
FT   gene            110318..110500
FT                   /locus_tag="LACR_0119"
FT   CDS_pept        110318..110500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71742"
FT                   /db_xref="UniProtKB/TrEMBL:Q032Y0"
FT                   /protein_id="ABJ71742.1"
FT                   /translation="MLSDTKVINITIGKINHFFLTFYHKTLIKIVFKEPNIFDILDISK
FT                   ENKGFDNIFVFLVNV"
FT   gene            110576..110716
FT                   /locus_tag="LACR_0120"
FT   CDS_pept        110576..110716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71743"
FT                   /db_xref="UniProtKB/TrEMBL:Q032X9"
FT                   /protein_id="ABJ71743.1"
FT                   /translation="MNLSEIHRIVYNICKKEYLYMKRKKDTLVNLNDTIKRVIVNVQPK
FT                   I"
FT   gene            complement(110768..111622)
FT                   /locus_tag="LACR_0121"
FT                   /note="LactoCOG number LaCOG00439"
FT   CDS_pept        complement(110768..111622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0121"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71744"
FT                   /db_xref="GOA:Q032X8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q032X8"
FT                   /protein_id="ABJ71744.1"
FT                   /translation="MSAADMAQTIQTLALNVRLSCQLLDVPESSYYQRINRHPSKTQLR
FT                   RQYLSLKISQLFNANRGIYGAPKIHHLLLKQGEKVGLKLVQKLMKQLQLKSVVIKKFKP
FT                   GYSLSDHINRKNLIQTEPTKKNKVWSTDITYIPTQQGWAYLSTIMDRYTKKVIAWDLGK
FT                   RMTVELVQRTLNKAIKSQDYPEAVILHSDQGSQYTSLEYEELLKYYGMTHSFSRRGYPY
FT                   HNASLESWHGHLKREWVYQFKYKNFEEAYQSIFWYIEAFYNSKRIHQSLGYLTPNQFEK
FT                   VSA"
FT   gene            complement(111619..111879)
FT                   /locus_tag="LACR_0122"
FT                   /note="LactoCOG number LaCOG00049"
FT   CDS_pept        complement(111619..111879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0122"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71745"
FT                   /db_xref="GOA:Q02W89"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q02W89"
FT                   /protein_id="ABJ71745.1"
FT                   /translation="MQKRYSKEFKETLIAFYHSGQSVTQLSKEYDVAPATIYKWIDLYS
FT                   KSNESSVSKADFLELKRQLAKVKEERDILKKVLTIFAEKKK"
FT   gene            111938..113074
FT                   /pseudo
FT                   /locus_tag="LACR_0123"
FT   gene            complement(113775..113861)
FT                   /locus_tag="LACR_t0124"
FT                   /note="tRNA_Ser_CGA"
FT   tRNA            complement(113775..113861)
FT                   /locus_tag="LACR_t0124"
FT                   /product="tRNA-Ser"
FT   gene            114024..115217
FT                   /locus_tag="LACR_0125"
FT                   /note="LactoCOG number LaCOG00076"
FT   CDS_pept        114024..115217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0125"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71746"
FT                   /db_xref="GOA:Q032X6"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032X6"
FT                   /protein_id="ABJ71746.1"
FT                   /translation="MGNKKIVLAYSGGLDTSVAVKWLTDKGFDVIAACMDVGEGKDLNF
FT                   IHDKALQVGAVESVVLNCKAEFAEIFVGAALKGNLMYENKYPLVSALSRPLIAKKLVEV
FT                   AKEKGATAIAHGCTGKGNDQVRFEVAIHSLAPELEVIAPVREWHWAREEEIEYANQNGV
FT                   PIPADLDNPYSIDMNLWGRAIEAGVLENPWNTCPEDAFFMINSVEDAPNEPEFIEVEFK
FT                   EGLPIALNGKIMELHEIIKEVNIIAGKHGVGRIDHIENRLVGIKSREFYECPAAITLLK
FT                   AHKDLEDLTFVRELAHFKPVLENELANLIYNGLWFNPATKALIAYLDETQKVVNGIVRI
FT                   KLYKGLATPIGRKSTNSLYSEKLATYTAADEFDQAAAVGFIKLWGLPTQVNAQVNLK"
FT   gene            115246..116625
FT                   /locus_tag="LACR_0126"
FT                   /note="LactoCOG number LaCOG00077"
FT   CDS_pept        115246..116625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0126"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71747"
FT                   /db_xref="GOA:Q032X5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032X5"
FT                   /protein_id="ABJ71747.1"
FT                   /translation="MVEKLWGGRFEASLDKQTEEFGASIKFEQRLAPFDLKGSLAHVKM
FT                   LGETGIITAEEATTIANGLIKVEEKLMKGQIEFKIENEDIHMNMETYLHDEIGPLAGKL
FT                   HTARSRNDQVATDMHLYLKSVLSDLLKALRTLRETIVNLSVNHVDTLMPGYTHLQHAQP
FT                   ISFAQHLMAYYQMFTRDFDRFEFNVKHTDMNPLGAAALAGTTFPIDRELTTNLLQFEKA
FT                   YANSMDAVSDRDFILEFLSNSSLLMMHLSRLCEELLLWSSHEFNFVSLSDNYSTGSSIM
FT                   PQKKNPDMAELIRGKSGRVYGNLMSLLTVMKGLPLTYNKDLQEDKEGMFDSADTILTSL
FT                   SVMDGMLSTMTVNRVNMEKATEQDFSNATELADYLAAKGLPFREAHELVGQLVLTCIKK
FT                   GIYLQEVSLKDYQALSQLIEEDVYEILQSRTAVSRRNSLGGTGFESIKKQIEQAKKELQ
FT                   K"
FT   gene            complement(116642..117838)
FT                   /locus_tag="LACR_0127"
FT                   /note="LactoCOG number LaCOG00078"
FT   CDS_pept        complement(116642..117838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0127"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71748"
FT                   /db_xref="GOA:Q032X4"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q032X4"
FT                   /protein_id="ABJ71748.1"
FT                   /translation="MKESWQRNLIVLWFGTFMTGIGSSLISPFISLYIGTLGHYSKTEL
FT                   NIWSGLVFSSTFIVLAIVSPLWGRLADQKGRKLMLLRASLGMAISISLMAFVTAAWQLL
FT                   ILRMLLGAFSGFVSNSMALMASSAPKEKSGSVLSLLTTGSVAGTLIGPIVGGVLVNITG
FT                   YRRVFSVTGIIMFLVFFLALFLVKETFKPVEKKNMLSYKQVWEVVTHPAIIWGMFFATL
FT                   ITQMTNQSINPVLSLYVQELMHGQGNITFMAGLVAAAPGIVTLVAAPFLGRLGDKVGQR
FT                   KILGFGLFFSLIVFSITALTTNVWFLIVMRLFVGISDAAILPSVQAILAKESPQAVTGR
FT                   IFSYNQSAQSIGAFAGPLLGSAIAGFIDYRYVFVGSAILVIFNLINYFTHNNSVTLKK"
FT   gene            118032..118607
FT                   /locus_tag="LACR_0128"
FT                   /note="LactoCOG number LaCOG00079"
FT   CDS_pept        118032..118607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0128"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71749"
FT                   /db_xref="GOA:Q032X3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q032X3"
FT                   /protein_id="ABJ71749.1"
FT                   /translation="MARIALTRDKIVQATIKLASEIGLSNVSFPRLAEYFGIKAPSLYN
FT                   HFKNMEEVRVATAVYLQKELNHELTHAMVGLTPLAALRAYAESYKKFAEKYEAVYELIN
FT                   VIHQTNNGELEYLAKENIRLVRRSLENFNLSEEENFHISRMFRSTLHGFITLTQLGYFR
FT                   QSGSISKEESFTYMVDHLLSTLNDKHSI"
FT   gene            118764..119117
FT                   /locus_tag="LACR_0129"
FT                   /note="LactoCOG number LaCOG00080"
FT   CDS_pept        118764..119117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0129"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71750"
FT                   /db_xref="GOA:Q032X2"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032X2"
FT                   /protein_id="ABJ71750.1"
FT                   /translation="MAIKKTYRVKRSKDFDQIFSAKHSFANKRFVVYKLNTNQPHFRVG
FT                   LSVSKKLGHAVLRNRIKRLLRHAVAEFKPYLVDEDFVIIARSGVETLSFEEVKKNLRHV
FT                   LKLSKIYVDGEND"
FT   gene            119114..119923
FT                   /locus_tag="LACR_0130"
FT                   /note="LactoCOG number LaCOG00081"
FT   CDS_pept        119114..119923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0130"
FT                   /product="Preprotein translocase subunit YidC"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71751"
FT                   /db_xref="GOA:Q032X1"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:Q032X1"
FT                   /protein_id="ABJ71751.1"
FT                   /translation="MKKKFSLIAMAGAALLLLTACGTTAVTGSSSNLWDQIVYGFAQVI
FT                   RFLSFGGLTGVGIILFTIIIRAALLPLMNIQIKSSQRMQEIQPEIKKIQAKYPSKDMES
FT                   RRLMNEEIQKLYAENKVNPYMGCLPLVVQMPVLWALYQALSRVDFLKHGTFLWFEIGAK
FT                   DPTFILPILAAIFTFLSSYLMMKSAPERNAMTTSMTYIMPIFILIMGVNFASGIALYWV
FT                   ISNAFQVFQTMLLANPYKIIAAREAKVQVEKDKVKAREKALKKARKK"
FT   gene            120011..120925
FT                   /locus_tag="LACR_0131"
FT                   /note="LactoCOG number LaCOG00082"
FT   CDS_pept        120011..120925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0131"
FT                   /product="Predicted RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71752"
FT                   /db_xref="GOA:Q032X0"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:Q032X0"
FT                   /protein_id="ABJ71752.1"
FT                   /translation="MAIFTGETVEDAIDRGLNRLGVKRENVHIHIEQKEKKGFLGFGKK
FT                   RARVNIEPIHEETVRKADHLAERGVDDTINLGVPKSQSAMEATLELSQVVKAVRAAERE
FT                   QNGEITEEERNAIIEVAKKTVVQNRQGTTDLSDVVAAVKEEVEAKKEVSNEEEKIASKI
FT                   SSYLTTITQEMGIATRVSVSRDGNLTVFNLTSNHDALLIGKHGKILQSLQILAKAYANS
FT                   ILNTRMNVAVNVGDYHEKRKAYIVSLARRAAERARGGETVYINDLQSNERKIVHTIIGQ
FT                   ENGVSSHSEGQEYNRYIVVSKEI"
FT   gene            121057..121191
FT                   /locus_tag="LACR_0132"
FT                   /note="LactoCOG number LaCOG00083"
FT   CDS_pept        121057..121191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0132"
FT                   /product="LSU ribosomal protein L34P"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71753"
FT                   /db_xref="GOA:Q032W9"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032W9"
FT                   /protein_id="ABJ71753.1"
FT                   /translation="MKRTYQPHKKSRKTTHGFRSRMATKNGRRVLAARRRKGRASLTV"
FT   gene            121369..122280
FT                   /locus_tag="LACR_0133"
FT                   /note="LactoCOG number LaCOG01993"
FT   CDS_pept        121369..122280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0133"
FT                   /product="Predicted oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71754"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q032W8"
FT                   /protein_id="ABJ71754.1"
FT                   /translation="MKTFKIGELEASQIILGCMRINEEGKDPVAVIETSVEEGINFFDH
FT                   ADIYGGGACESIFADALNKSSVKREDIILQSKCGIVPGKMFDFSKEHILESVEGSLSRL
FT                   KTDYLDTLLLHRPDTLVEPEEVAEAFYELEKAGKVRYFGVSNQNPGQVELLKTAVKEPL
FT                   LFNQLQFGLKHTGMIDAGIHVNMSDDASFVHDNGILEYSRINKMTIQAWSPFQYGFFEG
FT                   VFVGNEKFPDLNKKLEYYAEKYNSTPTGIAIAWINRHPANIQTIIGTMTLSRIKEIAAA
FT                   ADIVLEREEWYDLYMAAGNVLP"
FT   gene            122350..122664
FT                   /locus_tag="LACR_0134"
FT                   /note="LactoCOG number LaCOG00006"
FT   CDS_pept        122350..122664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0134"
FT                   /product="Transcriptional regulator, xre family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71755"
FT                   /db_xref="GOA:Q032W7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q032W7"
FT                   /protein_id="ABJ71755.1"
FT                   /translation="MKFLKYFKEIRINKDSNHSFKLLNFEDLTDDELLGVSGGGFSDNL
FT                   RQERLEAGWTQEELGKLLFTSKQAVCNWEHGRRQPNLMLLQEMSNLFECSIDALLKERK
FT                   "
FT   gene            122841..122999
FT                   /locus_tag="LACR_0135"
FT                   /note="LactoCOG number LaCOG02391"
FT   CDS_pept        122841..122999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71756"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="InterPro:IPR023991"
FT                   /db_xref="UniProtKB/TrEMBL:Q032W6"
FT                   /protein_id="ABJ71756.1"
FT                   /translation="MEGQKIFEVFETLTDAELMEISGGGGLINYSQNYLSSVLIGSGDI
FT                   IGDIYDR"
FT   gene            123082..123762
FT                   /locus_tag="LACR_0136"
FT                   /note="LactoCOG number LaCOG01370"
FT   CDS_pept        123082..123762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0136"
FT                   /product="Predicted metal-dependent membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71757"
FT                   /db_xref="GOA:Q032W5"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q032W5"
FT                   /protein_id="ABJ71757.1"
FT                   /translation="MIERIKKSLQTKLKTLLVLLVTVVLYNGWEPSLGIFPTGFYDFTF
FT                   NHYGAVDILTFSLIMIIAYKNGAFRKFFDIFRWKNLLFILFFIIGGIVFIVLAHKLYFQ
FT                   MTSALVAFPEHGVDVANSLARTPFWTHSLDLFVIGPICEELIFREYLYRLFDKKWLACF
FT                   VSVVVFAWIHTGFTYSFFFYLPMSLVVTLAYHRRKAIGESIILHSSINLINNYLPYLLN
FT                   FLVP"
FT   gene            124057..124323
FT                   /locus_tag="LACR_0137"
FT                   /note="LactoCOG number LaCOG00085"
FT   CDS_pept        124057..124323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71758"
FT                   /db_xref="InterPro:IPR009309"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032W4"
FT                   /protein_id="ABJ71758.1"
FT                   /translation="MSFTDETVRFEFGDSDKKEIGETLVDVYNVLEAKGYNPINQIVGY
FT                   VLSGDPAYIPRHDDARNKIRRFDRDDIVEELIKNYLKDNGVNL"
FT   gene            124323..124754
FT                   /locus_tag="LACR_0138"
FT                   /note="LactoCOG number LaCOG00086"
FT   CDS_pept        124323..124754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0138"
FT                   /product="RNase H-like ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71759"
FT                   /db_xref="GOA:Q032W3"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032W3"
FT                   /protein_id="ABJ71759.1"
FT                   /translation="MFARILGLDVGTKTVGVSVSDLLGMTAQPVETIKIDSEAGELGFD
FT                   RLAVLIKEYKPEKVVLGLPKHMNGDEGIRAEASRDYGTKLANEFSLEVAYQDERLTTAQ
FT                   AEKVLIDGGVRRKDRKKSIDKLAAVLILQNYLDAHALKL"
FT   gene            124855..125178
FT                   /locus_tag="LACR_0139"
FT                   /note="LactoCOG number LaCOG00087"
FT   CDS_pept        124855..125178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71760"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032W2"
FT                   /protein_id="ABJ71760.1"
FT                   /translation="MTHTHDHEHDHNHEPDYITLVEENGNESLFQILITIDGQEEFGKN
FT                   YVVLQPTEFEEDEQGLIDVLAYSFTENADGTEGDLQPIPEDAEDEWDMIEEVFNSFMDE
FT                   QED"
FT   gene            complement(125208..125726)
FT                   /locus_tag="LACR_0140"
FT                   /note="LactoCOG number LaCOG00063"
FT   CDS_pept        complement(125208..125726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0140"
FT                   /product="Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71761"
FT                   /db_xref="GOA:Q032W1"
FT                   /db_xref="InterPro:IPR010617"
FT                   /db_xref="UniProtKB/TrEMBL:Q032W1"
FT                   /protein_id="ABJ71761.1"
FT                   /translation="MIKDVAKNGLKRKFKTPDKSGWPALTELTVPLLAYALSFFMIMTV
FT                   WYNHHQLYRDIKNITPRIFLLNTLCLFIMSFFPFTTGWVGKHATEFLPEFFYLVIVFLW
FT                   TAVFHLMDYELLKENPDKEYKELTHSISRRNIFIILGISLPIVWFWPPIGLVCVAMLGA
FT                   VALASFLKK"
FT   gene            complement(125723..126460)
FT                   /locus_tag="LACR_0141"
FT                   /note="LactoCOG number LaCOG00088"
FT   CDS_pept        complement(125723..126460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0141"
FT                   /product="carbonyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71762"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q032W0"
FT                   /protein_id="ABJ71762.1"
FT                   /translation="MKTLITGANKGIGFALAQNLGHRGYEVLVGARNETRGQEAVEKLK
FT                   AEGINAEFVKVDLDDLNQLTSLSALTDIDLLINNAGISGNIHSDKGHLDMEKSAFDYSS
FT                   SDLEETIKTNFLGTHAVITELLPHSLTENAKIINITVPVSQEYWMPLAYVTSKAAQNAM
FT                   TFAFGHQFKKDKSQKQIFAIMPGAVATDLNGAKVGDSPFVKSPEETAQMISKFIFDEKI
FT                   TMLKLLILTEQFMITMNQAYVTK"
FT   gene            complement(126480..126791)
FT                   /locus_tag="LACR_0142"
FT                   /note="LactoCOG number LaCOG00089"
FT   CDS_pept        complement(126480..126791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71763"
FT                   /db_xref="InterPro:IPR018757"
FT                   /db_xref="UniProtKB/TrEMBL:Q032V9"
FT                   /protein_id="ABJ71763.1"
FT                   /translation="MSLNPLQMHNTKKELRQNFELTGLSKSEIANDLKISEVKLEKIFK
FT                   LKQRTLEDTWILRNYLLEKVKNAGQEPVPFTALAGDWHRHWFLNADLIDHQQMSKGDN"
FT   gene            complement(126801..127586)
FT                   /locus_tag="LACR_0143"
FT                   /note="LactoCOG number LaCOG00090"
FT   CDS_pept        complement(126801..127586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0143"
FT                   /product="Short-chain dehydrogenase (D-alanine transfer
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71764"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q032V8"
FT                   /protein_id="ABJ71764.1"
FT                   /translation="MTFTGHTILITGGTSGIGLGFAKKFAELGNKVIITARNEDRLNQI
FT                   LSENPTFSGFVSDVADENSLSQLVNFINENSPKLDLLMNCAGIMRAINLFEQADNSLGA
FT                   LTEEININLLGTIAVTQAFLEVLVANNGMVINVSSGLSNLADGAHPIYNLTKASVHFYS
FT                   DALREQAKYFDKSLKVVELVPPLVAETNLESHTNTDAPNNMALSDLINETLAGLENGLE
FT                   RIDAGFSKQLHQMGKVNSDENTKLLSNQMLSNYFPKNKE"
FT   gene            127705..128250
FT                   /locus_tag="LACR_0144"
FT                   /note="LactoCOG number LaCOG00091"
FT   CDS_pept        127705..128250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0144"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71765"
FT                   /db_xref="GOA:Q032V7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041478"
FT                   /db_xref="UniProtKB/TrEMBL:Q032V7"
FT                   /protein_id="ABJ71765.1"
FT                   /translation="MNTREKILKKTEEFILKNGIEKLTISKIAKELNISQPAIYKHFKS
FT                   KDELLTILSLRWLNGQTLVKIFPFDTSSYEHQKDIVHDWLWSVAIAKYEAHRNTPEMFA
FT                   LYTTYIGENLELGRQHILEMVESLKTAAKLESYEEAGAYIQAFVYFHHPKIAPQWDDQF
FT                   QTQFENLWTLVEPNLNEF"
FT   gene            complement(128316..130259)
FT                   /locus_tag="LACR_0145"
FT                   /note="LactoCOG number LaCOG01535"
FT   CDS_pept        complement(128316..130259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0145"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71766"
FT                   /db_xref="GOA:Q032V6"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:Q032V6"
FT                   /protein_id="ABJ71766.1"
FT                   /translation="MPLNILDYDPYLEPFKDDLSLRLFEFARTKKRILDVDGSLVDFAN
FT                   GYKYFGFQQESKHWTFREWAPNAKKAWLVGDFNNWENNYELKQAYGGTWEISVPGLLPV
FT                   GSKVKIKLLLPTGEVVYRVPSYIMYALPNENHGLDGVITQPKYEWKNKSPKLSEAPLIY
FT                   EAHIGISTEEYKINSYKEFTRDVLPRIKKDGYNTIQLMAIMEHPLYASFGYQVSNFFAI
FT                   SSRFGQPEDLMELIDKAHGLGLQVLLDVVHSHAVKNIEDGLNYFDGTENQYFHEGERGN
FT                   HPAWKTKLFNYGKDEVLHFLLSNLKFWLDIYHFDGFRFDGVTSMLYHDHGLGTAFTDYS
FT                   KYFSLNTDVEAVTYLMLANELTHLFNPSATTIAEDMSAMPGMALPISAGGIGFDYRLSM
FT                   GIPDFWIKQLKEKTDNSLDLLSLWWELTTRRPGEKNIGYSESHDQALVGDKTLMMWLAN
FT                   EEIYWNMDINSQSLIIDRAIALHKLIRLITFSLAGEGYLNFMGNEFGHPEWLDFPREEN
FT                   HDDFQHARRQWSLADNENLRFKYLLAFDQAMLNLEHDFKFLESTDPVQQLWIKDSDKLL
FT                   AYKKGQLVFVFNFHPSYEQKLQLQFSKKPELIFDSDDQKFGGFGPRSSFGWSKGTLNLI
FT                   LEPRTAMVFKIK"
FT   gene            complement(130379..130699)
FT                   /locus_tag="LACR_0146"
FT                   /note="LactoCOG number LaCOG02394"
FT   CDS_pept        complement(130379..130699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71767"
FT                   /db_xref="UniProtKB/TrEMBL:Q032V5"
FT                   /protein_id="ABJ71767.1"
FT                   /translation="MNYDDFMKSKHIAERWGEFQEKFKNMDKSSELKAYHELLTEFYEY
FT                   IQYLETHFFAADKTSVDKNLLTDWSVNSQASTASAQIPMTLPPSQEHLTGEEDPWFGFN
FT                   DE"
FT   gene            130855..131483
FT                   /pseudo
FT                   /locus_tag="LACR_0147"
FT   gene            131535..132074
FT                   /locus_tag="LACR_0148"
FT                   /note="LactoCOG number LaCOG03052"
FT   CDS_pept        131535..132074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0148"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71768"
FT                   /db_xref="GOA:Q032V4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q032V4"
FT                   /protein_id="ABJ71768.1"
FT                   /translation="MINTKEKIVNLGLELIQTRGINGFSFADIAKVIDIKKASIHYYFP
FT                   SKTDLIEAVLEKYSTNFFEALEQSTASTLKAKLEYYTSLYRMNLIEGRICLCSDLAMDT
FT                   YNLNDSINNKVGDFFQKNISWLEKQFTEYKSSQKASEFFAGIQGAQLISRNQKRIDYFD
FT                   EVITKSIDDLLLSVEK"
FT   gene            132531..137945
FT                   /locus_tag="LACR_0149"
FT                   /note="LactoCOG number LaCOG00092"
FT   CDS_pept        132531..137945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0149"
FT                   /product="Predicted outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71769"
FT                   /db_xref="GOA:Q032V3"
FT                   /db_xref="InterPro:IPR008456"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="InterPro:IPR041171"
FT                   /db_xref="UniProtKB/TrEMBL:Q032V3"
FT                   /protein_id="ABJ71769.1"
FT                   /translation="MESRKKVASIILGLVLLLQYIVTPVGVIAEALTDGSVNTAISLSQ
FT                   LKIDESETKTDLTSFNLTLKVEKPIEQNETVIIDLNSSINTPSEDNKTKSTTDFTANEN
FT                   KLTVVVAANSNNELNINFSVLKEKLKDLNQLTATLNNQKVSVDLPTTDSTTDSTENSTS
FT                   TSESKSTSNSELSTNSSESKSQSTSESKKEQTKQETTTQADSGRNIHDLLDAAGVSPSS
FT                   IINGATVVYVDKDGNPYPDQNNVPIDAAVKIDYTWSIPEDIMPLKAGDYFDFKLPDGVT
FT                   IEEAMGNMGDYGTYTIDADGTVHFVFNEKVETKHDIHGTFHYDAHFDKETVPGEVVIDT
FT                   PTEENFPPSEVHVRPDYNQGIDKSGHFDKTPNPSEVIWEININRPLNTMENATLTDPMP
FT                   AGTTYKSVVIYPETVGPNGEILSVDKAHPLVEGTDYTVDANGKITFIGKYAKTDQAFNV
FT                   VYTTSIDDDTIPEKGGNVNFTNTATLNDGKTDTDASASVDAEYKGPITKNGPYSTGDDQ
FT                   VYNWNVEYNYNEQKHKAGSYIEDTMSDAIELVDGSVKLYKITFDKDGNEIKGAELKEGE
FT                   DYKLVPDPNDPQKFKIVFLKDIDYAVKAEYQTKVKDIVDENVPIENSVETDTGDKDGST
FT                   GNATQEGLVKNVDGDIDYSKDEIPWKIDINSAGYLMENWSLEDTMSQGLTFIEDSFQII
FT                   DKNEGNRVLLPTEYTLVKTATGFQVSFNSPLKEGTDHKYQIKYKTKFDTSAIDNGSGHE
FT                   GDIKFKNDASMTWNDQKGGDHTNTDHKDVEPLPPFQYNGQKSGDYNATTKKITWTVATN
FT                   FDQQELNDASIVDPISADQKYVSGSAKVYEATINSDGTYTLGADVTSTSGIKVTEGKND
FT                   IKVNLPDKSTKAYVLIFETSLAGELINQKEYKNTATFTNNDISHDLTASVTAAHEGEFV
FT                   SKSGEQSSSDSDYVDWTLTVNASQSTLKDVEVVDNPSSNQYVVPEDVVVYGTTIDKSGN
FT                   ITEDKNTVLKQGVDYTVDITTDNITGAQVITVDFLAEINTAYMVEYRALITTDKTNDTV
FT                   SNQAHISGDNETTIEKDVEVDVPVINHDGTAEGSEGSVTFEKVGPDKEKLANAHLQLWS
FT                   INDEGKKDKLIREGDTDQNGDLKLGHLRVGDYLLIETKAPAGYTLDEELVKGKKVTVAE
FT                   DGETANFPIQEVENEPTKVVLKKVGMTIENGEEVKNPLQGAEFKLLDDSGQTVAGYGQL
FT                   TSDSSGNVTIEKLVSGKYSLVETKAPAGYILDPTPIEFELKANEEGIISDVNLEKVNYQ
FT                   GSAELIKHDSKGQPLSGAIFKVVDKSGKTIQTNLTSDKDGKVIVDGLAPGDYSFIEVQA
FT                   PTGYVLNTDPVHFTVADQAEGQPQIVMASDNFINYQGSAELIKHDSKGQPLSGAIFKVV
FT                   DKSGKTIQTNLTSDKDGKVIANGLAPGDYSFIEVQAPTGYVLNTDPVHFTISAESEEKP
FT                   QLVMASDNFVNYQGSAELIKHDSKGQPLSGAIFKVVNESGKVIKEGLTSDKVGKVAIDG
FT                   LAPGDYSFIETQAPTGYILNTEKVDFTISDKEEGQPKVVTASDNFVNYQGSAELIKHDS
FT                   EGQPLSGAVFKVVNESGEMIKEGLTSDKDGKVKIDDLVPGNYSFIETQAPAGYILNTAK
FT                   ADFTISDEEKNKPKVVMASDNFINYQGSAELVKVSESGEKLSGAVFKVVDTSKNEVVLK
FT                   GLKSNSDGIIKANNLKPGKYAFVEEKAPTGYQLSQETKTFEIVNESENKPEMVKVGKFV
FT                   NRKLIIPRQKSELPKTGEQENRFLPISGLAIFIFGIYVTFKRQKLKNK"
FT   gene            139022..139165
FT                   /locus_tag="LACR_0150"
FT   CDS_pept        139022..139165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71770"
FT                   /db_xref="UniProtKB/TrEMBL:Q032V2"
FT                   /protein_id="ABJ71770.1"
FT                   /translation="MKKRIILYFEDMIKFGNLGGAFKKKKDFKAKENVTKSQRKFKKLS
FT                   NQ"
FT   gene            139323..140453
FT                   /locus_tag="LACR_0151"
FT                   /note="LactoCOG number LaCOG00915"
FT   CDS_pept        139323..140453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0151"
FT                   /product="cell surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71771"
FT                   /db_xref="GOA:Q032V1"
FT                   /db_xref="InterPro:IPR010317"
FT                   /db_xref="InterPro:IPR021759"
FT                   /db_xref="UniProtKB/TrEMBL:Q032V1"
FT                   /protein_id="ABJ71771.1"
FT                   /translation="MIEKKNSVYNILGKIGLVLVLVFSLCYCSKNIYASSSNFNVNPVT
FT                   PENQIDKSLGYFNLLMNPEAEQNLTFNLNNTTSKSITVDMSFSRSTTNDNGLAIYDSAG
FT                   KTKDSSLQYNIEDYVEIPKKEITISAHSQVTVTAKIKMPQGANSGVLAGGFAFKEKKSK
FT                   NQESTSKGVSITNEYRYVIALVIQQDTQKVSPQLKMNDAKATQVNSRNVFTANLQNMSP
FT                   TYLQDMNAKATVKNVNNPEIKYSFENSDMKMAPNSNFNFAIPVSIQGNMKDQTSKALEP
FT                   GKYHLTMTVYGVKNTNGTYESTVDGKAVKYEYKWEFEKEFEIAEEKAQKLNQSDPTVHY
FT                   KEPINWLMIIGIALILIILLLIFLIFSRKRNKDSHQ"
FT   gene            140493..140813
FT                   /locus_tag="LACR_0152"
FT   CDS_pept        140493..140813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71772"
FT                   /db_xref="GOA:Q032V0"
FT                   /db_xref="UniProtKB/TrEMBL:Q032V0"
FT                   /protein_id="ABJ71772.1"
FT                   /translation="MNKVIKTFLISMGFLIVIAYPFSVFAQERAANTTQATVGFTGSFP
FT                   SKEKPDINSPKNPQIDSKNKELPKTGAKSSLAIEWIGVGLINLIIGLIYIKRNKSVRYN
FT                   LT"
FT   gene            complement(140860..140994)
FT                   /locus_tag="LACR_0153"
FT   CDS_pept        complement(140860..140994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71773"
FT                   /db_xref="UniProtKB/TrEMBL:Q032U9"
FT                   /protein_id="ABJ71773.1"
FT                   /translation="MNPIVPVEVHCSSLTESADAVEIAVAPTTRRASVAAESESVFSY"
FT   gene            141098..141571
FT                   /locus_tag="LACR_0154"
FT                   /note="LactoCOG number LaCOG01034"
FT   CDS_pept        141098..141571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0154"
FT                   /product="cell surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71774"
FT                   /db_xref="InterPro:IPR027994"
FT                   /db_xref="UniProtKB/TrEMBL:Q032U8"
FT                   /protein_id="ABJ71774.1"
FT                   /translation="MDFGTHEISASQATYYASADSKAFSKPVGAFVQMYDLRGLGTGNG
FT                   TTLTVTQLAQFTNGSKGLTGAALSFSSGAGVNADASGSYVPKSTASYTLTPGTAQEVMS
FT                   TDGTVGQYLTSYGKAADYQGNEAGGPISLSVPSGSAVAGNYTATLQWDLTTAP"
FT   gene            141678..144425
FT                   /locus_tag="LACR_0155"
FT                   /note="LactoCOG number LaCOG02495"
FT   CDS_pept        141678..144425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71775"
FT                   /db_xref="UniProtKB/TrEMBL:Q032U7"
FT                   /protein_id="ABJ71775.1"
FT                   /translation="MGKIKNLLKKSTKIGASALLLVSTLLPSLALQGQLIVSATNASTT
FT                   LAPGGAVDTGNHTWGLKDFQTANNYTPVGKNTSGAGWSSSSTYDFGTNQANTGSWLPFN
FT                   GAVDMTQSIRIVGTTLANSKGLFGSGKILGDANGILLTNLSSSQLSGGATGGNLGVGNL
FT                   GSGTYFIGNNYSYKKTSIIVGSDYNTATVIAQGNGPGAKILSASSDYTANNNSTNLFTM
FT                   EWSNPVLNSDGTVTGTISYLSRNGGTNYVSSADITVQKSMSIGFMAATGGNYSQMSVTV
FT                   NEVTAGKGVQPVNVNYLNSLTGSQLAPKGTAWKNSTITANVGDKIGVVAQGNTVQTSDN
FT                   YDYFVPVAPTGYNFKSFTPAVTVQNFPVGTANPNQINVSYTPLAQSAGFTFNYDPAAQR
FT                   TPTVPPLYSVSGVTDQTIVAASPNFQKNLAAQVPAGYYISKITNSAGGSSTGSTTDSTI
FT                   KSFLAGNPTFDATVSKNQYQIMLSAANQTGTVNFAYKSNVPAGAPTLPNDIQLSGLTGS
FT                   DLNFVMPNISAGYVVSSVVGPNNVTYSSIAEALQANNHFVPGSNNFKVTISAVTQNGTI
FT                   SYNWASNVPGQNGVVGKLQATLPATTAISGLVGETIKLSPDIPTGYGIDKVVAPDGKTY
FT                   TDSTTPGMTALQAAQAANPKFIVGPNNFVITLKALEQDVTLKVNVDQNSGSGAPTAPQP
FT                   YTIATLLTGAPIDGPSIDKAQKWLNDWITNNAAGWSVKDFLDPNLVSYVNSGLSSAVTG
FT                   AGGVAFSKNNVYQVNLIYSGSIGFSSVPSQIDFGKNPVVPVDKSYQGMLDNSVVVSDTR
FT                   APNLATSWTVSVSQSSPIQGVINNGVDTPVSGGISFMNYLSYDGKVLTNNPQVVHSKSA
FT                   GEVGDTVVIDKASPSLFALKVPSSFQKVNSEFKGTLSWTLTSAP"
FT   gene            144437..144580
FT                   /locus_tag="LACR_0156"
FT   CDS_pept        144437..144580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71776"
FT                   /db_xref="UniProtKB/TrEMBL:Q032U6"
FT                   /protein_id="ABJ71776.1"
FT                   /translation="MMKIFWAGIYDEVNIQGILGKEYTSNSVLMDKKNGKYILSTFESF
FT                   DS"
FT   gene            144537..144851
FT                   /locus_tag="LACR_0157"
FT                   /note="LactoCOG number LaCOG02622"
FT   CDS_pept        144537..144851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0157"
FT                   /product="Transcriptional regulator, xre family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71777"
FT                   /db_xref="GOA:Q032U5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q032U5"
FT                   /protein_id="ABJ71777.1"
FT                   /translation="MENIFYLRLKALTHESGKSFNQIERELGYTRNALANYKNGGVPSG
FT                   IRLMELANYFKVLPDYLIGKVPFENVESIENTFVSLTNKQKIEMYLLCQKWILSRIKED
FT                   "
FT   gene            complement(145002..145077)
FT                   /locus_tag="LACR_t0158"
FT                   /note="tRNA_Thr_CGT"
FT   tRNA            complement(145002..145077)
FT                   /locus_tag="LACR_t0158"
FT                   /product="tRNA-Thr"
FT   gene            complement(145140..146288)
FT                   /locus_tag="LACR_0159"
FT                   /note="LactoCOG number LaCOG00093"
FT   CDS_pept        complement(145140..146288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0159"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71778"
FT                   /db_xref="GOA:Q032U4"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032U4"
FT                   /protein_id="ABJ71778.1"
FT                   /translation="MTEHAIKYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATV
FT                   KTMSPEELKTLGSGIILSNTYHLWLRPGDELVAEAGGLHKFMNWDQPILTDSGGFQVYS
FT                   LVQNKKNITEEGVKFKSHLDGRELFLNPEKAISIQNNLGSDIMMSFDECPPFYQPYDYV
FT                   KASVERTSRWAERGLNAHRRPNDQGLFGIVQGAGFEDLRRQSASDLTSMDFAGYSIGGL
FT                   AVGESHKEMNAVLDFTTPMLPEDKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARN
FT                   GTLMTHFGRVNIRNAKYEHDFTPLDPMCDCYTCTNYTRAYLRHLIKADETFGLRLCSYH
FT                   NLHFLVNLMKDVRQAIMDDNLLEFREDFCERYGYNQPNAKDF"
FT   gene            146489..147178
FT                   /locus_tag="LACR_0160"
FT                   /note="LactoCOG number LaCOG00094"
FT   CDS_pept        146489..147178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0160"
FT                   /product="Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71779"
FT                   /db_xref="GOA:Q032U3"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:Q032U3"
FT                   /protein_id="ABJ71779.1"
FT                   /translation="MSRWELKNQAKGALRDNFGSKMLLFIIPIIMGILGGGNGMKQSMD
FT                   YNGSFDNVSSSVWMAVSFATLLILILMIVVALFVSVVTVGAIFNYIKIFRGERNNPQFK
FT                   NVFGPFYDGSAGKIILLNIVKGIIFVILMFIPIIGWAFGIYLALGWSQSTYVLFDQLEE
FT                   DRYSGVMNVLSESATMMKGLRGDYFIFKFSFFWWYVLYGISGGLAGFWTTPYLNMASIA
FT                   YYENIRK"
FT   gene            complement(147233..148411)
FT                   /locus_tag="LACR_0161"
FT                   /note="LactoCOG number LaCOG00095"
FT   CDS_pept        complement(147233..148411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0161"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71780"
FT                   /db_xref="GOA:Q032U2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q032U2"
FT                   /protein_id="ABJ71780.1"
FT                   /translation="MKEKLWTTTFVVNMLLNFIFYLVFYLPTVVIGTMAMDRYHASASI
FT                   AGILSGIFIVGGFIARLWAGNNMKRLGAKKLLYIGTLIYFLLTFVYFIVHSVALLLILR
FT                   LVHGVGFGIAATASGTLAGAIVPSSRRGEGIGYYALSVTLSSAVGPFLSMFLYRTSGFY
FT                   SLIWLSALLLFLALIGIFFLRVNEKPTDSSAITENHKKFAWSNYFEKEALPISLIAFLI
FT                   GISYSSILSFMDAYALNIHLSEAASFFFLVYAITVLLSRPITGRIFDGFGDNFVMYPTY
FT                   LFFALGLLLIGLAQSGWMLLIAAIFIGLGYGSFSPFGQAIAIRNSEAHRLGVTTSTFFG
FT                   FMDMGVGFGPFILGMFMPLLGYRNLYFASAILALLIAVIYHFVHGRHVKTEN"
FT   gene            complement(148588..149025)
FT                   /locus_tag="LACR_0162"
FT                   /note="LactoCOG number LaCOG00096"
FT   CDS_pept        complement(148588..149025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0162"
FT                   /product="Predicted CoA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71781"
FT                   /db_xref="GOA:Q032U1"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q032U1"
FT                   /protein_id="ABJ71781.1"
FT                   /translation="MYEFENPEQEVLFDYLKKAKTIAVVGISDKTDRSSYLIAQGLQKN
FT                   GYRVIPVNPRLAGTELLGEKVFSTIKDIPFHIDIVDIFRRSEFLADVARDFIETDADVF
FT                   WAQLGLQSQEAEQILRTAGKSKIVMNRCIKIEYAYSGLGRK"
FT   gene            149195..149947
FT                   /locus_tag="LACR_0163"
FT                   /note="LactoCOG number LaCOG00097"
FT   CDS_pept        149195..149947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0163"
FT                   /product="DNA-entry nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71782"
FT                   /db_xref="GOA:Q032U0"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="UniProtKB/TrEMBL:Q032U0"
FT                   /protein_id="ABJ71782.1"
FT                   /translation="MVAVIIALAVGYFGSGRLHLGQGNDSSTSSSQVSTKALATSVKQA
FT                   PLPFKNQKQMVMANTDALGRAVDAHIQLKDSQEPKVKREPLTYNPVGWHNYNFYYKKPN
FT                   GSIGKMWLMARGHLVGYQFSGLNDEARNLVPETAWFNGGNFTGTNDGNTASMLYYENRL
FT                   DSWLANHPNYYLDYQVTPLYKGNELLPRQIRLAYVGIDKNGQSLPIKLGGGREKSGNGG
FT                   ATVVVLDNVAPNAKINYADGTAVNTVKP"
FT   gene            150126..150320
FT                   /locus_tag="LACR_0164"
FT                   /note="LactoCOG number LaCOG02395"
FT   CDS_pept        150126..150320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71783"
FT                   /db_xref="GOA:Q032T9"
FT                   /db_xref="UniProtKB/TrEMBL:Q032T9"
FT                   /protein_id="ABJ71783.1"
FT                   /translation="MFLLVMLLLIKGFFKFVLPALIILMILKFLFGGLMLLFSPHFWGT
FT                   LLVIAFIVWLVRASRSRYY"
FT   gene            150332..150571
FT                   /locus_tag="LACR_0165"
FT                   /note="LactoCOG number LaCOG02396"
FT   CDS_pept        150332..150571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71784"
FT                   /db_xref="GOA:Q032T8"
FT                   /db_xref="UniProtKB/TrEMBL:Q032T8"
FT                   /protein_id="ABJ71784.1"
FT                   /translation="MFLGILSGIIVLGALLSILLVFLGVIALRVFLRYIFPILLILLVI
FT                   RLMVSGILLLFNPHFWFFIVIVALVLWVLGKMKN"
FT   gene            150769..152349
FT                   /locus_tag="LACR_0166"
FT                   /note="LactoCOG number LaCOG00098"
FT   CDS_pept        150769..152349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0166"
FT                   /product="4-amino-4-deoxy-L-arabinose transferase related
FT                   glycosyltransferase of PMT family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71785"
FT                   /db_xref="GOA:Q032T7"
FT                   /db_xref="UniProtKB/TrEMBL:Q032T7"
FT                   /protein_id="ABJ71785.1"
FT                   /translation="MSNEYGSRSSRHERRSSRWAKKDSDVVEAAANQAIKHLEETEDQT
FT                   AERTSRQKLTHGKTLRIPLATYGLLTGLSILLALSFYAFPLWKPVATASQSQNLYSGFA
FT                   MHHGLVPYNDFYGTGGSIFYLINWLGNTGGSTWLLWLFEIIALLISGILTYRLVSQQTR
FT                   NHTASLTVSVFTLVIIAGLARGGDSPTLFALPFALWGAQFLSQYFQDSSTDRGFIRFGM
FT                   AAAFALVISPVMSIFFILSALALVIYNISIRRIGHGFYQMLASILGVLLVGYSVAYYSL
FT                   EAQTVYTSIEQSVLIPFTHFGPSGDLLVTLAKALVLTLIFGIVAGFVQGLVQLKKGGPA
FT                   RIWYVMLLIGIVGVTTIVVFAQTFDSSNLLAVLPFTVVFAGLSLKDSDQILLKYLQNRL
FT                   FAPILAILFVIFTPISYHFMNRTIASEEQNVAQYIQANAKSYDRVYVVSDGKNINNLTK
FT                   TISTLDNVPANYPVKFTQNYDLKVGKLTDKYVVLQAAQEVPASLKKVLDKDYKVSNYSG
FT                   KYFQVYQKK"
FT   gene            152479..153693
FT                   /locus_tag="LACR_0167"
FT                   /note="LactoCOG number LaCOG00099"
FT   CDS_pept        152479..153693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0167"
FT                   /product="L-aspartate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71786"
FT                   /db_xref="GOA:Q032T6"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q032T6"
FT                   /protein_id="ABJ71786.1"
FT                   /translation="MRKFEKSHKLDNVSYDIRGPVLDEAQRMRANGEKILRLNTGNPAE
FT                   FGFLAPDEVISDLIQHAVDSEGYSDSKGIFSARKAIMQYCQLKGFPNLDINDIFTGNGV
FT                   SELIVMAMQGLLDTGDEVLIPMPDYPLWTASVSLAGGTAVHYLCDEQAGWFPDIDDIRS
FT                   KITSNTKAIVLINPNNPTGALYSKDLLLEIVQVARENNLIIFSDEIYDRLVMDGAVHVP
FT                   IASLAPDLFVVTMNGLSKSHRIAGFRVGWMVLSGEKSHVKGYIEGLNMLASMRLCSNVL
FT                   AQSVVQTSLGGTQSVDKLLLPGGRVYEQREFIYKAINDIPGLSAVKPQAAFYIFPKIDR
FT                   EMYKIDNDEQFVLDFLKQEKILLVHGRGFNWKDPDHFRIVYLPRVDELAEIQEKMERFL
FT                   WQYRK"
FT   gene            153846..154634
FT                   /locus_tag="LACR_0168"
FT                   /note="LactoCOG number LaCOG00100"
FT   CDS_pept        153846..154634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0168"
FT                   /product="Pleiotropic transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71787"
FT                   /db_xref="GOA:Q032T5"
FT                   /db_xref="InterPro:IPR010312"
FT                   /db_xref="InterPro:IPR013198"
FT                   /db_xref="InterPro:IPR014154"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032T5"
FT                   /protein_id="ABJ71787.1"
FT                   /translation="MATLLEKTRKITAILQDGVTDLQQELPYNSMTERLANVIDCNACV
FT                   INTKGELLGYSLPYNTNNDRVDQFFYDRKLPDEYVRAAVRVYDTMANVPVDRPLAIFPE
FT                   ESLSDFPKGVTTLAPIYGSGMRLGTFIMWREDGEFTDDDLVLVELATTVIGVQLSNLKL
FT                   EQMEENIRKDTMATMAVNTLSYSEMKAVKAIIEELDGEEGHVIASVIADKIGITRSVIV
FT                   NALRKLESAGVIESRSLGMKGTYLKVLNTGLFDKLAGRNF"
FT   gene            154912..155217
FT                   /locus_tag="LACR_0169"
FT                   /note="LactoCOG number LaCOG00101"
FT   CDS_pept        154912..155217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0169"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71788"
FT                   /db_xref="GOA:Q032T4"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032T4"
FT                   /protein_id="ABJ71788.1"
FT                   /translation="MSQITEEQVKHVALLSKLEFSENEVKSFTDTFGKIIDMVEMLDEV
FT                   DTDGVPFTMNVADNLNFMREDVAEKGLDREKLMAAVPEKEDGFIKVPAMLSDGGDA"
FT   gene            155217..156677
FT                   /locus_tag="LACR_0170"
FT                   /note="LactoCOG number LaCOG00102"
FT   CDS_pept        155217..156677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0170"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71789"
FT                   /db_xref="GOA:Q032T3"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032T3"
FT                   /protein_id="ABJ71789.1"
FT                   /translation="MSYNNKSIKELHELLVNKEISALELTKATLSDIQAREPQIDAFLK
FT                   VTEEKALKEAAAIDARGINPDVVTDGISIGVKDNIVTEGIETTAASKILGGWIPPYNAT
FT                   VANKLSQSGLITIGKLNMDEFAMGGSGENSSIKPTKNVWDQTKVPGGSSSGSAASVASG
FT                   EVRLSLGSDTGGSIRQPAAFNGIVGLKPTYGRVSRFGLIAFASSLDQIGPLTPTVEENA
FT                   QLLNVISGFDKNDSTSSNVSVPDFTSKIGQDIKGMKIALPKEYFGEGIDEKVKEQILAA
FT                   AKHLEKLGAIVEEVSLPHSKYGVAVYYIIASSEASSNLQRFDGIRYGYRAQDIKNLEDL
FT                   YVKSRSEGFGPEVQRRIMLGTFSLSAGSYDKHFKKAGQVRTLIINDFAKVFEKYDLILG
FT                   PTTPTAAWDLGARVDDPISMYLADLLTIPVNLAGLPGISIPAGFADGLPVGMQLIGKRY
FT                   DEETIYQVAAAFEATTDFHKKQPIIFGK"
FT   gene            156702..158135
FT                   /locus_tag="LACR_0171"
FT                   /note="LactoCOG number LaCOG00104"
FT   CDS_pept        156702..158135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0171"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71790"
FT                   /db_xref="GOA:Q032T2"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032T2"
FT                   /protein_id="ABJ71790.1"
FT                   /translation="MNFETVIGLEVHVELSTNSKIFSPASTKFGGDPNSNTNVIDWSLP
FT                   GVLPVMNKGVIDSGIKAALALNMDIHKSMHFDRKNYFYPDNPKAYQISQFDEPIGYNGS
FT                   IEIELEDGHKATIRIERAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRTPE
FT                   EAYAYLTALKEAILYTGISDVKMEEGSMRCDANVSLRPYGQEAFGVKTEVKNMNSFSNV
FT                   KKALDFEVARQAKILRAGGEIRQETRRFNDKTGETILMRVKEGASDYRYFPEPDVPRFE
FT                   ISDEWIEQMRESLPMTATARRAHYINDLGLSDYDARQLTATKEVSDFFDQAIKFDTDPK
FT                   LVSNWLQGEVAQYLNSEKKELHEIGLTPENLTEMIRLISDGTISSKIAKKVFIELAKNG
FT                   GSAEEFVKKAGLVQISDPDLLLPIIHEVFAKNEQSVADYRGGKQNAAKALVGQLMKATK
FT                   GQANPTVAQKLLYQELDNF"
FT   gene            158259..159758
FT                   /locus_tag="LACR_0172"
FT                   /note="LactoCOG number LaCOG00105"
FT   CDS_pept        158259..159758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0172"
FT                   /product="Amidase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71791"
FT                   /db_xref="GOA:Q032T1"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q032T1"
FT                   /protein_id="ABJ71791.1"
FT                   /translation="MLEIKDATYWAEQLKSRNLSAKELLEMTKQKIDQLNPLYNAIVAE
FT                   DLAVAKEDLALTGQGFFAGLPFALKMLGQTHKGLPDTASSQLFSENVASEDDNYVKALI
FT                   RAGLTPYGQTNSPEFGFKNISDSKLYGDTRNVWNSDYYSGGSSGGAASAVASGMFAIAG
FT                   ASDGGGSIRIPASFSGLIGLKMTRGRMLQGPGSYRGWQGASISGALTVSVRDTARFILE
FT                   MQTLQEAAPYQARLLDEKELLEVCESTDSFVSKNLSVKLKIAYSLQSPISGIELSDDAL
FT                   KAVKKAVEFLKGQGHELVEIDFPLNARPLIQSYYQMNAAETVAMLEPWEKSAGRQLTSQ
FT                   DVELLTYALLEAGRKAPVTTYINALAQWDQAAETFADKIYADYDLFLTPTTAKTAPKIG
FT                   EELMTEEILTKMSEISQYDFEQQIAIIEAAFERSLAFTPYNFISNLTGQPALSLPIYVN
FT                   KETNLPLGIQLWGPKNSEIELLKVAKEFENADQFILPKFYQ"
FT   gene            complement(159824..161164)
FT                   /locus_tag="LACR_0173"
FT                   /note="LactoCOG number LaCOG00106"
FT   CDS_pept        complement(159824..161164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0173"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71792"
FT                   /db_xref="GOA:Q032T0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q032T0"
FT                   /protein_id="ABJ71792.1"
FT                   /translation="MKDLTKGNILTGLIAFTLPLLMGNFFQVLYNTADTLIVGQTLGKD
FT                   ALASVGATGSINFLIVGFAQGMTAGLTILTAQRFGAKDKLAIKKSYVTGLYFTVAVSII
FT                   LSILSLIFVGPLLQAMQTPSQIFEGAKTFLSIMLGGMIATNLYAYLSNALRALGDSKTP
FT                   LYALIAASILNIAFEYFAILVLKLGIAGASGATILAQMISVLFLFWHIRRKVPEFQISK
FT                   NLWRLDRAEIAHHARLGIPMGFQSSIIAIGSITLQVALNKMGTNAVATQAIVSKIDQFA
FT                   MLPMISIGLAMATFGAQNYGAKQYKRINQGLMRALAIAVGWSIVFAIILNLAHFYFTTA
FT                   FISSSQTAVIEMSSHYYLVNGSFYWLLAILFVTRSTIQGLGNAKIPTLCGFAELFMRAG
FT                   VAIIGVLLLNYTVIISSNPAAWLGSTSILIPTTIRMIKRFRQNQDLA"
FT   gene            complement(161346..161543)
FT                   /locus_tag="LACR_0174"
FT                   /note="LactoCOG number LaCOG00107"
FT   CDS_pept        complement(161346..161543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0174"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71793"
FT                   /db_xref="GOA:Q032S9"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q032S9"
FT                   /protein_id="ABJ71793.1"
FT                   /translation="MAQGTVKWFNATKGFGFITTEEGNDVFAHFSAIQTDGFKTLDEGQ
FT                   KVTFDVEEGPRGPQAVNIQK"
FT   gene            161701..162196
FT                   /pseudo
FT                   /locus_tag="LACR_0175"
FT   gene            162186..162878
FT                   /locus_tag="LACR_0176"
FT                   /note="LactoCOG number LaCOG00109"
FT   CDS_pept        162186..162878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0176"
FT                   /product="Membrane-associated serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71794"
FT                   /db_xref="GOA:Q032S8"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q032S8"
FT                   /protein_id="ABJ71794.1"
FT                   /translation="MNFNEIKRDFTRYKATYVLSIITLLVWLWQFFTYGTSATSAFNLF
FT                   KSGAILGQVMVFDPSQMWRLLTANFIHIGWAHVLLNVATLFFIGRQIENVFGWLRFTLI
FT                   YLLSGIFGNAMVFLLTPQVVSAGASTSLFGLFAAVVGLAYFTKHPFLQQIGRMFTVLIV
FT                   ANLVMNLFSLGNVSIWAHIGGAIGGLLLSAILPPKAFVPSIPKQYRVFAIGAFIILFFL
FT                   FIGLPFFK"
FT   gene            162977..163408
FT                   /locus_tag="LACR_0177"
FT                   /note="LactoCOG number LaCOG00110"
FT   CDS_pept        162977..163408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71795"
FT                   /db_xref="InterPro:IPR021701"
FT                   /db_xref="UniProtKB/TrEMBL:Q032S7"
FT                   /protein_id="ABJ71795.1"
FT                   /translation="MRIDKIVDAPREFIFEKIVDSCLFDIEKNTGKRPKVRSLNGYEYN
FT                   KSFGKNQRGTIKITELTEPSIYAFTTKTNRNTFSTRWELHKIDDRSTQVIIEENQSSNG
FT                   FIQMVNDKAVGFFLGRFKKRQMVAILDNVNRAYNGGRAH"
FT   gene            163429..163809
FT                   /locus_tag="LACR_0178"
FT                   /note="LactoCOG number LaCOG00240"
FT   CDS_pept        163429..163809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0178"
FT                   /product="Lactoylglutathione lyase related lyase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71796"
FT                   /db_xref="GOA:Q032S6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q032S6"
FT                   /protein_id="ABJ71796.1"
FT                   /translation="MKIEHVGLMVQDLEGMRHFYEHYFEGQAGQKYHNPKTTFQSYFLT
FT                   FSDGARLEIGTKENLKSADKSVWTGYAHLAISVGSKEKVDELCQRFLADGFEVKSGPRT
FT                   TGDGYYEAVILDPEENEIEITI"
FT   gene            163920..164972
FT                   /locus_tag="LACR_0179"
FT                   /note="LactoCOG number LaCOG00111"
FT   CDS_pept        163920..164972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0179"
FT                   /product="Predicted acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71797"
FT                   /db_xref="GOA:Q032S5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR041380"
FT                   /db_xref="UniProtKB/TrEMBL:Q032S5"
FT                   /protein_id="ABJ71797.1"
FT                   /translation="MNTNTKDKKEYLNLATYAFHKPKTLERARAFDKLLEFSKAYGHYE
FT                   NEKLTSMLIDSHFRGYWGDKNVKISGIGYVASYPEYRGNGAIRQLMTESLREDYEEGTF
FT                   FSYLAPFSYGFYEKFGYHYAFNQKHYKIPAQDFPKGQRTNGEISREKFEFEAEMSNEKT
FT                   VSKSSEIFKVLTDIHQKAYNQGSLVRSEELWSYFFIHKSQPHVAIYRENGKALGYLLYE
FT                   FSEMTFVIRELITLTDEAKQALYRFISSHAGSFSEIAWQAPADTLLEEEMIEPQRAEIK
FT                   LVPYMQARIVNLKEFLKVNGQPNFSVQITDDIIAENNMTIGEGKAEKMTIGQLTTKILK
FT                   ENQAILREYF"
FT   gene            165320..166411
FT                   /locus_tag="LACR_0180"
FT                   /note="LactoCOG number LaCOG00112"
FT   CDS_pept        165320..166411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71798"
FT                   /db_xref="GOA:Q032S4"
FT                   /db_xref="InterPro:IPR008589"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q032S4"
FT                   /protein_id="ABJ71798.1"
FT                   /translation="MGKLGVSIYPERSNFEADKTYLDLAHQYGFKRVFTSLLEIDGDKE
FT                   GVLAAFKKVVNYANQLGMEVMVDINPGLFTQLNISYDDLSFFHKMGADGVRLDIGFTGA
FT                   EEARMTRNPYGIKIEINMSQGTTYVDSIMDYSPDTEKLLGSHNFYPHRYTGLEFNHYLK
FT                   CTEKFKGYNLNTMAFVNSHAATFGPWPTQDGLCTLEDHRALEIATQVKHYKLLGGIDDI
FT                   TIANAYASEEELKAMSQAFNASMPEVKVVPRETITENERKCLFEATHSYRGDKSAYMLR
FT                   STMTRITYKDLDFPAHDTDKIQRGDIIIDNEGYGQYKGETQIALREMENDGRVNVVGRI
FT                   ADDELFLLDFLKPWSSFKLIESK"
FT   gene            166511..167995
FT                   /locus_tag="LACR_0181"
FT                   /note="LactoCOG number LaCOG00113"
FT   CDS_pept        166511..167995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0181"
FT                   /product="PTS system cellobiose-specific IIC component, Lac
FT                   family"
FT                   /note="TC 4.A.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71799"
FT                   /db_xref="GOA:Q032S3"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="UniProtKB/TrEMBL:Q032S3"
FT                   /protein_id="ABJ71799.1"
FT                   /translation="MNGITAWMEKYLVPVAAKIGSQKHLVALRDSFIGMLPATLAGALA
FT                   AMVSAIVTTFPSAIQQMMLGATAFSKLAPEKVWTLANTPIIGDLNNISALVNQGTLTVI
FT                   GLIFAFSWGYNLARAYGVNDLAGGIVSVATLFAGLPNQMGKFTAALGTGKAGVAATDKI
FT                   NGVLGDQGLAAWKPLFASAHLDAGAYFTVIIMGALAVIIYAKLMLADITIKMPESVPPA
FT                   VAKAFLAIIPTIAALYIVGLIYYIIGKLTNDSVINLITHYIAEPFQILSQNIFSVLIVT
FT                   LFVSVFWFFGLHGPNVLAPVLDGIWGPLGLNNQALYFQVHSQGIRDLIAKGAVDKAHAI
FT                   NGDYVNLWVRGSWDAFAWFGGSGGTITLVIAIILFSKRKDYKIVGRLGLAPGIFNINEP
FT                   VLFGLPVVLNAIFFIPFAVAPLISVIIAYTATALHLVDPVVNAVPWVTPPIMNAFMATG
FT                   FDWRAIVLTIINLIITFVIWVPFVIAANKLEETELD"
FT   gene            168121..168327
FT                   /locus_tag="LACR_0182"
FT                   /note="LactoCOG number LaCOG02397"
FT   CDS_pept        168121..168327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71800"
FT                   /db_xref="UniProtKB/TrEMBL:Q032S2"
FT                   /protein_id="ABJ71800.1"
FT                   /translation="MILVNSAMMQKEIIELLEENGFKHTKKQGLKLFFETPTDDATTDA
FT                   AMAKQLIKGSSFGAAVFFNVSVV"
FT   gene            168324..168518
FT                   /locus_tag="LACR_0183"
FT   CDS_pept        168324..168518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71801"
FT                   /db_xref="GOA:Q032S1"
FT                   /db_xref="UniProtKB/TrEMBL:Q032S1"
FT                   /protein_id="ABJ71801.1"
FT                   /translation="MSTWGIAFISLGLLLVAYHNWLGLAIVLIGFVMIFIARSQKKKAT
FT                   KIEEENRQEHKDIKIKTRK"
FT   gene            168647..170083
FT                   /locus_tag="LACR_0184"
FT                   /note="LactoCOG number LaCOG00114"
FT   CDS_pept        168647..170083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0184"
FT                   /product="Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71802"
FT                   /db_xref="GOA:Q032S0"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:Q032S0"
FT                   /protein_id="ABJ71802.1"
FT                   /translation="MEHKKLSSFPSDFLWGSASAAYQVEGAPFEDGKKASVWDNFVRIP
FT                   GKTFKGTNGDVAVDHYHRYKEDVALMKELGLKSYRFSIAWTRILPDGRGEVNQAGLKFY
FT                   EDLIDELIANHIEPIVTIYHWDLPQALEDLYGSWESREIISDFVNYAEVLFKAFKGKVK
FT                   YWVSLNEQNIFTSQGWSLATHPPGKRDMKLFYQVNHIANLANAAVINKFHELEMDGQIG
FT                   PSFAYTPQYAKDSDPLNVLAAENAEELYSHFWMDVYLYGEYPIAAMAYLRENGLAPEFE
FT                   AGDAELLKSAKPDFLGINYYQTATNAWNPIDGGVGVGSFNTSGKKGTTKESGIPGLHKK
FT                   IQNPFIDRTNWDWEIDPEGLRIALRRITSRYRIPVMITENGLGEYDKVEEGKIHDDYRI
FT                   KYLESHVKAIKEAMTDGATVIGYHTWSYTDILSWLNGYQKRYGFVYVDQDETMEGSLKR
FT                   IPKDSYYWYQHLIETNGEEL"
FT   gene            170149..170601
FT                   /locus_tag="LACR_0185"
FT                   /note="LactoCOG number LaCOG00115"
FT   CDS_pept        170149..170601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0185"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71803"
FT                   /db_xref="GOA:Q032R9"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:Q032R9"
FT                   /protein_id="ABJ71803.1"
FT                   /translation="MKIRGFEVVAKYKNAGINLPKRSTEHSAGYDIEAAETVRFAPGEI
FT                   KLIPTGLKAYMQTGEVLYMYDRSSNPRKKGLVLINSVGVIDKDYYNNPDNEGHMFMQMR
FT                   NFTDEEVLVEKGERVVQGVFMPFLVADGDENQEKEERTGGFGSTGV"
FT   gene            170694..172034
FT                   /locus_tag="LACR_0186"
FT                   /note="LactoCOG number LaCOG00116"
FT   CDS_pept        170694..172034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0186"
FT                   /product="5'-nucleotidase/2',3'-cyclic phosphodiesterase
FT                   related esterase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71804"
FT                   /db_xref="GOA:Q032R8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR011240"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:Q032R8"
FT                   /protein_id="ABJ71804.1"
FT                   /translation="MNKLRILHLNDLHSHLERFPVIERFFAEKSQEKVESLRFDLGDNV
FT                   DRVHPLTEATEGQINVELMNRLNLTAATIGNNEGLGLTHEMLSHLYDEANFPVLLSNLI
FT                   TDFAQTEPLIMTTSFGLRVGLIGLTAPYSRAYPQAGWELLDPFVVLDKLLPKMDCDFTI
FT                   LLSHLGKNVDEQIAKDYDIDLIIGAHTHHLFEHGAQVNQTLLAAAGRYGEYVGQIDLAF
FT                   NENNQLVDAQIEAIATNTLPQKRSDIVETNGWELRGHKLLEGTVVTKLAKPLPNLSPDF
FT                   TASHYLAKLFADYEKTALCLINSGLLVTDELPQSLTLDDLHEFLPHSIRLVRFTFTGEE
FT                   LRQVLLEIIDVSAFLATQKIQGMGFRGKTFGSLIFQGIEPINGDFYLKNAKDDSLEKIN
FT                   DEQKYQILLPDQYLFAWYFPLLKKLGQSEILFPYFLREIVAEYFKNK"
FT   gene            172049..172816
FT                   /locus_tag="LACR_0187"
FT                   /note="LactoCOG number LaCOG00117"
FT   CDS_pept        172049..172816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71805"
FT                   /db_xref="InterPro:IPR009370"
FT                   /db_xref="InterPro:IPR038141"
FT                   /db_xref="UniProtKB/TrEMBL:Q032R7"
FT                   /protein_id="ABJ71805.1"
FT                   /translation="MAKVIDETKLNYNKYPGEHVMASGEVVQVGKRTFHIVHNYREAFD
FT                   AEKLEQRFSDVLDKYDYIVGDWGFEQLRLKGFFSTSRKKMLADNKIDHLEDYINEYCNY
FT                   GCAYFVLRRIRTRDEAFVSEKLFTEKELKQGLDKPRRKRNRNRNRARDEQTVNSKDEKR
FT                   SENASEARKDFKIRDKSADRKAKPTDKKINKPLSKKSQEGRADKAVNKKVTSSKESDKK
FT                   FTMKKRNPRKKVEQTEPKNQGNQGFVIRNRKKD"
FT   gene            173008..174105
FT                   /locus_tag="LACR_0188"
FT                   /note="LactoCOG number LaCOG00118"
FT   CDS_pept        173008..174105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0188"
FT                   /product="23S rRNA m(2)A-2503 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71806"
FT                   /db_xref="GOA:Q032R6"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032R6"
FT                   /protein_id="ABJ71806.1"
FT                   /translation="MTENITTETRPSIYGLTRDQLIEWAIENGEKKFRATQVWDWLYRK
FT                   RVQSFEEMSNLSAVFIDKLNEAFILNPLEQVVVQESADGTVKYLFMLPDKVMIETVLMR
FT                   QSYGLSVCVTTQVGCNMGCTFCASGILKKERDVTAGEIVSQIMLVQKYFDERGLDERVS
FT                   HVVVMGIGEPFDNYEHLMNFLRVINDDNGLAIGARHITVSTCGFMPAKIKEFAHENLQI
FT                   NLAISLHAPNNELRTSLMRITRNAPLEKLFEAIDYYTETTNRRVTYEYIMLSGENDSPE
FT                   IAQQLADLIKPRNKLSYVNLIPYNPVAEHIKYERSTKDNTAKFYDVLKKNGINCVVRQE
FT                   HGTDIDAACGQLRSKQIKKNKAKLA"
FT   gene            174353..174964
FT                   /locus_tag="LACR_0189"
FT                   /note="LactoCOG number LaCOG00958"
FT   CDS_pept        174353..174964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0189"
FT                   /product="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71807"
FT                   /db_xref="GOA:Q032R5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q032R5"
FT                   /protein_id="ABJ71807.1"
FT                   /translation="MDYVKLNKSRHKVKTFDGKKIPTVDVKQIISAASLAPSAHNIQSW
FT                   HFVIVESKEKREALLTEVDPGNHEQIKQAGAVIVLFSDTDLVERSREIARVGAGELDDE
FT                   QLLRFNSRYPQMYEGFEELHESNYLSINIGLVTMNLILAIKNYGYESNIIMGFNRTQKV
FT                   NELLEVEKRYRPELIIPLGNSEDKGKPSYRLPQSQIMEIR"
FT   gene            175115..176095
FT                   /locus_tag="LACR_0190"
FT                   /note="LactoCOG number LaCOG00120"
FT   CDS_pept        175115..176095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0190"
FT                   /product="Geranylgeranyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71808"
FT                   /db_xref="GOA:Q032R4"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q032R4"
FT                   /protein_id="ABJ71808.1"
FT                   /translation="MLTFWQDYPEIQNKLKDVQALMIERLKINNQEIEVALQKFASRGG
FT                   KMVRPALFLLFAGIVPNGSKDEEKLIKIAASLEMLHSATLIHDDIIDDSPLRRGMPSVE
FT                   SQFGKDVAVYAGDFVYTVYFELLIETMNGTSFVAKNAQSMKRILQGELTQMQSAFDKNN
FT                   TARRYMKAISGKTAELLSLSCLEGVYFAGGDKKLQHSARKIGRAIGLAFQVYDDILNFT
FT                   VGLDEADKPILTDFRQGIYTLPLLLAREVNEAAIAPYLEAPEKLSRQECLDLAELVTEL
FT                   GGITGSLLVAGRLTELALNEIKKLPESPNRQILEEATQILLERNY"
FT   gene            176291..177196
FT                   /locus_tag="LACR_0191"
FT                   /note="LactoCOG number LaCOG00121"
FT   CDS_pept        176291..177196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0191"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71809"
FT                   /db_xref="GOA:Q032R3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:Q032R3"
FT                   /protein_id="ABJ71809.1"
FT                   /translation="MNFKIFAELIELKAKTASVFPFLLGLSYSLYHYHSLNLLALSIYF
FT                   VAMFMFNCFVDIWDNYNDYHNAVDTNDYQKNTNIIGRENLSMALIKALLAFFFFGSLAL
FT                   GIIVALMTGWAVFWLGLLCYAVGIFYAGGPKPLSSLPVGELISGLTMGYIIFLICVYIN
FT                   SSQAFVWSSANLATSFLIALPNTLLIANLMLANNTCDLEEDEANHRFTIVHYIGKKAAL
FT                   IWWTLALILSFIAIIVSVILGLLSPIMLLILLIVPLMIKFAKPYLQKQVKRETFICSVK
FT                   ILMVFQLVQVLLLFISLIRF"
FT   gene            complement(177257..177457)
FT                   /locus_tag="LACR_0192"
FT                   /note="LactoCOG number LaCOG02398"
FT   CDS_pept        complement(177257..177457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71810"
FT                   /db_xref="UniProtKB/TrEMBL:Q032R2"
FT                   /protein_id="ABJ71810.1"
FT                   /translation="MNLASIVILAIIFIITGFAIFKTVRSKGACEDCNVNTCPVKGAAA
FT                   LPTSNQASTNKNTESKHDCCN"
FT   gene            complement(177444..179519)
FT                   /locus_tag="LACR_0193"
FT                   /note="LactoCOG number LaCOG00123"
FT   CDS_pept        complement(177444..179519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0193"
FT                   /product="Fe2+ transport system protein B"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71811"
FT                   /db_xref="GOA:Q032R1"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:Q032R1"
FT                   /protein_id="ABJ71811.1"
FT                   /translation="MKIIALLGNPNSGKTSIFNLLTGSNQQVGNWPGVTVEKKSGIYRK
FT                   DKNVCIQDLPGLYSLSPYSLDEQVARDFLVKTPPDALVNIVDSTNLERSLYLTLQLMEF
FT                   GIPMVLALNMSDLLENQGKKIDLEKLSYSLGIPVITTSAIKNKGLDEVIKAALRSPEVQ
FT                   PLDYDHRLEGALSEISKVTGFTNRFEQIKVFEGDQLLLTKLSAEQLDEVEEIVSITEKL
FT                   MTDDRESIIVNERYDLIGHFVQLSVSQTETGKVNLTDRIDQIITHKWLGLPIFVFIMWL
FT                   VYFISIQTVGTAATDWLNDVFFGQWLPDLIANGMNALAVTPWVQDLVLNGVVAGIGAIL
FT                   GFVPQIFVLFLLLGILEDSGYMARVAFVMDRIFRRFGLSGKSFIPMLIASGCGVAGIMA
FT                   TRTIEQERDRKITIMVTTFMPCSAKLPIIALVSGAFFPHASWVAPSAYFLGMSMIILSG
FT                   IILKKTRMFSGDTSAFIMELPTYHLPYALTVLKYAFDRAFSFVKRAGTIIFAMNVLIWF
FT                   TSNYNWTLAHVDAGQSILADVGKVVAVVFAPLGFGEWRATVATITGLIAKETIVGTMGV
FT                   LFAHNSGDSHQLWSAVQATYTPLSAYSLLVFNLLCAPCVAAISTIYKEMGDVRWTLRAV
FT                   GFQTLVAYSMSFIIYQLGSFFSSQNFDVLSLVALLVLLVGLYFIFRKGKDVSYELS"
FT   gene            complement(179622..180080)
FT                   /locus_tag="LACR_0194"
FT                   /note="LactoCOG number LaCOG00124"
FT   CDS_pept        complement(179622..180080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0194"
FT                   /product="Fe2+ transport system protein A"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71812"
FT                   /db_xref="GOA:Q032R0"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:Q032R0"
FT                   /protein_id="ABJ71812.1"
FT                   /translation="MKTLNNTHIGQIYYIHKVIGKNQSKLRDLGLISDKKITLVSADGE
FT                   NSIIKIDEMRLALNSSFLEQIFVKEERSSEEIIGLAHLQVGQTGTVRMIDATSDIRRRL
FT                   MDMGITRGTSVHLQKLAPLGDPLELRLRGYSLSLRKTDAEKIKVVLEQ"
FT   gene            180411..180839
FT                   /locus_tag="LACR_0195"
FT                   /note="LactoCOG number LaCOG00125"
FT   CDS_pept        180411..180839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0195"
FT                   /product="Conserved domain frequently associated with
FT                   peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71813"
FT                   /db_xref="GOA:Q032Q9"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032Q9"
FT                   /protein_id="ABJ71813.1"
FT                   /translation="MKKEELKKKLSPLAYRVTQENGTEAPFTNEFDDFFEKGLYVDIVS
FT                   GEPLFTSLDKYQSGCGWPAFTQPIDKKMVKEKRDKSLFMERTEVRSSNADSHLGHVFTD
FT                   GPLDKGGLRYCINSAALRFIPFDQLESEGYGDYIKYFS"
FT   gene            complement(180967..182631)
FT                   /locus_tag="LACR_0196"
FT                   /note="LactoCOG number LaCOG00126"
FT   CDS_pept        complement(180967..182631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0196"
FT                   /product="Dihydroxyacetone kinase related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71814"
FT                   /db_xref="GOA:Q032Q8"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR019986"
FT                   /db_xref="InterPro:IPR033470"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:Q032Q8"
FT                   /protein_id="ABJ71814.1"
FT                   /translation="MPNINSSKFQEMVQAAASRLNEQAEYVNSLNVFPVPDGDTGTNMG
FT                   MTITNGAKDVASKPAETVGEVAQILSKGLLMGARGNSGVILSQLFRGFAQYVKDYEEID
FT                   GIHLAAALQNGVEVAYKAVMKPVEGTILTVSRGAAELAKRKTDETDDAVEIMEAALEGA
FT                   KKALAMTPDMLPVLKEVGVVDSGGQGLVYIYEGFLMALNGEFVPETPVAELGAMDRMVN
FT                   VEHESVANASTVDIKYGYCTEIMVELGKGPTSRESYDHDNFQTYLAGIGNSLLVVDDEE
FT                   VVKVHVHTEDPGLVMQEGLKYGRLVKVKVDNMRLQNEGVAEKEAKSSNVSTSTSKKDWG
FT                   LIAIAAGEGLADIFREMGVNHVVSGGQTMNPSTEDILTAIEAVNAEKVIIVPNNKNIFM
FT                   AAKSAAEVAEIPVEVIESATVPQGFTALLSFDPTRSIEENKAAMTSALSDVQSGSVTTA
FT                   IRDTNVDGIEIHKKDTLGMLNNKIVVSTRKMNDAIFAVFDQMIDEDSEIVAIYIGEEGK
FT                   KANAEKIAKELEKKYPEIEVEIHDGKQPVYPYLFSVE"
FT   gene            complement(182631..183065)
FT                   /locus_tag="LACR_0197"
FT                   /note="LactoCOG number LaCOG00127"
FT   CDS_pept        complement(182631..183065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71815"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:Q032Q7"
FT                   /protein_id="ABJ71815.1"
FT                   /translation="MPFVSQFFFIYKFCKYIDDGTAMKMSVIINNQHGNVDIATEVIAT
FT                   VVGASTTEIFGVVGMTSKSAVKDNVRSVLRQENYSKGVVVTTADNETSIDVYVVISYGV
FT                   KISEVAKNIQERVRFNLENQLGITASSVNVYVQNVKVVED"
FT   gene            complement(183272..183466)
FT                   /locus_tag="LACR_0198"
FT                   /note="LactoCOG number LaCOG00128"
FT   CDS_pept        complement(183272..183466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0198"
FT                   /product="LSU ribosomal protein L28P"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71816"
FT                   /db_xref="GOA:Q032Q6"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032Q6"
FT                   /protein_id="ABJ71816.1"
FT                   /translation="MSKECYFTGRKTVSSNNRSHAMNQTKRVVKPNLQKVTILENGELK
FT                   TVWASAKALKKLPAGVERV"
FT   gene            183603..184262
FT                   /locus_tag="LACR_0199"
FT                   /note="LactoCOG number LaCOG00129"
FT   CDS_pept        183603..184262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0199"
FT                   /product="Uncharacterized membrane-bound protein conserved
FT                   in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71817"
FT                   /db_xref="GOA:Q032Q5"
FT                   /db_xref="InterPro:IPR009214"
FT                   /db_xref="UniProtKB/TrEMBL:Q032Q5"
FT                   /protein_id="ABJ71817.1"
FT                   /translation="MENLIEELTAKNKEYIHSVTKQLILVGKSDEEVKEILNDILPQII
FT                   EGQKSGIIARKLLGAPTEFVSQYQPKVADRPVSEKNENPVLMWLDSSLLFLGFISLLNG
FT                   VTALITSKAPVYGLITTILSAAVAGLVMYMMYRYFYRPKADNSRRSWNWKGFAATTLSV
FT                   LLWIAVTIFSGLIPTSINLQLPAVALVIVGAVAFGVRWLLKRQFNIQSALVAQPRR"
FT   gene            184457..185326
FT                   /locus_tag="LACR_0200"
FT                   /note="LactoCOG number LaCOG00130"
FT   CDS_pept        184457..185326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0200"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71818"
FT                   /db_xref="GOA:Q032Q4"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q032Q4"
FT                   /protein_id="ABJ71818.1"
FT                   /translation="MKGIILAGGSGTRLYPLTRAASKQLMPIYDKPMIYYPLSTLMLAG
FT                   IKDILIISTPTDTPRFKELLQDGSEFGINLQYAVQPSPDGLAQAFIIGEEFIGDDSVAL
FT                   ILGDNIYHGPGMSKMLQNAAAKEKGATVFGYHVPDPERFGVVEFDENMNAVSIEEKPEE
FT                   PKSNYAVTGLYFYDNDVIEIAKNIEPSPRGELEITDVNKAYLERGDLSVELMGRGFAWL
FT                   DTGTHESLLEAAQYIETVQRMQNMQVANLEEIAYRMGYITADDVLKLAQPLKKNEYGQY
FT                   LLRLIGKD"
FT   gene            185374..185496
FT                   /locus_tag="LACR_0201"
FT                   /note="LactoCOG number LaCOG02399"
FT   CDS_pept        185374..185496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71819"
FT                   /db_xref="GOA:Q032Q3"
FT                   /db_xref="UniProtKB/TrEMBL:Q032Q3"
FT                   /protein_id="ABJ71819.1"
FT                   /translation="MLKNIWEWFLWFTGVTDAGWSAWWGGFFSCLPLFGVFAVV"
FT   gene            185725..186318
FT                   /locus_tag="LACR_0202"
FT                   /note="LactoCOG number LaCOG00131"
FT   CDS_pept        185725..186318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0202"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase related
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71820"
FT                   /db_xref="GOA:Q032Q2"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q032Q2"
FT                   /protein_id="ABJ71820.1"
FT                   /translation="MTDNFFEKTLAAREISQIPGMLEFDIPVHGDNRGWFKENFQKEKM
FT                   MPLGFPESFFAEEKLQNNVSFSRKNVLRGLHAEPWDKYISVADGGSVLGAWVDLREGEN
FT                   FGHVYQTVIDASKGIFVPRGVANGFQVLSDTVSYSYLVNDYWALELKPKYAFVNYADPT
FT                   LGIKWEDVENAEVSEADKNHPLLKDVKALKADEL"
FT   gene            186318..186572
FT                   /locus_tag="LACR_0203"
FT                   /note="LactoCOG number LaCOG02400"
FT   CDS_pept        186318..186572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71821"
FT                   /db_xref="UniProtKB/TrEMBL:Q032Q1"
FT                   /protein_id="ABJ71821.1"
FT                   /translation="MFALHLRTKKRLEFWQVEKNTDRPSWANQAFTDGGFSWNDKSLSV
FT                   KNVGGLLKMTVPIGDYLVFNGKYLKAVPKAKFVREYRVD"
FT   gene            186614..187666
FT                   /locus_tag="LACR_0204"
FT                   /note="LactoCOG number LaCOG00132"
FT   CDS_pept        186614..187666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0204"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71822"
FT                   /db_xref="GOA:Q032Q0"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q032Q0"
FT                   /protein_id="ABJ71822.1"
FT                   /translation="MTEFKNIVVTGGAGFIGSNFVHYVYNNHPDVHITVLDKLTYAGNV
FT                   NNINMLFDSGRVELVVGDIADPEIVDQVASKADAIVHYAAESHNDNSLKSQDEFIQTNF
FT                   IGTYTLIQAARKYDLRFHHVSTDEVYGDLPYREDLPGHGEGEGEKFTDKTPYNPSSPYS
FT                   STKAASDLIVRAWVRSFGLKATISNCSNNYGPFQHIEKFIPRQITNILSGIKPKLYGDG
FT                   KNVRDWIHTEDHSSGVWAILTKGRMGETYLIGADGEKNNKEVLEDILTRMGKDKDDYDR
FT                   VTDRAGHDLRYAIDNTKLRTELGWTPKHTDFESGLQATIDWYRENENWWKAEKEAVEAK
FT                   YAETQKVLDK"
FT   gene            187710..188651
FT                   /locus_tag="LACR_0205"
FT                   /note="LactoCOG number LaCOG00133"
FT   CDS_pept        187710..188651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0205"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71823"
FT                   /db_xref="GOA:Q032P9"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q032P9"
FT                   /protein_id="ABJ71823.1"
FT                   /translation="MKKSVSKKLKIGEQMILITGGNGQLGTELRHLLDERGIAYTATDA
FT                   KELDITDGVAVDKFFDENKPELVYHCAAYTAVDKAEDEGRELDEKINVDGTKNVAEAAA
FT                   RVGATLVYISTDYVFGGTLPIGQEWPVDAPKAPESEYGRTKHLGEEAVVASGVKYYIIR
FT                   TAWVFGSYGPNFVFTMQNLATRFPELTVVNDQHGRPTWTRTLAEFMVYLVSEKADFGFY
FT                   HLTNDAASGEDVTWFDFAKEILKDTDVLVKPVDSSKFPAKAKRPFNSTMSLEKAKATGF
FT                   VIPTWQEALASMLEKGDLRENKDGVKGEINKK"
FT   gene            188785..189993
FT                   /locus_tag="LACR_0206"
FT                   /note="LactoCOG number LaCOG00134"
FT   CDS_pept        188785..189993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0206"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71824"
FT                   /db_xref="GOA:Q032P8"
FT                   /db_xref="InterPro:IPR015393"
FT                   /db_xref="UniProtKB/TrEMBL:Q032P8"
FT                   /protein_id="ABJ71824.1"
FT                   /translation="MKKHVFIIGSRGLPAKYGGFETFVEELVKHQNNKNIKYHVACQSE
FT                   NSDMALPGEHFEYLGADCFVIKLPKIGSARVIAYDILAINAALKYCKKEEIKAPIFYIL
FT                   GNTAGGFIGHYANKIHKLGGKLFVNPDGLEWKRTKWAAPIRSYLKFAEKKMVRYADLII
FT                   SDNAGIKEYLTSEYGQVESEVIAYGTEKFKSDLTESETLVKYKVNDYYLIVGRFVPENN
FT                   YETLIRAFMKSSTKRDLVIITNHEGNAYFKELREKTEFDKDARIKFVGTVYNQNELRYI
FT                   REHAFAYLHGHEVGGTNPGLLEAMWSTAVNVVLGVNFNRTTAGDSVIYFDKENLLTTLS
FT                   EVENLTPDEGQRLHEKAQAIIEEKYTWEHICAQYEDLFAPKFTDESEPLRKMENLARGG
FT                   DES"
FT   gene            189983..190924
FT                   /locus_tag="LACR_0207"
FT                   /note="LactoCOG number LaCOG00135"
FT   CDS_pept        189983..190924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0207"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71825"
FT                   /db_xref="GOA:Q032P7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q032P7"
FT                   /protein_id="ABJ71825.1"
FT                   /translation="MRVNILMSTYNGEKFVADQIESIQKQTYTDWNLIIRDDGSSDRTC
FT                   KIVDDFVSKDNRIKLIRAENVGVIKSFHELVTDNNNADFYFFADQDDYWLPEKLSVMLE
FT                   ETKKHDNSKSVMYYTDLKVTDRNLNVTSESMIRSQSEHANTKLVQELTENTVTGGASMI
FT                   NHELAQLWQSTNDIIMHDWYLAIVAAALGELVYIDQPTHLYRQHDSNVLGARTLSKRIK
FT                   KWIHPNLWFEKYWWLITASQKQAQKLLTENLSLMSEADRALVSDYVNILKQPKAERRQI
FT                   LDRYNLRKNKNYHTRIFRTLIITKFAYKGKNK"
FT   gene            190921..191730
FT                   /locus_tag="LACR_0208"
FT                   /note="LactoCOG number LaCOG00136"
FT   CDS_pept        190921..191730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0208"
FT                   /product="ABC-type polysaccharide/polyol phosphate export
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71826"
FT                   /db_xref="GOA:Q032P6"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q032P6"
FT                   /protein_id="ABJ71826.1"
FT                   /translation="MNFFSRRNQILLKELIKTDFKLRYQGSVIGYLWSILKPLLLFLIL
FT                   YLVFVRFMRFGEAIPHFAVALLLGITIWNFFSEATNMGMLSIVSRGDLLRKVNFSKPVL
FT                   IFSVVANAFINLMISLVVVIIFALINGVQMSWTVIFAVPLLLELIIFTMGIAFILSTLF
FT                   VYFRDLGPIWEVVMQAAFYGTPIIYPVTQISTSHLEIAKILMLNPMAQIVQDMRYILTF
FT                   SNNANPTLWQMWHNPFVIIIPYILPILVFGLGLWIFTKNSKKFAEVI"
FT   gene            191744..192937
FT                   /locus_tag="LACR_0209"
FT                   /note="LactoCOG number LaCOG00137"
FT   CDS_pept        191744..192937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0209"
FT                   /product="ABC-type polysaccharide/polyol phosphate
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71827"
FT                   /db_xref="GOA:Q032P5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q032P5"
FT                   /protein_id="ABJ71827.1"
FT                   /translation="MAELAVKIDHVSKYFRLPTEASTSLRTTLVNRFRGIKGYKEQHVL
FT                   KDIDFEVEKGDFFGIVGRNGSGKSTLLKIISQIYVPEKGKVTVNGKLVSFIELGVGFNP
FT                   ELTGRENVYMNGAMLGFSTQEIDEMYDEIVDFAELHEFMNQKLKNYSSGMQVRLAFSVA
FT                   IKARGDVLVLDEVLAVGDEAFQRKCNDYFLERKKSGLTTILVTHDMNAVKKYCNKAVLI
FT                   EDGLIKVAGNVDKVANQYSLDNLKRLKAAQEESTEEVEEFVSDLKVNLLSPVQTTPEQP
FT                   IKFEVSYNVKEDIKTYVAFSLTDADRNIWIYNDNSMDYLTEGQGEKRAVYECKLDQVNN
FT                   LKLKLQVSVRNAKDEMVAYDIDEKIIIINRLDIPKDDLSAKDSASGLILRNGDWNFG"
FT   gene            192930..194306
FT                   /locus_tag="LACR_0210"
FT                   /note="LactoCOG number LaCOG00138"
FT   CDS_pept        192930..194306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0210"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71828"
FT                   /db_xref="GOA:Q032P4"
FT                   /db_xref="InterPro:IPR018674"
FT                   /db_xref="UniProtKB/TrEMBL:Q032P4"
FT                   /protein_id="ABJ71828.1"
FT                   /translation="MVKEKTQTKKLMKPERLFFLVALVAGLIFAIAQPLFIEPDSSYHF
FT                   DKSSYLSNTVVDRTKIGFPAEDYQSAPLPFTTVTTKMKDGTYFKDFFETKLPLVSKSKV
FT                   TDKRALGKKWYQDIMHLIPALGVKVGYMIYPSVGSMVLVARLFSLIFFVLTMYFIIKKL
FT                   KAYQMIFTIISVTPVAIQFATSLSYDSYNYIAFAWLSATLINLAVELQENKEIQLKDFF
FT                   LRIILPSIALYFSKANSRLLYLIVLAVFIVIVAKKLKLSLTKLQVLIGSGVLIGLGALV
FT                   YIFRYHDQLRLVVSKFIYTFMEPYYSVLTTQVISGTSTAAIPAWFYPIQYGALILLFLS
FT                   YTKEQVPRWFAWLGLLINLINLFGVLFKFAIDPAFTEHVITGPQGRYFTVFILLLAPIL
FT                   TLLAQKISVKSTGSWLRRIVLFVSLMALALNLGVTTLRSYYLHLPMDEYRSGIEHYIFK
FT                   "
FT   gene            194315..195280
FT                   /locus_tag="LACR_0211"
FT                   /note="LactoCOG number LaCOG02401"
FT   CDS_pept        194315..195280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0211"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71829"
FT                   /db_xref="GOA:Q032P3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q032P3"
FT                   /protein_id="ABJ71829.1"
FT                   /translation="MDKKVSVVVTCYNHEKYIEECLRSIFGQTHQEIELLIFNDGSTDA
FT                   SGDVISEVLQDSPFTETHYFSEKNRGLAYVRNDALSKMTGDFLLFVDSDNFLNDDHIEK
FT                   LLTELSATNSDIAYCQLWDFNAQRDVLRSDLEYSFEKQIVGNLIDASSLVRASKIIDAK
FT                   FDESLNNQTLEDYDFWLNLIINNEAKPVYVSTTKLNYRVLNESLSKRGNWENYYKSYFY
FT                   IINKYIQKIPAELIEALQKNLLLWVDNYQNLVIDSEQKLADKEQELINHNTQEEIMRKI
FT                   IADKDTHIANQEKVISDITSSLAYRILNKLLHPLGKKHEQ"
FT   gene            195270..197036
FT                   /locus_tag="LACR_0212"
FT                   /note="LactoCOG number LaCOG00139"
FT   CDS_pept        195270..197036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0212"
FT                   /product="Lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71830"
FT                   /db_xref="InterPro:IPR007739"
FT                   /db_xref="UniProtKB/TrEMBL:Q032P2"
FT                   /protein_id="ABJ71830.1"
FT                   /translation="MNNKLLLYVHFNRNNELSDHVIYQLTHLRQNFEEVFFISNSEMDE
FT                   NDLSTLTGQNLIDGFMQRENKGYDFVAWSDAMKHYGFDKLASYDSVTVMNDTCFGPVYD
FT                   FEGILAKFDKDTSVDFWGITNNRSHKVKPLENREAIVLPDHIQSYFVNYKQKIVKSEAF
FT                   ENFWANIEVLDDVVEVIVKYETAMTKYFEDAGFKSGVVFDTRKEEWSGMLVHDFSVFNL
FT                   PELLKRHIPFLKIKAFSYGAENIYTPLVIERLKQETSFPVKLIVNHMTEVDYPDREYML
FT                   EEKTLKFTKEVSAKTNLKIGIHLHAFYLDLIPEYLNYFDKYVQNYDLYITTDTEEKYEE
FT                   ILKNYPLPQIKKVIVTGNKGRDVLPWMQVSELMTDYDLCGHFHTKKSKDNDWIVGESWR
FT                   RDIEYSLLEPAQAIFQEFEKNPKLGLIIADVPSFFEHFYGPTYITERDIWPDMQEIWQK
FT                   IDFENSKELKQKDSYVMSYGTMIWYRPQALNNLLNVNIQADVPEEPLPYNSILHAFERL
FT                   LVYVSWANGYDFRISQIQTNNGFVANFSANRLLRSVETDLTQTKLRDLVKMIFKKIKVI
FT                   IVYRLGFNKKNK"
FT   gene            197113..197850
FT                   /locus_tag="LACR_0213"
FT                   /note="LactoCOG number LaCOG00140"
FT   CDS_pept        197113..197850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0213"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71831"
FT                   /db_xref="GOA:Q032P1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q032P1"
FT                   /protein_id="ABJ71831.1"
FT                   /translation="MSEDKKMKILLIIPAYNEGEGILENLKIVEDYQATCPYQLDYVVI
FT                   NDGSTDNEEEILIANNINHVELIQNLGIGGAVQTGYLYALQNSYDIAVQFDGDGQHDIH
FT                   SLPNLIEPILKDEADFTVGSRFLDESNSEFKSSKSRQMGIKILSSLIYMSSKIKIKDVT
FT                   SGYRAGNRKVIEQFVKRYPRQYPEPESYMHLFSKNIRVKEVGVRMFERTTGVSSINMVK
FT                   GVSYMISVSLAIIASSLLGKEKK"
FT   gene            197850..198203
FT                   /locus_tag="LACR_0214"
FT                   /note="LactoCOG number LaCOG00141"
FT   CDS_pept        197850..198203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71832"
FT                   /db_xref="GOA:Q032P0"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="UniProtKB/TrEMBL:Q032P0"
FT                   /protein_id="ABJ71832.1"
FT                   /translation="MPIQLRILAIILAAFFFVYTIRLVRKDRAEIRHMLKWFVLALILL
FT                   VGSLIPDFGTSIAHLLGIGTLTSLALYFLVGALLLICLKYQISLISAEKEIKNLVQEVS
FT                   LLKKKLSDKDKEK"
FT   gene            198225..199364
FT                   /locus_tag="LACR_0215"
FT                   /note="LactoCOG number LaCOG00144"
FT   CDS_pept        198225..199364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0215"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71833"
FT                   /db_xref="GOA:Q032N9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q032N9"
FT                   /protein_id="ABJ71833.1"
FT                   /translation="MKTVAIFSGFYLPFLGGIERYTYNIVQKFIDKGYNVVIVTSQHDK
FT                   DLPTKEEFDHLKIYRLPIRKIWKNRYPFPLKNERYKQLISDITSEPIDYYVVNTRFQLP
FT                   ALLGAQLAKKAGKEALVLEHGTTYLTLNNSLLDSILHRIEHFLVKKIKKNTKTFYGVSK
FT                   EATEWLKTFGIEAKGVIYNAIDLDDFEKYFSPKLSEKIVISYSGRLQAKFKGVEMLLEA
FT                   FSELSKERNNLELKIAGDGPIYSEMIRKYSQENIQFLGHISHEDVMRLNNHSDIFVLMS
FT                   KIEGFSTSMLEAALMNNVIVTTNVGGATELIPNQEYGYVIKDDKETLLKTLKLIVDDTK
FT                   KMAEIQKRVHDRVVENFNWNKSIESFEKAFVELEKIEIN"
FT   gene            199495..200487
FT                   /locus_tag="LACR_0216"
FT                   /note="LactoCOG number LaCOG01739"
FT   CDS_pept        199495..200487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0216"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71834"
FT                   /db_xref="GOA:Q032N8"
FT                   /db_xref="InterPro:IPR021520"
FT                   /db_xref="UniProtKB/TrEMBL:Q032N8"
FT                   /protein_id="ABJ71834.1"
FT                   /translation="MEKIDFVVTYLDSRDKEWKADRAKYSGKSLDETLNDESRFRNMDN
FT                   FHYWFRAVEKYAPWVNKIHLVTYGHVPDWLNVEHPKINIVNHKDFIEDKYLPTFNSNVI
FT                   ELNMDRIDGISEKFVNFNDDIFLNNEVQPNDFFNKGLPVLQAMHTPILPSESFNVVLFN
FT                   NILALNNINCSKKSLFQWKNFSIKNGIFAVAANLLMLPILLYMKKFVGYRPDHLAQPYT
FT                   KTIYKEVKNMASESINQAYSSKFRSKESISIWFILDYIRATGQFHPHNSFKFGGLFPMG
FT                   KNTDYQQILNSKKKIVCFNDGIDIDFELEKDRLNETLEKKYFKKSEFEK"
FT   gene            200484..201581
FT                   /locus_tag="LACR_0217"
FT                   /note="LactoCOG number LaCOG01935"
FT   CDS_pept        200484..201581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0217"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71835"
FT                   /db_xref="GOA:Q032N7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q032N7"
FT                   /protein_id="ABJ71835.1"
FT                   /translation="MKKKVLFVVPTWSLGGTEKVNLAIAEKLSKKNNVSIYTLSSPSSK
FT                   YLVNDVSIEGQSDFRFSVFTGVSGVLGMLRLKALNRLWLSSKAYEITKVIRKRQSEIIV
FT                   VSSGSIYLIPFLKRRNPNKKIVAWCHFSADTYLNGYLKYTTNLWVEGLEAADEVICLTP
FT                   EDKDIFLKINKKTRVINNPLTLKNTQVSDLTSNIISWTGRISNPQKGIDYLAQVAGKLP
FT                   EGWKISVAGDGNMKEFQTYLSENDSEERVILQGSLSGEKLRDHYLNSSIYLMTSRFEGL
FT                   PLVLVEAMSFGLPIVAFEQSGSRYALDNGKNGILVKNGDVEEMVKQLTRLINDFEERKR
FT                   YQEKSLERLQNFTLDRVSEEWEKIL"
FT   gene            201658..202695
FT                   /locus_tag="LACR_0218"
FT                   /note="LactoCOG number LaCOG02116"
FT   CDS_pept        201658..202695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0218"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71836"
FT                   /db_xref="GOA:Q032N6"
FT                   /db_xref="UniProtKB/TrEMBL:Q032N6"
FT                   /protein_id="ABJ71836.1"
FT                   /translation="MKKYYINALQKENMNAGSKAVNDATEIFEKMGYESLLSKVNIKNI
FT                   YLRTLFFSVQVMIRILFLPKNTKVVSNFPPIFFFERICLYFLKKRSKSLKVFILIHDIY
FT                   ELRIGKNNSTPYRNLLNFKNSNFYFIAHNDKMVSWLVKEGYKKNNIIDLEIFDYLSVIK
FT                   EDAGGTYGKSVIIAGNLAPEKSSYLMELFKISEIDFNLYGPNVSSDVEKSKNVIYHGSF
FT                   PADEIPNIIQGSYGLIWDSETTIGGTGKYGNYQRYNNPHKTSLYLAAGFPIIMWEKAAL
FT                   ASFIMEHNLGFLVNTLEEIPSKIAKIKEVDYNRMRENVEKFGNKIRMGYFLTEALEKAE
FT                   EISNE"
FT   gene            202688..203830
FT                   /locus_tag="LACR_0219"
FT                   /note="LactoCOG number LaCOG01730"
FT   CDS_pept        202688..203830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0219"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71837"
FT                   /db_xref="GOA:Q032N5"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:Q032N5"
FT                   /protein_id="ABJ71837.1"
FT                   /translation="MSETMKYNTKNYDYLIVGAGPYGAIFAHEAAKRGKRSLIIERRAH
FT                   VGGNMYTHKEHGINVHDFGAHIFHTDNKEVWDYVNQFTEFNGYINQVVANYKGELYNLP
FT                   FNMNTFYQMWGVKTPEEAAAKIEEQKVAAGLSGIPKNLEEQAISLIGTDIYTKLIKGYT
FT                   EKQWGRKATELPSFIIRRLPVRYTFDNNYFNHRYQGVPVDGYTAIFDKMLDSDLIDVQV
FT                   NTDFFSNKEDYLAEFPKIVYTGMIDQYFNYEFGELEYRSVRFESETFETDNKQGNAVIN
FT                   YTDAETPFTRVMEWRHFDKKGDDNKTIITKEYPQDWDRTKEAYYPVNDTKNSELFKKYR
FT                   KLADNEKTVIFGGRLGNYQYYDMDQVFNAALKAVEKEFKD"
FT   gene            203827..205245
FT                   /locus_tag="LACR_0220"
FT                   /note="LactoCOG number LaCOG00143"
FT   CDS_pept        203827..205245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0220"
FT                   /product="Polysaccharide Transporter, PST family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71838"
FT                   /db_xref="GOA:Q032N4"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q032N4"
FT                   /protein_id="ABJ71838.1"
FT                   /translation="MKVLKNYLLNSSYQLLIVIIPIITIPYISRVLGTTAIGINTFTYA
FT                   IIQYFVLAGSIGITTYGNREIAYHQSNKEKRSQIFWEISFLRFCTIALSFLVFCIFLAF
FT                   QKQNFEIYLLQSIAIIAAAFDISWYFMGVENFKRTVGRNFIVSIISVIFIFTFIKSPKD
FT                   LPIYVLIITGTSLIGNLSLWPYLRKEIFAPKWKTLALGHHLKPTLLLFLPQIATQIYTI
FT                   ANKTMIGIFDGKTASGFFSQSDSLIKVTLSIVTSLGVVMLPHVSNLFSKGKIKEVQETL
FT                   KKSFVLMTGLAIPIMFGVMGISLNFAGFFFGPKWVAVGPLLMMEAPIIVFIAWSNVLGI
FT                   QYLLPLNRMREFTTSVTIGAVLNILLNFVLIPSLGLTGAMIATVIAEAAVTVYQFYILR
FT                   NDFEIGTMILSCWKYFLSGAIMFGGVFYLNNLWKMNFRNLLFQIVIGAIIYIILNILLK
FT                   TSLFIEVKKIVSKK"
FT   gene            205274..207073
FT                   /locus_tag="LACR_0221"
FT   CDS_pept        205274..207073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71839"
FT                   /db_xref="GOA:Q032N3"
FT                   /db_xref="UniProtKB/TrEMBL:Q032N3"
FT                   /protein_id="ABJ71839.1"
FT                   /translation="MYKKVTFLVTLIGVLGLFLFTFSEGQVVSASEKTSTTNLSIKVTA
FT                   SGEPIQNGTFAAGNYQTAYEHIKSGTFPNSVTNTPDWRGAQNTEHMIVVAGLTVGENNK
FT                   HSDSEAKTIISTLFSTNFKLLQSINETNNGTDIMSFNPPSNFVRMRTPSGSNETTDAKG
FT                   RTVAKVSTGLTAIVDGSSQGIVKLITVTPGMKEITIDTDSLGLSLSFSSGNSKKNQPRT
FT                   VELNQEIHYKLKVNKKMLSPTALTKIILRPDANIVIDETSVPNTVSSLIPPIINPGVTF
FT                   DPLSSPDQLSKVAETIGATLISWQINMYELVIPPTDSDVSIDIKAHLSPVVYLNDISIQ
FT                   QGTSITTTKMTIPIEAFSSPDNNFGMTANVISPATATQITTSAPKINTTGINFVQVDTN
FT                   KNKLVRDSVYVLGKEVAGKKYLYDNQGKWSEVQSISTIDPAGYTLLRGGNQYVFGDNNV
FT                   SPIELNSTRFNYNYERDTKINESLIKLFGLGKGKDYFLYQVASPANYSMNKMPIGFSVF
FT                   SDISTSPNGSQLIKTSMKMAANQSFKLNGLIPDYGAGTNEYNVLSVTPQKEIHFSAVKS
FT                   IIFPLLVLVLGIVILGVILVRVV"
FT   gene            207075..208496
FT                   /locus_tag="LACR_0222"
FT                   /note="LactoCOG number LaCOG00138"
FT   CDS_pept        207075..208496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0222"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71840"
FT                   /db_xref="GOA:Q032N2"
FT                   /db_xref="InterPro:IPR018674"
FT                   /db_xref="UniProtKB/TrEMBL:Q032N2"
FT                   /protein_id="ABJ71840.1"
FT                   /translation="MDTVRYRRNNHQHQYEITSDKSLFSTKVDGLEKRIHKYYLVIALF
FT                   FGVVLSILMPFFNEPDGVYHFVNSSNIVHLTTDINVYGENSKWFGDQFVNQKPAYQNGD
FT                   YFKKYFETEVQRMPMSKLPRSTVYPKVLSYNFIGHLIPAIGIWAGYHIYPSIGMMIVCG
FT                   RLVNMLVMTIGMFLIIKFVKRGKLLFMVVALSPVQMNIFSSLSYDATSMLLVSIFIAAV
FT                   INIVNRDKFTIFSLMRLCLLAAILYLGAKTNLCLVFLFIPLLVFAYPLKRIIKSIIVLT
FT                   PPIARRIFMIITVGFLAVIAFYITHQRGGFLTLIYKLFINFTYNFGGSDYSIFTSTFTK
FT                   PLSGSNSKIPIYFSAVWFLLVGVAAFSETKFVKKSIISWTALAIFILNIVALFVIYSNV
FT                   GGFTGDRGALMGQIGGIQGRYITPLLPLLVLFAGNHRFVLGVTSRITVIRATIVIAVLS
FT                   NATLLFDTLFTIFKF"
FT   gene            complement(208634..209257)
FT                   /locus_tag="LACR_0223"
FT                   /note="LactoCOG number LaCOG02627"
FT   CDS_pept        complement(208634..209257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0223"
FT                   /product="Surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71841"
FT                   /db_xref="UniProtKB/TrEMBL:Q032N1"
FT                   /protein_id="ABJ71841.1"
FT                   /translation="MNYNTLGGAKKVWAAQYLYGTPSSNNLKNTQYGAWQYTSQMRFKG
FT                   GTSNLLNNNLDTSIDYNNIFSAPSQNLQDVYRLYNANTGEHFYTLNFAEKTNLQNVGWR
FT                   YEGIGWLSSSTGSPVYRVYNPNAKGGDHYYTMSKYEAQQLVSKGWRWDNNGGAAFYSNG
FT                   SKNLYVAYNPNASSGSHNYTTNSYEQDNLLRLGWKYGAVAWKVN"
FT   gene            complement(209247..209966)
FT                   /locus_tag="LACR_0224"
FT                   /note="LactoCOG number LaCOG01500"
FT   CDS_pept        complement(209247..209966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71842"
FT                   /db_xref="GOA:Q032N0"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:Q032N0"
FT                   /protein_id="ABJ71842.1"
FT                   /translation="MKLKKSHIIPLILLSGLLIAKPVFAEDNVSQDDHPMGYYIKQEQE
FT                   QQASDESTSTDAAEVPSIRARSFAAAIPAANAPDILYSDNISLPRKDAVDISSHQSWMV
FT                   QADFNAIKAAGVKTVIIKLTEGTGYINPYASSQIQMAKSAGLNIAVYHYATLQGANSQD
FT                   AGNSLAVQEANYFANTAKKLGLSTNIVMIMDCEQPYKDSSGKIIGPNPANVDWATAAAK
FT                   FASQLKSQGYSNLPNEL"
FT   gene            210348..211829
FT                   /locus_tag="LACR_0225"
FT                   /note="LactoCOG number LaCOG00149"
FT   CDS_pept        210348..211829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0225"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71843"
FT                   /db_xref="GOA:Q032M9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:Q032M9"
FT                   /protein_id="ABJ71843.1"
FT                   /translation="MSNWETKFLKKGFTFDDVLLIPAESHVLPNEVSMKTKLAKNLTLN
FT                   IPIISAAMDTVTDSKMAISMARQGGLGVVHKNMSVEEQAEEIHKVKRSESGVITDPFFL
FT                   TPNHKIEEAENLMATYRISGVPIVDTLENRKLVGIITNRDLRFITDYNQQIKNMMTSEN
FT                   LITAPVGTTLDTAARILQEHKIEKLPLVDEAGKLAGLITIKDIERVIEFPNAAKDEQGR
FT                   LLVAGAVGVSSDTFERAEALFAAGADAIVIDTAHGHSAGVLRKIREIRNHFPDRTLIAG
FT                   NIATGEGARALFEAGVDVVKVGIGPGSICTTRVVAGVGVPQITAIYDAANVAREFGKTI
FT                   IADGGIKYSGDIVKALAAGGDAVMLGSMLAGTDESPGEFEIFQGRKFKTYRGMGSLAAM
FT                   KKGSKDRYFQGAVNEANKLVPEGIEGRVAYKGTATDIVFQMLGGLKAGMGYTGAADITA
FT                   LHDSAQFIEMSGAGLKESHPHDVQITKEAPNYSVQ"
FT   gene            211995..213200
FT                   /locus_tag="LACR_0226"
FT                   /note="LactoCOG number LaCOG00150"
FT   CDS_pept        211995..213200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0226"
FT                   /product="Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71844"
FT                   /db_xref="GOA:Q032M8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019988"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:Q032M8"
FT                   /protein_id="ABJ71844.1"
FT                   /translation="MLMKCGIIGNMIENENTMEDLYCIGCGAKIQTEDKNALGFLPAGA
FT                   LKKKIAERDQMEAVQAGDEGSEAFVKNEDLYCQRCFRLRHYNEIAPTSLTDADFLRLLK
FT                   EIGQHNALIVNVVDIFDFNGSLIPNLHKLTGGNDLLMVANKRDVLPKSLKVGKMTAWLR
FT                   EQAASRGLKPKDILVTSAQNKDDVAELMEAIEHYRRGRDVYVVGVTNVGKSTLINAIIK
FT                   SASGSEDVITTSRFPGTTLDKIEIPLDEDSALIDTPGIIHRGQMAHYLEPEDLKYVSPR
FT                   KEIKPKTYQLNPEQTLFFGGLARFDFISGERQGMTAYFDNEINVHRTKLEGATEFYEKH
FT                   KGELLAPALVGAKLVRREFKITDKSDIVFSGLGWVRVPQKAVVAAWVPEGVDVVVRKAL
FT                   IG"
FT   gene            213295..213798
FT                   /locus_tag="LACR_0227"
FT                   /note="LactoCOG number LaCOG02117"
FT   CDS_pept        213295..213798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0227"
FT                   /product="NUDIX family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71845"
FT                   /db_xref="GOA:Q032M7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q032M7"
FT                   /protein_id="ABJ71845.1"
FT                   /translation="MEDRSQDIGFTRGNQWFRYRAAGIIIKDDAILMVGNDHNDYYYSV
FT                   GGAVQLGETAEEACLREIREETGLNLEIERLAFIHENFFVGQENDFLNDVTCHELSFYF
FT                   LMKPLTENLSVNSKSLGTDGSKEFLKWIPIADYRNYKAFPSFFADELANLSVNSQVKRI
FT                   VTNE"
FT   gene            213881..215125
FT                   /locus_tag="LACR_0228"
FT                   /note="LactoCOG number LaCOG00151"
FT   CDS_pept        213881..215125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0228"
FT                   /product="GTP-binding protein HflX"
FT                   /EC_number="3.1.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71846"
FT                   /db_xref="GOA:Q032M6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:Q032M6"
FT                   /protein_id="ABJ71846.1"
FT                   /translation="MIDLEEKQERVLLAGVETAQNFQAFESSMVELAELTKTAGGLVID
FT                   QFTQKRERPDSRTMIGSGKLEQMRWAIEVGEIDTVIFNDRLSPRQNVNLEEALGVKVID
FT                   RMQLILDIFAMRARSHEGMLQVEEAQLNYLLPRLVGQGIMLSRQGGGIGSKGPGETKLE
FT                   TDRRYIRTRIENIDKALKKVEKTRENIRQKRSKSGIFRIGLIGYTNAGKSSIMNALVGL
FT                   DKEQYEQNELFATLDATTKAVQLVEDFMVSLTDTVGFIQNLPTELIKAFKSTLEESANV
FT                   DLLIHVIDASNPHHEIHEQTVLKIMEDLKLTNIPVLNVYNKMDIAPSDFLPTLSPSLQL
FT                   SIKSESGVQWLKTAILEKLHELFEAFEIELPYEKAYQLPELRKSALVQLVVEGENAYQI
FT                   KGLIAPELSWKLNEF"
FT   gene            complement(215254..215580)
FT                   /locus_tag="LACR_0229"
FT   CDS_pept        complement(215254..215580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71847"
FT                   /db_xref="UniProtKB/TrEMBL:Q032M5"
FT                   /protein_id="ABJ71847.1"
FT                   /translation="MSITATIAAGATALTLLGAGGAAAVNAATPSTNTSPTTTATTATA
FT                   TIAKTKTAAGDYGGPKTDNGVGKGPTVDRSDMSSAQLAQVQKDEANGAPQQTGGPSTNT
FT                   SVAK"
FT   gene            215749..216063
FT                   /locus_tag="LACR_0230"
FT                   /note="LactoCOG number LaCOG00152"
FT   CDS_pept        215749..216063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0230"
FT                   /product="RNA-binding protein containing KH domain"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71848"
FT                   /db_xref="GOA:Q032M4"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:Q032M4"
FT                   /protein_id="ABJ71848.1"
FT                   /translation="MELNGKQKRYLRALAVNIKPIVQIGKSGLSNEILTSIRTACDARE
FT                   LIKVSILQNSDEVATDVAEAIEEMGLDVVQIIGRNLIVFKVSDRKENRKISVEVKNIVK
FT                   "
FT   gene            216138..216737
FT                   /locus_tag="LACR_0231"
FT                   /note="LactoCOG number LaCOG00736"
FT   CDS_pept        216138..216737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0231"
FT                   /product="Nicotinic acid mononucleotide
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71849"
FT                   /db_xref="GOA:Q032M3"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q032M3"
FT                   /protein_id="ABJ71849.1"
FT                   /translation="MAIDLLTPFTKVELKTKEDEKRRAIGLFWGNFNPVHVGHLTIADQ
FT                   VRQELNLEKVVFLPEHNTNGHVAAMLTAAIEDCPGLEVDACRLKAKDGADIYQTVLELH
FT                   EENPDCDFYFIIGGDMISGLAHWAHIDELLELVQFVGIRRPRYRAGTSYPIMWVDVPMM
FT                   DISGNLIREQLHRGIKPHFLLAPKVLDYILKEGLYV"
FT   gene            216730..217320
FT                   /locus_tag="LACR_0232"
FT                   /note="LactoCOG number LaCOG00153"
FT   CDS_pept        216730..217320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0232"
FT                   /product="HD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71850"
FT                   /db_xref="GOA:Q032M2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q032M2"
FT                   /protein_id="ABJ71850.1"
FT                   /translation="MFDFYSEVNLSREDLLAKIAGAVKESRFKHMLGVEKAAIALGEKY
FT                   GVDPHKASLAGLLHDYCKEVDDEIFLALIDKYNLDADLKNWDNNIWHGKVGIYKIREDF
FT                   GLEDEEILRAIEIHTVGDKEMSGLAKVLYVADYIEEGRKFPGVIETRAVAAQDLNQAVA
FT                   FETMRLVEYLAERRLTIYPQTFEAYNAFIAYLS"
FT   gene            217367..217798
FT                   /locus_tag="LACR_0233"
FT                   /note="LactoCOG number LaCOG00154"
FT   CDS_pept        217367..217798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0233"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71851"
FT                   /db_xref="GOA:Q032M1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q032M1"
FT                   /protein_id="ABJ71851.1"
FT                   /translation="MIRKVEMRDVSDITRLAGVLGYPISESIVKNNMSRILNDEKQEFL
FT                   VFDNGNQVVGFIEAETYDAVYSKEIMFNVLGLVVDAQEQGQGIGAQLLSALEENAKARG
FT                   INVIRLNSGVQRHEAHQFYEHQVYTSNHSQKRFLKVLEK"
FT   gene            217965..218324
FT                   /locus_tag="LACR_0234"
FT                   /note="LactoCOG number LaCOG00155"
FT   CDS_pept        217965..218324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0234"
FT                   /product="Iojap-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71852"
FT                   /db_xref="GOA:Q032M0"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q032M0"
FT                   /protein_id="ABJ71852.1"
FT                   /translation="MDSKKLLEVVVKAADDKKALDIVALDMSDVTFVADYFVIMEAMNS
FT                   RQLDAIADNIAEAAELAGAKAAGHIEGDAKTGWVLIDLGDIVVSVFGHDERGHFNLEKL
FT                   WSDAPMVDISGFIAE"
FT   gene            218328..219158
FT                   /locus_tag="LACR_0235"
FT                   /note="LactoCOG number LaCOG00156"
FT   CDS_pept        218328..219158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0235"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71853"
FT                   /db_xref="GOA:Q032L9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q032L9"
FT                   /protein_id="ABJ71853.1"
FT                   /translation="MALSVLLTELLFIFYPLTVRQKGLSLIQERAEMAFYEDFSRVYDQ
FT                   VMDQELYEQWLDFTKRHLPKETKSVFELACGSGALSVRLAQEGYEVTGLDISEEMLTLA
FT                   SKKARQAGYKLEFTAGDMRDLSGLGKFDAVTCYSDSLCYLENLNEVQATFDGVFEILNE
FT                   GGTFIFDVHSTHQVDEVFPNYSYHENAEDFAFLWDSFEGEVPHSIVHELSFFIQGEDGR
FT                   FTRKDEVHEERTYPIDDYLAHLATAGFKEAIVCADFTDEAPSKESARWFFVCKK"
FT   gene            219208..220377
FT                   /locus_tag="LACR_0236"
FT                   /note="LactoCOG number LaCOG00157"
FT   CDS_pept        219208..220377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0236"
FT                   /product="Predicted nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71854"
FT                   /db_xref="GOA:Q032L8"
FT                   /db_xref="InterPro:IPR008513"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032L8"
FT                   /protein_id="ABJ71854.1"
FT                   /translation="MTKITGIIAEFNPFHKGHEYLLNQIDGPKIVAMSGNWMQRGEPAI
FT                   FDKWTRAEMALSCGADLVVELPVTVSVQAADFFASGAVDILKNLGITDLAFGSESAIDY
FT                   NEIADIYETKETEMESFIKALPEQLSYPEKTQMMWQHFTGIKFDGNTPNHVLALAYAKA
FT                   AAGKNINLQAIKRVGKFHSTKLTEGFASATALRQSLFSLTERKNLLTEQTHQSVSQKPA
FT                   ILDLSAIKNHVPSVILETYASPKTNWAAYFPLLQYKIRLDDHLENIFQVNQELSVRLKN
FT                   AVKSAKNFDELVELVYTKRYTKARVRRLLTYILLNIPKEFNLPKEIHILGFSKAGQEIL
FT                   AQNRGKIISKIGQKPWDELTQKADEIYQLGNVDFKEQNFGRKPIIKREK"
FT   gene            220530..221246
FT                   /locus_tag="LACR_0237"
FT                   /note="LactoCOG number LaCOG00158"
FT   CDS_pept        220530..221246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71855"
FT                   /db_xref="GOA:Q032L7"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032L7"
FT                   /protein_id="ABJ71855.1"
FT                   /translation="MGRKWANIVAKKTAKDGATSKVYAKFGVEIYAAAKQGEPDPESNS
FT                   SLKFVIERAKQAQVPKHVIDKAIDKAKGGGDETFVQGRYEGFGPNGSMVIAETLTSNVN
FT                   RTIANVRTTFHKNGGNIGAAGAVSYMFDNTGVIVFEGTDPDHIFEILLDAEVDVRDVTE
FT                   EEGNIVVYTEPTDLHKGIAALKAAGITEFSTTELEMIAQSEVELSPEDLEIFEGLIDAL
FT                   EDDDDVQKVYHNVANL"
FT   gene            221311..221952
FT                   /locus_tag="LACR_0238"
FT                   /note="LactoCOG number LaCOG00159"
FT   CDS_pept        221311..221952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71856"
FT                   /db_xref="InterPro:IPR008319"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:Q032L6"
FT                   /protein_id="ABJ71856.1"
FT                   /translation="MSSPKIDYKKSDKNYYLPKGISLIELPALNYLMIDGKGAPTSPAF
FT                   QEAIALLYATAYMISMSYRNSNFTIKNFQPFVVPPLEGLWTSKNEPIDGKIDKKDFIWR
FT                   LMLRMPDFVNDQVIDKAKKLVEVKKGLDLSGLEFGKVEDGLCLQALHVGSFDQEGETFE
FT                   KLFAYAEKHDLKAIHKEFHHREIYISDFRKTAAEKLKTTVRIFVEKGQEK"
FT   gene            221949..222608
FT                   /locus_tag="LACR_0239"
FT                   /note="LactoCOG number LaCOG00160"
FT   CDS_pept        221949..222608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0239"
FT                   /product="Uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71857"
FT                   /db_xref="GOA:Q032L5"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032L5"
FT                   /protein_id="ABJ71857.1"
FT                   /translation="MKKTDWSQPLRNRLAEDYFPKMIEFINQTYQEGKIYPPENQIFRA
FT                   IELTPLAQTKVIIVGQDPYPQPGKAQGLAFSYPATFKVNRPDSIVNIQKELREEGFSKE
FT                   DSDLTAWAEQGVLLLNAVLTVPEFASNAHAGKIWEPLTDEIIKIASDDERPKVFILWGG
FT                   FARKKAKLIDGSKHLILEAAHPSPLSASRGFFGSHPFSKTNDFLVQTGQSPIDWSK"
FT   gene            complement(222746..223555)
FT                   /locus_tag="LACR_0240"
FT                   /note="LactoCOG number LaCOG02404"
FT   CDS_pept        complement(222746..223555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0240"
FT                   /product="NADPH:quinone reductase related Zn-dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71858"
FT                   /db_xref="GOA:Q032L4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q032L4"
FT                   /protein_id="ABJ71858.1"
FT                   /translation="MVKALQYKRFGQPEVLELVDLPSLEPKANEVSIIVSHVGLNPMDW
FT                   AIMGHPEVAPNFGVKLPQTFAYDFAGQIDQIGAEVTDFKVGDRVFGTTMKGAATEQLIA
FT                   STKEPGLYHTPDFIENDVASTLAVAGLTAAVALRKAHVKNGDTLLIGGAAGGVGIFAVQ
FT                   LAQLWGAKVIGTASDSTADFLKELGAEQVAYGEGLTDRLKGKGITAAIDLHSFESLNTA
FT                   LELGVKADKMSTVIMYPEPPAGVPTATGGEAIPSDMEMVLTAIGSHN"
FT   gene            complement(223578..224456)
FT                   /locus_tag="LACR_0241"
FT                   /note="LactoCOG number LaCOG02910"
FT   CDS_pept        complement(223578..224456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0241"
FT                   /product="Predicted nucleoside-diphosphate sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71859"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q032L3"
FT                   /protein_id="ABJ71859.1"
FT                   /translation="MKITLLGSLGNINRHFIPRLIADGHEVTVITSRPEGAAAIEKLGA
FT                   KAAVGLNTDLDFLSRTFTGSDLVYLMITGIAFSSATSMSDLAKIYSQAIKKADVKKVIN
FT                   LSSVGAQSPEAGILYEYHAMEDGLDELTGVTVKHIRPVGFYTNLLTEIALLKAQGKIFE
FT                   AISPETMRAWVHPSDIADAVYNRINDLLTDKAVSKIKYVVSDWATGTDWVNALGTNNIS
FT                   AQYVTISVEDLIENFVKAGLPKVVADGFGQMNQFQQSPDKLYQEIKSSNYHHGKVKIND
FT                   FAKEFAQVYYQ"
FT   gene            complement(224478..225317)
FT                   /locus_tag="LACR_0242"
FT                   /note="LactoCOG number LaCOG01986"
FT   CDS_pept        complement(224478..225317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0242"
FT                   /product="Saccharopine dehydrogenase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71860"
FT                   /db_xref="GOA:Q032L2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q032L2"
FT                   /protein_id="ABJ71860.1"
FT                   /translation="MKILITGATGKVGSRLAQYFLNQKENIRLLVSDEKRANSLKEQGA
FT                   EIIVGDLTNLNDLKKAVAGIDVIIHTAAAFRGVSDQTQKSVNLDATLSLAKAALEAKVQ
FT                   RFIFASTTNVYLGNTLNRPATENDEPTGKATYPASKIAAEKGLHSLLAGTATELVITRF
FT                   GLVYGDKDPHLNELAPYLTERHPDKLNSLVHHTDIDRALLQIIHTKDLKHDLYNIVDDS
FT                   ETSIADILSIENIAQECPTDNDHNKWESVSSNHRLKEDFDFNFLYPSITDAKDANAL"
FT   gene            225521..226066
FT                   /locus_tag="LACR_0243"
FT                   /note="LactoCOG number LaCOG00161"
FT   CDS_pept        225521..226066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0243"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71861"
FT                   /db_xref="GOA:Q032L1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:Q032L1"
FT                   /protein_id="ABJ71861.1"
FT                   /translation="MKKSSQEKLNEAALELITAQGYDNTTVLQIATKAGLTERTFFRKF
FT                   KNKADIFFAGGEQYSEMLLNKMRESKETNPLFIVLDGYFYAADFFDEHRERTVKRQKII
FT                   ASHPDLEERELLKQSKIEGLLVEYLLTDYEERTARLAVRLARAIYSVAWEEWLENETES
FT                   LRQLLEKAIGSYNDLKNY"
FT   gene            complement(226179..227600)
FT                   /locus_tag="LACR_0244"
FT                   /note="LactoCOG number LaCOG00162"
FT   CDS_pept        complement(226179..227600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0244"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71862"
FT                   /db_xref="GOA:Q032L0"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q032L0"
FT                   /protein_id="ABJ71862.1"
FT                   /translation="MLSNVMAGLEGSIVATALPAMMAELHGIKLMSWVVTIYMLLMAVS
FT                   SPIWTKLAERFGYKQMFVLGTLLFTIGSLGEGLAVNMLMVIVARALMGLGAGVMIQLPF
FT                   VIYGMMYQADERRRVIGNTVAAYSFSTIAGPIVGGLIVTLLDWRWVFFINIPIGIYMAF
FT                   IVWKNFDLKTDHTKKSIDFAGSASLSIAVIAIMLLFQMMGNAVINLPLLIALLVISLLF
FT                   FTGFYFAEKRAVDPIVPLELFKNPSFIAKNVMFFMQYGFFGFYTNYLPTWGQGVMGATA
FT                   LVGGMVLIPSAIMLVIGTRNVNHLIQKVGEKRTIYIGFAIMVLGALFLFSLPEHASILM
FT                   LFVATAILGTAFGIVNITLQVAVQESVAKHLIGAATAVNALLRTMGTTLVLSGLSIALN
FT                   RTFTDSTAHNPKLTTTLLNQISDAQALKNIPTALVAPLRHTLFNGMHLLALISGLLLFI
FT                   ALFVNWLDPWKKGLE"
FT   gene            227827..228198
FT                   /locus_tag="LACR_0245"
FT                   /note="LactoCOG number LaCOG00963"
FT   CDS_pept        227827..228198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0245"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71863"
FT                   /db_xref="GOA:Q032K9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q032K9"
FT                   /protein_id="ABJ71863.1"
FT                   /translation="MVTIATVAGRTGISAYNLRFYEKEGLISVPRTKAGIRDFDEAAES
FT                   RINAIRHYRCAGLSLAQIKEVFANTDKHEMIIEVLKVRKKEMEKELAELEKSMAYLDKK
FT                   INIHQERMNEEAAAKASLV"
FT   gene            228279..228455
FT                   /locus_tag="LACR_0246"
FT                   /note="LactoCOG number LaCOG00163"
FT   CDS_pept        228279..228455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0246"
FT                   /product="SSU ribosomal protein S21P"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71864"
FT                   /db_xref="GOA:Q032K8"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032K8"
FT                   /protein_id="ABJ71864.1"
FT                   /translation="MSKTLVRKNESLDDALRRFKRSVTKAGTLQELRKREHYEKPSVKR
FT                   KRKSEAARKRKKY"
FT   gene            228563..229375
FT                   /locus_tag="LACR_0247"
FT                   /note="LactoCOG number LaCOG00164"
FT   CDS_pept        228563..229375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0247"
FT                   /product="Predicted hydrolase of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71865"
FT                   /db_xref="GOA:Q032K7"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q032K7"
FT                   /protein_id="ABJ71865.1"
FT                   /translation="MTKIKHFFSDLDGTLLDDQGKIFQKTQEVIENSNLPFSLVSARAP
FT                   QAMEELINQLNLKSAQVAFNGGLIFAKNEVIKTNPLVHASTQKLIKTIKKDYPEINLSL
FT                   YSLSDWYVEKIDADIKQEMQFTPQVPKLVNLEALVTERPRLEIFKILLITPNEIKLEEI
FT                   KRHLEKLNFPDIIIQKTWETYLEITHLEAKKAKAVQFIAQRERLEQRELAAFGDNENDL
FT                   SMLKAVGLPIVMANASDDLKKIGKVITKSNTEDGVAYGIQKYITDSSL"
FT   gene            229577..230773
FT                   /locus_tag="LACR_0248"
FT                   /note="LactoCOG number LaCOG00165"
FT   CDS_pept        229577..230773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0248"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71866"
FT                   /db_xref="GOA:Q032K6"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032K6"
FT                   /protein_id="ABJ71866.1"
FT                   /translation="MAKLTVKDVELKGKKVLVRVDFNVPIKDGVITNDNRITAALPTIK
FT                   YILEQGGRAVLFSHLGRVKEEADKAGKSLAPVAKALSEKLGQDVVFPGTTRGAELEAAI
FT                   NELKDGEILLVENTRFEDIDGKKESKNDPELGKYWASLGDGIFVNDAFGTAHRAHASNV
FT                   GISANVEKAVAGFLLENEIAYIQEAVEAPERPFVAILGGSKVSDKIGVIENLLSKADKV
FT                   IIGGGMAYTFLKAQGYEIGTSLVEDDKLDLAKELLEKAAGKLILPLDHKVANAFAGYTE
FT                   VKETADQNIPAGFMGLDVASKTIADYNTQLEGAKTVVWNGPVGVFENPDFQAGTVGLME
FT                   AIVKQPGVKSIIGGGDSAAAAINLGYAEKFSWISTGGGASMELLEGKVLPGLAALTEK"
FT   gene            230831..231505
FT                   /locus_tag="LACR_0249"
FT                   /note="LactoCOG number LaCOG01953"
FT   CDS_pept        230831..231505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0249"
FT                   /product="Predicted hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71867"
FT                   /db_xref="GOA:Q032K5"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q032K5"
FT                   /protein_id="ABJ71867.1"
FT                   /translation="MTGKYPILVFDINETLLSFESLESFFAKYFDDKKVLRQWFSEQIL
FT                   YSQALTLSRNYYDFGELATSVLQMVAELHNHSLNDRVLLEFKQLLGQLLPYPEVEKGLE
FT                   MLKQSGFRMIALTNSPTLSSQVSLERSGLRKYFENVISVEEVQQYKPAPATYRRVRELI
FT                   GFEEKYCMIACHIWDLLGAQSENFDTAFIKRQGNATLPNLFQDNFVADDLQELSKLLIK
FT                   KY"
FT   gene            231625..232611
FT                   /locus_tag="LACR_0250"
FT                   /note="LactoCOG number LaCOG00166"
FT   CDS_pept        231625..232611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0250"
FT                   /product="Dihydroxyacetone kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71868"
FT                   /db_xref="GOA:Q032K4"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR012735"
FT                   /db_xref="UniProtKB/TrEMBL:Q032K4"
FT                   /protein_id="ABJ71868.1"
FT                   /translation="MKFYTSTTEIPEEMLKGVELTHTHLSYLSETGILYDNTFDNKAVP
FT                   IISGGGSGHEPAHIGYVGDGMLAAAVAGPLFVPPRAKNILKAIRQVNSGKGVFVIIKNF
FT                   EADLKEFKKAIEEARTEGIDVRYIVSHDDISVNAYNFHKRHRGVAGTVLLHKILGAFAK
FT                   EGASIDEIEQLALSLSPEIYTLGVALAPVHFPHQKTSFVLAEDEVSFGIGIHGEPGYRV
FT                   EKFEGSERIAVELVNKLKAEINWQKKANKNYILLVNGLGSTTLMELYHFQYDVMRLLEL
FT                   EGLSIKFCKVGNLMTSCDMSGISLTLCSVKDFKWLDYLNAPTGAFAW"
FT   gene            complement(232612..233153)
FT                   /pseudo
FT                   /locus_tag="LACR_0251"
FT   gene            233254..234248
FT                   /pseudo
FT                   /locus_tag="LACR_0252"
FT   gene            234378..234836
FT                   /pseudo
FT                   /locus_tag="LACR_0253"
FT   gene            234833..235204
FT                   /locus_tag="LACR_0254"
FT                   /note="LactoCOG number LaCOG00170"
FT   CDS_pept        234833..235204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0254"
FT                   /product="dihydroxyacetone kinase DhaM subunit"
FT                   /EC_number="2.7.1.121"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71869"
FT                   /db_xref="GOA:Q032K3"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR012844"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR039643"
FT                   /db_xref="UniProtKB/TrEMBL:Q032K3"
FT                   /protein_id="ABJ71869.1"
FT                   /translation="MTYGIVIVSHSSEIASGLKKLIREVAKDISLTAIGGLENGEIGTS
FT                   FDRVMNAIEENEADNLLTFFDLGSARMNLDLVSEMTDKELTIFNVPLIEGAYTASALLE
FT                   AGATFEAIKEQLEKMLIEK"
FT   gene            235214..235930
FT                   /locus_tag="LACR_0255"
FT                   /note="LactoCOG number LaCOG00842"
FT   CDS_pept        235214..235930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0255"
FT                   /product="Glycerol uptake facilitator related permease
FT                   (Major Intrinsic Protein Family)"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71870"
FT                   /db_xref="GOA:Q032K2"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q032K2"
FT                   /protein_id="ABJ71870.1"
FT                   /translation="MTLQILGEFLGTFILVLLGNGVVAANVLGKTKSENAGWVTIAIGW
FT                   GLAVAVAVWVVGFFSPAYLNPALVIGFLVLGKIKIGLALAFIVAEFLGAMLGAVAVWLH
FT                   YYPHWEETKDSSLILASFATAPAIRHSWSNFLGEAFDGALLMLLIMAMGHYRLEGGFGT
FT                   IIIGFLIMAVGFSLGPTTGYAMNPARDLGPRIMHALLPIKNKGTSDWGYAWIPATGSIV
FT                   GAVIAGLLYQWMLTLH"
FT   gene            complement(235967..237346)
FT                   /pseudo
FT                   /locus_tag="LACR_0256"
FT   gene            237590..238336
FT                   /locus_tag="LACR_0257"
FT                   /note="LactoCOG number LaCOG00173"
FT   CDS_pept        237590..238336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0257"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71871"
FT                   /db_xref="GOA:Q032K1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q032K1"
FT                   /protein_id="ABJ71871.1"
FT                   /translation="MTSPITVKGMSVKFGDKIILDRLSYDFESGKIICLIGPSGSGKST
FT                   FIKSIVGMQKLDSGSVEILEVKIPDRKILGQLGYMAQEDALFKELTGKQNLEFFGSIQG
FT                   IKKNELTEKLEKAALTVNLTSHLKQSVTNYSGGMQRRLSLAIALQTDAPILLLDEPTVG
FT                   IDPELRQEIWEELRNQADQGKTILITTHVMDEAERCDIVLMLRNGKFIDEGSPKEIKEK
FT                   YQVDSVEEAFIVAGKTLEMKAKEVVR"
FT   gene            238333..239475
FT                   /locus_tag="LACR_0258"
FT                   /note="LactoCOG number LaCOG00174"
FT   CDS_pept        238333..239475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0258"
FT                   /product="ABC-type multidrug transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71872"
FT                   /db_xref="GOA:Q032K0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q032K0"
FT                   /protein_id="ABJ71872.1"
FT                   /translation="MRIIAIFKRIMLQRRGDPRTLAMMFLAPIFILTLMYFLFQVPSNT
FT                   AYRVGLKSDNTELTKALKNMPDDKAHLEVVNVSKNNRLTMNEKDLSAIVSISGKNIEIS
FT                   YANQSNGTSSAVKMLLTQVLQENQAKATKEETQQALQNLMDKLSQVSGQSAPTKLSVNT
FT                   EQFQIRSKYLYGNPTSTNATFDDLAPILVGAFAFFLVLLISGISLVNERTSGTLGRMLV
FT                   TPVKRSEIVTGYTLSYGILAMIQTALMVIFTYWILGVHNNGNIGWVFVINFFIAIIALL
FT                   FGLLLSTLAKTEFQFVQMIPLAIISQFLFSGLIPVDTMPTILQGIAHCIPVYYGISAMQ
FT                   EVVKRGMGFSGIWFDLLIMFVFAVVLYLANVLALKNVRRT"
FT   gene            239598..240767
FT                   /locus_tag="LACR_0259"
FT                   /note="LactoCOG number LaCOG00175"
FT   CDS_pept        239598..240767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0259"
FT                   /product="Predicted SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71873"
FT                   /db_xref="GOA:Q032J9"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:Q032J9"
FT                   /protein_id="ABJ71873.1"
FT                   /translation="MKKITVRTKAAKKLRAGYPLLVAEDLSSPISEDDFAQFFDEKAQA
FT                   LGTGYLSKQNKGIGWLLSTSSAKIDHHFYVEKFVQARSLRAPFFQDELTTAFRLFNGEG
FT                   DGLGGLTIDFYNGFVVFSWYNPFIYSQKKAIVKAFQVVFPDIKGAYEKLRFADSQLESQ
FT                   YLFGEEAQEPLLVMENGVTYATYLNEGLMTGIFLDQKNVRGALVNGLVAGKTLLNMFSY
FT                   TGAFSVAAAVGGASQTTSVDLAKRSLDKTREQFLVNGIEPDSQKIYVMDVFGYFNYAKK
FT                   KNLTYDIVVLDPPSFARNGKKTFSVAKNYGELVEEAVDILEDNGTLIASTNAANVSDKK
FT                   FRQMVEESLKNKGVKFTIFQEEKLPADFQIADSFPEGNYLKVLFIKIKK"
FT   gene            240932..242854
FT                   /pseudo
FT                   /locus_tag="LACR_0260"
FT   gene            complement(242931..243019)
FT                   /locus_tag="LACR_t0261"
FT                   /note="tRNA_Leu_AAG"
FT   tRNA            complement(242931..243019)
FT                   /locus_tag="LACR_t0261"
FT                   /product="tRNA-Leu"
FT   gene            complement(243086..244360)
FT                   /locus_tag="LACR_0262"
FT                   /note="LactoCOG number LaCOG00177"
FT   CDS_pept        complement(243086..244360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0262"
FT                   /product="Predicted flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71874"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q032J8"
FT                   /protein_id="ABJ71874.1"
FT                   /translation="MTKSAKTFDVIVVGAGPSGMMAAISAAENGAKVALIDKNKKVGKK
FT                   LLMTGGGRCNVTNSRSVDEILANVPGNGRFLHSAFSQFSNLDIINFFESNGVKLKEEDH
FT                   GRMFPLTDKSKTIVDALFNKILSLHVSYFPSQPVSQLIIENGAIVGLETDSESYLSPTI
FT                   VLSTGGRAYPSTGSTGDGYRLARSAGHTISQLYATEAALLSDESFILDKSLQGISLREI
FT                   KLSVVNAKGKTVISHQHDLLFTHFGLSGPAALRCSSFINQLLEKGETPVMVSLDQFPDK
FT                   SAGFLKNELTKLASSDKSIKNAFSGLTQERMLLFILEKAGINPALPAKSLSEQQIEKLV
FT                   QLFKNWQIIINKTLPIEKSFVTGGGVSLKEVNPKSMESKKTQGLFMTGELLDINGYTGG
FT                   YNITCAFVTGFVAGKHAAEIASYFQ"
FT   gene            244398..245225
FT                   /locus_tag="LACR_0263"
FT                   /note="LactoCOG number LaCOG00178"
FT   CDS_pept        244398..245225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0263"
FT                   /product="Predicted sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71875"
FT                   /db_xref="GOA:Q032J7"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q032J7"
FT                   /protein_id="ABJ71875.1"
FT                   /translation="MIELTDEILRKVIKKRKKDSYKGTYGRLLVIGGNAQYGGAAILAT
FT                   TSAVYSGAGLVSVALAKENHGALHARLPEAMTIDFDDLSALREVAKSADVIVIGPGLGL
FT                   ERLDLLTEFLNLLTEKQKLVIDGSALTLFAKEQLSLPYPQNTIFTPHEMELERLSSLKI
FT                   GQQTKEALQDFVNQEGAIIVAKSSETRIFSPNQENFILKIGLPAQATGGMGDTLAGMIG
FT                   GFLAQFHGETRETVAAATYLHSLIASHLAKKAYVVLPSRLIEEIPLFMKKYEC"
FT   gene            245299..245712
FT                   /locus_tag="LACR_0264"
FT                   /note="LactoCOG number LaCOG02408"
FT   CDS_pept        245299..245712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0264"
FT                   /product="Phage envelope protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71876"
FT                   /db_xref="InterPro:IPR009833"
FT                   /db_xref="InterPro:IPR036696"
FT                   /db_xref="UniProtKB/TrEMBL:Q032J6"
FT                   /protein_id="ABJ71876.1"
FT                   /translation="MNAIELVEGAMKKAETIRPKVGGFPYLAECLREAGVLKNVWTLPA
FT                   GQSTFWTVAGVISLTNAPMLTGFQEVATFDREALIKALRADQAGKTTFPEFLSATWEAG
FT                   VIDYEANFEKRIVTYRGAQGEEYVEAYPAVTIA"
FT   gene            245964..247745
FT                   /locus_tag="LACR_0265"
FT                   /note="LactoCOG number LaCOG00179"
FT   CDS_pept        245964..247745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0265"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71877"
FT                   /db_xref="GOA:Q032J5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q032J5"
FT                   /protein_id="ABJ71877.1"
FT                   /translation="MLTIGRRYLNFWPVFWALFLLVIQVVTNLWLPTITADIINKGIGQ
FT                   SDMKYIWFMGLIMLIVALASWISAIGNVYFASKQSQGLGMKLRRDLFNKVLFMDERNFQ
FT                   DFGDATLITRTTNDVTQLQNVFQTMLRMMLMAPMMLIGSIFMAWKLSHDLMLVFLISLP
FT                   ILTLAVVINIAIAMPRFRSMQTKVDKINLIFQQGLTGVRVIRAFRRDQYEIDKLDEANR
FT                   DLTHTSRVVLITIAMLMPIMTVILSFTNIGIVWFGAQLIGKDMMEMGSLVAFLTYASQI
FT                   LMSFMQLSAVAVMVPRAQVSAVRVREILERQDKITDEQVNKELNESVSNSLALHQVSFK
FT                   FDEAKRQALSDLSVNVKAGQTLAIIGGTGSGKSTILNLIARLIDPTSGSVNINGIDIRQ
FT                   MSKHDLHEKVALTQQKAVLFSGSLRSNLQFGKSDATDEEMWQALEIAQAADFIREQGGL
FT                   EMAVEQNGANFSGGQKQRIAIARTLIKEAEIYLFDDSFSALDFATDRKLREAINKSEKH
FT                   HDKIKVIVAQRIATVMSADKILVLENGLAVGLGTHESLAKSCPQYQETMQSQLSDEDLV
FT                   KMGLSITNSTDKGGPVQ"
FT   gene            247742..249640
FT                   /locus_tag="LACR_0266"
FT                   /note="LactoCOG number LaCOG00180"
FT   CDS_pept        247742..249640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0266"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71878"
FT                   /db_xref="GOA:Q032J4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q032J4"
FT                   /protein_id="ABJ71878.1"
FT                   /translation="MMRGNYLNRGGKGADRFQKGRRAENFFPTIIRLFKYMRRDLWGLI
FT                   FSMVIAGLSVILSVQAPKILGTATTVIFDGVTKSLKNHQAIRIDMAKVESILLYVLVIY
FT                   LISFVSGVLQQSIMTRISQRTVYTLRREFKNKMKKLPISYYDSHNNDDIMSRMINDMDN
FT                   ISGTLNQTLIQLITSILQFVGTIYFMLTISWQLALVAFITVPLVMITVRIVAPLSQKFF
FT                   SEQQKNLGLLNDQIEENYSGHTVIKTFNHEAAAEKEFARRNDDFYKSAWKAQFVSTLIY
FT                   PTMRFINNLDYLAMAVIGGLKVISGSVNLGDVQAMLQYTNQFAQPITNISNMLNTIQET
FT                   VASAERIFEVLDEKEMTEGITDIEKVTDSKKKRTDERPRNSVSNFETAERTDFIHFEQV
FT                   AFSYNENQTLMTDVNFSVEVGQMVAIVGPTGAGKTTMINLLERFYDVSSGKILLEGKDI
FT                   RETKREQLRSRMAMVLQETWLFSGTIMDNLRYGRLESTDDEVIQAAKMAHADEFITTLP
FT                   QGYQTVLNETATNISQGQRQLLTIARAFVAKPEILILDEATSSVDTRTERLIQSAMNRL
FT                   LKGRTSFVVAHRLSTIRDANQILVMDKGNIVETGNHESLLKQEGLYASLYNSQFAK"
FT   gene            249731..250396
FT                   /locus_tag="LACR_0267"
FT                   /note="LactoCOG number LaCOG00181"
FT   CDS_pept        249731..250396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0267"
FT                   /product="Uncharacterized protein/domain associated with
FT                   GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71879"
FT                   /db_xref="InterPro:IPR021147"
FT                   /db_xref="UniProtKB/TrEMBL:Q032J3"
FT                   /protein_id="ABJ71879.1"
FT                   /translation="MIRKSDKKLKDRTKEDKIAKNEGFDEFFNQVLKNMPARSAKIIKS
FT                   SFVVSKAKAEQFLANNSQKFDQLFDEFLVGVDSQTRRKCHETIHFATLTAAIVGFSPIP
FT                   FSDAVLLVPIQLTMMMRLYKIFGASWSEALAKGVTKELVVVGLGRSLVGNVLKFVPAVG
FT                   TIAGGAINATVATTITEALGWVTVKMLNDGEDIFNNVLTFEGQFKGLVSKLQKTTKKK"
FT   gene            complement(250442..251461)
FT                   /locus_tag="LACR_0268"
FT                   /note="LactoCOG number LaCOG00182"
FT   CDS_pept        complement(250442..251461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0268"
FT                   /product="Predicted dehydrogenase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71880"
FT                   /db_xref="GOA:Q032J2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q032J2"
FT                   /protein_id="ABJ71880.1"
FT                   /translation="MTKKLNIAYVGFGKSTNRYHIPYVKERENIVIKRIVNRTLGKRPE
FT                   QAELEATGTLFSTDVADIINDDLIDLVVIVTPAFAHYDYAKQLLLAGKNVLCDKPLVET
FT                   LEQAKELVDIAKEKNLFFMPFQNRRFDSDFLTVKKVIEQGYLGDLVDITVNMDHFRPND
FT                   ASQGGNFDGAWYGHGVHLVDQMVSLFGTPEEVQYDIRATRDYDSVDDYFSVNLMYPNLR
FT                   ATVAATEVAAMPHPKWIVYGTKGTFIKMDVDQQENDLKVGMFPGDEGFGQDSPTDFGKL
FT                   TYFNQNGDRIVKHIPTVAGDYGRVYDSAYEAIINGADKLVSDEQMLAVIKTLENGFSK"
FT   gene            complement(251445..251612)
FT                   /locus_tag="LACR_0269"
FT                   /note="LactoCOG number LaCOG03053"
FT   CDS_pept        complement(251445..251612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71881"
FT                   /db_xref="UniProtKB/TrEMBL:Q032J1"
FT                   /protein_id="ABJ71881.1"
FT                   /translation="MGKYQLDNKGQKSVGKFHEKNSTVGGKGINTKNATQAKIEALRAK
FT                   MENKKYDKKA"
FT   gene            complement(251811..252287)
FT                   /locus_tag="LACR_0270"
FT                   /note="LactoCOG number LaCOG00183"
FT   CDS_pept        complement(251811..252287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0270"
FT                   /product="LuxS protein, autoinducer AI2 synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71882"
FT                   /db_xref="GOA:Q032J0"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032J0"
FT                   /protein_id="ABJ71882.1"
FT                   /translation="MAEVESFQLDHTKVLAPYVRLIGSETGPKGDVITNFDVRFVQPNA
FT                   NAIGMAALHTVEHSMASLIRDRIDGMIDFSPFGCQTGFHMIMWGEHSSEEIAKVIKSSL
FT                   EELSSDEFGWDNVPGVAEKECGNYRNHSLFGAKEWSKKILAEGISTDPYERKVI"
FT   gene            252504..252968
FT                   /locus_tag="LACR_0271"
FT                   /note="LactoCOG number LaCOG02409"
FT   CDS_pept        252504..252968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71883"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029441"
FT                   /db_xref="UniProtKB/TrEMBL:Q032I9"
FT                   /protein_id="ABJ71883.1"
FT                   /translation="MNIREVEKSSFSVIGKEGLGKSQEADIWIPPLWQQATNAFDEIAH
FT                   LVKQPLAVWGAMSDEARTFSAWSDGGLYLAGAEVENTTKAPENWTKWTFPSFRYLVVET
FT                   ATYEMHKVYSEIENFMAQQDLELVGAVQEHHSISAENPEELELWFPIERI"
FT   gene            253035..253880
FT                   /locus_tag="LACR_0272"
FT                   /note="LactoCOG number LaCOG00184"
FT   CDS_pept        253035..253880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0272"
FT                   /product="Aldo/keto reductase of diketogulonate reductase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71884"
FT                   /db_xref="GOA:Q032I8"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q032I8"
FT                   /protein_id="ABJ71884.1"
FT                   /translation="MTLTDTYTLNNGIKIPKVGFGTWQSASGEEAYNAVKAALEAGYRH
FT                   IDTAAAYKNEESVGKAIADSGIPREELFITTKLWGVGTTEDAAKALDESLEKLGLDYVD
FT                   LYLIHWPNPKAFRPDFEKRNLAVWKAMEAGLKAGKTRAIGVSNFHPRHLKPLLKFAEIK
FT                   PAVNQIMVNPSDQQEEIVSFNVDNNILTEAYSPLGTGKIFEVAELADLANKYNKTIAQV
FT                   VLRWSLHKGYLPLPKSVTPARIKENAEIFDFDLSIEDIAFIDSLHGKAGLAKNPDEVDF
FT                   "
FT   gene            254120..254632
FT                   /locus_tag="LACR_0273"
FT                   /note="LactoCOG number LaCOG00185"
FT   CDS_pept        254120..254632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0273"
FT                   /product="Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71885"
FT                   /db_xref="GOA:Q032I7"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q032I7"
FT                   /protein_id="ABJ71885.1"
FT                   /translation="MKKALVLVDFQNDFIDGSLGTKEAQAILPNVIEKLSHYPKENRFA
FT                   TQDTHFEDYLSTQEGKNLPVLHCQNGTYGWEIRKEAQVGFAKIFEKTTFGSRSLAEFIR
FT                   DENFDEVELIGICTDICVVSNALLIKAYAPEVKLTVDASCCAGVSPEKHLAALETMSSC
FT                   QIEIINA"
FT   gene            254729..255295
FT                   /locus_tag="LACR_0274"
FT                   /note="LactoCOG number LaCOG02410"
FT   CDS_pept        254729..255295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71886"
FT                   /db_xref="UniProtKB/TrEMBL:Q032I6"
FT                   /protein_id="ABJ71886.1"
FT                   /translation="MREVKNLNYHQLFSRLNEKLSEENLQLHLHCVGGFVLEYYGMKAT
FT                   EDIDAFYETTEKIDKIIEEIGEEYHVGTANEPWLSQAVGEVMSHSKIDETIIFEGSHLT
FT                   VGLSPLEAILIDKIQVGRTKDVPDIAKLMKKLKIESPDILLERFKHTDGSADPAVILEA
FT                   YSLAYGEEALKNYLRKNPKILRLLQ"
FT   gene            255292..255576
FT                   /locus_tag="LACR_0275"
FT                   /note="LactoCOG number LaCOG02411"
FT   CDS_pept        255292..255576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71887"
FT                   /db_xref="UniProtKB/TrEMBL:Q032I5"
FT                   /protein_id="ABJ71887.1"
FT                   /translation="MTWIEYLLQAAQKSKWNLELWVRYLNKVIQRDKILLSKKEIDYLT
FT                   NCEELTSFQRVFLELALEKETTPWEMTVGMSEPTRSIHLQAVLQELKKE"
FT   gene            complement(255626..256938)
FT                   /pseudo
FT                   /locus_tag="LACR_0276"
FT   gene            257283..259526
FT                   /locus_tag="LACR_0277"
FT                   /note="LactoCOG number LaCOG00187"
FT   CDS_pept        257283..259526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0277"
FT                   /product="ribonucleoside-triphosphate reductase /
FT                   ribonucleoside-triphosphate reductase class III catalytic
FT                   subunit"
FT                   /EC_number="1.17.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71888"
FT                   /db_xref="GOA:Q032I4"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:Q032I4"
FT                   /protein_id="ABJ71888.1"
FT                   /translation="MKSEIKYQDVTLEEINVIKRDGRSVKFNSEKIFDALTKAAKKVEL
FT                   TDMSVLSELTDRVVSEIFTRFSENVKIYEIQSIVEQELLESGETQLAEEYISYRANRDL
FT                   ARTKATDINFTIEKLINRDQTVVNENANKDSNVFNTQRDLTAGAVSKAIGLKLLPPQVA
FT                   NAHQKGDIHYHDLDYSPFTTMANCCLIDFKNMFENGFKLGNAQVDSPKSIQTATAQASQ
FT                   IIANVASSQYGGCSFDRADEVLAPYAKLNYKKHLKDAQKWIDGAEKQEAYAREKTAKDI
FT                   YDAMQSLEYEINTLFTSNGQTPFVTVGFGLGDDWYAREIQKAILNVRIGGLGSEHRTAI
FT                   FPKLIFTLKRGLNLEVGTPNYDIKELALECSTKRMYPDILSYDKIVELTGSFKASMGCR
FT                   SFLQGWRDENGNDVTAGRNNLGVVTVNLPRIALEAAGNKEKFWEIFNERIEIAHDALAF
FT                   RVERAKEAQPKNAPILFMNGALGRLDAEGSVDELYNKERSTVSLGYIGLYEVATTFYGP
FT                   TWENNPEAKAFTIEIVKRMHEDCEDWSKASGYHYSVYSTPSESLTDRFCRMDKEKFGSV
FT                   ADITDKDYYTNSFHYDVRKNPTPFEKLEFEKDYPVYANGGFIHYCEYPVLQQNPKALEA
FT                   VWDFAYDRIGYLGTNAPIDHCYACGFEGDFAATERGFKCPQCGNDDPKTCDVVKRTCGY
FT                   LGNPQARPMVHGRHKEISSRVKHMNGSVGALNDGNLIDSVEVDEAKSKYFAEK"
FT   gene            259529..260182
FT                   /locus_tag="LACR_0278"
FT                   /note="LactoCOG number LaCOG00188"
FT   CDS_pept        259529..260182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0278"
FT                   /product="ribonucleoside-triphosphate reductase class III
FT                   activase subunit"
FT                   /EC_number="1.17.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71889"
FT                   /db_xref="GOA:Q032I3"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:Q032I3"
FT                   /protein_id="ABJ71889.1"
FT                   /translation="MNNPKPGEWRADELSQNYIADYKPFNFVDGEGVRCSLYVSGCMFH
FT                   CEGCYNQATWSFRYGTPYTKELEDKIMDDLAEPYVQGLTLLGGEPFLNTTFLIPLLKRI
FT                   RRELPDKDIWSWTGYTWEELVGTNGSDKDFTQGLLSNPTAETDDKLEMLDLLDVLVDGR
FT                   FELSKKNLMLQFRGSSNQRIIDVPKSRSQGQVVIWEKLNDGENSFEQIHKEKLI"
FT   gene            complement(260254..260763)
FT                   /locus_tag="LACR_0279"
FT                   /note="LactoCOG number LaCOG02412"
FT   CDS_pept        complement(260254..260763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71890"
FT                   /db_xref="InterPro:IPR016772"
FT                   /db_xref="UniProtKB/TrEMBL:Q032I2"
FT                   /protein_id="ABJ71890.1"
FT                   /translation="MKTLLILCEVKYWHDFREGLAKIGVTFLGFDKKKPNRAEIDQLVA
FT                   KSDFVIMRNRNVAHHSIQFAKEACKATNTPFWISSNFGLETIIKQLAQNFPDESFERTG
FT                   QIKKTKSQNGKTDLQKKVSLSESAKAKETQNYLKGTKKHRPLKTALKEIQITDDESDFT
FT                   KLLKKY"
FT   gene            260967..261365
FT                   /locus_tag="LACR_0280"
FT   CDS_pept        260967..261365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71891"
FT                   /db_xref="GOA:Q032I1"
FT                   /db_xref="UniProtKB/TrEMBL:Q032I1"
FT                   /protein_id="ABJ71891.1"
FT                   /translation="MEKFKGSLGSVVRGLGFLFVVLFLIMITSTINNVLGIIVFLGLLG
FT                   FTIYYLLSGRKNTGNFISKITNKILWLVTLILFVATTGVLTVHSNQIKLKEARTELTKS
FT                   DKKLSNLSSEYVSIETQKDVKAEQYSSN"
FT   gene            261334..261927
FT                   /locus_tag="LACR_0281"
FT                   /note="LactoCOG number LaCOG02444"
FT   CDS_pept        261334..261927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0281"
FT                   /product="Predicted phage phi-C31 gp36 major capsid-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71892"
FT                   /db_xref="UniProtKB/TrEMBL:Q032I0"
FT                   /protein_id="ABJ71892.1"
FT                   /translation="MLKLNNTHQINQSKNNEKIKAETKRLNHLISVVKSEQKAVDDILN
FT                   QSAELKNDENILSEDKASLDKLEQKANNYQSLKSYKKESENLLELISVHNQREEQLKTV
FT                   ATTLKDKNLSAQDKSQLDKLVLEIKKAKKVSDIEDKMSEISTALETAQSNIQTKNEVDD
FT                   KKAQLNSTVKSAQSLLSDTYISAADKTLIQESID"
FT   gene            262153..262347
FT                   /locus_tag="LACR_0282"
FT                   /note="LactoCOG number LaCOG01641"
FT   CDS_pept        262153..262347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71893"
FT                   /db_xref="UniProtKB/TrEMBL:Q032H9"
FT                   /protein_id="ABJ71893.1"
FT                   /translation="MASGGYSTNPAGWGVAEAGYCFYRPSSQRYYSSVANPGNYTYMTI
FT                   SEAQGLNGSPGHSNGSAHT"
FT   gene            262560..263816
FT                   /locus_tag="LACR_0283"
FT                   /note="LactoCOG number LaCOG00189"
FT   CDS_pept        262560..263816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0283"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71894"
FT                   /db_xref="GOA:Q032H8"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032H8"
FT                   /protein_id="ABJ71894.1"
FT                   /translation="MTVTIENIHAREIFDSRGNPTVEVDVRLTDGTLGRAAVPSGASTG
FT                   DREAVELRDGGARLQGKDVSKAVANVNGEIYEALKGQSPFNQAKLDHLMIELDGTKNKS
FT                   RLGANAILGVSMAIARAAANSEKIPLYRYLGGVDLELPQPFFNVINGGVHADSGIDVQE
FT                   FLITPVKRASFRDGLEKIANIYHTLKKILADKGLETAVGDEGGFAPKLGSTENAIATLY
FT                   QAIERAGYVPGEEIAIAIDPASSEFYDDKEKVYHFEGQKLTSAELLTYYEGLVEKYPAL
FT                   ISIEDGFSEHDWAGFAAQTKVQGQKIQLVGDDIFVTNPEIFKEGIQKGVANAILIKLNQ
FT                   IGTVTEAIEAISLARKAGYKTMISHRSGETVDSFIADFAVAMHAGQIKTGSMARSERVE
FT                   KYNQFLRIEEELLGLEVTK"
FT   gene            complement(263918..264961)
FT                   /locus_tag="LACR_0284"
FT   CDS_pept        complement(263918..264961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71895"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041498"
FT                   /db_xref="UniProtKB/TrEMBL:Q032H7"
FT                   /protein_id="ABJ71895.1"
FT                   /translation="MGVDNDGNTIVRFTNPPATWGIANGLHFNVNIALDLGDFVTQTGI
FT                   RIADAVNGTHYSFNGAVVTDHDYTNIADDNTATSLNTHALDPGYDLLQQVPTIEDVYDT
FT                   DTTISGTGVPGATIEIKAGGKVIGTGTVGTNGIYHVTISPKQNENVTIEVRQNTGVGMS
FT                   AAATTTVKHKVSEIPAPKVNTIHEGDTVVTGTGHTPGNTIITDSSGQEIGRGSVDSAGK
FT                   YSITLTSSQPAYSILNVVETDGKDTSPITQVVVQAPIPNAITHIDNFSASQDQYITGTY
FT                   TGSKVAKIGLTVDNAKKPLIKITPGNGNFSIFTSTYGITASSTVLVTLYDANDVALTSG
FT                   NSVSVLP"
FT   gene            complement(265280..265387)
FT                   /locus_tag="LACR_0285"
FT   CDS_pept        complement(265280..265387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71896"
FT                   /db_xref="UniProtKB/TrEMBL:Q032H6"
FT                   /protein_id="ABJ71896.1"
FT                   /translation="MNKKIFVPMATIKLLSSAILFANSASADTNMNVQA"
FT   gene            265994..266884
FT                   /locus_tag="LACR_0286"
FT                   /note="LactoCOG number LaCOG03011"
FT   CDS_pept        265994..266884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0286"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71897"
FT                   /db_xref="GOA:Q032H5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q032H5"
FT                   /protein_id="ABJ71897.1"
FT                   /translation="MTYNSTLPKVFVYLLTTIETLYQTSVPLEVQNRKNVHLATSDCLV
FT                   ITCYLWGVLHFSETLKAKHQLAQSLFPNFLEYSRFVRRCNALLPSIQVIRQALVFKEVE
FT                   GMSVSIIDSFPIPLCQPIHNFRSKGLGDYANVGYNATKGQYFYGCKCHALVSESGYVID
FT                   YTITPASMADSSMTEEVLSQFGTPTVLGDMGYLGQSLHDRLELKGIDLMTPVRKNMKQK
FT                   KILFPNFSKRRKVIERVFSFLTNLGAERCKSRSPQGFQLKLEMILLAYSSLLKSAKSLE
FT                   PETLRYSIGYQVMPK"
FT   gene            complement(266943..267030)
FT                   /locus_tag="LACR_t0287"
FT                   /note="tRNA_Ser_GGA"
FT   tRNA            complement(266943..267030)
FT                   /locus_tag="LACR_t0287"
FT                   /product="tRNA-Ser"
FT   gene            267176..268009
FT                   /locus_tag="LACR_0288"
FT                   /note="LactoCOG number LaCOG00190"
FT   CDS_pept        267176..268009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0288"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71898"
FT                   /db_xref="GOA:Q032H4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032H4"
FT                   /protein_id="ABJ71898.1"
FT                   /translation="MNKILEVENLVFKYEKESDVNQLNGVSFSITKGEWVSIIGQNGSG
FT                   KSTTARLIDGLFEEFEGIVKIDGERLTAENVWNLRRKIGMVFQNPDNQFVGATVEDDVA
FT                   FGMENQGIPREEMIKRVDEALLAVNMLDFKTREPARLSGGQKQRVAVAGIIALRPEIII
FT                   LDESTSMLDPTGRSEIMRVIHEIKDKYHLTVLSITHDLDEAASSDRILVMRAGEIIKEA
FT                   APSELFATSEDMVEIGLDVPFSSNLMKDLRTNGFDLPEKYLSEDELVELLADKLG"
FT   gene            268281..269147
FT                   /locus_tag="LACR_0289"
FT                   /note="LactoCOG number LaCOG00191"
FT   CDS_pept        268281..269147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0289"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71899"
FT                   /db_xref="GOA:Q032H3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032H3"
FT                   /protein_id="ABJ71899.1"
FT                   /translation="MIKFEKVNYTYQPNSPFASRALFDIDLEVKKGSYTALIGHTGSGK
FT                   STLLQHLNGLLQPTEGKVTVGDIVVSSTSKQKEIKPVRKKVGVVFQFPESQLFEETVLK
FT                   DVAFGPQNFGIPKEKAEKIAAEKLEMVGLADEFWEKSPFELSGGQMRRVAIAGILAMEP
FT                   EVLVLDEPTAGLDPKARIEMMQLFESIHQSGQTVVLVTHLMDDVADYANYVYLLEKGYI
FT                   ISCGTPSDVFQEVDFLKAHELGVPKATHFADQLQKTGAVTFEKLPITRAELVTLLTSLS
FT                   VNSGGEN"
FT   gene            269147..269947
FT                   /locus_tag="LACR_0290"
FT                   /note="LactoCOG number LaCOG00192"
FT   CDS_pept        269147..269947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0290"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component CbiQ related transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71900"
FT                   /db_xref="GOA:Q032H2"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:Q032H2"
FT                   /protein_id="ABJ71900.1"
FT                   /translation="MQNMLMGRYIPGDSIIHRMDPRSKLLVMIAFVVIIFLAHDWLGYL
FT                   LLVLYTLAGVLLSKISVSYFLRGLRPMIGLILFTVIFQMLFTNGQHVIFSLWFIKISTE
FT                   SLINAVYIFFRFVLIIFMSTILTLTTPPLTLADGIEKGLGPLKKIKVPVHELGLMLSIS
FT                   LRFIPTLMDDTTMIMNAQKARGMDFGEGNLLKKIKSVIPILIPLFVSSFRRADDLAVAM
FT                   ESRGYQGGDGRTKYRQLKWQSRDSLLVVSIIIMTILLILWSKVS"
FT   gene            269970..270584
FT                   /locus_tag="LACR_0291"
FT                   /note="LactoCOG number LaCOG00193"
FT   CDS_pept        269970..270584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0291"
FT                   /product="Thiol-disulfide isomerase and thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71901"
FT                   /db_xref="GOA:Q032H1"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q032H1"
FT                   /protein_id="ABJ71901.1"
FT                   /translation="MITLNVNSLENAEIFWKELGLEEEIALNETYDPAPETLAISVETI
FT                   DEIHDKIIELGLQLSPITKSADGRYLFSFIAPEGNTIIIIGEWVERPYTGEMRTEFFEN
FT                   IKDVLPLAPVRLSELTEGQFVLFGRVTCPWTRRFAKQLPGYADKTIYYVDTENTDLDNE
FT                   LQAIRKAHEINTVPTFMKRGADGTFVKFDEKIESLSDFISQ"
FT   gene            270708..272012
FT                   /locus_tag="LACR_0292"
FT   CDS_pept        270708..272012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71902"
FT                   /db_xref="GOA:Q032H0"
FT                   /db_xref="UniProtKB/TrEMBL:Q032H0"
FT                   /protein_id="ABJ71902.1"
FT                   /translation="MKIIKNRRNFILISLIALFWLTFSLALPFRLVGDDPHYFTALHDF
FT                   HGNLISYLVNDYKTWSSRMIGDGLNVLLVHHVRLWQILEALAFTIISVLPAYFFKNSSK
FT                   NCAKFLLISFTLSFLFPIGLIYRAGYVATTVHYLFPFACLLLAIFPFIQRLNEKKNPIF
FT                   LWIISFLAFIYAILEQQTLVILGIFLTSLIIYLFIEKKWIRLPLTYLVFAFLSLIFSLT
FT                   APGNHLRTISETKAYFPNFGQLSLFTKANMGFASLTSSLFTNTYLLPLIFLLTVFVLLI
FT                   KQGKICKSLIILPPIIFSVIIGFDASSLQDLIVSKLDLATNAGTLTRLLLTFLNMNKVN
FT                   NTGNPVMTSSLADILFLLLIICLFLAIYWLFNSNFKKSLLSFLVLLTGFLSRFMMGFFP
FT                   SVWMSGARTATFLLYSFMFALLIILYQLNESKNLE"
FT   gene            272069..272842
FT                   /locus_tag="LACR_0293"
FT                   /note="LactoCOG number LaCOG00194"
FT   CDS_pept        272069..272842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0293"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71903"
FT                   /db_xref="GOA:Q032G9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR013710"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR019873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032G9"
FT                   /protein_id="ABJ71903.1"
FT                   /translation="MTQAQKLSAQEIIQFIGNAEKKTQVKVTLSGMPSFKSAGFLAENG
FT                   RPNFKALANKGIQVLGDFHTHYSLKIIIGDWQAVRPLLEGLTENKDYTIEFEGRNSAVP
FT                   LLDTRAINARIEPGAIIRDQVMIGDNAVIMMGAIINIGAEIGEGTMIDMGAVLGGRATV
FT                   GKNSHIGAGAVLAGVIEPASAEPVRVGDNVLVGANAVVIEGVQVGSGSVVAAGAIVTQD
FT                   VPENVVVAGVPARTIKEIDEKTAQKTALEDALRNL"
FT   gene            272980..274110
FT                   /locus_tag="LACR_0294"
FT                   /note="LactoCOG number LaCOG00195"
FT   CDS_pept        272980..274110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0294"
FT                   /product="Metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71904"
FT                   /db_xref="GOA:Q032G8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR023905"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032G8"
FT                   /protein_id="ABJ71904.1"
FT                   /translation="MINLIEIRRQLHQIPEIGLEEHKTQKYLLTIIHQIIQNKSFIQVE
FT                   TWQTGILVYLKGSQGQKTIGWRTDIDGLPVEELTNLPFASKNGRMHACGHDIHMTVALG
FT                   LLEKLSESQPKNNLLFLFQPAEENEAGGKLMYDGGAFKNWLPDEFYGLHVRPDLKVGDI
FT                   ATNEQTLFAGTCEVELTFVGTGGHAAFPHTANDALVAAAYFVTQVQTIVSRNVDPLDSA
FT                   VVTFGKMEAGTTNNIIAERAFLHGTIRSLTQEVNELTQKRLTELAKGVAQSFDMTIDLK
FT                   LKQGGYLPVENNPKLAKELMDFFRNETKANLIDIAPAMTGEDFGYLLSKIPGVMFWLGI
FT                   NSEAPLHSQKMQADEEVLDFAVEAIGQFLDFKANRN"
FT   gene            274267..275388
FT                   /locus_tag="LACR_0295"
FT                   /note="LactoCOG number LaCOG00196"
FT   CDS_pept        274267..275388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0295"
FT                   /product="Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71905"
FT                   /db_xref="GOA:Q032G7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q032G7"
FT                   /protein_id="ABJ71905.1"
FT                   /translation="MSQKRSARSKSSKKAFWKLTLIMGALLIVVAGIGTYYYDQGVRKQ
FT                   NIAYEKQVNEAKEAKDKAYNSRKTSDINEAKKLIVKLHEKDKSSLNQSITQLLAYLTDI
FT                   DKVSQLVAKEHQNITEDTIKEAEQALELLNASYEKTDKEKFAQQIAIDKQVLVERQKEA
FT                   ERIADEKNKLANQKLIALTFDDGPNPTTTPQLLKTLSAAKVPATFFALGKEAQQYPDII
FT                   KEESDLGNEVASHTWDHKDLVTLSPAQQKQEIESANQLINKITGKNVTLFRPRYGSYNN
FT                   SVLCQTDLTAVNWSVDTNDWRYHTSAPVVQNVATYAHDGAIILMHDIHQWSVDAVPQII
FT                   QNLKAQGYTFVTVSTLLDIRNGGAKAQQVYFGR"
FT   gene            275529..275602
FT                   /locus_tag="LACR_t0296"
FT                   /note="tRNA_Arg_ACG"
FT   tRNA            275529..275602
FT                   /locus_tag="LACR_t0296"
FT                   /product="tRNA-Arg"
FT   gene            275665..275738
FT                   /locus_tag="LACR_t0297"
FT                   /note="tRNA_Pro_TGG"
FT   tRNA            275665..275738
FT                   /locus_tag="LACR_t0297"
FT                   /product="tRNA-Pro"
FT   gene            275888..276010
FT                   /locus_tag="LACR_0298"
FT   CDS_pept        275888..276010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71906"
FT                   /db_xref="UniProtKB/TrEMBL:Q032G6"
FT                   /protein_id="ABJ71906.1"
FT                   /translation="MKGAIMAYKSHKFGKRNGKKHFNAVGVRTAPKPEAKKEEK"
FT   gene            276137..277561
FT                   /locus_tag="LACR_0299"
FT                   /note="LactoCOG number LaCOG03054"
FT   CDS_pept        276137..277561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71907"
FT                   /db_xref="GOA:Q032G5"
FT                   /db_xref="InterPro:IPR025686"
FT                   /db_xref="UniProtKB/TrEMBL:Q032G5"
FT                   /protein_id="ABJ71907.1"
FT                   /translation="MEENKNLFKRKIFPLLIITCAITLTYFPYFKNTFGIDTSTMIKSQ
FT                   GQMLSGYLSQGRFGMVWIFELLIHRYNNQIVPFIVIPLLVGAGIYLYFTLNKYDKESSD
FT                   FAASLFAIVFICNPVVYAQLYFKMQAIQIVIGVFCVLLGINLSLSRLRTSVKIIGSGLL
FT                   FAFSFLIYQVFVFFIFSMILFCFYVFRDKRQQILQVMVPSWLVASLIYFLSYFLASFMI
FT                   HYSSYGNETYMMWNKLPELGNLQKIGALFIALFALAYLFLLIITIRRFRAKKEINVLLL
FT                   ILLIGSIMTFNMAFGNLRPAPRVYFGTFSTVFSGILYLGIRKGNGLKYLFLLIILFSMF
FT                   FTFSLSHKANLSYENDQILTENVMKYARDHNILENGTNLVFNGNLQTGNQGMLNKFQDI
FT                   FITGATRVSFFQFDPPLTSLRPYDFMEIKGYHFKIPTPKLRANLSLKYEHLPNYPSEKS
FT                   MFWDKGENALLVKLSN"
FT   gene            277772..278383
FT                   /locus_tag="LACR_0300"
FT                   /note="LactoCOG number LaCOG00197"
FT   CDS_pept        277772..278383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0300"
FT                   /product="SSU ribosomal protein S4P"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71908"
FT                   /db_xref="GOA:Q032G4"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032G4"
FT                   /protein_id="ABJ71908.1"
FT                   /translation="MSRYTGPSWKQSRRYGISLTGSGKEIARRNYVPGQHGPNNRSKLS
FT                   EYGLQLAEKQKLRFTYGLSERQFRNLYVAATKVKEGTVGYNFMTLLEQRLDNVVYRLGL
FT                   ATTRRQARQFVNHGHILVDGKRVDIPSFRVQPGQVISVREKSMKVPAILEAVEATKGRA
FT                   NFVSFDADKLEGTLVRLPERDEINPEINDALIVEFYNKMM"
FT   gene            complement(278489..279685)
FT                   /locus_tag="LACR_0301"
FT                   /note="LactoCOG number LaCOG00024"
FT   CDS_pept        complement(278489..279685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0301"
FT                   /product="Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71909"
FT                   /db_xref="GOA:Q032G3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q032G3"
FT                   /protein_id="ABJ71909.1"
FT                   /translation="MNKLNIKEYKTKSGEVRYILRGAYIGTDVLTGKQVRTDVRGRTKK
FT                   DVKTKLQRLQNDFIKNGCMKKEKQLKTFAEVAESWFDMYQHTVKSHSIEIMRSNLNRYI
FT                   LPAFGNTKIDRLTTSQIQLQVNRWAKNAGQPLNGAMRRNKGNAKGYKLLLNVTNRIFKY
FT                   AISMGLVSSNPCLTVIVPNVKMETTEREVKHFNKEQLQSYFDYMESLPNTWVNNELRAI
FT                   CRLLTASGLRIGEATALSWSDIDFEKQTISVSKTTTGHQTIQDTPKTKHSKRVVIIDSK
FT                   TISHLQRWHLYQKSYFLKLGQPNQSLIFPTNQGKILDYQRLRKSLQATFKATELHDIGF
FT                   HGFRHSHASLLLNAGVSYKEIQTRLGHASIKMTMDIYSHLEKEKESEAVELFAKYANF"
FT   gene            complement(279778..280455)
FT                   /locus_tag="LACR_0302"
FT                   /note="LactoCOG number LaCOG01777"
FT   CDS_pept        complement(279778..280455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0302"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71910"
FT                   /db_xref="GOA:Q032G2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q032G2"
FT                   /protein_id="ABJ71910.1"
FT                   /translation="MIINRLSVLLAERNVRANRLAVETGIAPSTLTRINNNRSSQIDYE
FT                   TLNSICNFFKITPNDFFDYSPFDFEVVLSTKEEIKASDELTIFIQVQKFNSYIGTFEFT
FT                   GKYKNSEDYVPTEFASDGTPENFMEVEILEVVFPDELTSFVKFINNQPLLEDASLSLKM
FT                   NTEIYKKVEEALKEFTKDYYNDEFNDFLTNYVSILEPNQVDKEIKSKVSEIESRLRTNI
FT                   MPF"
FT   gene            280611..280841
FT                   /locus_tag="LACR_0303"
FT                   /note="LactoCOG number LaCOG01777"
FT   CDS_pept        280611..280841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0303"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71911"
FT                   /db_xref="GOA:Q032G1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q032G1"
FT                   /protein_id="ABJ71911.1"
FT                   /translation="MIANNFSILLLKNNFKAKSFSAYTGIAESTLSSLVNIAENGKDIK
FT                   LSTLIKICNHLNCTLSELIEYFPEEQLINNK"
FT   gene            281058..281726
FT                   /locus_tag="LACR_0304"
FT                   /note="LactoCOG number LaCOG01298"
FT   CDS_pept        281058..281726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0304"
FT                   /product="Uncharacterized phage-encoded protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71912"
FT                   /db_xref="UniProtKB/TrEMBL:Q032G0"
FT                   /protein_id="ABJ71912.1"
FT                   /translation="MTPLVLFDSLDLSKANNESFYTTTEIIAERSDNSYKVVSDLVRKY
FT                   RFELEKIAPLNSFFKKLNVNNVGRSRKIYKLNEQQTLFFIPLLGNTPAVVQFKFDLAAA
FT                   FVAMRNELQARKIERATEKVTTRSLTDAVHDWDNKSKHSYIHIRNLLVKVATGESHTYV
FT                   KNRDPSNKTSMVDLLTSDEMEEYNYMKSLVIPMLSKSGEKAMDYHDIKEKLEFLTTKKP
FT                   "
FT   gene            281825..281995
FT                   /locus_tag="LACR_0305"
FT                   /note="LactoCOG number LaCOG02688"
FT   CDS_pept        281825..281995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71913"
FT                   /db_xref="InterPro:IPR012450"
FT                   /db_xref="UniProtKB/TrEMBL:Q032F9"
FT                   /protein_id="ABJ71913.1"
FT                   /translation="MTEFISIDEAKLLFTECLARARHHIEVDDVTDKLFDGKSVATFTF
FT                   MGNGYQVELEA"
FT   gene            281997..282251
FT                   /locus_tag="LACR_0306"
FT                   /note="LactoCOG number LaCOG02687"
FT   CDS_pept        281997..282251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71914"
FT                   /db_xref="UniProtKB/TrEMBL:Q032F8"
FT                   /protein_id="ABJ71914.1"
FT                   /translation="MQSSTFKIEDLEKARTFENKHFLILSVKMNSEIGHQVFLKSVKNK
FT                   KTVIIFNQNKAPLCIKVSHEFAQSWKLKKQAEIKKRDKV"
FT   gene            282248..282400
FT                   /locus_tag="LACR_0307"
FT                   /note="LactoCOG number LaCOG02686"
FT   CDS_pept        282248..282400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71915"
FT                   /db_xref="UniProtKB/TrEMBL:Q032F7"
FT                   /protein_id="ABJ71915.1"
FT                   /translation="MKFIKMDVISTEILPTWWVKSSRAEVRKILIVNESKAPKLHIRLK
FT                   RGGES"
FT   gene            282397..282666
FT                   /locus_tag="LACR_0308"
FT                   /note="LactoCOG number LaCOG02685"
FT   CDS_pept        282397..282666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71916"
FT                   /db_xref="UniProtKB/TrEMBL:Q032F6"
FT                   /protein_id="ABJ71916.1"
FT                   /translation="MSILSFEAEQELTQSVLSHVDKLVEARIEQSRLFPYVQQAELLKE
FT                   LNISTTYLAKLRAHGLKQVILEDGDRTVWYKKSQLESLMDSLAE"
FT   gene            282677..284374
FT                   /locus_tag="LACR_0309"
FT                   /note="LactoCOG number LaCOG02684"
FT   CDS_pept        282677..284374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71917"
FT                   /db_xref="UniProtKB/TrEMBL:Q032F5"
FT                   /protein_id="ABJ71917.1"
FT                   /translation="MTEVKTDYGDLEKQRKAWERLENNLKKVINLPWEKFGNIDGAKIP
FT                   QSLDLVHILHRDIYEYPYLSVKSTGENKRIKRPSLHLNNGQNTVSIFYGGVNKKAEKTD
FT                   DGEDKEVVTLKSSKSIPRFVNVILDYLFGKLALHHGYLYDISTSQFKRLSEMDIAHEYK
FT                   LGKRSDFTASEVVEIISFIDEQIKLKPLKEIKASIIACHDFQMDLHQKKILKDCSIKDN
FT                   ECYFKVFDCQLSDVIEMSILNANYLGMVIDDVDSLHNAQLQPIYQMLVACREITKTRFF
FT                   VSKSGTRTGKGLRHKVISSIFDTKHVNLDELSNKATAAMAWAGFDGGEMLLVTESGEIG
FT                   KSLERYLKILATESTYRGRGIGQNYADINLTGVLSIDSNEKVLFSSEMNSRAVNIAFKN
FT                   RPKGETDSERESIFAPYWEAFTEQRVSETSREATALAGVAALYSSFVYWRQNKFKFNFK
FT                   QVEMDNFSSDHFDFDDVQIYIIEEHIKGNKTIIKTDEVQKLLKETYYGAGSPKRRKEAL
FT                   DIIGYFETTRKLPTFEGERRTFRVIAIGNPRRASKAVAAFLESMYEPP"
FT   gene            284736..284918
FT                   /locus_tag="LACR_0310"
FT                   /note="LactoCOG number LaCOG02683"
FT   CDS_pept        284736..284918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71918"
FT                   /db_xref="UniProtKB/TrEMBL:Q032F4"
FT                   /protein_id="ABJ71918.1"
FT                   /translation="MSFNFTKTVVFTVNEKMPFNIPYDEEEFEKFSHALLVDKNAEWLG
FT                   GYLFNIKNIVSIKRV"
FT   gene            284937..285143
FT                   /locus_tag="LACR_0311"
FT                   /note="LactoCOG number LaCOG02682"
FT   CDS_pept        284937..285143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71919"
FT                   /db_xref="UniProtKB/TrEMBL:Q032F3"
FT                   /protein_id="ABJ71919.1"
FT                   /translation="MSDKVIMVYTVNDASAFVFNQTLDNMKVIGKWQDDPDQLFKLGTT
FT                   VFNGSHVVAIKVAKRGPLGTVPE"
FT   gene            285305..285877
FT                   /locus_tag="LACR_0312"
FT                   /note="LactoCOG number LaCOG02681"
FT   CDS_pept        285305..285877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71920"
FT                   /db_xref="UniProtKB/TrEMBL:Q032F2"
FT                   /protein_id="ABJ71920.1"
FT                   /translation="MKTFEEIESELINQKDGNLLEIDKFKNNKEKAERALKIANEELIK
FT                   AEETADLVAYDKAKGDIWTSQHAIELYQKQLDKLESTPLVTKDDYNQLVSDIEKAADKL
FT                   QDELNIKGAKLMAELKALADESNAVYHKADELLRIAQYDVYKDADCLVASNGTRITRAV
FT                   EYKRNNSVRNVYNFKYLGNTFLDDMNA"
FT   gene            285893..286255
FT                   /locus_tag="LACR_0313"
FT                   /note="LactoCOG number LaCOG02680"
FT   CDS_pept        285893..286255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71921"
FT                   /db_xref="UniProtKB/TrEMBL:Q032F1"
FT                   /protein_id="ABJ71921.1"
FT                   /translation="MTETIKDNSQQHTGNWVEDIRKGAEIERKEREETSRQRSKEAFDK
FT                   MRDKANAERDEMNGLMKQVAERNYNDNKLKRDKEIKVAKQKAMQQIESEYESKYGVNTD
FT                   KTERTKQALSNLLKGL"
FT   gene            286437..286607
FT                   /locus_tag="LACR_0314"
FT                   /note="LactoCOG number LaCOG02679"
FT   CDS_pept        286437..286607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71922"
FT                   /db_xref="UniProtKB/TrEMBL:Q032F0"
FT                   /protein_id="ABJ71922.1"
FT                   /translation="MSVIRCKTCKNLFNTTKQERYCSEECRKEARKKVRKKWETKNPEY
FT                   MKNYMRGYREK"
FT   gene            286809..287039
FT                   /locus_tag="LACR_0315"
FT                   /note="LactoCOG number LaCOG01297"
FT   CDS_pept        286809..287039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71923"
FT                   /db_xref="UniProtKB/TrEMBL:Q032E9"
FT                   /protein_id="ABJ71923.1"
FT                   /translation="MQRKNLKNDTDYPLIMTRELAAEFIGVSGPTFDKYYRYAHNFPVV
FT                   KNGDVEEAFPRDPIIKWVADNWQSLEKRRKK"
FT   gene            287199..288398
FT                   /locus_tag="LACR_0316"
FT   CDS_pept        287199..288398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71924"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:Q032E8"
FT                   /protein_id="ABJ71924.1"
FT                   /translation="MQKNDLDSRMKVANKYNNEGVVMDDQIIIEEEIVRNENRIDDEKY
FT                   GDNGLFQINSWGADLSFRELINMYAEDELQKPELQRYYVWDKREASRFIESILLGLPVP
FT                   SIFLARTQEENYLIIDGYQRIMTVVDFVNGVFTKDGSSFKLSPTVNELWANKTFSQLSS
FT                   EEQKRLRRTTIHSIIFEQKRPTNDDTSMYQIFERINTGGRTLFPQEIRNCVYHNEINTL
FT                   LIELNVNPAWRTLFGQSEKDSRMRDMEFILRFLMFSNKKFSETTAISLKKELNLFMDIT
FT                   KNKDGKYRCEDYKKQFLETMELLVNTDKDAFRNINEEGSILSRFHPTIFDSIAVATKMA
FT                   IENGVDILWKNDREAFLKAKRNLLKDFQFIEYTTTRTTNTASINGRIDLAYKYLFEEVQ
FT                   "
FT   gene            288398..288913
FT                   /locus_tag="LACR_0317"
FT   CDS_pept        288398..288913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71925"
FT                   /db_xref="InterPro:IPR041519"
FT                   /db_xref="UniProtKB/TrEMBL:Q032E7"
FT                   /protein_id="ABJ71925.1"
FT                   /translation="MRYSEFDLMLYNEIRDLSELHEFIKKLNQLKDSQEIGYLTNYLVI
FT                   RSCGIIEQLTKTLIYCHFNYEVSQNFVSKFLDNKIRIKNSANPSKSMINGLIDTFDDSR
FT                   KFNELIKKNISTSEINQFYTHIDSLRQLRNSIAHGDKISTTWRDVMGYFDSCIILMFRI
FT                   KETLVAYY"
FT   gene            288996..289370
FT                   /locus_tag="LACR_0318"
FT   CDS_pept        288996..289370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71926"
FT                   /db_xref="GOA:Q032E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q032E6"
FT                   /protein_id="ABJ71926.1"
FT                   /translation="MKTKQILLIEQPKQLEIMVTPQDTENRIIRPKKWDKLKTYIKAHK
FT                   TVYITTGAVIIGAIVGGLIVASAKNKEIDDLVEDNADLDAQNYGRGLVLDLALDRIDEL
FT                   EGELTNLHENYSWVNNGKGL"
FT   gene            289695..291836
FT                   /locus_tag="LACR_0319"
FT                   /note="LactoCOG number LaCOG00198"
FT   CDS_pept        289695..291836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0319"
FT                   /product="Transcriptional accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71927"
FT                   /db_xref="GOA:Q032E5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q032E5"
FT                   /protein_id="ABJ71927.1"
FT                   /translation="MENVKKIAELLNIKNSQVEKVLELTAEGNTVPFIARYRKEATGSL
FT                   DEVEIKKIIDEDNLLTKLSERKTAVLSKIEELGKLTDSLKTQILAAEKLTEVEDLYLPY
FT                   KEKRRTKATIAKENGLFPLAQLIVKNAANLEEEAEKFVNENFTTAQKALEGAVDILSEA
FT                   ISEDARLRSWLTGEIKNNSLLTSSLKKDAVDEKQVFQMYYKFSEKVSELPNYRVLALNR
FT                   GEKLGILSVKFENNEDKILRYFAARFAAQNNPMMQVAIKDAVKKKLIPAMERSIRTELT
FT                   EKAEASAIEVFGKNLKNLLLVAPLKGRVVMGFDPAYRTGAKLAIVDETGKLLMTTVIYP
FT                   VKPANAGQIAQAKKDLAKFIREYGVNMIAIGNGTASRESESFVSEVLKENNFSDVYYVI
FT                   VSESGASIYSASELAREEFPELTVEKRSAISIARRLQDPLAELVKIEPKAIGVGQYQHD
FT                   VSEKKLTENLDFVVETVVNQVGVNVNTASPSLLSHVAGLNKSLAQNVVKYREENGALKT
FT                   RNELKKVPRWGAKAFEQAAGFLRIPEGKNFLDNTGVHPESYKVTEQLLTEIAAGPAVSN
FT                   EELLTKLSSVNIPEMAEKLGLGQETLTDIINDLQKPGRDLRESFDAPILRQDVLSAGDL
FT                   QIDQQLEGVVRNVVDFGAFIDIGIKNDGLAHVSDLSKSFVKNPSDVVAVGQIVTVWVKS
FT                   LDLQRGKINLTLVNPREKD"
FT   gene            291969..292412
FT                   /locus_tag="LACR_0320"
FT                   /note="LactoCOG number LaCOG00199"
FT   CDS_pept        291969..292412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0320"
FT                   /product="Zinc-dependent metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71928"
FT                   /db_xref="GOA:Q032E4"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR035240"
FT                   /db_xref="UniProtKB/TrEMBL:Q032E4"
FT                   /protein_id="ABJ71928.1"
FT                   /translation="MLTNQELTKKVREISLNYFKRPFEHEAKWNQRLRTTGGRFFPKDL
FT                   HLDFNPKMAELENFEGVVLHELTHYHLYRTQRGYKHQDADFKRLLAQVGGLRYAPAVEE
FT                   RKVKYDYVCQNCGQNYPRQRKIDTKKYRCGKCRGQLKIKTSRI"
FT   gene            292713..293747
FT                   /locus_tag="LACR_0321"
FT                   /note="LactoCOG number LaCOG00200"
FT   CDS_pept        292713..293747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0321"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71929"
FT                   /db_xref="GOA:Q032E3"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028893"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q032E3"
FT                   /protein_id="ABJ71929.1"
FT                   /translation="MLKSEIIAQMPKVELHCHLDGSLSLSCIKELAKNAGVNITMTDEE
FT                   ILEKAQAPENTKNLLEYLKRFDFVLPLLQSYTNLELAAYDVVKQAADDHIKYIEIRFAP
FT                   TQHLLENLSLEEAVEAVIAGLSRAENDFDIRANALICGLKQEPIQKLQKLLPLFDKIPD
FT                   EHLVGFDMAGDELNYPQEKFIDLIHDLKINGVNVTLHAGECPACEQNILDSIAMGASRI
FT                   GHGIMTKNLSKAEQEMMIEKQIVLEMAPTSNFQTKAVTELAQYPFKELYDKGLHVTLNT
FT                   DNRTVSATSLNKEYEKISAWYPDFSLADFEKINHYAIDGAFISKEEKEQLHQSFIKEYK
FT                   KISE"
FT   gene            complement(293811..294200)
FT                   /locus_tag="LACR_0322"
FT   CDS_pept        complement(293811..294200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71930"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q032E2"
FT                   /protein_id="ABJ71930.1"
FT                   /translation="MTNKEEIQTLINNYATYADTRQTKAQFDLFTKDGSMSVYYPWNKG
FT                   KAEEINTSEKMLATFEALKQYEKTFHFIGQVQIALDSEKPRQASAYVYTIAHHVITKEN
FT                   GEKSLMIAYLRYDDSFEKNRIWLEI"
FT   gene            complement(294236..294589)
FT                   /locus_tag="LACR_0323"
FT                   /note="LactoCOG number LaCOG00963"
FT   CDS_pept        complement(294236..294589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0323"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71931"
FT                   /db_xref="GOA:Q032E1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q032E1"
FT                   /protein_id="ABJ71931.1"
FT                   /translation="MPTIQEVSRKFKVSSSSIRFYERKGFLSIPRDKNGNRIFDEESLT
FT                   RLELVLHYRTAGVSLEDIHEIFKNYMNHQVSVQLLKKTAQDLDNKIAELEKTRVFLADK
FT                   IIFHEQLAQKEKD"
FT   gene            complement(294757..296442)
FT                   /locus_tag="LACR_0324"
FT                   /note="LactoCOG number LaCOG00201"
FT   CDS_pept        complement(294757..296442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0324"
FT                   /product="RNase J1"
FT                   /EC_number="3.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71932"
FT                   /db_xref="GOA:Q032E0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:Q032E0"
FT                   /protein_id="ABJ71932.1"
FT                   /translation="MPKQLKIKADEVAVYAIGGLGEIGKNTYGVEYKDEIIIIDAGIKF
FT                   PEDDLLGVDYVIPDYTYIVENIDRIKGLFITHGHEDHIGGIPFLLKQANIPIYAGPLSL
FT                   ALIRGKLEEHGLLRDAKLYEIHADSVIKFNHLSLDFFRTTHSIPEPLGIVVNTPQGKIV
FT                   ATGDFKFDFTPVGEPADLHRMAELGSEGVLLLLSDSTNAEIPTFSHSEKVVGASIMKIF
FT                   ERIEGRIIFASFASNIFRLQQAVDGAVKTGRKIVVFGRSMEKAIVNGLELGYIKAPKGT
FT                   FIEPNEVNQYASHELLIMCTGSQGEPMAALSRIANGMHRHITLQMGDTVVFSSNAIPGN
FT                   THGVNQLINKIAEAGVEVIYGKMNNIHTSGHGGQQEQKLMLRLIKPKYFMPVHGEYRML
FT                   KIHAGLAQDTGVPKENCFIQENGDVLALTADSARYADHFPAADTYVDGSGIGDVGNAVL
FT                   HDRHELSEDGIVLAVATVDFKKKTVLAGPDMLSRGFIYMRESGDLIRSGQRVLFNAIRE
FT                   AMHEENANEASVARAMREALSPFLYKQTERSPLVVPMIMTPDEK"
FT   gene            complement(296636..296887)
FT                   /locus_tag="LACR_0325"
FT                   /note="LactoCOG number LaCOG00202"
FT   CDS_pept        complement(296636..296887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0325"
FT                   /product="Predicted RNA binding protein, contains RRM
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71933"
FT                   /db_xref="InterPro:IPR009907"
FT                   /db_xref="UniProtKB/TrEMBL:Q032D9"
FT                   /protein_id="ABJ71933.1"
FT                   /translation="MLVVNYRMIFKVFYQKDNTRSPRRETTDALYLDLDVATKEEGVIL
FT                   ARELLAKNTAYHVEFIDSLSDESVEYEKETGVFEITSF"
FT   gene            296971..297108
FT                   /locus_tag="LACR_0326"
FT   CDS_pept        296971..297108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71934"
FT                   /db_xref="UniProtKB/TrEMBL:Q032D8"
FT                   /protein_id="ABJ71934.1"
FT                   /translation="MRSLISQMKRFLKNNGGTCKASVVKYKEVDTDNRDKVKNYLKRMI
FT                   "
FT   gene            297204..297929
FT                   /locus_tag="LACR_0327"
FT                   /note="LactoCOG number LaCOG00203"
FT   CDS_pept        297204..297929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0327"
FT                   /product="Metal-dependent protease related protein,
FT                   putative molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71935"
FT                   /db_xref="GOA:Q032D7"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q032D7"
FT                   /protein_id="ABJ71935.1"
FT                   /translation="MNILAFDSSSKALSVALLTDGLLLGEVTLNLKKNHSTTLMTTIDF
FT                   LMAQVGMEAKDLDRIAVAQGPGSYTGLRLAATVGKMLAFSLNKELVGLSSLLAIANRVQ
FT                   DDEAYVLPIIDARRGNAYAALYKNGQQIIADQHCNFSEFLADLSEKFSDFSKVIFTGES
FT                   ENFVDAIQNAGFSKEQIIADSLEKLPSAYEIAKIAENLVPENVHAFVPKYLKKVEAEEK
FT                   WLESHEKAENTPDDYVQRV"
FT   gene            297883..298452
FT                   /locus_tag="LACR_0328"
FT                   /note="LactoCOG number LaCOG00204"
FT   CDS_pept        297883..298452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0328"
FT                   /product="[SSU ribosomal protein S18P]-alanine
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71936"
FT                   /db_xref="GOA:Q032D6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q032D6"
FT                   /protein_id="ABJ71936.1"
FT                   /translation="MKKLKTLLTTTFKGFSGKKFNPRRYLEMADIDLEHDREGVHYRLA
FT                   DRVDIVALLAIERDVYNGDIPWTFSHFEHEIVKNDEAFFIVAEISGSVVGFIGTRINHH
FT                   GQDAHVTNLAVFKAFQGQQIASTLIEQLISLMAALGKNVMTLEVRRDNTKAQGLYRRQG
FT                   FVTDKLLPQYYEDGADAIWMVKELKK"
FT   gene            298449..298919
FT                   /locus_tag="LACR_0329"
FT                   /note="LactoCOG number LaCOG00204"
FT   CDS_pept        298449..298919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0329"
FT                   /product="Acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71937"
FT                   /db_xref="GOA:Q032D5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q032D5"
FT                   /protein_id="ABJ71937.1"
FT                   /translation="MNLKRLSYSENKSKDKNTFPPVEKLSVNIYELLSVAYGQSPWSQV
FT                   YISSDLVNENSEYFLLEEDEQLIGLLAISTMMDELEVTNIAIHPDFQGQGLAKLLLTEL
FT                   SGFTGTLFLEVRQSNFAAQKCYEKFGFEIYHTRKNYYDKPLEDALLMRKEQF"
FT   gene            298922..299947
FT                   /locus_tag="LACR_0330"
FT                   /note="LactoCOG number LaCOG00206"
FT   CDS_pept        298922..299947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0330"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71938"
FT                   /db_xref="GOA:Q032D4"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032D4"
FT                   /protein_id="ABJ71938.1"
FT                   /translation="MKDNYILAFETSCDETSVAILKNGSELLCNIIASQINSHKRFGGV
FT                   VPEIASRHHVEQITVCIEAALEEAEISADQLTAVAVTEGPGLNGALLVGIMAAKTFAWA
FT                   NHLPLIPVNHMAGHLMAASLVDTIEYPAMALLVSGGHSELVYVEKEGSYKKVGETRDDA
FT                   AGEAYDKVGRVMGLTYPSGKVIDELAHKGQDTYNFPRAMMNTHEVEFSFSGLKSAFINL
FT                   VHNENQKGNDVIANDLENLAASFQAAVVDVLMAKTKLAMEKYPVKTLIIGGGVSANQGL
FT                   RERLSAEITDEKLIIPPLRLCGDNAGMIAAAAYIEWKKGLENVQAGLDLNAKPSLVFED
FT                   M"
FT   gene            299962..300162
FT                   /locus_tag="LACR_0331"
FT                   /note="LactoCOG number LaCOG00207"
FT   CDS_pept        299962..300162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71939"
FT                   /db_xref="InterPro:IPR027879"
FT                   /db_xref="UniProtKB/TrEMBL:Q032D3"
FT                   /protein_id="ABJ71939.1"
FT                   /translation="MMKLIGKLQNGMTFTEEFDGVNDFLALQQSDYNAIADEIEVVEVK
FT                   IADEVLDFQGNMGQLYYELMK"
FT   gene            complement(300331..300492)
FT                   /locus_tag="LACR_0332"
FT                   /note="LactoCOG number LaCOG02413"
FT   CDS_pept        complement(300331..300492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71940"
FT                   /db_xref="UniProtKB/TrEMBL:Q032D2"
FT                   /protein_id="ABJ71940.1"
FT                   /translation="MTTAYLLLGNDLSLETQAGLPIGKMFAYKEMEKPWLKKAKSSLAM
FT                   KLNFKKHI"
FT   gene            complement(300596..301387)
FT                   /locus_tag="LACR_0333"
FT                   /note="LactoCOG number LaCOG00208"
FT   CDS_pept        complement(300596..301387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71941"
FT                   /db_xref="UniProtKB/TrEMBL:Q032D1"
FT                   /protein_id="ABJ71941.1"
FT                   /translation="MKNLTFTVTLSDFGLEIHLPSEARLLLLEQNNARFDLNNDELFFL
FT                   LKKGQIKMIANDLELIPKLEFDKVVILNVKAYELDANYLTQYLVNLAEEAGINLRDKAE
FT                   PLKIPNNIEKACATYADEFLSALGAFGIKLEKKKAFSPKAQHRWKKGLSEIEFFVKRPD
FT                   SQATIIWRKSNELVIKAGAKIAESGGMKSDGTPGLAYRFTQTLREEQKENWDPKTFITT
FT                   ADIVLKSVNEVGHFLYFAGTNSWLQLVDKEGRSIHELSVVQ"
FT   gene            301686..302735
FT                   /pseudo
FT                   /locus_tag="LACR_0334"
FT   gene            302851..303591
FT                   /locus_tag="LACR_0335"
FT                   /note="LactoCOG number LaCOG00210"
FT   CDS_pept        302851..303591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0335"
FT                   /product="ABC-type phosphate/phosphonate transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71942"
FT                   /db_xref="GOA:Q032D0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032D0"
FT                   /protein_id="ABJ71942.1"
FT                   /translation="MIKFENVSKVYPNGTKGLTDVNLQIDQGEFVAIIGTSGAGKSTLI
FT                   RCVNGLNDVTSGRLFVNDTDVSKLKGKDLRKFRRHVGMIFQSYNLVPRVTVLKNVMFAR
FT                   VPEMNLFKVIFGLFSKEDKLVALDSLNKVGILDKAYIRADQLSGGQQQRVSLARALTQE
FT                   SEILLADEPVSALDPVTAKEVMDDFKRINEELNKTILLNIHHVELALEYASRIIAVKKG
FT                   KIVYDGPSQEVTKEILDEVYRKEG"
FT   gene            303592..304404
FT                   /locus_tag="LACR_0336"
FT                   /note="LactoCOG number LaCOG00211"
FT   CDS_pept        303592..304404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0336"
FT                   /product="ABC-type phosphate/phosphonate transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71943"
FT                   /db_xref="GOA:Q032C9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q032C9"
FT                   /protein_id="ABJ71943.1"
FT                   /translation="MYDKIFKPKKIELLTGEVVEEKVSRTWIYWIIIIIIIGLSVLLTN
FT                   FDFSALSRSGLFLQKLASMLPPNWSYFDKVLPPLLDTIKMSFFASLLGALLAVPFAILT
FT                   ANNIVKNRLVNGIIRFIFMLARTLPTLVLALIATYIFGLGTFAGVVAIFIFTFSFIGKQ
FT                   LFEVIETVDMGPFEAAEALGVSPLKAFFIAVFPQVLPTYLSTALYAFEGNVRYAAILGY
FT                   VGAGGIGNILNDRVNFRDFASVGMILVSILVTVMIIDSVSALIRKKIA"
FT   gene            304424..305233
FT                   /locus_tag="LACR_0337"
FT                   /note="LactoCOG number LaCOG00212"
FT   CDS_pept        304424..305233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0337"
FT                   /product="ABC-type phosphate/phosphonate transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71944"
FT                   /db_xref="GOA:Q032C8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q032C8"
FT                   /protein_id="ABJ71944.1"
FT                   /translation="MNSQIIEEYNRRPKKWFYYLLIFIILLAISIWSTSVVHYHGVSEH
FT                   GALIAKNIFTGIFHPDSSLIFNFTETGLAYLLLQTFAIGILGTLVGAIIAVPLSFLAAT
FT                   NLVPNWLAYLIRFVLMAIRTIPSFIYALLFIPVVGLGSSAGVMALGFESIGMIAKLFIE
FT                   AIEDLDMGVIEAMDAAGATTFQKIRFGVLPQLLPDLYSILLYRLDMNLRDAAILGLVGA
FT                   GGIGAPLSFAMSGYKWSSVGAILLGLLVLIIFVELISSRIRKKLAKG"
FT   gene            305240..306799
FT                   /locus_tag="LACR_0338"
FT                   /note="LactoCOG number LaCOG00213"
FT   CDS_pept        305240..306799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0338"
FT                   /product="5'-nucleotidase/2',3'-cyclic phosphodiesterase
FT                   related esterase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71945"
FT                   /db_xref="GOA:Q032C7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041827"
FT                   /db_xref="UniProtKB/TrEMBL:Q032C7"
FT                   /protein_id="ABJ71945.1"
FT                   /translation="MKIRILETSDLHGFVLPTNFTEKDMDLPFSIAKARTKMDELTSSS
FT                   EQKGEIVIKIENGDILQGSALAYYLAKKAKEGIKDLVNVTNSFGYDVGLLGNHEFNYGL
FT                   EYLETYVKQVNYPILTANVLDKKGQPAFGPTYQIIERQGVKIGIVGFLTQYIPHWEQSA
FT                   TIKDLTFQSIVEAAKKILPDLRQRVDVLLVAYHGGFERDLVTGIPTESLTGENEAYQLL
FT                   LEYGELIDALVTGHQHRKIAQHVLGVPVIQPGFRGGFVGEIELELDKQKKITHSKAKIH
FT                   RTAKSKVSTEVLELISDISKETEEWLDQPMGKVLGNMKILDPMAARISEHPYIELINKI
FT                   QMEATAAKISGTALFNNEAKGFDEQITMRSILTNYIYPNTLAVLRVTGADLKAALERTA
FT                   EHLEINDEGEIIFSPRFVEPKPEYYNYDMYEGIDYTIDLKKKIGQRIVNLSFEGRPVAS
FT                   EEFLEIVVNQYRAVGGGNYPMFSADKIVREITVDMTELIAAYLKNHPVIQATVNHNFMI
FT                   LK"
FT   gene            306943..307062
FT                   /locus_tag="LACR_0339"
FT   CDS_pept        306943..307062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71946"
FT                   /db_xref="UniProtKB/TrEMBL:Q032C6"
FT                   /protein_id="ABJ71946.1"
FT                   /translation="MKQTLKIKKINYQFVKSEDNKLILPSPLESPYLTAKDEQ"
FT   gene            307125..307607
FT                   /locus_tag="LACR_0340"
FT                   /note="LactoCOG number LaCOG00214"
FT   CDS_pept        307125..307607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0340"
FT                   /product="thiol peroxidase (atypical 2-Cys peroxiredoxin)"
FT                   /EC_number="1.11.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71947"
FT                   /db_xref="GOA:Q032C5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q032C5"
FT                   /protein_id="ABJ71947.1"
FT                   /translation="MTMNITSHGEKIATINPTTSGDAPDFELTDLKGNKIKLSKLEKPV
FT                   LISVFPDINTRVCSLQTKHFNLEAAKHSEIDFLSISNNTADEQKNWCAAEGVEMTILAD
FT                   DGTFGQAYGIVLNDGPLKGRLARSVFVVKGGQIVYSEILAELSDEPNYEKALEATK"
FT   gene            307776..310316
FT                   /locus_tag="LACR_0341"
FT                   /note="LactoCOG number LaCOG00215"
FT   CDS_pept        307776..310316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0341"
FT                   /product="lysyl aminopeptidase, Metallo peptidase, MEROPS
FT                   family M01"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71948"
FT                   /db_xref="GOA:Q032C4"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:Q032C4"
FT                   /protein_id="ABJ71948.1"
FT                   /translation="MAVKRLIETFVPENYKIFLDIDRKTKKIKGQVAITGEAKDTVVAF
FT                   HAKGLHFNKVRAFSVDTNFIENEEDEEIVVKIGVTGRVTVSFEYEAELTDNMMGIYPSY
FT                   YEVNGEKKMLIGTQFESHFARQAFPSIDEPEAKATFDLSVKFDEEEGDIIVSNMPELLN
FT                   INGIHVFERTVKMSSYLLAFVFGELQYKKGKTKSGVEVGAFATKVHSQAALDFPLDIAI
FT                   RSIEFYEDYYQTPYPLPHSWHIALPDFSAGAMENWGCITYREVCMLVDPENATIQSKQY
FT                   VATVIAHELAHQWFGDLVTMQWWDDLWLNESFANNMEYVCMDALEPSWNVWESFSISEA
FT                   NMALNRDATDGVQSVHVEVTHPDEIGTLFDPAIVYAKGSRLMVMLRKWLGDEDFAAGLA
FT                   LYFKRHQYGNTVGDNLWDALAEVSGKDVAAFMHSWVNQPGYPVVTAEVVDDTLILSQKQ
FT                   FFVGEGVDKGRLWNVPLNTNWTGLPDLLSSEKVEIPGFAALKTKNNGKALFLNDANMAH
FT                   YIIDYKGALLTDLLSEVESLENVTKFQILQDRKLLAKAGVISYADVVNILPSFTNEESY
FT                   LVNTGLSQLISELELFVDEDSETEKAFQSLVGKLFAKNYARLGWDKVAGESAGDESLRG
FT                   IVLSKTLYSENADAKTKASQIFATHKENLASIPADIRPIVLNNEIKTTNSAELVKTYRE
FT                   TYIKTSLQEFKRELEGAVALIKDEKVIAELLESFKNADIVKPQDIAFSWFYLLRNDFSQ
FT                   DAAWAWEKANWAFLEEKLGGDMSYDKFVIYPGNTFKTADKLAEYKAFFEPKLENQGLKR
FT                   SIEMAIKQITARVALIDSQKAAVDKAITDIAEKL"
FT   gene            complement(310364..311554)
FT                   /locus_tag="LACR_0342"
FT                   /note="LactoCOG number LaCOG00075"
FT   CDS_pept        complement(310364..311554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0342"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71949"
FT                   /db_xref="GOA:Q032C3"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q032C3"
FT                   /protein_id="ABJ71949.1"
FT                   /translation="MNINKHALTFGLITTFLTGLGFTIISPVVPFMVAPFANAHDQAFI
FT                   VSALMAIYALCTFFAAPALGSLSDRFGRKPILLISLAGSALGYLVFGLAGSLWMLFIGR
FT                   IIDGLTGGNIVTLFAYFADITDEENRTKVFGWTAAAVGVGTISGPTVGGLLAHFGNSVP
FT                   FYFGAIISLANLLYGAFVMDESLPENNRTKNFSLKQLNPFTQLFQLLRMKNLNRLLFAG
FT                   ILLWLPNGALQAIISQFSLDSFAWIPVLIGLAISIMGLMDILTQIFIMPRLLKLANEDK
FT                   LICLAIVCEIIAYLLFALSAFSKMWPLFILAMFIFAFGDSIFGTAFNGKLSKSATSSEQ
FT                   GKLQGGSQALQALKRVIGPLIGGQIYISLGHSAPALMGFIFLILALIVLSKAKSNE"
FT   gene            complement(312036..312509)
FT                   /locus_tag="LACR_0343"
FT                   /note="LactoCOG number LaCOG00216"
FT   CDS_pept        complement(312036..312509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0343"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71950"
FT                   /db_xref="GOA:Q032C2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q032C2"
FT                   /protein_id="ABJ71950.1"
FT                   /translation="MTQFQENQEQIMTSLTNLFNKIDAYYTPQMEAEFSNISLSEIETI
FT                   EFIAKTPYPNVTKLAHHLYMTRGAASKIAKKLLKKNLIESYQIPQNKKEIYFRLTKEGQ
FT                   QINDRHESLHQKFSQNDQVIFDELTDEAVSNILEFLDKYNNHLDSSIRKNIEK"
FT   gene            complement(312506..313789)
FT                   /locus_tag="LACR_0344"
FT                   /note="LactoCOG number LaCOG00217"
FT   CDS_pept        complement(312506..313789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0344"
FT                   /product="Predicted Co/Zn/Cd cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71951"
FT                   /db_xref="GOA:Q032C1"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q032C1"
FT                   /protein_id="ABJ71951.1"
FT                   /translation="MAASSTNNLKLAEKGVWVSILAYIVLSIGQIAFATIVHSSALQAN
FT                   GFNNVTDIMGNIAILIGLRIARIPADSDHVYGHWKIESIASLISSFIMFFVGFEVLRET
FT                   VMTLLSGKEETIDPLGALVGLFSAFVMLGVYLYNRDLAKKTNSQALSAASKDNLSDAVT
FT                   SIGTVVAILASSIGWEWLDTAMAIIICGFILKTAYDIFHESVFSLSDGFEENLVKEYRE
FT                   AICLAPKVKGVKLVRGRSYGSNIFLDVVVEMSPDLSVYESHEATESIEKMLIDGFGVYD
FT                   VDVHVEPAALPEEEHYASRSLELLAKEEQFLNHQNLPKLTDEKYQEILADGRMINASEK
FT                   LNTFGQITDKNSVSKNNESGNLLSSRSVIPLAINHYKASQVSKKTFILTYDYWQNEQNY
FT                   IVTSIWRRNDYWSCIYRQSTLKMEENDS"
FT   gene            314065..314415
FT                   /locus_tag="LACR_0345"
FT                   /note="LactoCOG number LaCOG00218"
FT   CDS_pept        314065..314415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0345"
FT                   /product="transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71952"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q032C0"
FT                   /protein_id="ABJ71952.1"
FT                   /translation="MAEIPKEMLRAQTNVILLNVLKQGDNYVYGIIKEVKEASNGEMEL
FT                   NEATLYTIFKRLEKDGIISSYWGDESQGGRRKYYRLTEIGHENMRLAFESWSRVDKIIE
FT                   NLEANKKSEAIK"
FT   gene            314712..316451
FT                   /locus_tag="LACR_0346"
FT                   /note="LactoCOG number LaCOG00219"
FT   CDS_pept        314712..316451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0346"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71953"
FT                   /db_xref="GOA:Q032B9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q032B9"
FT                   /protein_id="ABJ71953.1"
FT                   /translation="MIFKSIMKHKWVALFSIFSTFVYAGVQLYQPQIMKRIMTVMSSTT
FT                   YSRHEMADKVSGYGVELLIVAGIGILFAIFSTLSAARIAQEIGADVREATYKKINTFSY
FT                   ENVEKFNAGNLVVRMTNDVTQVQNLMMMVFQILMRIPVLLIGAVILSITTLPKLWWITV
FT                   LLIVLILVVTAVLMGRMGPHFMAFQKLMDRINAIAKQNLRGARVVKSFVQEKNQIKEFD
FT                   ETSDELYDHNWAVGKLFSAMIPLFTVIAQGAIWLAIYFVSTFVTDSPTVAQDSIGGIAT
FT                   FMTYMGMIMFAIIMGGMISMFASRGMVSIGRINEVLKTDPAMKFDENAKDEELSGSVKF
FT                   DHVSFSYPNDEEPTLKDISFEVEAGQMVGIVGATGAGKSTLAQLIPRLFDPTEGTVSVG
FT                   GKDLKTVSRGTLKRNISIVLQKAILFSGTIAGNIKQGKSDATDEEMTRAAQIAQAAEFI
FT                   TTKDGQYESEVEERGNNFSGGQKQRLSITRGVVKNPNVLILDDSTSALDAKSEKLVQEA
FT                   LNKELKETTTIIIAQKISSVVHADNILVLDQGKLVGQGTHQELVAENKIYQEIYDTQKA
FT                   QED"
FT   gene            316455..318449
FT                   /locus_tag="LACR_0347"
FT                   /note="LactoCOG number LaCOG00180"
FT   CDS_pept        316455..318449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0347"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71954"
FT                   /db_xref="GOA:Q032B8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q032B8"
FT                   /protein_id="ABJ71954.1"
FT                   /translation="MENTKSTRKMSDTTRAIRFFYLYLKRYKLQFAVIMIFIVAATWLQ
FT                   VIAPSLLGDAITNLGVYVKDFFTHQHAGQSQDALQQIAQQLSQQMHQTVDWHNVPEVVK
FT                   TLPQAAQDQITAHLPKGTTLETLKTVATSHASSTSTFMKGMWQLLAVYVATGVSMLIYT
FT                   LLFSRIVAHSTNRMRKGLFGKLERLTISYFDRHQDGDILARFTSDLDNIQNTLNQALVS
FT                   VISNAAVFVGVIIQIFLKDVTFAWLTVAASPVAILSAVIIIRQSKKATDKQQEEVSQLN
FT                   AYMDEKISGQKAIIVEGLQEDSIDGFLKHNENVKKRTFAAQAWSGMIFPLMNGFQLLSI
FT                   AIVIFGGTAYVLNNDSMSITTGLGLLVAFVQYVQSYYNPIMQISSNFGQLQLAITGATR
FT                   LNVMFDEPEEVRPENGRKFDTIKDGIQIENLDFEYLPGKPVLKKVNIDVKKGQMVALVG
FT                   PTGSGKTTVMNLMNRFYDVNGGAIKFDGTDIREFDLDSLRSNVGIVLQESVLFDGTIAD
FT                   NIKFGKPNATQEEIETVAKTTHIHEFIESLPDKYETHVSDDESVFSVGQKQQISIARTI
FT                   LTNPELLILDEATSNVDTVTEEQIQWAMEAAIAGRTSFVIAHRLKTILNADKIVVLKDG
FT                   EVIEEGNHHELVAQGGFYSELYHNQFVFE"
FT   gene            318623..319888
FT                   /locus_tag="LACR_0348"
FT                   /note="LactoCOG number LaCOG00220"
FT   CDS_pept        318623..319888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0348"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71955"
FT                   /db_xref="GOA:Q032B7"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:Q032B7"
FT                   /protein_id="ABJ71955.1"
FT                   /translation="MKKIVINGGKRISGTIPISGAKNSVVALIPATILANDIVTLEGVP
FT                   DISDVASLVEIMEITGAKIERNLEEGRLVIDTRSVVSRPLPYGKINSLRASYYFNGALL
FT                   GRFGQATVGLPGGCDLGPRPTDLHDKAFKALGAKKIQEEEAEHLEVIGDSLVGTTIYMD
FT                   VVSVGATINTMLAASRAKGVTVIENAAREPEIIDVATLLNNMGAKVRGAGTDIIRITGI
FT                   DEMHGAQHTVIPDRIEAGTYLALAAAMGDGVIIENVIYEHLESFIAKLEEMGVRLTIRE
FT                   DSIEVHKSENLKSVNITSVPYPGFATDLQQPITPLLLKAKGRGSIVDTIYQKRVNHVPE
FT                   LARMGANISVLDDRIIYDAPNELTGSCVQATDLRAGAALVTAGIIASGTTKISNIEFIL
FT                   RGYDHIIEKLTAVGVDIQLIEE"
FT   gene            319934..320152
FT                   /locus_tag="LACR_0349"
FT                   /note="LactoCOG number LaCOG00221"
FT   CDS_pept        319934..320152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71956"
FT                   /db_xref="GOA:Q032B6"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="InterPro:IPR017154"
FT                   /db_xref="UniProtKB/TrEMBL:Q032B6"
FT                   /protein_id="ABJ71956.1"
FT                   /translation="MADKLKFEIIEELIVLSENAKGWRKELNRVSWNDAEPKYDIRTWS
FT                   PDHEKMGKGITLSEEEFGVLLKELGNK"
FT   gene            complement(320411..321301)
FT                   /locus_tag="LACR_0350"
FT                   /note="LactoCOG number LaCOG03011"
FT   CDS_pept        complement(320411..321301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0350"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71957"
FT                   /db_xref="GOA:Q032B5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q032B5"
FT                   /protein_id="ABJ71957.1"
FT                   /translation="MTYNSTLPKVFVYLLTTIDTLYQTRVPLEVQNRKNVHLATSDCLV
FT                   IACYLWGVLHFSETLKAKHQLAQSLFPNFLEYSRFVRRCNALLPSIQVIRQALVFKEVE
FT                   GISVSIIDSFPIPLCQPIRNFRSKGLGDYANVGYNATKGQYFYGCKCHALVSESGYVID
FT                   YTITPASMADSSMTEEVLSQFGTPTVLGDMGYLGQSLHDRLELKGIDLMTPVRKNMKQK
FT                   KILFPNFSKRRKVIERVFSFLTNLGAERCKSRSPQGFQLKLEMILLAYSLLLKSAKSLE
FT                   PETLRYSIGYQVMAK"
FT   gene            321413..321490
FT                   /locus_tag="LACR_0351"
FT   CDS_pept        321413..321490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71958"
FT                   /db_xref="UniProtKB/TrEMBL:Q032B4"
FT                   /protein_id="ABJ71958.1"
FT                   /translation="MDEKIFEDIMSDIIVVSAEGSEVNI"
FT   gene            321546..321806
FT                   /locus_tag="LACR_0352"
FT                   /note="LactoCOG number LaCOG00049"
FT   CDS_pept        321546..321806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0352"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71959"
FT                   /db_xref="GOA:Q02XG4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q02XG4"
FT                   /protein_id="ABJ71959.1"
FT                   /translation="MQKRYSKEFKETLIAFYHSGQSVTQLSKEYDVVPATIYKWIDLYS
FT                   KSNESSVSKADFLELKRQLAKVKEERDILKKVLTIFAEKKK"
FT   gene            322237..322647
FT                   /locus_tag="LACR_0353"
FT                   /note="LactoCOG number LaCOG00439"
FT   CDS_pept        322237..322647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0353"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71960"
FT                   /db_xref="GOA:Q032B2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q032B2"
FT                   /protein_id="ABJ71960.1"
FT                   /translation="MDRYTKKVIAWDLGKRMTVELVQRTLNKAIKSQDYPEAVILHSDQ
FT                   GSQYTSLEYEELLKYYGMTHSFSRRGYPYHNASLESWHGHLKREWVYQFKYKNFEEAYQ
FT                   SIFWYIEAFYNSKRIHQSLGYLTPNQFEKVSA"
FT   gene            322765..323718
FT                   /locus_tag="LACR_0354"
FT                   /note="LactoCOG number LaCOG01776"
FT   CDS_pept        322765..323718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0354"
FT                   /product="Dinucleotide-utilizing enzyme for molybdopterin
FT                   and thiamine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71961"
FT                   /db_xref="GOA:Q032B1"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q032B1"
FT                   /protein_id="ABJ71961.1"
FT                   /translation="MIILNQSKFIEVLDDGLSFYDGKHQKIKRYTKQIWIKILEWYQIA
FT                   REIDDIPKCILPNEEMVALREVLLTLHILKEIEMVPRHLERIYNFYSTYNASNLERISN
FT                   IRVMIWGCGTVGTAIVDNLVKMGVKNFLLIDSDIVEEKNIVAQSIFQKKDIGLKKIEVI
FT                   KNYVESFNIGKNNVEISDKFINHGEEFMINYQEFYPNFIIDCADTKDEELDIQFIKFAE
FT                   QLGSVYMSTGYTDDRDFIFVISKNFDKFRMFMRNNWAISKRKYQISSNRGTIIDSQLLG
FT                   SLGARSIINHVCALNQNDRVIEINLLDITMRDVPFR"
FT   gene            323774..325009
FT                   /locus_tag="LACR_0355"
FT                   /note="LactoCOG number LaCOG00792"
FT   CDS_pept        323774..325009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0355"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71962"
FT                   /db_xref="GOA:Q032B0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q032B0"
FT                   /protein_id="ABJ71962.1"
FT                   /translation="MKKYFTQNKLLTIFLMFLFGSLASGTLTFMISWTVLKETHQASQF
FT                   ALLSTISSLVMLIAMPVIGIIVDRYDHRHLLVIAQVFSLFVLLSFIFQPFHGLIIYILF
FT                   SIGLNLGDLLFSITMYASVKSLSDDKTEMSKINGIEQGIGALFAIVSPAVAGFTLTFIS
FT                   VRIFSWVEIVCESIIVLLVFRLNFERFDTKNEEESVSVEKISYKRVLQLLNKKYIVMII
FT                   VSIMIVLKFLLGSINVGIPFILNKNYQGNTVILGIVQFSFPLGIILSSLLVQKLPKFQL
FT                   FKLLKISYFSCAFVIFSFGIVLSFLIGSIVFTVVVLSVLMLFMGLGLGFSRVPMMTFAQ
FT                   NNIPENIQGRAFSIIDTSAQILSSLGLRFYGVLFDNFSGGWIYLFSSFLMFGVLIVGFW
FT                   FVDRADKENYIY"
FT   gene            complement(325240..325578)
FT                   /locus_tag="LACR_0356"
FT                   /note="LactoCOG number LaCOG00222"
FT   CDS_pept        complement(325240..325578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71963"
FT                   /db_xref="GOA:Q032A9"
FT                   /db_xref="InterPro:IPR024515"
FT                   /db_xref="UniProtKB/TrEMBL:Q032A9"
FT                   /protein_id="ABJ71963.1"
FT                   /translation="MALYPLIVFIALVFIFKFFRLRHLTNRKLKIPDVFTLFLILGMQI
FT                   FSKNVTSISIIPYYLLIISGLALILLLLDLFYYKQFAYRRFLKLWWRLTFFITLIIYLI
FT                   LVVMTFTH"
FT   gene            complement(325620..326168)
FT                   /locus_tag="LACR_0357"
FT                   /note="LactoCOG number LaCOG00223"
FT   CDS_pept        complement(325620..326168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71964"
FT                   /db_xref="GOA:Q032A8"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:Q032A8"
FT                   /protein_id="ABJ71964.1"
FT                   /translation="MQNTKLYSLTLIALGAAIIAVLSPLAIPIGIVPVTLQTLAVGLVA
FT                   TVLKARETFFAILLYLLLGFIGIPVFTGGTSGIAVLFGPTGGFLLAFLIMGTLISWGLH
FT                   QIKYKTIPAFIINIVGHLLMLVIGTLWLKFFTQVDWSLALKLGFTPFVFVEIIKAILVT
FT                   IFGLALIRALSHTNKYFTN"
FT   gene            complement(326280..326756)
FT                   /locus_tag="LACR_0358"
FT                   /note="LactoCOG number LaCOG00224"
FT   CDS_pept        complement(326280..326756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0358"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71965"
FT                   /db_xref="GOA:Q032A7"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q032A7"
FT                   /protein_id="ABJ71965.1"
FT                   /translation="MSKKQKLKKTLVEQILDKAKIEHTGLAINALESDSLPDDINRSDI
FT                   YKTLALIGDKTGPVIGILPLTEHLSEKKLAKVSGNKKVSMIPQKDLQKTTGYIHGANNP
FT                   VGIWQNKKFPIYIDSIALEHDFIVCSAGEVGRSIKIAPQELADFVHAHFVEIRE"
FT   gene            complement(326819..327367)
FT                   /locus_tag="LACR_0359"
FT                   /note="LactoCOG number LaCOG00225"
FT   CDS_pept        complement(326819..327367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0359"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71966"
FT                   /db_xref="GOA:Q032A6"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:Q032A6"
FT                   /protein_id="ABJ71966.1"
FT                   /translation="MSNSKFNVRLLTEIAFMAALAFIISLIPNTVYGWIIVEIACIPIL
FT                   LLSLRRGLTAGLVGGLIWGILSMITGHAYILSLSQAFIEYLVAPVSLGIAGLFRQKTAP
FT                   LKLAPVLLGTFVAVLLKYFFHFIAGIIFWSQYAWKGWGAVAYSLAVNVISGILTAIAAF
FT                   VILIIFVKKFPKLFIHSNY"
FT   misc_binding    complement(327414..327513)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="THI element, riboswitch"
FT   misc_binding    327695..327957
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="T-box leader, riboswitch"
FT   gene            328059..328961
FT                   /locus_tag="LACR_0360"
FT                   /note="LactoCOG number LaCOG00226"
FT   CDS_pept        328059..328961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0360"
FT                   /product="ABC-type metal ion transport system, periplasmic
FT                   component/surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71967"
FT                   /db_xref="GOA:Q032A5"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q032A5"
FT                   /protein_id="ABJ71967.1"
FT                   /translation="MILKNKSIRKKGEEMNPRNRNILLVVIVVVIVAIAAFFGFNHKSG
FT                   GSKTANKTVNIGIMTGTKEDDSIWSTVSKTAKDKYGITLKFTHFTDYTQPNTALKNGDI
FT                   DLNAFQHYAFLNAWNKANNGDLKAIGNTTISPIRLYSKKITSLSQIKSGDTIAVPNDAS
FT                   NESRALYVLKNAGLIGLSVSGDTLATVKDINSNPKNLVIKELDAAQTPRALDSITAAVI
FT                   NDDFATTAKLTVEESIYTEPVNKDSEQWINIIVANKKDENNKIYKEVVKAYQTEATKKA
FT                   IEKAYPDKRKIAAWGLKLD"
FT   gene            329106..329966
FT                   /locus_tag="LACR_0361"
FT                   /note="LactoCOG number LaCOG00226"
FT   CDS_pept        329106..329966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0361"
FT                   /product="ABC-type metal ion transport system, periplasmic
FT                   component/surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71968"
FT                   /db_xref="GOA:Q032A4"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q032A4"
FT                   /protein_id="ABJ71968.1"
FT                   /translation="MNPRNRNIIIGIIVVVIIAIAAFIGFGHQTKANKTVNKTVKIGIM
FT                   TGTKEDDSIWQTVSKTAKDKYGITLKFTHFTDYTQPNTALKNGDIDLNAFQHYAFLKAW
FT                   NKANNGDLVAIGDTVISPISVYSKSLKTLSDIKEGGTIAVPNDASNESRALYVLKSAGL
FT                   IKLDVSGQTLATVKDITSNPKNLVIKELDASQTARALDSVDAAVINNNYAVTAGLKKAD
FT                   VIFTEPVNKDSQQWINIIVANKKDANSSVYKDVVKAYESEATKKAIAKAYPDKSTIPAW
FT                   GLKLK"
FT   gene            330112..330975
FT                   /locus_tag="LACR_0362"
FT                   /note="LactoCOG number LaCOG00226"
FT   CDS_pept        330112..330975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0362"
FT                   /product="ABC-type metal ion transport system, periplasmic
FT                   component/surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71969"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q032A3"
FT                   /protein_id="ABJ71969.1"
FT                   /translation="MNPKNRNIIIAVAVLILVALVAFFSLNHQGGVKASAGEKTVKVGI
FT                   MSGDKQDQEVWKSVAKTAKEKYDLKLKFVYFSDYNQPNEALLSGDIDINAFQSYNYVKT
FT                   WNKAHKSDIVAVGNTYITPMHIYSKEISKLSDLKEGSTVAIPNDASNESRALFVLQSAG
FT                   LLKLTTSDSSKLVGLPDITENPHQLKFKEVDASQTPRALDSVALSVVNYNYATAASLPK
FT                   SESVFMEPLNKTSAQYINFIAATSKEKNNKVYKEVAKAYASKATEKAIKEQYPDGGEFP
FT                   AWDLKL"
FT   gene            331044..331742
FT                   /locus_tag="LACR_0363"
FT                   /note="LactoCOG number LaCOG00625"
FT   CDS_pept        331044..331742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0363"
FT                   /product="acetoin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71970"
FT                   /db_xref="GOA:Q032A2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014007"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q032A2"
FT                   /protein_id="ABJ71970.1"
FT                   /translation="MGKLAIVTGSGQGIGEGIVYRLAKDGFAVAVADINPQTAKNVAKT
FT                   LIDKGFEAKAYVLDVANRSAVFQLIEQAVNDFGELAVFVNNAGVAFIDSIIDSDSERVE
FT                   RLFDVNIKGTYWGIQAAATQFKKQGHGGRIINASSLASVEGSALQSAYSASKFAIRGLT
FT                   QSAAKELAKDHITVNAYNPGIVRTAMRDEIDKKTAQIKGISIEQQRQNCLNEIYLGREG
FT                   RPEDVAEVVA"
FT   gene            331830..332690
FT                   /locus_tag="LACR_0364"
FT                   /note="LactoCOG number LaCOG00226"
FT   CDS_pept        331830..332690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0364"
FT                   /product="ABC-type metal ion transport system, periplasmic
FT                   component/surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71971"
FT                   /db_xref="GOA:Q032A1"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q032A1"
FT                   /protein_id="ABJ71971.1"
FT                   /translation="MNVKNRRILITIIILVFIIIVGGIFAFSHSGNKSKVSSKIVKIGL
FT                   MPGGKQEDVIWKQVQKNAKDQFGITLKFVNFTDGDEPNKALVNHEVDLNAFQHYAYLKS
FT                   WNKANNGNIVSIGDTIITPIHLYSTKYKKVDEIPDKSTIAIPNDVTNESRALYVLKNAG
FT                   LIKLDTSRGVLATVKDIRENPKGLIIKEIDASQTPRALDSVAAAVINYNFAISAKISDK
FT                   ESIYQEPLNEDSAQWINFIAANQSDKNNKVYKEVVKAYEQKNIADIIKKEYPDGRELPA
FT                   WNLKL"
FT   gene            332814..333920
FT                   /locus_tag="LACR_0365"
FT                   /note="LactoCOG number LaCOG00227"
FT   CDS_pept        332814..333920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0365"
FT                   /product="ABC-type metal ion transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71972"
FT                   /db_xref="GOA:Q032A0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q032A0"
FT                   /protein_id="ABJ71972.1"
FT                   /translation="MTAIIELNNLSVQFHQKGRLVTAVKNATLHIEKGDIYGVIGYSGA
FT                   GKSTLVRTINLLQKPTEGQIVINGEKIFDSANPVKFTGAKLREFRQKIGMIFQHFNLLS
FT                   EKTVFNNVAFALQHSQIEDKNGKKRYLTKKEKNDKVTELLKLVDLADLSDKYPAQLSGG
FT                   QKQRVAIARALTNDPEILISDEGTSALDPKTTNQILDLLKSLHEKLGITVVLITHEMQV
FT                   VKEIANKVAVMQNGEIIEQNSLIDIFAQPKEALTKQFIETTSSVNRFIASLSKTELLAQ
FT                   LADDEELIHLDYSGSELEDPVVSDITKKFDVTTNIFYGNVELLQGQPFGSLVLTLKGSS
FT                   EHRAAAKAYFVERHLKFEVLGKIERTVD"
FT   gene            333920..334615
FT                   /locus_tag="LACR_0366"
FT                   /note="LactoCOG number LaCOG00228"
FT   CDS_pept        333920..334615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0366"
FT                   /product="ABC-type metal ion transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71973"
FT                   /db_xref="GOA:Q031Z9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Z9"
FT                   /protein_id="ABJ71973.1"
FT                   /translation="MAEWFAHTFPNVVYLGWTGETGWWTAIVQTLYMTFISALIGGLLG
FT                   LIFGIGVVVTAEDGITPNRPLFWILDKIVSIGRAFPFIILLAAIAPLTKILVGTQIGVT
FT                   AALVPLALGVAPFYARQVQASLESVDHGKVEAAQTVGADFLDIVFTVYLREELASLIRV
FT                   STVTLISLIGLTAMAGAIGAGGLGNTAISYGYNRFANDVTWFATILILIFVLLVQLVGD
FT                   FLARRVSHR"
FT   gene            334640..335206
FT                   /locus_tag="LACR_0367"
FT                   /note="LactoCOG number LaCOG00229"
FT   CDS_pept        334640..335206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0367"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71974"
FT                   /db_xref="GOA:Q031Z8"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="InterPro:IPR022914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031Z8"
FT                   /protein_id="ABJ71974.1"
FT                   /translation="MIKGETIKNNSVKIVVATGIGAALFVIIGWLINIPTPIPNTSIQL
FT                   QYAVLALFSALFGPLAGFLIGFIGHALKDSFLYGAPWWTWVLGSGLMGLFLGFGVKRES
FT                   LTQGIFGNKEIIRFNIVQFLANVVVWGLIAPIGDILVYSEPANKVFTQGVVAGLVNALT
FT                   IAVAGTLLLKLYAATRTKSGTLDKE"
FT   gene            335325..336950
FT                   /locus_tag="LACR_0368"
FT                   /note="LactoCOG number LaCOG00230"
FT   CDS_pept        335325..336950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0368"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71975"
FT                   /db_xref="GOA:Q031Z7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022216"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Z7"
FT                   /protein_id="ABJ71975.1"
FT                   /translation="MEPLISFKDFTFKYDLQKNSTLKKINLEIFPGEKVLIVGPSGSGK
FT                   STIGSCLNGILPHLYKGEASGELSIAGLPFGTSITELSERVSTVLQDTDGQFIGLSVAE
FT                   DIAFALENDGLIHDEMVSKVAYWSEKTESKSLLNHRPQDLSGGQKQRVSLAGVLIDESP
FT                   ILLFDEPLANLDPQTCGETIALIKNIHEEKNVTTIIIEHRIEEVLSLGIDKIVVVNEGE
FT                   IVAIGSPDELLKTEVFRENSLREPLYLSALKAVKVADSLTNFSDLKTLDAPNLKKILTD
FT                   FTSSYKVTDKAVSKNNILSVKNLTVNFGQHEVLKGINLEIQEGEKISIVGKNGVGKSTF
FT                   ANALCHFVEASGEILYRGQSIVNDSISERAAKIGYIMQNLNLMISQNIVSDEVASGLRL
FT                   RGFDEGVISEKVEEILQVCGLYPFRNWPISSLSYGQKKRVTIASILILEPEILVLDEPT
FT                   AAQDLKAYREIMDFLDQLNHRLHLTMIMITHDMYLITEYTDRTLVFADESPFEILENEN
FT                   FVKMGNLRQPSLYQLARKADISPI"
FT   gene            336997..337818
FT                   /locus_tag="LACR_0369"
FT                   /note="LactoCOG number LaCOG00231"
FT   CDS_pept        336997..337818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0369"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component CbiQ related transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71976"
FT                   /db_xref="GOA:Q031Z6"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Z6"
FT                   /protein_id="ABJ71976.1"
FT                   /translation="MNNQLKVLGYQAGSGFIYQLNATAKLLFFLLISISSMVTYDTRYL
FT                   AFVALFSMLLFYFSKIPFSSVKRVAQFAALFAFLNLLFVFVFDLGYGVRLYDSKTIIWG
FT                   PLTLEELFYLFNLVLKYFSTIPLALLFILTTNPSQFASSLNKIGLPYRSSYSVSLALRY
FT                   IPDMQEKFLAIRNAGQARGMHLSKKVGLFSRIKLNVQLLLPLIFSSLEQIDTISTAMEL
FT                   RRFGKKKKRSWYSYQPLKVKDYFVILLALLGVALVILLFFVNQGRFFNPFH"
FT   gene            338130..338423
FT                   /locus_tag="LACR_0370"
FT                   /note="LactoCOG number LaCOG00232"
FT   CDS_pept        338130..338423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0370"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71977"
FT                   /db_xref="GOA:Q031Z5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Z5"
FT                   /protein_id="ABJ71977.1"
FT                   /translation="MENKIRELRRLSHLSQEDVAHIAHVSRQTINAIENDKYDPELTLA
FT                   FKLAETLGTTVDELFNYQPTVVKRKENDVFWCEKYQCVLWKRAGIEKRNAVD"
FT   gene            338398..339126
FT                   /locus_tag="LACR_0371"
FT                   /note="LactoCOG number LaCOG01994"
FT   CDS_pept        338398..339126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0371"
FT                   /product="ABC-type cobalamin/Fe3+-siderophores transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71978"
FT                   /db_xref="GOA:Q031Z4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Z4"
FT                   /protein_id="ABJ71978.1"
FT                   /translation="MKNVTLSIEKGKTTAIIGVNGSGKSTILKALGRLIKAEGQVIFDN
FT                   QPLSNHSNREIARILALLPQSITAPADITVYELVSLGRFPHQKLMQQRLSKEDITFIEE
FT                   LMRETNVWDIRESKVSELSGGQKQRVFITMILAQDSEIILLDEPTTYLDLAHQLDILCL
FT                   LKDLATKRNKTIVYVIHDLNHAARFADNLVLVKNGKVVEQGTVDDLFTQKTLKECFGLD
FT                   VTLGCDTFTKKLMITGVKDA"
FT   gene            339119..340069
FT                   /locus_tag="LACR_0372"
FT                   /note="LactoCOG number LaCOG00233"
FT   CDS_pept        339119..340069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0372"
FT                   /product="ABC-type Fe3+-siderophore transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71979"
FT                   /db_xref="GOA:Q031Z3"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Z3"
FT                   /protein_id="ABJ71979.1"
FT                   /translation="MPKKHFLTIFFALVFSLLFLSVLYLMLGNKNVPLTELSTNKMVLQ
FT                   LRLPRLISLFLTGFLLSVSGFLVQIMTRNPIAEMSTLGISGGSSLALSLLLTLGWSTND
FT                   GISVMVSSLGAFIALAVVMLLTARTHFQPLKVVLVGTSVGLFATSLASSMTFASHDTQA
FT                   YFRWIVGSFSGITNTKVLLMAVVSLIFLLLLLLFSKQIYLLNFGDELAQSFGVSVNFVR
FT                   LLIMFLVALASGVTVASVGVVSFVGLIAPHIAKKIVRTNFWQNVILSVLTGMLLLVLAD
FT                   LAARNLFKPYEFPSGSLTMLLGAPFFLWVITKEAK"
FT   gene            340070..341008
FT                   /locus_tag="LACR_0373"
FT                   /note="LactoCOG number LaCOG00234"
FT   CDS_pept        340070..341008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0373"
FT                   /product="ABC-type Fe3+-siderophore transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71980"
FT                   /db_xref="GOA:Q031Z2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Z2"
FT                   /protein_id="ABJ71980.1"
FT                   /translation="MKRKFTLLFVLLLVLIVADLTQFSTNSQILSILIPNFRLPRLITI
FT                   LSAGIALSLSGYIIQNITENPLADSGTIGITSGASAGSVTFLLIADHFKLTGIWNFSYP
FT                   LFALIGALLSFALIYIFALRKQVSSVRVLLTGIAITAFFQALITIGQLSVNAFDFQKVA
FT                   VWLSGDIWQTGTTYLIICILLLVIGLIILPFFLKKLEILSLGEEMATVLGLDVPKTKIY
FT                   LYLLALLFAAIGVLLVGGLAFVGLIAPHIAREIVGFKSRKSLIATALSGMIILSFADII
FT                   SQMIIAPSSLPLGFVVAFIGAPYYIYLIQKV"
FT   gene            341092..342033
FT                   /locus_tag="LACR_0374"
FT                   /note="LactoCOG number LaCOG00235"
FT   CDS_pept        341092..342033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0374"
FT                   /product="ABC-type Fe3+-hydroxamate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71981"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Z1"
FT                   /protein_id="ABJ71981.1"
FT                   /translation="MKKVLTTLIAAGALLTLAACSPNSSSKKSTSSEDKVTFHALNGDV
FT                   KVPKDPKRIAVQNYPDEVASLGANVVGTDSWAFPNTFLSKEQKKNMVDLGAPKFNMEKL
FT                   IAQNPDLIITVDKDQVADYQKVAPTVLVNYKDLSGMNKSLDYFAKLLNREDEKASFLKN
FT                   FKKEADKQKEKLAKVDVKPAKNTISLLELQGDKVYAFGDNFARGGQALTTGLGFKESSK
FT                   MSELSKGVGYAEVNTESLGEFDADYIFIDFAEKDKEQYAALKNNPAWQNLKAVKEGHVI
FT                   TMDYDKVYFFGGPTAAKKELSLYTDAIIKATK"
FT   gene            342095..343000
FT                   /locus_tag="LACR_0375"
FT                   /note="LactoCOG number LaCOG00236"
FT   CDS_pept        342095..343000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0375"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71982"
FT                   /db_xref="GOA:Q031Z0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Z0"
FT                   /protein_id="ABJ71982.1"
FT                   /translation="MNIKQLRYVVAIANSGTFREASEQLFVSQPSMSIAVKDLEQELGF
FT                   QIFERTNTGVTLTIEGERFYEQAQTVLRNFESFESKYSKPKESDKTFSVASQHYDFLAP
FT                   VAVEFAKKNPEIKNFRIFESTTYNILQEVAQGHSELGVVYLNKQNRSGILRMLNKLELD
FT                   YEEIFLSQTHIYIRKGHPLAQRETISDDDLKPLDRVRFTQENEQFLYYSEDLVETFENT
FT                   LIYNVTDRASLNGILERTDAYATGLGFIDKASVHNVTVVPMQGDNGNSLILVKHRGHLL
FT                   SNAATSYKRSLEVYFENYEF"
FT   gene            complement(343072..343962)
FT                   /locus_tag="LACR_0376"
FT                   /note="LactoCOG number LaCOG03011"
FT   CDS_pept        complement(343072..343962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0376"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71983"
FT                   /db_xref="GOA:Q02Z65"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q02Z65"
FT                   /protein_id="ABJ71983.1"
FT                   /translation="MTYNSTLPKVFVYLLTTIDTLYQTRVPLEVQNRKNVHLATSDCLV
FT                   IACYLWGVLHFSETLKAKHQLAQSLFPNFLEYSRFVRRCNALLPSIQVIRQALVFKEVE
FT                   GISVSIIDSFPIPLCQPIRNFRSKGLGDYANVGYNATKGQYFYGCKCHALVSESGYVID
FT                   YTITPASMADSSMTEEVLSQFGTPTVLGDMGYLGQSLHDRLELKGIDLMTPVRKNMKQK
FT                   KILFPNFSKRRKVIERVFSFLTNLGAERCKSRSPQGFQLKLEMILLAYSLLLKSAKSLE
FT                   PETLRYSIGYQVMPK"
FT   gene            complement(344070..345245)
FT                   /locus_tag="LACR_0377"
FT                   /note="LactoCOG number LaCOG00237"
FT   CDS_pept        complement(344070..345245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0377"
FT                   /product="Arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71984"
FT                   /db_xref="GOA:Q031Y8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Y8"
FT                   /protein_id="ABJ71984.1"
FT                   /translation="MKKISPSLTLLALAINAFAIGSTEFISVGLMPMIVNTFNISLSQA
FT                   GLTVSLYALGVTVGAPLLTILTGTWNRKTLMVAIMILFILGNLLSAFASTFILLLVGRV
FT                   LASLAHGIFMSISTVIAADVVRPEKRASAIALMFTGLTVATVIGVPLGTFIGQHSTWHM
FT                   SFIFIVVIGLIGLIATSILVPKGLPIPGKINLSGLARIFTNKSIMMSFFITAFGYGGTF
FT                   AAYTYLSPILEGTFRFSASTVVIILVAYGVMVAIGNSLGGHLANKNILPALQKMFAALA
FT                   LSLLFLFISTSLASQPLGLIATLLLGLFAFMNVPGLQLYVVQLAEKFTPKDITLVSAFN
FT                   IAAFNIGITLGSFVGGQISKTSSVVFTPIGGIVIILLAMILIGIAQKQKAQ"
FT   gene            complement(345258..346076)
FT                   /locus_tag="LACR_0378"
FT                   /note="LactoCOG number LaCOG00238"
FT   CDS_pept        complement(345258..346076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0378"
FT                   /product="Aldo/keto reductase of diketogulonate reductase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71985"
FT                   /db_xref="GOA:Q031Y7"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Y7"
FT                   /protein_id="ABJ71985.1"
FT                   /translation="MKLNNQIEIPELGLGVFQIPNEETAEVVKNGIINGYRLIDTAKIY
FT                   ENEEGTGQGIKEGLTSTGLTREDLFVTSKLWGDNHSYKETIQSFEESLKKLDLDYLDLY
FT                   LIHWPGTNYAYKEAWKAMEDLYKAGKVKAIGVSNFQKHHLEELLSYAEIKPVLNQIELH
FT                   PKLSQKELREFLKLHDIKVQAWSPLMQGQLLDNEMLKKIADKHGKSVAQIILRWDIQQE
FT                   ILVNVKSIKSERMIANRQIFDFALDQEDMKALNSLNEALRVGPNPDTFNF"
FT   gene            346218..346565
FT                   /locus_tag="LACR_0379"
FT                   /note="LactoCOG number LaCOG00239"
FT   CDS_pept        346218..346565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0379"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71986"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Y6"
FT                   /protein_id="ABJ71986.1"
FT                   /translation="MKKIYNIGVEATMDVIGGKWKPIILCNLRHHPSRPGELRRLIPGI
FT                   SQKMLTQQLRELEIDNIIVRKVYNQVPPKVEYSLSPYGETLNGLLDILCSWGEGHVQTL
FT                   KSKGEEVQILE"
FT   gene            346609..347001
FT                   /locus_tag="LACR_0380"
FT                   /note="LactoCOG number LaCOG00240"
FT   CDS_pept        346609..347001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0380"
FT                   /product="Lactoylglutathione lyase related lyase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71987"
FT                   /db_xref="GOA:Q031Y5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Y5"
FT                   /protein_id="ABJ71987.1"
FT                   /translation="MYQPRFNKIHHIAIIADDYEKARHFYVDILGFSIIRENHRPEKED
FT                   VKLDLRLNDETELELFIKSGAPERLTYPEAKGYRHLALTTTNIEEDRNYLISQGVKVEE
FT                   IRQDEITDKKMLFFYDPDDLPIELHE"
FT   gene            346994..347065
FT                   /locus_tag="LACR_0381"
FT   CDS_pept        346994..347065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71988"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Y4"
FT                   /protein_id="ABJ71988.1"
FT                   /translation="MSNFLKKSDEGKIFIFADASVSK"
FT   gene            347180..347881
FT                   /locus_tag="LACR_0382"
FT                   /note="LactoCOG number LaCOG00241"
FT   CDS_pept        347180..347881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0382"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71989"
FT                   /db_xref="GOA:Q031Y3"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031Y3"
FT                   /protein_id="ABJ71989.1"
FT                   /translation="MPKLVFARHGESEWNLANLFTGWADVDLSENGTKQAIEAGKLIKE
FT                   AGIEFDIAYTSVLKRAIKTTNLALEFSDQLWVPVVKSWRLNERHYGGLTGLNKADAAAK
FT                   HGDEQVHIWRRSYDVLPPAMDHDDKYTAHGDRRYAGLEDSLIPDAENLKVTLERALPFW
FT                   EDQIAPALKEGKNVFVGAHGNSIRALVKQIKKLSDDEIMDVEIPNFPPLVFEFDDNLNV
FT                   QNEYYLAPKKA"
FT   gene            348059..348622
FT                   /locus_tag="LACR_0383"
FT                   /note="LactoCOG number LaCOG00242"
FT   CDS_pept        348059..348622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0383"
FT                   /product="Peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71990"
FT                   /db_xref="GOA:Q031Y2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Y2"
FT                   /protein_id="ABJ71990.1"
FT                   /translation="MSLVGKKIEEFSTDAYLGGKFIKVSDKDFYGKWNVLCFYPADFSF
FT                   VCPTELEDLEETYPELKKLGVEVYSASTDTHFVHAAWHDHSDAISKITYPMLADPSQKI
FT                   SRAFDVLDEEAGLAQRGTFIIDPDDVIQAFEITADGIGRDASQLIDKIKAAQYVRNHPG
FT                   EVCPAKWKEDGESLHVGIDLVGKI"
FT   gene            348688..350214
FT                   /locus_tag="LACR_0384"
FT                   /note="LactoCOG number LaCOG02417"
FT   CDS_pept        348688..350214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0384"
FT                   /product="Alkyl hydroperoxide reductase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71991"
FT                   /db_xref="GOA:Q031Y1"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Y1"
FT                   /protein_id="ABJ71991.1"
FT                   /translation="MILDENLRSQLLPYMDLLENPIILKVDANDSENGQKINEFTDELA
FT                   SLSDLISKEKTNLNHKPAFSIEREGVSGVAFSGLPLGHELNSLVLALVQVSGRPPRIEQ
FT                   ELIEQIKAIKTSLHFDTYVSLTCHNCPDVVQALNTMTILNPNISHTMIEGGMFQEEVEA
FT                   KGIMAVPAVFKNAEEFHSGRASLEELLEKITGPESSDSFAEKEPYDVLVVGGGPAGASA
FT                   AIYAARKGIRTGLIAERFGGQPLETLGIENLIGTPYIEGVQLGRQLEEHVKKYPVDLMN
FT                   LQKAVKLEKKDLIEVSLENGATLKSKAVILSTGARWRDLGIPGEQRFKNKGVAYCPHCD
FT                   GPLFSGKDVAVIGGGNSGIEAAIDLAGLVNHVTVLEFLPELKADKILQKKLASLTNVTV
FT                   LTNVETKEILGDEQVTGLNYQVRGSKETIHLELAGVFVLIGLVPNTQWLEGTIDLTDRH
FT                   EIVTDKVGATNIPGVFAAGDCTDTVYKQIIVSMGSGATASLGAFDYLIRN"
FT   gene            350409..352571
FT                   /locus_tag="LACR_0385"
FT                   /note="LactoCOG number LaCOG00243"
FT   CDS_pept        350409..352571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0385"
FT                   /product="cell elongation-specific peptidoglycan
FT                   D,D-transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71992"
FT                   /db_xref="GOA:Q031Y0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Y0"
FT                   /protein_id="ABJ71992.1"
FT                   /translation="MSVNKRKNDKRNKVDQSKKTNKETKVLKDPTKLIPKRINLLFFVI
FT                   FVLFMILIGKLFHMQVLNSHFYAEKSISAGGDQIIEGAPRGNIYDASGKALATTIPVQT
FT                   VEFTRSQNATADEMYQVANKLATILSNDIDVADLTTRDKKDYFLANAKNLEKIANKLTD
FT                   KEKKDKQGNDLTGSQIYEIELSKVKDSDLNFTAEQTFAAKLFKEMNSTSTFNTTKIATG
FT                   SITAEQQATIAEQEGDLPGITIGTSWDRSYAQNSLTPLMGTITSQKSGIPAEDLDAYLK
FT                   KGYQRNDRVGTGLLEKGYESELQGTHSISKVKFDKNGDVSGTKTIQKGKRGDDLKLTIN
FT                   LDFQNAVNDLVKTQLDQLIAQGYGQYNRGAYAVVLNVKTGAVLALSGYNRDPNTGVITD
FT                   NTLGTFQSVFTPGSVVKMGTLTAAWNAGVISGNDTLTAQSIQFKGSPPINDWWGDASPM
FT                   ALTAVEALQYSSNTYMMQLAMRMLGAPYTGAGQYLNDSNRVKVYEQLRSAFASYGLGTS
FT                   TGFDIPGESTGFIPSAKSKDASGVNVLYESFGQYDNYTPLQLAVYAATLGNNGTRLAPH
FT                   IVQGIYEGGNDGQPGTLIKNITPKIMDKVNITPDNMDVLHQGMYAVVHGAGGLTTGKPM
FT                   SAATVSISGKTGTSESTKILGDGSQVIVTANNAVAFAPSDNPEIAIGVVLPDNTESDAS
FT                   SGTKANQSIVTGITDLYYSNEAFRTN"
FT   gene            352701..353297
FT                   /locus_tag="LACR_0386"
FT                   /note="LactoCOG number LaCOG00244"
FT   CDS_pept        352701..353297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0386"
FT                   /product="DNA replication and repair protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71993"
FT                   /db_xref="GOA:Q031X9"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031X9"
FT                   /protein_id="ABJ71993.1"
FT                   /translation="MYYPEPIARLIESFSKLPGIGQKTATRLAFYTIGMEDQDVNEFAK
FT                   NLLSAKRDLRFCSICGNLTESDPCAICTDPTRDRTTILVVEESKDVLAMEKIREYRGLY
FT                   HVLHGTISPMNGISPDEINVKSLITRLMDSEVKEVIIATNATSDGEATAMYLARMIKPA
FT                   GIKVTRLAHGLAVGSDIEYADEVTLSKAVENRLEI"
FT   gene            353362..354465
FT                   /locus_tag="LACR_0387"
FT                   /note="LactoCOG number LaCOG00245"
FT   CDS_pept        353362..354465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0387"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71994"
FT                   /db_xref="GOA:Q031X8"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031X8"
FT                   /protein_id="ABJ71994.1"
FT                   /translation="MVSKKEATDKAVSKKGRNMSKETLILLYGGRSAEREVSVLSAESV
FT                   MRAVNYSRFIVKTYFITKGGEFIKTQEFTDTPAEEEKLLTNDLAESYPKISPAAIYEKD
FT                   AVVFPVLHGPMGEDGSIQGFLEILRLAYVGPNILSASSTMDKLLAKHVFEAVGVPQVPY
FT                   VAAFADENQAEIAQEVVEKLEFPVFVKPANMGSSVGISKVDDLADLQPALSEAYKYDNR
FT                   VVIEQGVDAREIECAVLGNNSDVSATLPGEVVKDVGFYDYNSKYIDNKIQMDIPAKVSA
FT                   DLAQKIQEYAKKAYKAVNGAGLSRCDFFVTKDGNVYLNEVNAIPGFTQWSMYPLLWENM
FT                   GLSYSDLIEKLVDLAKETFETRENHLL"
FT   gene            354729..356051
FT                   /locus_tag="LACR_0388"
FT                   /note="LactoCOG number LaCOG00246"
FT   CDS_pept        354729..356051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0388"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71995"
FT                   /db_xref="GOA:Q031X7"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q031X7"
FT                   /protein_id="ABJ71995.1"
FT                   /translation="MKLTIHEIAQVVGAKNDWSQLADLSVNKIEFDSRLIEKGDIFLPL
FT                   KGARDGHDFIEIAFDNGAIISFSEKEVEQAHLLVDDNLAAFQTLAKYYLEKTKVPVIAV
FT                   TGSNGKTTTKDMIAAVLSKKYKTYKTQGNHNNEIGLPYTILHMPEDTEKLVLEMGMDHP
FT                   GDIDFLSQLAQPELALITLIGEAHLEFMGSRENIAKGKMGITAGLHGELIAPADPIINA
FT                   FIPENQKISRFGLPGEDLFITKLIEHKERLTFETNFLDESITIPVPGKYNATNAMLAAY
FT                   VGLHYGLTEAEIKNALKEVELTRNRTEWNKSKNGADLLSDVYNANPTAMRLILETFQAI
FT                   PKNENGRKIAVLADMLELGPTAAQLHKEVLKSIDFTKIDKVYLYGEMMKNLADISTDKP
FT                   VSYFTDLDLLTESLSADLKPADQVLFKGSNSMKLSEVVEKL"
FT   gene            356220..357872
FT                   /locus_tag="LACR_0389"
FT                   /note="LactoCOG number LaCOG00248"
FT   CDS_pept        356220..357872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0389"
FT                   /product="ABC-type oligopeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71996"
FT                   /db_xref="GOA:Q031X6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q031X6"
FT                   /protein_id="ABJ71996.1"
FT                   /translation="MKQAKIIGLTTVIALSGIILVACGSKTSEQKNIQFSIPTDVASLD
FT                   TTILTDQYSYDVAGNVEEGLTRVDSKGNAALALAKSIDVSKDGLTYTVTLKDNLKWSNG
FT                   DILTAKDFVYSWKRAVDPKTGSEYAYLMGAVSGANDIISGKSSLDSLGIKAESDTEFTV
FT                   TLAQPTPYFKFLLSEPVYYPLDQKVVDKYGKQYGTSSDKTVYNGPFMFKSDKAWTGTNK
FT                   NFSIYANPNYYDKSAVKSKQIDFQVISNANTGAQLYKQGKLDFTLLSTTDLINANKKTE
FT                   GYTVFKQARTDYIEYNQSGKNASSPDAQKALANQDIRQALNLATNRAEVVKTALPGSTV
FT                   ATSFIPVGMSKTSTGEDFATYAKQDYSYDPTKAKELWANGLKELGLTKLSLSLEAAGDL
FT                   APSEATANFLQTAYQQNLPGLTVNLKLVPFKQRLNDAQNGNFDMVLSGWGGDYAEPSTF
FT                   LQLFTTGQSYNDGKFSSKTYDDAFKAATTTPDVLEPAKVDEHYKAAEAALYEGSYINPI
FT                   DFQANPALMNPKITGLEFHSTGLAYDLKSAYIK"
FT   gene            358182..359819
FT                   /locus_tag="LACR_0390"
FT                   /note="LactoCOG number LaCOG00248"
FT   CDS_pept        358182..359819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0390"
FT                   /product="ABC-type oligopeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71997"
FT                   /db_xref="GOA:Q031X5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q031X5"
FT                   /protein_id="ABJ71997.1"
FT                   /translation="MKTWKKVTLGTVALGSAALLAACGNSGSSSSSSSKDIQWNLTSPI
FT                   QTLDSSLATDTYSNIIIGNTNAGLTRVDKDGKAQPELAKSVDVSKDGLTYTFHLRDGLK
FT                   WSNGDALTAKDFVYSWQRAVDPATASEYGYLLGPVKNANEINGGKADKSTLGVKATDDK
FT                   TFVVTLAQPTPYFEFLTANSVYYPLNQKVVEKYGKQYGTSSEKMVYSGPYKFEKSKGWN
FT                   GSNQTFSIVKNDDYWDKSAVKTKEIDFQVVQDPKTSFNLYKQGKIVQASIGDPDLFKAN
FT                   KNNKDVVSLDEATTAYIQYNQSGKNKALANKNIREAFNLATDRQQYVDTVTPASNPATG
FT                   LTPAGMAKTNTGEDFAKYAAQPYKYDATAAKAAWAKGLSEIGETKLTLTLTTDDTSASK
FT                   DSATFLKQAWEKQLPGLTLNIKSVPFKQRLNDSTTGNFDMVISLWGGDYAEPSTFLDLF
FT                   VKDGPNNNGKINNVTYDKAIKAAEVTDALDPEKHFADYKAAEEALYTESNLNPLYFRTT
FT                   PVLRNPNLKDVRFGSTGLMYDFKTAYLK"
FT   gene            359898..360809
FT                   /locus_tag="LACR_0391"
FT                   /note="LactoCOG number LaCOG00249"
FT   CDS_pept        359898..360809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0391"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71998"
FT                   /db_xref="GOA:Q031X4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q031X4"
FT                   /protein_id="ABJ71998.1"
FT                   /translation="MVKYILKRLGLLLLTLFLIVTLTFFMMQVMPGTPFSNPKLTPDQL
FT                   EILKHAYGLDKPLWQQYFIYVGHMFTGNFGTSFVYTNQPVITMIAQRLPVSMQLGVQAL
FT                   ILGTVLGAFMGKASARRKNGLLDGIFGFVSVLGISVPSFVIGTLILLYLGFNLNLFPIS
FT                   GWGTFSQTIMPTIALSFAPMAVVTRFVRSEMIESLSSDYILLARAKGLSEKEVVNKHAL
FT                   RNSLIPMLTLIGPMAANLLTGSVLIEKIFSIPGIGSQFVDSIPAKDFPVIMATTIVYAV
FT                   ILMLFILVTDILTAIVDPRVRL"
FT   gene            360825..361856
FT                   /locus_tag="LACR_0392"
FT                   /note="LactoCOG number LaCOG00250"
FT   CDS_pept        360825..361856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0392"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ71999"
FT                   /db_xref="GOA:Q031X3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q031X3"
FT                   /protein_id="ABJ71999.1"
FT                   /translation="MENLNKDFTLVGSKGSDSTEKIAKPALSFFQDAWRRFKKNKVALV
FT                   AMWIIAITLVFSVISAFVVPQSKANYFNPNKSQVYGNLPPKLSGDLPFWNGEFKAPGST
FT                   ERTDVYKSQDVPSKDKYVFGTDKYGRSLAKRTVVGLRISLIIALAAALIDLVIGVTYGI
FT                   ISGWMGGKVDMVMQRIIEIIQSVPNLVVVTMLALLLGQGISSIIIAIGLFAWTGMARQV
FT                   RNMVLSYKERDFVLASKTLGQSTWKIAVKHLLPNVSGVIVVQIMFDIPSMIMYEAVLSA
FT                   INLGVKPPTSSLGTLINDGIASLQFYPFQLIIPAVVLSVLSLTFIFFGDGLRDAFDPRA
FT                   SED"
FT   gene            361859..362908
FT                   /locus_tag="LACR_0393"
FT                   /note="LactoCOG number LaCOG00251"
FT   CDS_pept        361859..362908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0393"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72000"
FT                   /db_xref="GOA:Q031X2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q031X2"
FT                   /protein_id="ABJ72000.1"
FT                   /translation="MAEEKVLEVKNLHVNFHTYAGDVKAIRDVSFDLEKGQTLAIVGES
FT                   GSGKSVTTKTLMGLNAKNAVIPQGELLFKGRNLLDLKEEEWQKIRGNEISMIFQDPMTS
FT                   LDPTMRIGKQIAEPLLKHNKGMSKADAMKRSLELMQQVGIPDAEVHINDYPHQWSGGMR
FT                   QRAVIAIALAADPEILIADEPTTALDVTIQAQIMHMMAELQERINSSIVFITHDLGVVA
FT                   GFAHKVAVMYAGEIVEYGTVEEIFYNPQHPYTWGLLDSMPTVDSSVDRLVSIPGTPPDL
FT                   LNPPKGDAFAARNKFALAIDFEEEPPYFEVSPTHFAKTWLLDPRAPKVTPSDNILARWK
FT                   RWEELKGDK"
FT   gene            362908..363846
FT                   /locus_tag="LACR_0394"
FT                   /note="LactoCOG number LaCOG00252"
FT   CDS_pept        362908..363846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0394"
FT                   /product="ABC-type oligopeptide transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72001"
FT                   /db_xref="GOA:Q031X1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q031X1"
FT                   /protein_id="ABJ72001.1"
FT                   /translation="MTEPKKVVEIKNLDLTFNKGKKGANKAINNVSLDIYEGETFGLVG
FT                   ESGSGKTTIGRAILKLYDNFITGGEILFEGKDVRNLKGSELREYRSEAQMIFQDPQASL
FT                   NGRMRVKDIVAEGLDANGLVKTKAERDARVLELLRLVGLNDDHLTRYPHEFSGGQRQRI
FT                   GIARALAVKPKFVVADEPISALDVSIQAQVVNLMRDIQAKENLTYLFIAHDLSMVKYIS
FT                   DRIGVMHWGKILEVGTSEQVYNHPIHPYTKSLLSSIPSPDPISERQRTPIVYDPTAELD
FT                   GQEREMREITPGHFVFSTEAEAEVYKKNATL"
FT   gene            364240..365811
FT                   /locus_tag="LACR_0395"
FT                   /note="LactoCOG number LaCOG00253"
FT   CDS_pept        364240..365811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0395"
FT                   /product="bacterial peptide chain release factor 3 (bRF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72002"
FT                   /db_xref="GOA:Q031X0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031X0"
FT                   /protein_id="ABJ72002.1"
FT                   /translation="MTLQEEIKKRRTFAIISHPDAGKTTITEQLLKFGGAIREAGTVKA
FT                   RKTGNFAKSDWMDIEKERGISVTSSVMQFDYAGKRVNILDTPGHEDFSEDTYRTLMAVD
FT                   AAVMVIDSAKGIEAQTKKLFQVVKRRGIPVFTFINKLDRDGREPLDLLSELEEILGIAS
FT                   VPMNWPIGMGKNFQGLYDFTHGRVEVYQPEDGKRFVEFDENGEVPTSHPLTKNPFFTQA
FT                   LEDAELLLDAGNQFSEDEVVAGQLTPVFFGSALTSFGVETFLETFLEYAPEPHSHKTVD
FT                   EEEIEPLNPDFSGFIFKIQANMDPRHRDRIAFVRIVSGEFERGMDVNLVRTGKKVKLSN
FT                   VTQFMAESRENVENAVAGDIIGVYDTGTYQVGDTLTTGKLKKSFEPLPTFTPELFMRVQ
FT                   AKNVMKQKSFQKGIDQLVQEGAIQLYKSYTTGDIMLGAVGQLQFEVFKDRMEREYNSET
FT                   IMTPMGSKTVRWIKEEDLDEKMSSSRNILARDRFDHPLFLFENEFAMRWFKDKYPDIEL
FT                   MEQFSV"
FT   gene            366134..367789
FT                   /locus_tag="LACR_0396"
FT                   /note="LactoCOG number LaCOG00254"
FT   CDS_pept        366134..367789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0396"
FT                   /product="Superfamily II DNA and RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72003"
FT                   /db_xref="GOA:Q031W9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030880"
FT                   /db_xref="UniProtKB/TrEMBL:Q031W9"
FT                   /protein_id="ABJ72003.1"
FT                   /translation="MKFSELGLSEGIVKTLTEIGYEQPTPIQEETIKLALEGRDVLGQA
FT                   QTGTGKTAAFGLPTIEKINAENPAIQALVIAPTRELAVQGQEELFRFGKSKGLKVRTVF
FT                   GGSSIEKQIKGLKAGAHIVVGTPGRLVDLIKRKAIKLDQLETLILDEADEMLNMGFLED
FT                   IHFIIEKTPENRQTLLFSATMPADIKKIGVKFMKNPEHIKIAAKEMTADRIDQYFVKTK
FT                   EFEKFDVLTRLLDVERPQLAIVFGRTKRRVDELIRGLKLRGYRAEGMHGDLDQNKRLAV
FT                   LRDFKAGHIDVLVATDVAARGLDVSGVTHVYNYDITQDQESYVHRIGRTGRAGKSGRSV
FT                   TFVSYNEMGYLRAIEKLTNKEMKGLKPPTKEEAYQASLSVAMDDVLRDLSDESGKAKLA
FT                   KFDKQAASLLEKFDAKELVALLLQGRVKDPDNQEEVKITAERPLPYNGEGKGFKKKGKG
FT                   GGGRYKGRGNGDRDGNRDGNRGGYRGNRDSKDGERGGDRKRNWKDRDDNRGGYRGKRDD
FT                   RRFDDRKQGEKTPRKRTTGTEKSAGFVMRSRGDK"
FT   gene            368487..369398
FT                   /locus_tag="LACR_0397"
FT                   /note="LactoCOG number LaCOG00255"
FT   CDS_pept        368487..369398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0397"
FT                   /product="GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72004"
FT                   /db_xref="GOA:Q031W8"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031W8"
FT                   /protein_id="ABJ72004.1"
FT                   /translation="MTNKKFKSGFVAILGRPNVGKSTFMNHVMGQKIAIMSDKPQTTRN
FT                   KIQGIYTTENEQIVFIDTPGIHKPHNALGDFMVQSAYSTLRECDVVLFMVAADEPRSTG
FT                   ENMIIERLKKAEVPVILVVNKIDKIHPDRLFEIVADYTSQMEFSEVVPISAKQGNNTER
FT                   LIDTLSEKLDEGPQYFPEDQITDHPERFLVSEMIREKILLLTREEVPHSIAVTTDQMTR
FT                   DEETGKIHIMATIIVERKSQKGIILGKGGDMIRKIGKMARRDIEIMLGDKVYLETWVKI
FT                   KNDWRDRKMDLADFGYNRDDYM"
FT   gene            369496..371088
FT                   /locus_tag="LACR_0398"
FT                   /note="LactoCOG number LaCOG00256"
FT   CDS_pept        369496..371088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0398"
FT                   /product="Asparagine synthase (glutamine-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72005"
FT                   /db_xref="GOA:Q031W7"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:Q031W7"
FT                   /protein_id="ABJ72005.1"
FT                   /translation="MCGFLFMETSDLTIEEFKSNLELIEHRGPDDQQHVRDTLGNDFGF
FT                   CRLSIMDLSDLGRQPFGLNGKRVMCNGEIYNFLSLRKFLETKGYKFTGDSDCEVLLPLF
FT                   ETTGIETMVKMLDAEFAFVLVDENTGEIFAARDPFGIRPLFYGYNKVTGKISFSSEAKA
FT                   LISTCKDVTPFPPGYYYTGGEFYVYNDIAEVSTIVEEPLAEISGHIRRKLERAVKKRLH
FT                   ADAPMGYLLSGGLDSSLVCAIAAKELESPIKTFAIGMETDPIDLKYAREVADFLRTDHT
FT                   EILMTKEDVLSAVREVIWHLETWDITTIRASIGMYLICKYIHENTELKVLMTGEVSDEM
FT                   FGYKYTDFAPSAGAFQKEAQKRVHELYMYDVLRADRCLAAHSLEARVPFADLDFATYVM
FT                   SINPSRKLNTYGKGKYLLRHAFEGTELLPDEILFREKAAFSDAVGHSMVDYLKEFADEK
FT                   YSDEDLAKASEKYPKHTPFTKESLMYREIFSEFYPGYEDWIIDFWMPNPDWVGADVKDP
FT                   SARVLSNYGDSGK"
FT   gene            371279..372097
FT                   /locus_tag="LACR_0399"
FT                   /note="LactoCOG number LaCOG00257"
FT   CDS_pept        371279..372097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0399"
FT                   /product="Formamidopyrimidine-DNA glycosylase /
FT                   DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="3.2.2.23"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72006"
FT                   /db_xref="GOA:Q031W6"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="PDB:4CIS"
FT                   /db_xref="UniProtKB/TrEMBL:Q031W6"
FT                   /protein_id="ABJ72006.1"
FT                   /translation="MPELPEVETVRRELEKRIVGQKIISIEATYPRMVLTGFEQLKKEL
FT                   TGKIIQGILRRGKYLIFEIGDDFRLISHLRMEGKYRLATLDAPREKHDHLTMKFSDGQL
FT                   IYADVRKFGTWELISTDQVIPYFLNKKIGPEPTYEDFDEKLFREKLRKSTKKIKPYLLE
FT                   QTLVAGLGNIYVDEVLWLAKIHPEKEANQLTESSIHLLHDSIIEILQKAIKLGGSSIRT
FT                   YSALGSTGKMQNELQVYGKTGEKCSRCGAEIQKIKVAGRGTHFCPVCQQK"
FT   gene            372250..373413
FT                   /locus_tag="LACR_0400"
FT                   /note="LactoCOG number LaCOG00258"
FT   CDS_pept        372250..373413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0400"
FT                   /product="RecA protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72007"
FT                   /db_xref="GOA:Q031W5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031W5"
FT                   /protein_id="ABJ72007.1"
FT                   /translation="MATKKKTNFDDITKKYGAERDKALADALALIEKDFGKGSLMRLGE
FT                   AANQKVSVVSSGSLALDIALGAGGYPKGRIVEIYGPESSGKTTVALHAVAAVQKEGGIA
FT                   AFIDAENALDPEYAKALGVNIDELLLSQPDYGEQGLQIAEKLITSGAVDLVVIDSVAAL
FT                   VPKAEIDGEIGDSSVGLQARMMSQAMRKLAGHINKTKTTAIFINQLREKVGVMFGSPET
FT                   TPGGRALKFYASVRLDVRGSTKIEEGSGDNKTQIGKITKIKVVKNKVAPPFKVALVDIM
FT                   FGEGISSTGELLNIAVEEGIIKKSGAWFAYNDEKIGQGAEKAKNYLKEHQDVFDEIDHK
FT                   VRAAHGLLDDSEVAETEEETTASKTKAKAKKEEKAVETEEIELELED"
FT   gene            complement(373428..374810)
FT                   /locus_tag="LACR_0401"
FT                   /note="LactoCOG number LaCOG00259"
FT   CDS_pept        complement(373428..374810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0401"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72008"
FT                   /db_xref="GOA:Q031W4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q031W4"
FT                   /protein_id="ABJ72008.1"
FT                   /translation="MNTNQNDENIEKQPSQRGLKNRHIQLIAIAGTIGTGLFLGAGKSI
FT                   HLTGPSIIFVYLIIGALMYILLRAIGEMLYQDPSQHSFLNFVSRYMGAKPGYFIQWSYL
FT                   LVVVFVAMAELIAIGTYINFWLPDLPIWMTEVFVLVLLTLLNTLNPKFFGETEFWFGMI
FT                   KIVAIIGLILTAIILIFSHYHTGTDTVSLTNITKGFEFFPNGVSSFFESFQMVMFAFVS
FT                   MEFIGMTAAETDNPRPTLKKAINQIPIRIVLFYIGALLAIMSIYQWRDIPADKSPFVTI
FT                   FQLIGIKWAAALVNFVVLTSAASALNSALFSITRNLYSLSQLNDDKILKPFTKFSKAGV
FT                   PVNALLFTSLLILFTPFISMIPAISNSFVFITSVATNLFLVVYLMTLITYLKYRKSKDF
FT                   DPSGFTLPAAHIFIPLAIAGFVLIFISLFCFKDTIIPAIGSVIWVLIFGLFTFFRKIKT
FT                   AD"
FT   gene            complement(374882..376261)
FT                   /locus_tag="LACR_0402"
FT                   /note="LactoCOG number LaCOG00259"
FT   CDS_pept        complement(374882..376261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0402"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72009"
FT                   /db_xref="GOA:Q031W3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q031W3"
FT                   /protein_id="ABJ72009.1"
FT                   /translation="MEDIQKNHEAQRGLQNRHIQLIAIAGTIGTGLFLGAGKTIQMTGP
FT                   SVIFAYILIGIAMFFFLRTIGEMLYNDPSQHSFLNFVTKYSGIRTGYFTQWSYWLVIIF
FT                   VCISELTAIGTYIQFWLPHLPLWLIEIVMLALLFGLNTLNSRFFGETEFWFAMIKVAAI
FT                   LGMIVTAIILVASNFHYTTVLSGKTVNDTASLNNIFDGFQLFPHGAWNFVGALQMVMFA
FT                   FTSMEFIGMTAAETVNPKKSLPKAINQIPVRILLFYVGALLAIMAIFNWHYIPADKSPF
FT                   VIVFQLIGIKWAAALINFVVLTSAASALNSSLFSATRNMYSLAKQHDKGRLTAFTKLSK
FT                   AGIPINALYMATALSLLAPVLTLIPQIKNAFNFAASCTTNLFLVVYFITLYTYWQYRKS
FT                   DDYNPNGFLTPKPAIAVPFIAIIFAIVFASLFFNADTFYPALGAIVWTLIFGLYSHFKK
FT                   I"
FT   gene            376408..376788
FT                   /locus_tag="LACR_0403"
FT                   /note="LactoCOG number LaCOG00260"
FT   CDS_pept        376408..376788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72010"
FT                   /db_xref="InterPro:IPR010368"
FT                   /db_xref="InterPro:IPR023378"
FT                   /db_xref="UniProtKB/TrEMBL:Q031W2"
FT                   /protein_id="ABJ72010.1"
FT                   /translation="MLIIDENLVEIDDLLEKIMDSFLEFPEIKLYQKAKADFMADETLQ
FT                   NQLKVLNDNSDYISFRPELKTLQHEINTNEKVYALRLAENDVQQILTDLTKKITKSISE
FT                   QIYVDENLPLKGGQHGRHHGKH"
FT   gene            376775..377086
FT                   /locus_tag="LACR_0404"
FT                   /note="LactoCOG number LaCOG00261"
FT   CDS_pept        376775..377086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72011"
FT                   /db_xref="GOA:Q031W1"
FT                   /db_xref="InterPro:IPR016979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031W1"
FT                   /protein_id="ABJ72011.1"
FT                   /translation="MENIEKKEIRPLYIRERVAVYVYCYSYKGTRQLSRFGDIVYSSQK
FT                   SHYSLLYVNNDEVADLLNKLKELRFVKKVRVGHIKELDQNFSEAFIQTNLEVKEELEH"
FT   gene            377104..377829
FT                   /locus_tag="LACR_0405"
FT                   /note="LactoCOG number LaCOG00262"
FT   CDS_pept        377104..377829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0405"
FT                   /product="Dithiol-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72012"
FT                   /db_xref="GOA:Q031W0"
FT                   /db_xref="UniProtKB/TrEMBL:Q031W0"
FT                   /protein_id="ABJ72012.1"
FT                   /translation="MCSLENKLVYCLSGQAFFDKIVKKERSLGRVVGLHIEVKEICEID
FT                   VFYKLLYISFSKNMKNRPEPRKKTMLETHYYFTPILDHLEEFDHNDWHLYPIVTLPAAK
FT                   QLRDEEDLPKTISSLNACYDRLQKVSLDYLTVNLYGRKQGRLFLLLLQDFLEETTILDY
FT                   TAQIRQQILQEIGVSTLNFLEYRSFAKKHLALILKDFRKNNFQTSPASLILTDKECLRV
FT                   ENCSHALLQQYLEQIEKTA"
FT   gene            complement(377893..378450)
FT                   /locus_tag="LACR_0406"
FT                   /note="LactoCOG number LaCOG00263"
FT   CDS_pept        complement(377893..378450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72013"
FT                   /db_xref="InterPro:IPR009195"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:Q031V9"
FT                   /protein_id="ABJ72013.1"
FT                   /translation="MSLAEYDQLKKLFTHVTPVRQTNHYLDSKDFKLRKKKLALRIRTF
FT                   DKSAEMTLKVPQEVGNIEYNIDLSLEEAQQLLGERNIVCGATDLSEICELLTARDINLE
FT                   EITLIGSLTTIRYEQHLPIGLAALDKNDYLGHTDYELELEVDDSKQGKKDFFDFLDKNR
FT                   VEYRFSKSKVVRFLDCLRHLRK"
FT   gene            378733..379512
FT                   /locus_tag="LACR_0407"
FT                   /note="LactoCOG number LaCOG02419"
FT   CDS_pept        378733..379512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0407"
FT                   /product="Uncharacterized integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72014"
FT                   /db_xref="GOA:Q031V8"
FT                   /db_xref="InterPro:IPR008535"
FT                   /db_xref="UniProtKB/TrEMBL:Q031V8"
FT                   /protein_id="ABJ72014.1"
FT                   /translation="MKDFWDFGLKQFRSAIFGITIILSLIVTTFIKIPHLARYDTLLIC
FT                   VLVIQVILLVSKYERVYDLIPIMVFHILGMILEIFKVRHGSWSYPDAGIFKIMDVPLYS
FT                   AFMYSAIGSYIVRAIKEFDLEVIHWPKWFISIGISSIIYLNFFSGTFGFDFRNLFYLFI
FT                   LIIFWKTKFTFVLRTKRYQMPAILSFFLIGLFIYFAENIGSYFSAWIYSYQLKAWKFVD
FT                   LGKISSWTLLIIVSIIIVIELQRYFSQKIKIKNIIND"
FT   gene            379679..380359
FT                   /locus_tag="LACR_0408"
FT                   /note="LactoCOG number LaCOG00264"
FT   CDS_pept        379679..380359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0408"
FT                   /product="Uncharacterized protein, containing RelA_SpoT
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72015"
FT                   /db_xref="GOA:Q031V7"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:Q031V7"
FT                   /protein_id="ABJ72015.1"
FT                   /translation="MLLQGEKMFNWEEFLDPYVQTVGELKIKFRGVRKQYLKKGLYSPI
FT                   EFVTGRVKRRESIRNKAKLRGYTRENLSEMEDIAGVRVMVQFVDDVWDVLELLRKRKDF
FT                   KIIEERDYINNQKASGYRSYHVIIEYPIDTIDGFQIVNAEIQIRTLAMNFWATIEHSLN
FT                   YKYGGLIPEDVKARLTNAAREAAQLDSEMGEIREDIQEAQLLFDSPQQKQDFKKENGEE
FT                   NELW"
FT   gene            380346..381158
FT                   /locus_tag="LACR_0409"
FT                   /note="LactoCOG number LaCOG00265"
FT   CDS_pept        380346..381158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0409"
FT                   /product="NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72016"
FT                   /db_xref="GOA:Q031V6"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031V6"
FT                   /protein_id="ABJ72016.1"
FT                   /translation="MNFGKKVWLIGNSSEKSKKILNKLSKILKAEHFVFDDINPEIVIS
FT                   VGGDGTLLRAMHMYEYQLDRVRFLGVHTGHLGFYTDFTDEDLFEVVEALYDENPAQAIH
FT                   YPLIRVQVSFTDGYQIVRHVLNEATIRRASKTMVGDVRISDYLFERFRGDGLSISTPTG
FT                   STAYNKSIGGAVVHPRVKAMQIAEIASLNNVVYRTLGSPMIVAEKDTITVCPAPEDDYS
FT                   LTFDQLTFEYKNIKSIEFSLDGTTISFANCAHTPFWERVSKSFIGEVE"
FT   gene            381158..382039
FT                   /locus_tag="LACR_0410"
FT                   /note="LactoCOG number LaCOG00266"
FT   CDS_pept        381158..382039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0410"
FT                   /product="Pseudouridylate synthase, 23S RNA-specific"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72017"
FT                   /db_xref="GOA:Q031V5"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q031V5"
FT                   /protein_id="ABJ72017.1"
FT                   /translation="MQFAFRNEIEGSMVKSMLGRQGISRRLLTKVKFDGGKIMVNGIEK
FT                   TAIYHLEKGDLVTITVPDEPDNEKLIPDDVPLNVLFEDDHYLVVEKPAGKASITGSLHP
FT                   TGAMSNAVKGYISRKNYPNQTVHIITRLDRDTSGIMFLAKHRYAHALMVQHKFRETLEK
FT                   RYYAIINDGDLPDSGQIDLPIGRRDDSIIERQVRFDEKSKNALTSYVVTERKNDLALLD
FT                   IILHTGRTHQIRVHFSHLGYPLVGDDLYGENHDLISRQALHCHHLQFLNPFTDEMVHVE
FT                   LDMPDDMKNLLK"
FT   gene            complement(382083..382916)
FT                   /locus_tag="LACR_0411"
FT                   /note="LactoCOG number LaCOG00267"
FT   CDS_pept        complement(382083..382916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0411"
FT                   /product="Peptidyl-prolyl cis-trans isomerase, cyclophilin
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72018"
FT                   /db_xref="GOA:Q031V4"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q031V4"
FT                   /protein_id="ABJ72018.1"
FT                   /translation="MNTNKKNNTILFTIFGIVLIVVVGLLVFFANRPKTDDSSASSTNT
FT                   SSSSQKVNYPTNYTLNAAVKNSSTALNDLTLPQLSTTVGEDEAEVQIKTSAGNINIKLF
FT                   PKLAPNAVQNFLVLAKNGYYKNNEFFRVIKDFMIQSGDPSNKGTGTASIFGGKTFDTEI
FT                   SNQLYNIRGALALANTGQASSSSSQFFIVQNPQDMTSQIQDKSKYPQKIIDAYKKGGYP
FT                   SLDGSYTVFGQVISGMDVVDKIAKADVKTNSSGESSAPIDPVKIKSVKILKDWKF"
FT   gene            383226..384659
FT                   /locus_tag="LACR_0412"
FT                   /note="LactoCOG number LaCOG02420"
FT   CDS_pept        383226..384659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0412"
FT                   /product="lysine:proton symporter, AAT family"
FT                   /note="TC 2.A.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72019"
FT                   /db_xref="GOA:Q031V3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q031V3"
FT                   /protein_id="ABJ72019.1"
FT                   /translation="MENQNQVKRNLKQRHITMIALGGTIGTGLLLTSGATISQAGPWGA
FT                   VLAYCFIGIMVYFVMTSLGEMATYLPTSGSFSDYGGRYVDPAFGFALGWNYWLNGAITI
FT                   AVDLTTAGLITQFWFPHLPSWIFSGIATVLIFIINVMAVGAFGETEYWLSTIKVITIIL
FT                   FLAIGLLTIFGVLGQGNVDVVANLTAGNHGFVGGISGFVGVLLIAGFSFQGTEMLGITA
FT                   GESEDPGKTIPKAMNSIFWRFLLFYIFSIIVIAAIINFKDPRLLNPSSTAVMSPFTIVF
FT                   KNIGFAVAASVMNAVILTSVISSANSVMYASTRILYSLGQEKGAPKFFGRTAKNGIPFY
FT                   ALLATTIICFIAFLTGIFGTQIYLFLVDLSSLTGFLAWLGISVSHIRFRRAYIAQGKKL
FT                   EDLPYKAKWFPFGPIVALLMTAAIAINLDPAMLFSEHWGEGLALYAAIPIFIVLYFGYK
FT                   WKYNTKIIPLEEVDLSREK"
FT   gene            384819..385622
FT                   /locus_tag="LACR_0413"
FT                   /note="LactoCOG number LaCOG00268"
FT   CDS_pept        384819..385622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0413"
FT                   /product="Predicted flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72020"
FT                   /db_xref="GOA:Q031V2"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q031V2"
FT                   /protein_id="ABJ72020.1"
FT                   /translation="MKFIAIVGTNASFSYNRKLLWYMKKHFKNQAQIDVVEITDVPLFS
FT                   EDTKVFPESVKKIALAIKDADGVIFSTPEYDHAITAALKSLVEWLSWGKNQPLNNRPVM
FT                   IVGASLGNMGTVFAQENLRQILSSPGLDAFVLPSNQFLLGRATEAFDHQDNLIDEHTIS
FT                   WLEHCFSNFMLYSKTIKPMRLEIQDEKEVEKKSKAKEEKQAAADDEDWWIEDTSLGFPL
FT                   LSDADTGATENEEVNEPEISAYTQFLEEDLWPDDIMDSKGTFENE"
FT   gene            385619..386596
FT                   /locus_tag="LACR_0414"
FT                   /note="LactoCOG number LaCOG00269"
FT   CDS_pept        385619..386596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0414"
FT                   /product="Membrane-associated lipoprotein for thiamine
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72021"
FT                   /db_xref="GOA:Q031V1"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:Q031V1"
FT                   /protein_id="ABJ72021.1"
FT                   /translation="MKSLEKKAANKITKSYRALGTVIDLTIYGCQDEGILDQSYQLIKY
FT                   YEDIFTVNREKSELMTVNQMAGIESVQVTEPVYQLTKISLEKSKEHFGFNAAIGPLVKL
FT                   WHIGFSDAKVPSQAEISEKLKLINPDEIVLKDEEFSIFLPKKGMEIDLGAIAKGYIADR
FT                   IKDFWRAYGVSSGIINLGGNLLLMGEAPHQTNKKWRVGVKNPLSSRKEPILQILTEESS
FT                   VVTSGIAERYLKVNNKSYHHIIDPETGYPHPNSLASVTVLSRKSIDGEIETSRLFFADG
FT                   PIENWLTEHPEVYGAIFISKNKKIKTVGIPKNQIYIADKSFEFE"
FT   gene            386720..387277
FT                   /locus_tag="LACR_0415"
FT                   /note="LactoCOG number LaCOG00084"
FT   CDS_pept        386720..387277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0415"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72022"
FT                   /db_xref="GOA:Q031V0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q031V0"
FT                   /protein_id="ABJ72022.1"
FT                   /translation="MVKYSIELKQRVIQDYLSGKGGSTYLANLHNVGSSSQVRRWIRNY
FT                   RAEGLPTAHSKVNKNYSMELKENAVQCYLTTDLTYEAVERKFEITNFTLLASWVNHFKI
FT                   YGEVPISKKRGWRKKLESIASSMTQNPNDSQRIKELEQELRYAQIEVAYLKGLRRLEKN
FT                   ALMNKNQDSSTVSVKPSNSKKS"
FT   gene            387274..388092
FT                   /locus_tag="LACR_0416"
FT                   /note="LactoCOG number LaCOG00270"
FT   CDS_pept        387274..388092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0416"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72023"
FT                   /db_xref="GOA:Q031U9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q031U9"
FT                   /protein_id="ABJ72023.1"
FT                   /translation="MKVTGFPKATYYYWVNCFERVNKDELIEKEMLKIRQEHANAGYRP
FT                   MSELLKQRGYHVNHKKVQRLMKKLGLRVTSYWHKSRKYNSYKGKVGTVAKNKLHRRFRT
FT                   SIPHQKITTDTTEFKYYEDGIQKKCYLNPYIDLFNSEVISYHISKHPSYQSIDIALNQA
FT                   LAVTSDCPYRRTFHSDQGWGYQMRDYVSKLKSHRIFQSMSRKGNCHDNSVMENFFGLLK
FT                   QEIYYGHIFSSFEELEQVIVIWIRYYNTKRIKQKLNWMSPIQFRLNYQNN"
FT   gene            complement(388168..389652)
FT                   /locus_tag="LACR_0417"
FT                   /note="LactoCOG number LaCOG00271"
FT   CDS_pept        complement(388168..389652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0417"
FT                   /product="Lysyl-tRNA synthetase (class II)"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72024"
FT                   /db_xref="GOA:Q031U8"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031U8"
FT                   /protein_id="ABJ72024.1"
FT                   /translation="MAEIEELNDQMKVRREKMGNLHDAGIDPFGHKFTRTHNSQELHEA
FT                   YDEKTKEELHELALSGIVAGRLMTKRGKGKVGFAHLQDREGQIQLYVRKDEVGEENYEI
FT                   FKKADLGDFLGVEGEIMKTDMGELSIKAKKLTFLSKALRPLPEKFHGLTDTETRYRKRY
FT                   LDLISNKESFNRFVTRSKIISEIRRYMDGRGYLEVETPVLNNEAGGASARPFYTHHNSL
FT                   DIDMALRIATELHLKRLIVGGMEKVYELGRVFRNEGMDMTHNPEFTTMESYEAYADFED
FT                   IMDLTEGIFQHVAKTVVGQDVLEYDGKEINVGGKFKRVHMVDAIKEVAGVDFWPEMTFE
FT                   EATALAKEHDIHVEKHFTSVGHIINEFFEKYVEETLIQPTFVFGHPKEISPLAKMNEKD
FT                   PRFTDRFELFINGKEYANAFSELNDPIDQLERFEAQAKAKELGDDEATGVDYDYVEALE
FT                   HGMPPTGGLGIGIDRLVMLFTGTTSIRDVLLFPTMK"
FT   gene            complement(389850..390669)
FT                   /pseudo
FT                   /locus_tag="LACR_0418"
FT   gene            390788..391828
FT                   /locus_tag="LACR_0419"
FT                   /note="LactoCOG number LaCOG00273"
FT   CDS_pept        390788..391828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0419"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72025"
FT                   /db_xref="GOA:Q031U7"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:Q031U7"
FT                   /protein_id="ABJ72025.1"
FT                   /translation="MLKLKNYIKNDRQAIMSILPGFLLSFAIAIVSYLLNRFIFHSLGS
FT                   ATIAILLGIILGNVYFKQVTLFAGTAWSEKKLLEFSVMFLGATVTFQTIGKLGFSGVGF
FT                   ILIQMISTIIFVLFMGKKLGFSANVSALMASGNAVCGSSAIAAVEPVIGAETSEKRTSI
FT                   AMVNLMGTILMLSLPFLGTWIFGNNDLLRGALIGGTEQSVGQVVASATMVNPNTTTLAT
FT                   LFKIMRIIMLVFVVLYFGFRSKKQTKGEQATAQIKIKRNSFLPWYVVGFLVLCTLDTLI
FT                   HFVPEVSATAKFLSGWCETIALAAIGLRLNLVEFIKAGRKLLIYSSSILVFQVVLAIIL
FT                   ISLLIK"
FT   gene            complement(391936..392010)
FT                   /locus_tag="LACR_0420"
FT   CDS_pept        complement(391936..392010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72026"
FT                   /db_xref="UniProtKB/TrEMBL:Q031U6"
FT                   /protein_id="ABJ72026.1"
FT                   /translation="MVALLFLVIASLWGLIWFNISESD"
FT   gene            complement(392046..392990)
FT                   /locus_tag="LACR_0421"
FT                   /note="LactoCOG number LaCOG00274"
FT   CDS_pept        complement(392046..392990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0421"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72027"
FT                   /db_xref="GOA:Q031U5"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q031U5"
FT                   /protein_id="ABJ72027.1"
FT                   /translation="MKITSRKVVVIGTGFVGTSIAYSMINQGLVNELVLIDVNQDKAEG
FT                   EALDLLDGISWAKENVIVRAGNYKDCENADIVVITAGVNQKPGQSRLDLVNTNAKIMRS
FT                   IVTQVMDSGFDGIFVIASNPVDILTYVAWETSGLDQSRIVGTGTTLDTTRFRKELATKL
FT                   EIDPRSVHGYIIGEHGDSEVAVWSHTTVGGKPILEFIVKNKKIGLEDLSNLSNKVKNAA
FT                   YEIIDKKQATYYGIGMSTARIVKAILNNEQVILPVSAYLRGEYGQEGVFTGVPSVVNQN
FT                   GVREIIELNMDAYEMKQFEKSVNQLKEVIESIK"
FT   gene            complement(393305..394126)
FT                   /locus_tag="LACR_0422"
FT                   /note="LactoCOG number LaCOG00272"
FT   CDS_pept        complement(393305..394126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0422"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72028"
FT                   /db_xref="GOA:Q031U4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q031U4"
FT                   /protein_id="ABJ72028.1"
FT                   /translation="MFSLFETFIVVYETKSFTLAGKYLFISQPTVTVRIKKLEEELKST
FT                   LFLRGKHQEIIPTEAAILFYPKAIAYLKKWEEDQAEVQKKSLAKHPFKIGVSHSAALSI
FT                   MPRIFKVFEEELEQLDVEINMYDSEKVFELVANHDLHFGIIERLLISDQTETFPLFLDE
FT                   LVLAGNTDSETFFTRESGSGIGYYIKRYLKSAPSSRRKIVRMNSNEMIISHIKSGLGSS
FT                   LISKSFLSDDIPYQELGSNYHREFLGVSFDEEKDPVIQKLINKIKKETEIR"
FT   gene            complement(394236..395126)
FT                   /locus_tag="LACR_0423"
FT                   /note="LactoCOG number LaCOG03011"
FT   CDS_pept        complement(394236..395126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0423"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72029"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q031U3"
FT                   /protein_id="ABJ72029.1"
FT                   /translation="MTYNSTLPKVFVYLLTTIETLYQTRVPLEVQNRKNVHLATSDCLV
FT                   IACYLWGVLHFSETLKAKHQLAQSLFPNFLEYSRFVRRCNALLPSIQVIRQALVFKEVE
FT                   GMSVSIIDSFPIPLCQPIRNFRSKVLGDYANVGCNATKGQYFYGCKCHALVSESGYVID
FT                   YTITPASMADSSMTEEVLSQFGTPTVLGDMGYLGQSLHDRLELEGIDLITPVRKNMKQK
FT                   KILFPNFSKRRKVIEQVFSFLTNLGAERCKSRSPQGFQLKLEMILLAYSLLLKSAKSLE
FT                   PETLRYSIGYQVMAK"
FT   gene            395420..396262
FT                   /locus_tag="LACR_0424"
FT                   /note="LactoCOG number LaCOG00275"
FT   CDS_pept        395420..396262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0424"
FT                   /product="Tellurite resistance protein related permease"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72030"
FT                   /db_xref="GOA:Q031U2"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:Q031U2"
FT                   /protein_id="ABJ72030.1"
FT                   /translation="MLGLFLMVLILLKIVLAMKHTISTLNDPIVASVSPTFTMSLMVLS
FT                   VFLQRLSGFSLLANVIWWTALVLHLILMMYFIYLHILPKELKIHDVYPSWFITFVGIGV
FT                   ISATSPDFGLEVGKVVVWITLLFYFILLPIVMHRVFILRKMHKSLLPLITIITAPGSLG
FT                   LVGYLTVVESKSKMFIIFLFILSQAIYFITLGLLTKLLRSAFYPSYAAFTFPLVISATA
FT                   VNLTSKLSIFQFLNLELLANLEIFIAIIIVTYVFIRYCIFWGSKLLQIISEKYSAESI"
FT   gene            396618..397836
FT                   /pseudo
FT                   /locus_tag="LACR_0425"
FT   gene            398051..399462
FT                   /pseudo
FT                   /locus_tag="LACR_0426"
FT   gene            399620..400225
FT                   /locus_tag="LACR_0427"
FT                   /note="LactoCOG number LaCOG00068"
FT   CDS_pept        399620..400225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0427"
FT                   /product="Acyl carrier protein phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72031"
FT                   /db_xref="GOA:Q031U1"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031U1"
FT                   /protein_id="ABJ72031.1"
FT                   /translation="MSKLLVVKGHPLTAEYSLSLKGLDAFVKSYKSAHPEDEIEELDVF
FT                   SADIPTLNTELVSAMFAGENAELTASQKDKLARFAGFTDQFLSADKVVIANPMYNLMIP
FT                   AELKSWVDTVNVAGKTFKYTAEGPVGLANGKKVLHLQANGGVYGAQDPATVYMSAIFNF
FT                   IGSDFRQIAVEGHAYDPEKTEELLAEFIKKVELEAQAF"
FT   gene            400323..400757
FT                   /locus_tag="LACR_0428"
FT                   /note="LactoCOG number LaCOG02421"
FT   CDS_pept        400323..400757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0428"
FT                   /product="Predicted redox protein, regulator of disulfide
FT                   bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72032"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019905"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q031U0"
FT                   /protein_id="ABJ72032.1"
FT                   /translation="MVKHLFNSHIDWVGGRNSIGDLQAGALNEKISIPETMAGPGVGTN
FT                   PDEMLLGAASTCYSITLAAMLERNEIPLEHLKVEGQGVVDVTKGIFTYEKITYHVFMKL
FT                   AAGADESKAIKLAERAESSCMISRAIQGNIELETIIKIEK"
FT   gene            complement(400813..402855)
FT                   /locus_tag="LACR_0429"
FT                   /note="LactoCOG number LaCOG00278"
FT   CDS_pept        complement(400813..402855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0429"
FT                   /product="sodium/proton antiporter, CPA1 family"
FT                   /note="TC 2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72033"
FT                   /db_xref="GOA:Q031T9"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:Q031T9"
FT                   /protein_id="ABJ72033.1"
FT                   /translation="MLHTIFYVIIFLLVLVFSNVLNKVFPKLALPLIQVVLGLILGFFG
FT                   ADEVLHVAPEFFLGFIIAPLLFRESEEADVKHILKHSKIILVLIFPLVFITTLGLGLIS
FT                   NWIYIGLPLAACFALGASLAPTDAVAVGALSKNFSFPRRVMSVLQGEGLLNDASGIISF
FT                   QIALVALVTGYFSFPDATMKLVISSIGGAAIGFSLIYIKGLVLRLLEDVDARDVSGYLL
FT                   LELVVPLAAFLISEELHVSGIIAAVVAGVMSANGLKRTTLFDAQVEKLKSTIWDTLTFI
FT                   LNSFVFLFLGIELYQLVVPLLVDPVYSSAHLILLTLALTAGLFALRFVVIAFYYWLRSL
FT                   KQKQPFSAYWNDILLLTFAGSKGTVSIATILLVPRSVDIQPVLVFLAAAVTGLSFLVGM
FT                   FILPFFAVKKVSKVNNISKIAILSEVVDELRQDMTTAKNPQGYDIAIDAYQERIQQLII
FT                   EQESTDMAIDYNDLQLLIIRIESEGLEAYLRENKISMYTYRTYQRYIRSLETSIVHSLV
FT                   SSIQFVYVITLRAFHLLVSRFLHVDFYFKKTKAAMETTRDEITELYFNNTELILQALDN
FT                   LNGVFDEQLLNFLQSERLRTSEIVASGGHISRMVNKAQPNNITEMMRAYYLERKVIFEH
FT                   ELSGAITAREAKDMRLNVNILEDYSLASNHHTLLFDFLERRKNKN"
FT   gene            complement(402945..403415)
FT                   /locus_tag="LACR_0430"
FT                   /note="LactoCOG number LaCOG02422"
FT   CDS_pept        complement(402945..403415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72034"
FT                   /db_xref="UniProtKB/TrEMBL:Q031T8"
FT                   /protein_id="ABJ72034.1"
FT                   /translation="MIDKKFEDKLKNLRELYIDKRPEMSQKLEDSKKFEAFMALSDEEK
FT                   EEKLHAKLEMLTDKLIKLDEKLGNALANEASANDISELKYYIDAVKNKKLILEQKLELI
FT                   KNGEFDIARKERVKRQLTDLELKRCKALLGKKDCSKINEKIALKKKAINRLK"
FT   gene            complement(403540..404799)
FT                   /locus_tag="LACR_0431"
FT                   /note="LactoCOG number LaCOG00279"
FT   CDS_pept        complement(403540..404799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0431"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72035"
FT                   /db_xref="GOA:Q031T7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031T7"
FT                   /protein_id="ABJ72035.1"
FT                   /translation="MNIFDELKARGLVFQTTDEAALSKALTEDMVSYYVGYDPTADSLH
FT                   LGNLVLILTMKRLQMAGHKPYALVGGATGLIGDPSFKDSERSLQTKDTVTKWSGKIRSQ
FT                   LERFLDFENGENKAEMTNNYNWFENLTFIDFLRDVGKHFTVNYMISKDSVKSRMESGIS
FT                   YTEFAYQIMQGYDFYELNQLHNVTLQLGGSDQWGNMTAGTELLRRKANKQGHVITIPLI
FT                   TDSTGKKFGKSEGNAIWLDADKTSPYEMYQFWLNVDDADAVKMLKIFTFLSLEEIAEIE
FT                   EQFEAARHERLAQKVLAREVVSLVHGKEAYEQAVKTSEILFGGGDLRQLDAKSILTGLK
FT                   AAPQHQIAPDEDLTLIELLISAGIAPSKRQAREDITNGAIYINGERVQELDYVLTDSDK
FT                   IENRLTVIRRGKKKNFVLTY"
FT   gene            404944..407382
FT                   /locus_tag="LACR_0432"
FT                   /note="LactoCOG number LaCOG00280"
FT   CDS_pept        404944..407382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0432"
FT                   /product="Membrane carboxypeptidase (penicillin-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72036"
FT                   /db_xref="GOA:Q031T6"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q031T6"
FT                   /protein_id="ABJ72036.1"
FT                   /translation="MKKDSIDSQEEIRARLKEKMDNKRRKQSNSSRKSPKKKNNDSDDR
FT                   SSLSITFKVLRGLSVVFGIVFVLVGVFGAATGVGYFARLVEQTKIPPKAEMLSKINDIH
FT                   GVSVINYSNGQPISDISSDLIRVTVKSDDISANVKNALIATEDDSFKTNKGVVPKAVIR
FT                   GIVGSIGGGTSSGGSTLTQQLIKQQVLGDSVTFQRKASEIVYALKLNNYLTKDQILTDY
FT                   LNVSPFGRNNKGQNIAGVQEAALGIFGKSAKDLTIPEAAFIAGLPQSPIVYSPYSADGS
FT                   LKSKENMSYGLERQKEVLFYLYRGGYISEADYKKYVAYDISKEFLQPGVAESQEHGYLY
FT                   NVVYNEAITDIYNYLIKRDKVSATDLGNDSTKKRYQELAEQSLQNGGYTVTTTVNQTVY
FT                   DAMQKAVTGYNGLMQDGTGTIQTGNVLMDNKTGAVYGFIGGLDFSQSQVNHAFDTKRSP
FT                   GSSIKPILAYGPAIDMGLMGSASVLSNYPAKYSSGQDIEHVGSTGTAMMPFSEALNVSY
FT                   NIPAYWTYQTILNKGKSVEPYMTKMGYDIADYSVESLPLGGGVDPTVVQHTNGYQTLAN
FT                   GGKYEPWYIVDSIKDDTGNVIYQHKSTGGTQVYSEATSTIMESMLQDAVKSQKTSKFYG
FT                   NLQTINPSLATNVQWAGKTGTTDDYTDVWMMLSTPSVTLGGWAGHDDNSPMTSKSGYIN
FT                   NAAYIAQLVNAINAADPNIFGPGQKFTDPNTDPNVTKSKVLVSTGEKPGKVIVKLANGK
FT                   TQEVNLGGETTTSFWATKAGAPTTTYDFSIGGSASDIAAGWKKILPSFNFSQTSSSKSN
FT                   "
FT   gene            complement(407421..408488)
FT                   /locus_tag="LACR_0433"
FT                   /note="LactoCOG number LaCOG00281"
FT   CDS_pept        complement(407421..408488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0433"
FT                   /product="glutamyl aminopeptidase, Metallo peptidase,
FT                   MEROPS family M42"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72037"
FT                   /db_xref="GOA:Q031T5"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR017538"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:Q031T5"
FT                   /protein_id="ABJ72037.1"
FT                   /translation="MELFDKVKALTEIQATSGFEGPVRDYLKARMVELGYQPEFDGLGG
FT                   IFVTKASKVENAPRIMVAAHMDEVGFMVSSIKADGTFRVVPLGGWNPLVVSGQRFTLFT
FT                   RTGKKIPVVTGGLPPHLLRGTGVTPQIPAISDIIFDGAFENAAEAAEFGIAQGDLIIPE
FT                   TETILSANGKNIISKAWDNRYGCLMILELLEFLADKELPVTLIIGANVQEEVGLRGAKV
FT                   STTKFNPDLFFAVDCSPASDTFGDDNGRLGEGTTLRFFDPGHIMLPGMKNFLLDTADHA
FT                   KVKTQVYMAKGGTDAGAAHLANGGVPSTTIGVVARYIHSHQTIFNLDDFLQAQTFLRAI
FT                   ITSLNTEKVAEIKNY"
FT   gene            408591..408875
FT                   /locus_tag="LACR_0434"
FT                   /note="LactoCOG number LaCOG02423"
FT   CDS_pept        408591..408875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72038"
FT                   /db_xref="UniProtKB/TrEMBL:Q031T4"
FT                   /protein_id="ABJ72038.1"
FT                   /translation="MKKILKFGLGIVAGAAVAHAAYHGYKNMEEEMIHELTDRVRQHFS
FT                   TKKIDAFWIFDEPTSGALFEGGIVSNDKSIAFEINAKTLEVFEKKEELL"
FT   gene            408920..409237
FT                   /locus_tag="LACR_0435"
FT                   /note="LactoCOG number LaCOG00282"
FT   CDS_pept        408920..409237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0435"
FT                   /product="Thiol-disulfide isomerase and thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72039"
FT                   /db_xref="GOA:Q031T3"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q031T3"
FT                   /protein_id="ABJ72039.1"
FT                   /translation="MIIPENIENLAELVKGPEKTVFFFTAGWCGDCNFIKPKMPEIETE
FT                   NPEFRFVEVDRDEYMDLAIEWGIMGIPSFVVIEDGQEKARLVNKLRKTKEEVNTFLASA
FT                   K"
FT   gene            409343..409969
FT                   /locus_tag="LACR_0436"
FT                   /note="LactoCOG number LaCOG00283"
FT   CDS_pept        409343..409969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0436"
FT                   /product="EMAP domain"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72040"
FT                   /db_xref="GOA:Q031T2"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027855"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR037154"
FT                   /db_xref="UniProtKB/TrEMBL:Q031T2"
FT                   /protein_id="ABJ72040.1"
FT                   /translation="MIATYNTNVGDVLMLITANDRGEKVNFERKGKVARIFIEETGATV
FT                   AWNIFEAKSLLTDLSGNGQVKLSSDDVEILNKELGKSGFSDVLVHDSQPKFVVAEIVEM
FT                   QDHPDSDHLHICKVNVGFADPVQIVCGAPNASLGLKTVAALPGAMMPNGALIFPGALRG
FT                   VQSYGMLCSARELELPDAPDVRGIIELSSALAAGTAFDSETMWQA"
FT   gene            410131..411471
FT                   /locus_tag="LACR_0437"
FT                   /note="LactoCOG number LaCOG00284"
FT   CDS_pept        410131..411471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0437"
FT                   /product="Uncharacterized NAD(FAD)-dependent dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72041"
FT                   /db_xref="GOA:Q031T1"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q031T1"
FT                   /protein_id="ABJ72041.1"
FT                   /translation="MKIVVIGTNHAGIATANTLLEQYPGHEIVMIDRNSNMSYLGCGTA
FT                   IWVGRQIEKPDELFYAKAEDFEAKGVKILTETEVSEIDFANMKVYAKTKSDDEIIEAYD
FT                   KLVLATGSRPIIPNLPGKDLKGIHFLKLFQEGQAIDAEFTKEKVKRIAVIGAGYIGTEI
FT                   AEAAKRRGKEVLLFDDENTSLASYYDEEFAKGMDENLAQHGIELHFGELAKEFKANEEG
FT                   YVSQIVTNKATYDVDLVINCIGFTANSALASDKLATFKNGAIKVDKHQQSSDPDVYAVG
FT                   DVATIYSNALQDFTYIALASSAVRSGIVAGHNIGGKELESVGVQGSNGISIFGYNMTST
FT                   GLSVKAAKKLGLEVSFSDFEDKQKAWFLHENNDIVKIRIVYETNSRRIIGAQLASKSEI
FT                   IAGNINMFSLAIQEKKTIDELALLDLFFLPHFNSPYNYMTVAALNAK"
FT   gene            411562..411951
FT                   /locus_tag="LACR_0438"
FT                   /note="LactoCOG number LaCOG00285"
FT   CDS_pept        411562..411951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0438"
FT                   /product="single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72042"
FT                   /db_xref="GOA:Q031T0"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q031T0"
FT                   /protein_id="ABJ72042.1"
FT                   /translation="MNKTMLIGHLTNAPEISKTTNNKSYVRVTLAVNRRFKNEKGEREA
FT                   DFISIILWGKSAETLVSYAKKGSLISVEGEIRTRNYTDKNEQKHCITEILGLSYDLLES
FT                   RATLALRESAVNFEELLLEADELPF"
FT   gene            412070..412354
FT                   /locus_tag="LACR_0439"
FT                   /note="LactoCOG number LaCOG00286"
FT   CDS_pept        412070..412354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0439"
FT                   /product="Co-chaperonin GroES (HSP10)"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72043"
FT                   /db_xref="GOA:Q031S9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031S9"
FT                   /protein_id="ABJ72043.1"
FT                   /translation="MLKPLENRVVLRVKEEEEKSMGGIVLTSASQEKPQTAEVIAVGEG
FT                   KTTNHGTLISPLVKVGDTVIFEKFSGTTVKMDGEEFLILKDSDLLAIVE"
FT   gene            412441..414069
FT                   /locus_tag="LACR_0440"
FT                   /note="LactoCOG number LaCOG00287"
FT   CDS_pept        412441..414069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0440"
FT                   /product="Chaperonin GroEL (HSP60 family)"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72044"
FT                   /db_xref="GOA:Q031S8"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031S8"
FT                   /protein_id="ABJ72044.1"
FT                   /translation="MSKEIKFSSDARTAMMRGIDILADTVKTTLGPKGRNVVLEKSYGS
FT                   PLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLK
FT                   NVTAGANPVGIRRGIELAAETAVASIKEMAIPVHDKSAIAQVATVSSRSEKVGEYISDA
FT                   MERVGSDGVITIEESKGMQTELDVVEGMQFDRGYLSQYMVSNTEKMVAELDNPYILITD
FT                   KKISNIQEILPLLEQILKTNRPLLIVADDVDGEALPTLVLNKIKGVFNVVAVKAPGFGD
FT                   RRKAQLEDLAILTGGTVITEELGLDLKDATLEALGQAAKATVDKDHTTIVEGAGSVDAI
FT                   SDRVAIIKAQIEKTTSDFDREKLQERLAKLAGGVAVVKVGAATETELKAMKLLIEDALN
FT                   ATRAAVEEGIVSGGGTALVNAIAALDKLSEEGDIQTGINIVRRALEEPVRQIAANAGYE
FT                   GSVIIDKLRSEKVGTGFNAATGQWVNMIEEGIVDPAKVTRSALQNAASVAGLILTTEAV
FT                   VANKPEPAAPAMPPMDPSMGMGGMM"
FT   gene            complement(414121..414933)
FT                   /locus_tag="LACR_0441"
FT                   /note="LactoCOG number LaCOG00288"
FT   CDS_pept        complement(414121..414933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0441"
FT                   /product="Metal-dependent hydrolase of the beta-lactamase
FT                   superfamily I"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72045"
FT                   /db_xref="GOA:Q031S7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q031S7"
FT                   /protein_id="ABJ72045.1"
FT                   /translation="MTEQNGFKYSILASGSTGNSFYLETPKKKILVDAGLSGKKIESLL
FT                   SEIDRDIHDIDALLITHEHSDHIKGIGVLARKYGINLYANEDTWSELDGKNALGKIPLE
FT                   QKHLFEMGKTMTFGDIDIESFGVSHDAIAPQFYRFMKDDKSFVMLTDTGYVSDRMRGTI
FT                   ENADAYLMESNHDIEILRMGAYPWRTKQRILSDQGHLSNEDGAEAAFNIHGNKTKKIFL
FT                   GHLSLNNNIKELAHLTMDGYLQQHDVDTKNELKILDTSHEHASPLYDI"
FT   gene            414935..415111
FT                   /locus_tag="LACR_0442"
FT   CDS_pept        414935..415111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72046"
FT                   /db_xref="UniProtKB/TrEMBL:Q031S6"
FT                   /protein_id="ABJ72046.1"
FT                   /translation="MTIVAEKVRDCYETYYFIGKKLSLKKFFFDEEVYVRNNRFFPKKE
FT                   FTDLTVNSFCSLN"
FT   gene            complement(415123..416550)
FT                   /locus_tag="LACR_0443"
FT                   /note="LactoCOG number LaCOG00289"
FT   CDS_pept        complement(415123..416550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0443"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72047"
FT                   /db_xref="GOA:Q031S5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q031S5"
FT                   /protein_id="ABJ72047.1"
FT                   /translation="MIKFFNSMIFKGVVAHLLLFVILFMSNFDYNLIHLSTFIGYYLFS
FT                   LVFVLVFLNQQHRMIVNVSKQMNDIKNGYLNRDKIPKGTSEINELYEEILKLGEDIVRT
FT                   QNNLENQRNQLDSILAYMVDGVIATDRRGNIIMANKSALHYLNTSNELLMEKNIVDVLK
FT                   IADQYNFYDLLEKEPEITIETHDAGNKSISLHIKFALFRRESGFISGIIAVLHDMTEQD
FT                   KAERERRLFVSNVSHELRTPLTSVKAYLEALEDGAIDDKETASSFIGVSLTETNRMIRM
FT                   ISDLLTLSRMDQDRIVLNKEIINLIAFLDYQINRLDQILETESNDLISSNFTLVRKYSD
FT                   KPIWVEIDTDKIAQVIDNIIGNAIKYSPKGGTITISIETRERDVLISIKDEGMGIPKSD
FT                   LLKIFDRFYRVDNASRNSKVGGTGLGLSIVHDIVKIHGGTIFASSEGEGKGTTFSFTLP
FT                   YSSETAEYWDDAADDFE"
FT   gene            complement(416543..417244)
FT                   /locus_tag="LACR_0444"
FT                   /note="LactoCOG number LaCOG00290"
FT   CDS_pept        complement(416543..417244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0444"
FT                   /product="DNA-binding response regulator, OmpR family
FT                   (Rec-wHTH domains)"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72048"
FT                   /db_xref="GOA:Q031S4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q031S4"
FT                   /protein_id="ABJ72048.1"
FT                   /translation="MKKILVVDDEKPISDIVKFNLTKEGFEVFTAFDGEEALEAFKEVQ
FT                   PDLILLDLMLPKLDGLDVAREIRKTSDTPIIMVSAKDSEFDKVIGLELGADDYVTKPFS
FT                   NRELLARIKANLRRINVAPAESTDNVKKELIIGNLRINPAHYAAYKNDKQLDLTHREFE
FT                   LLYYLAQHLGEVITRENLLETVWGYDYFGDVRTVDVTVRRLREKVEDTPSRPQYVSTRR
FT                   GVGYYMSNPHD"
FT   gene            417422..418057
FT                   /locus_tag="LACR_0445"
FT                   /note="LactoCOG number LaCOG00291"
FT   CDS_pept        417422..418057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0445"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72049"
FT                   /db_xref="GOA:Q031S3"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031S3"
FT                   /protein_id="ABJ72049.1"
FT                   /translation="MNGILISLEGPDGAGKTTVLQEILPEIQKMKREVVPTREPGGVRV
FT                   AEEIRQIILDPKNTEIDSKTELMLFEAARRLHMQEKMLPALRAGKVVIVDRFIDSSVAY
FT                   QGYGRDLGVEVVDWLNYFATDGLKPDLTLYFDIDTDVALERIMKNRADEVNRLDLERAE
FT                   MHRKVREGYLEIVAKEPERFVKIDASQSLEKVVADTLEVLKKRFVSEF"
FT   gene            418190..419050
FT                   /locus_tag="LACR_0446"
FT                   /note="LactoCOG number LaCOG00292"
FT   CDS_pept        418190..419050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0446"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72050"
FT                   /db_xref="GOA:Q031S2"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q031S2"
FT                   /protein_id="ABJ72050.1"
FT                   /translation="MEIVDIQPQLYKQFSTILQHGKLSHAYLFSGGFGSFELAIWLSQA
FT                   LFCENPENSLPCGHCRSCRLVAQQEFADLHIVEPDGQTIKTAQIRDLTQVFSESGYEGK
FT                   QQVLLFREAEKMHPNAANALLKSIEEPETEIVVFLLTDNENMILQTIKSRTQIINFRKN
FT                   VQFLQDFLEKNGILKTQAELLAEICNSTDRALELAQQSWFNEGLQRIQHFVKLLKKSAD
FT                   EAFLYLKDLVEIFDDKEKQNQAFELLLQLFNQERMSQELLKTFQAIKMWKSNVRFESSL
FT                   TFIVL"
FT   gene            419100..419882
FT                   /locus_tag="LACR_0447"
FT                   /note="LactoCOG number LaCOG00293"
FT   CDS_pept        419100..419882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0447"
FT                   /product="Regulator of signaling phosphorelay (PSP1/tpl
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72051"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:Q031S1"
FT                   /protein_id="ABJ72051.1"
FT                   /translation="MIYEIKFTHGESNIFATSEAELVPQSEVIIRSEKGTFYGKIIRSF
FT                   SDDANLETHHTIEREVTDEDLEVILKLEELSKKAKDKVRQLVVEQELEMKIIDVAYTFD
FT                   QMQLFISFTAENRVDFRLLLRELATTFRIRIELRQIGPRDAAKIHGGLGPCGRPLCCSE
FT                   FVYEFPNVSIKMAKNQNLSLKQNKLNGLCGRLMCCLTYEDSFYKEAQQLFPDFGEFVTT
FT                   SEGKGKVVGLNVLKNRVKIRFGEYSKDFELAEIEVNHG"
FT   gene            419875..420201
FT                   /locus_tag="LACR_0448"
FT                   /note="LactoCOG number LaCOG00294"
FT   CDS_pept        419875..420201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0448"
FT                   /product="Regulator of replication initiation timing"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72052"
FT                   /db_xref="GOA:Q031S0"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031S0"
FT                   /protein_id="ABJ72052.1"
FT                   /translation="MADKYDVFDQLGELENTLNTTLTQISGIRQVLEASMTENATLRME
FT                   LEKLRDRLAEFEKKEVKKETPKDQPNPNLIQIFNEGFHVCHLHYAERLAEGESCLDCLE
FT                   LLYR"
FT   gene            420201..421076
FT                   /locus_tag="LACR_0449"
FT                   /note="LactoCOG number LaCOG00295"
FT   CDS_pept        420201..421076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0449"
FT                   /product="Predicted methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72053"
FT                   /db_xref="GOA:Q031R9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q031R9"
FT                   /protein_id="ABJ72053.1"
FT                   /translation="MENKFNIQRSFKGVKTAGSLYLVPTPIGNMQDMTLRSLETLKTVD
FT                   LICSEDTRNTLRLLNHFEIKVPQESFHEHNSQEKIPKLIDFLKSGQSIAQVSDAGMPSI
FT                   SDPGHDLVLAAIKEEIDVVALPGASAGITALIASGLVPQPHIFYGFLPRKKGEQQKFLK
FT                   TKLAYPETQIFYESPFRVADTLSNMQEIYGDREVVLVRELTKIYEEYRRGKISEVLNSL
FT                   VEQPIKGECLIIVSGADELVQEIQEPELTALEAVKNLVAQNVKPNVAIKEISKERGLNR
FT                   QDLYAEFHDL"
FT   gene            complement(421154..421345)
FT                   /locus_tag="LACR_0450"
FT                   /note="LactoCOG number LaCOG02424"
FT   CDS_pept        complement(421154..421345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72054"
FT                   /db_xref="UniProtKB/TrEMBL:Q031R8"
FT                   /protein_id="ABJ72054.1"
FT                   /translation="MENQYEILQSLIEKMEIVTVGSAVSKTHLNRKEIIDFVRSQKSLR
FT                   IFDEEKQKWINENVDGHC"
FT   gene            complement(421420..422229)
FT                   /locus_tag="LACR_0451"
FT                   /note="LactoCOG number LaCOG00350"
FT   CDS_pept        complement(421420..422229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0451"
FT                   /product="ABC-type multidrug transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72055"
FT                   /db_xref="GOA:Q031R7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q031R7"
FT                   /protein_id="ABJ72055.1"
FT                   /translation="MDTTVINKNTTTMKTISLKSWLTDIIVMAKRELLKVKHSPEKLFD
FT                   VTVMPIIMIIVFSQLFGGAIMGNVKAYLPFFVPGILIQTLVMASGAAGTQLREDLDKGA
FT                   TDRFNSLPISQIAPLAGTLISDIIRYIIAAVFALGTGAALGWRASAGFGWLLVAIGLAI
FT                   VTTWALSWLFALVGVLAKSAATVTTISSFLTMFLAFLSNAYIPVTSLPKWLKVIAENNP
FT                   VSHLITAFKEVAYNGNFGHEAWLVLLISLLIVLILAPVTVLAYSKKN"
FT   gene            complement(422242..423171)
FT                   /locus_tag="LACR_0452"
FT                   /note="LactoCOG number LaCOG01832"
FT   CDS_pept        complement(422242..423171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0452"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72056"
FT                   /db_xref="GOA:Q031R6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q031R6"
FT                   /protein_id="ABJ72056.1"
FT                   /translation="MALAISTTNLVKNFDGKNAVNGISLDVHQGEIFGILGPNGAGKTT
FT                   FLRMLATLTKVTSGSASIFGNDLTKDGAKVRNFIGLTGQYASVDEELTGMENMIIFGQL
FT                   NGLSKKEAQKRGLELLKQFSLTEAKDKSISAFSGGMRRRLDLAVSLITKPPLIFLDEPT
FT                   TGLDPRTRGEMWKTIRELVKGGSTIVLTTQYLDEADQLADRIAIIDHGSVIAQGTPSEL
FT                   KNILGETTFELSLIKSSQIKQAKEMIEQKFNIEVIVLPEFATLSIKVTDTKIMTQILLL
FT                   LETEHIAINEFETRKPTLDEVFLELTGK"
FT   gene            423303..423803
FT                   /locus_tag="LACR_0453"
FT                   /note="LactoCOG number LaCOG01833"
FT   CDS_pept        423303..423803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0453"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72057"
FT                   /db_xref="GOA:Q031R5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q031R5"
FT                   /protein_id="ABJ72057.1"
FT                   /translation="MTKKKENTSQGFIRYVTLLFWYLRKIKSVTRKQTVEYSRLQGQGQ
FT                   ILNILMENSKMTQKNLVAQLDMRPQSASEMIKKLEKKQFISRQKDAQDKRGFIISLTEK
FT                   GKAVLEESAEQTELVPGIMTSFTEEEKIEFARLIGKLQSELDEKISHEDDRIKEQYNRI
FT                   AGN"
FT   gene            complement(423934..424866)
FT                   /locus_tag="LACR_0454"
FT                   /note="LactoCOG number LaCOG00296"
FT   CDS_pept        complement(423934..424866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0454"
FT                   /product="mevalonate kinase"
FT                   /EC_number="2.7.1.36"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72058"
FT                   /db_xref="GOA:Q031R4"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:Q031R4"
FT                   /protein_id="ABJ72058.1"
FT                   /translation="MTINKMGTGIAHSKLILIGEHSVVYGQPAIALPVTILKTTVTITS
FT                   SKYGQYIENNEFRRRLDLMGDEFEGIRQLIMRLLDKFHSSKMPFSLEIDSNIPQGRGLG
FT                   ASASLATAIIRAFYDFFDAELPQKDLLFYANFSENITHGKSSGIDVATVNSEHPLWFIK
FT                   DSTIEPFELNLHGFIVIGDTGVHGFTSQAINIVREKLVEENEKTQNSINDLGQLATDSK
FT                   AFLMTDKLKEFGHVMNKAHERLSELGVSHPRLDNLVDTARKNGALGAKLTGSGLGGVMV
FT                   ALAENEKDAIRISQRLLKNGAKNTWIYSF"
FT   gene            425176..426132
FT                   /locus_tag="LACR_0455"
FT                   /note="LactoCOG number LaCOG00297"
FT   CDS_pept        425176..426132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0455"
FT                   /product="diphosphomevalonate decarboxylase"
FT                   /EC_number="4.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72059"
FT                   /db_xref="GOA:Q031R3"
FT                   /db_xref="InterPro:IPR005935"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR029765"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="InterPro:IPR041431"
FT                   /db_xref="UniProtKB/TrEMBL:Q031R3"
FT                   /protein_id="ABJ72059.1"
FT                   /translation="MKNIVTARAHTNIALIKYWGKTDIALNIPATSSLSMTLEPFYTTT
FT                   SVEFTDNESDSLILNSAMEDSSRVSKFLEMMRGQYGNFPKVMIQSENHVPTAAGLASSA
FT                   SSFAALTAAMFGLLDLEKDDSEMSRIARRGSGSASRSIFGNFAVWNKGENHQSSFAESF
FT                   YNKDIGLSMIVAEISSEKKKMSSTKGMQLAQTAPTYGAWVEKSAIQLAEMKQAILQADI
FT                   EKVGLIAQDNALGMHEQNRLCLEPFDYFTSETQRVVDFTKECYKAGLLAFVTIDAGPNV
FT                   KIITDHATEKILLTKLKAEFPELTFDIARAGGAYEYL"
FT   gene            426119..427108
FT                   /locus_tag="LACR_0456"
FT                   /note="LactoCOG number LaCOG00298"
FT   CDS_pept        426119..427108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0456"
FT                   /product="phosphomevalonate kinase"
FT                   /EC_number="2.7.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72060"
FT                   /db_xref="GOA:Q031R2"
FT                   /db_xref="InterPro:IPR005917"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR035102"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:Q031R2"
FT                   /protein_id="ABJ72060.1"
FT                   /translation="MSISDKKIKTKIPGKLFFAGEYAVTKEGNLALITTIETNFEMSIS
FT                   RASDKSILKTNVGLADFEFSLSKIEFDKESPWNFALTALKNTLSAADSSKKESVSKISE
FT                   LSVEICLEIRSDLGFGENKKGYGSSASVVCGVVNAVNQFFDLQLSLEKRFEIAAKTHFE
FT                   VQGSGSMGDIAAIMYGGSVFYQNHNRILPLEIPWKTYVVQTGKAAKTAEKIKIKLSDEF
FT                   YQTSNELVIEMATAIDIQDFSLFKEKLSENQLLLLENIPEGYMTKELALALNLLNSYPE
FT                   LAAKISGAGFGENLILFAQNSMAIAEVQKKLYEYGINLEEFKIAQKNN"
FT   gene            427231..428280
FT                   /locus_tag="LACR_0457"
FT                   /note="LactoCOG number LaCOG00299"
FT   CDS_pept        427231..428280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0457"
FT                   /product="isopentenyl-diphosphate delta-isomerase"
FT                   /EC_number="5.3.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72061"
FT                   /db_xref="GOA:Q031R1"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q031R1"
FT                   /protein_id="ABJ72061.1"
FT                   /translation="MMKSEKEIHQHRKDEHLSLAYKYWKEERNQTLGLTFSDVRIIPNT
FT                   LPELSTEKVELSSKVFGQDFEFPFYIEAMTGGGERADKINQTLAEIAKNQHLAMAVGSQ
FT                   SIALKFPELAAGFKEVRKIHSSGFLFANLGAGHSLENAKRAVEMIEANALEIHVNTAQE
FT                   LPMDEGDREFYWLENINEIASQLEVPVIVKEVGFGISQKTFKELAKTAVSGINVGGAGG
FT                   TNFAWIERKRSKNGFDLDDFGFSTLESLLEAKTAENTKSLVATGGISSAQDIFKSLILG
FT                   ADLASSAGFILKNLMQTGPEKVEEILEQWKQDLNKLFVLTGSKNIAESHNVDLLYSAKM
FT                   LDFIQQRKK"
FT   gene            428434..429054
FT                   /locus_tag="LACR_0458"
FT                   /note="LactoCOG number LaCOG00300"
FT   CDS_pept        428434..429054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0458"
FT                   /product="Superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72062"
FT                   /db_xref="GOA:Q031R0"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:Q031R0"
FT                   /protein_id="ABJ72062.1"
FT                   /translation="MAFTLPELPYAPNALEPFFDEATMRLHHGKHHQTYVNNLNAAIEK
FT                   HNELDDLNLEELLTDLSAIPEDIRTAVRNNGGGHLNHSQFWLWLRPNTDGSENHADGEI
FT                   GDAIAKEFGSFETFKTEFKAAATGRFGSGWAWLVVDEAGKLKVVSTANQDNPISEGLTP
FT                   VLGLDVWEHAYYLKYHNVRPDYIEAFFNLVNWDKVNELYAKAK"
FT   gene            429305..431659
FT                   /locus_tag="LACR_0459"
FT                   /note="LactoCOG number LaCOG02425"
FT   CDS_pept        429305..431659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0459"
FT                   /product="Carbon starvation protein, predicted membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72063"
FT                   /db_xref="GOA:Q031Q9"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Q9"
FT                   /protein_id="ABJ72063.1"
FT                   /translation="MKDDGNSSNFTDEEELFLLRNKEGKIVGIKDLKQANFQETMKDWK
FT                   EHLPKPSLLSIIIWVAVALLGGLAWSLIALAQGETINAIWFVIAAVCSYLIGYRFYALY
FT                   IQRKIMRPNDLRATPSEAHNDGKEFNPTNRVVLFGHHFASIAGAGPLVGPVLAAQMGYL
FT                   PGTIWIIFGVIFAGGVQDMLVLWYSHRRRAKSIGAMAHDEVGRFAGGLTSFIVFIMTMI
FT                   VLAVLALICVTAMENSAWAVFSIGMTIPIALLMGIYLKYIRPGHVNEISAIGFILLLVA
FT                   IFGGRWVSESSFAHIFMLSPTALVWWVMGYTFIAAIIPAWILLTPRDYLSMFMKIGTIA
FT                   ILAIAVVGVRPDVTIPALTNFAHNTDGPAFAGSLFPFLFVTIACGALSGFHVMMSSGTT
FT                   PHLIAKESQTRMIGYGGMLFESFVAIMALVAAISLNPGIYYSMNTPQASIQKLAASSYQ
FT                   ADKSAEYNASKAIPNVAMMPDGSKLSIDWEGTTGEKALQQVAKDVGEKSIVSRTGGAPT
FT                   LAVSMSNILHKVPVIGGTNMMGFWYHFAIMFEALFILSAVSAATKSTRYLLNDALRGFK
FT                   KLGRLGDDDWLPSKIVTTAVIVGVWGALLLMGVSDPNGGIKIMYPLFGISNQLIAAVAL
FT                   AIVCVMVIRKGYLKWVWIPAIPLVWDVCVTFAASWQKIFSTDVNIGYFASYSAAKSQVD
FT                   SGKLTGLLLTNAQATMRNTMIQGILSVIFLLCVAILLAICAVKVVKILQTNKVGDKFSS
FT                   EEAFEESNLFETSSLWPSHLEHKVLKSKVKN"
FT   gene            complement(431840..432541)
FT                   /locus_tag="LACR_0460"
FT                   /note="LactoCOG number LaCOG01544"
FT   CDS_pept        complement(431840..432541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0460"
FT                   /product="Acyl carrier protein phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72064"
FT                   /db_xref="GOA:Q031Q8"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Q8"
FT                   /protein_id="ABJ72064.1"
FT                   /translation="MLYNYFIKRNEELSLKTLLINAHPDFNNFNHFSNQLQELFLANYK
FT                   SQFSEDDLTIFNLYDLDGNLPRIEQNQLLKIWDKKAADKKLSADELNIAQTSERLLKEF
FT                   KEHHRLVIVTPLHNFNITSRLKVYIDNILIARETFKYLDFPDEKGKVSTGLMTDDYRAL
FT                   LLFASGSVYSENNFYQDLDFAPQYLKMIFSEIMGFDTFEIVRAEGTATLAKNKILDKAK
FT                   ENLDKALKNFY"
FT   gene            432586..433523
FT                   /pseudo
FT                   /locus_tag="LACR_0461"
FT   gene            433672..435012
FT                   /locus_tag="LACR_0462"
FT                   /note="LactoCOG number LaCOG00301"
FT   CDS_pept        433672..435012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0462"
FT                   /product="Superfamily II DNA and RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72065"
FT                   /db_xref="GOA:Q031Q7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030881"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Q7"
FT                   /protein_id="ABJ72065.1"
FT                   /translation="MKFTDFNFKDYINQTLENIKFEKPTEVQQKLIPIVLSGRDLVGES
FT                   KTGSGKTHTFLLPIFQNINPELDEVQAVITAPSRELATQIYKAAQEFVKVNGKIRVSNF
FT                   VGGTDKARQIKKLEAAQPHIVIGTPGRIHDLVKSNALVVHTARTFVVDEADMTLDMGFL
FT                   ADVDQIASSFGKRVQMLVFSATIPQKLQPFLKKYLHNPVMEKIANKTVISDTIENWLVS
FT                   TKGSSHNQLLLQLTKALNPYMAMIFANTKGRVDDIHHFLTSNGLKVAKIHGDVPPRERK
FT                   RIMNSIKNLDYQYVVATDIAARGIDIEGVSHIINDEIPKDLTFFVHRVGRSGRNGLRGT
FT                   AITLYSPSDDSSIREIEKMGVTFQPKAVKDGEIVDSYDRDRREKRTKKQDEISLATRGA
FT                   LAKGKKKVKPGYKRAIKWQIEEENKKNRRAERNKNARKTRDSRKQSF"
FT   gene            435063..435599
FT                   /locus_tag="LACR_0463"
FT                   /note="LactoCOG number LaCOG02426"
FT   CDS_pept        435063..435599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72066"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Q6"
FT                   /protein_id="ABJ72066.1"
FT                   /translation="MILLVCLGLIFSKSNDRTADKARDIDTILVLGSRINADEQPAKIT
FT                   QERLDAALLLAAKNPQAKIIVSGAKGADEPVSEAFSMKKYLMAHAISADRIISENKATD
FT                   TAENLSYSKKYFHGKTVVVTNDFHLYRALYLASRQGLKVEGYAAKTEVTNPLYYPNYYG
FT                   HEVLGLIYAFVFGTG"
FT   gene            435715..436461
FT                   /locus_tag="LACR_0464"
FT                   /note="LactoCOG number LaCOG00302"
FT   CDS_pept        435715..436461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0464"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72067"
FT                   /db_xref="GOA:Q031Q5"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Q5"
FT                   /protein_id="ABJ72067.1"
FT                   /translation="MIFLPEQISKLNELETLVFDFIIKSPEEVQQMTIRDLASQVHVST
FT                   STIVRLCTKLGFEGWADLKFYLKNQLKEKTPEEQHYDNMLEFNMFLRRMNTDNYQAKLN
FT                   NAAQMIAKADYTVFLGLGTSGSLSEYATKYFVNTGLRSFVISDPFQAVQVQGMGNVVAV
FT                   IMSVSGETEQVVNKELEFKSGGAKIISITNNEDCTVARLADHQLSYNLVNEWSKQYPLG
FT                   NLTTQLPVLAILEILAHKSIDYLVKK"
FT   gene            436704..437030
FT                   /locus_tag="LACR_0465"
FT                   /note="LactoCOG number LaCOG00303"
FT   CDS_pept        436704..437030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0465"
FT                   /product="PTS system cellobiose-specific IIB component, Lac
FT                   family"
FT                   /note="TC 4.A.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72068"
FT                   /db_xref="GOA:Q031Q4"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Q4"
FT                   /protein_id="ABJ72068.1"
FT                   /translation="MADKVIALACAAGMSTSLLVSKMQKAAAENGKDYEIFAKSTADID
FT                   NMLAGTGSPKPDVLLLGPQVAFMKGEVAKKAEIAGVPMDVIKMQDYGMMRGDKVLAAAE
FT                   NLMN"
FT   gene            437113..437463
FT                   /locus_tag="LACR_0466"
FT                   /note="LactoCOG number LaCOG00304"
FT   CDS_pept        437113..437463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0466"
FT                   /product="PTS system cellobiose-specific IIA component, Lac
FT                   family"
FT                   /note="TC 4.A.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72069"
FT                   /db_xref="GOA:Q031Q3"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Q3"
FT                   /protein_id="ABJ72069.1"
FT                   /translation="MTDKYENPTSDDYMGVVMGIIMSGGNAKGLAFQAIQQAKDGKFAE
FT                   AESSLNEASEQLREAHDVQTDLLTRLAQGEKIGWNLYMVHAQDHLMNAITFKDLAVEVV
FT                   GQERRLQALENK"
FT   gene            437557..438285
FT                   /locus_tag="LACR_0467"
FT                   /note="LactoCOG number LaCOG00305"
FT   CDS_pept        437557..438285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0467"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72070"
FT                   /db_xref="GOA:Q031Q2"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Q2"
FT                   /protein_id="ABJ72070.1"
FT                   /translation="MSFFGNVDFQKLTYTERTCYSYLRDNVDKIPYLRVRDIALESHVG
FT                   TSSVMRLIHKMGYDSYTDFKEYIIDKKELEKGISNTAIPFSLDIFSGDVEQRLDNLAQR
FT                   VIESDNIIFTGVGSSGLICDYAARRLAGVGINTFSFSDVTYPIASKLQNTTNTLVIALS
FT                   ISGETNEIIEVLTSLRSNKDVYISSITPKINSSIAELSDFVLTYRINEHRINTHYDLTS
FT                   QLPTVYLTERLTDLVYQRSH"
FT   gene            438578..439915
FT                   /locus_tag="LACR_0468"
FT                   /note="LactoCOG number LaCOG00113"
FT   CDS_pept        438578..439915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0468"
FT                   /product="cellobiose-specific PTS system IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72071"
FT                   /db_xref="GOA:Q031Q1"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Q1"
FT                   /protein_id="ABJ72071.1"
FT                   /translation="MNNFIQNKIMPPMMKFLNTRAVTAIKNGMIYPIPFIIIGSVFLIL
FT                   GQLPFQAGQDFMNKIKLGPLFLQINNASFGIMALLAVFGIAYAWVRDAGYEGVPAGLTG
FT                   VIVHILLQPDTIHQVTSVTDPTKTSTAFQVGGVIDRAWLGGKGMVLSIIVGLLVGWIYT
FT                   GFMRRNITIKMPEQVPENVAASFTSLVPAGAIITMAGVVHGITTIGFNTTFIELVYKWI
FT                   QTPLQHVTDGPVGVFVIAFMPVFIWWFGVHGATIIGGIMGPLLQANSADNAALYKAGHL
FT                   SLSNGAHIVTQSFMDQYLTVTGSGLTIGLVIFLLVSAKSVQGKTLGRMEIGPAVFNINE
FT                   PILFGLPIVLNPILAIPFILAPLISGILTYLVIYLGIIPPFNGAYVPWTTPAVLSGYLV
FT                   GGWQGMVWQIIILALTTVLYWPFAKAYDNILLKEEAETEAGINAAE"
FT   gene            440005..441441
FT                   /locus_tag="LACR_0469"
FT                   /note="LactoCOG number LaCOG00306"
FT   CDS_pept        440005..441441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0469"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72072"
FT                   /db_xref="GOA:Q031Q0"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:Q031Q0"
FT                   /protein_id="ABJ72072.1"
FT                   /translation="MTLKKDFLWGGAVAAHQLEGGWNAGGKGVSVADVMTAGSNGVERK
FT                   ITNGVIEGENYPNHEAIDFYHHYKEDVALFAELGLNCFRTSIAWTRIFPKGDESEPNEE
FT                   GLQFYDDLFDECLKNGIEPVITLSHFELSYHLVTEYGGFRNRKLIDFFFHFSEVVMNRY
FT                   KDKVKYWMTFNEINNQANFMRDFAPFTNSGLKFPEGASEKEREEIMYQAAHYELVASAK
FT                   VVELGHKINPDFQIGCMIAMCPIYPATCKPEDMMASTVAMQRRYWFADVHVRGHYPSYL
FT                   KAYFERKEFKLDISDEDLEVLKNGKVDYIGFSYYMSFAIKDHGKAPTFDYNEDKDLVKN
FT                   NYVKASEWGWQIDPLGLRYAMNWFYERYEKPLFIVENGFGAVDEVEADGSIHDPYRIEY
FT                   LKSHIESMKEAVEYDGVDLMGYTPWGFIDLVSAGTGEMKKRYGVIYVDKDNEGNGTLKR
FT                   SKKDSFDWYQKVIANNGEEL"
FT   gene            441884..442009
FT                   /pseudo
FT                   /locus_tag="LACR_0470"
FT   gene            442168..442238
FT                   /locus_tag="LACR_t0471"
FT                   /note="tRNA_Cys_GCA"
FT   tRNA            442168..442238
FT                   /locus_tag="LACR_t0471"
FT                   /product="tRNA-Cys"
FT   gene            442374..444434
FT                   /locus_tag="LACR_0472"
FT                   /note="LactoCOG number LaCOG00307"
FT   CDS_pept        442374..444434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0472"
FT                   /product="NAD-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72073"
FT                   /db_xref="GOA:Q031P9"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031P9"
FT                   /protein_id="ABJ72073.1"
FT                   /translation="MNIESKIKEFTDQLNQFAYEYYTLDEPSVEDSEYDRLYHELVKLE
FT                   QENPQLVRADSPTHWTGGVILDGFVKFRHPYNLYSLGDVFSREELALWEERVRKEIVNP
FT                   EYICELKIDGLSLSLYYENGLLVTAATRGDGTTGENITENVKRIKDVPLKLKEAIDIVV
FT                   RGEAYLPRQNFAKLNAERELAGAAPFANPRNAAAGTLRQLDTKIVAKRGLATFLYQEAS
FT                   PATNDTQEEVLEYFEELGFQVNPERKFARNLDEIWEFIEEATRLRDELPYDIDGVVIKV
FT                   NNLAEQEELGFTVKAPRWAIAYKFPAEQAETEILSVDWTVGRTGVVTPTANMTPVLLAQ
FT                   TTVARATLHNVDYIQEKDIRNHDKVMIYKAGDIIPKVGKVLLEKRKPAKHLRKTHRANK
FT                   YVWTRFGRRSVEKGLVFSKREDNRVKIPTQCPECDSDLIHFEDEVALRCVNPLCPAQIR
FT                   EKLIHFASRDAMNIVGLGPSVISQLFDKKLVTDVADLYQLTVEDLLTLDKVKETLAQKI
FT                   VSAIAQSRENSAEKLLFGLGIRHVGGKAAKLLLERFANLRALSQASEEEISEIPSLGGV
FT                   IATAVVSYFETAGAKTLLDELENAGLNFAYLGAVNVEGILSGKTVVLTGKLTTLKRKEA
FT                   KEKLEALGANVSGSVSKKTDLVVAGEEAGSKLTKAQDLGIEIWSEQDLLDL"
FT   gene            444551..445603
FT                   /locus_tag="LACR_0473"
FT                   /note="LactoCOG number LaCOG00308"
FT   CDS_pept        444551..445603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0473"
FT                   /product="Lipid kinase from diacylglycerol kinase family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72074"
FT                   /db_xref="GOA:Q031P8"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q031P8"
FT                   /protein_id="ABJ72074.1"
FT                   /translation="MDEKFSGEMMKARLIYNPTSGQEIIKKHIADILDKLEQYGYEASA
FT                   YQTTAEQDSAKKEAARATQAGFDLIIAAGGDGTINEVVAGISPFEKRPRLAIVPTGTTN
FT                   DFARALKIPRGKPLEAIEIIGKNQILNIDVGHAIIKETKDEQYFINIAAGGGLTELTYS
FT                   VPSHLKTAFGYLAYLAKGAELLPRVRKAPVRVVHDEGVFEGDISMFFAALTNSVGGFEK
FT                   IAPDAKLDDGLFTLILVKTDNLFELIALLAIVANGKHLDDVNLEYIKTSKIEIEALGGQ
FT                   SILLNLDGEYGGDAPVQFDNLKGHLDMYVNLDEINDDHYIGDEETLALEAVAQKFAEEA
FT                   NKIKDEDETD"
FT   gene            445826..446962
FT                   /locus_tag="LACR_0474"
FT                   /note="LactoCOG number LaCOG00309"
FT   CDS_pept        445826..446962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0474"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family"
FT                   /note="TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72075"
FT                   /db_xref="GOA:Q031P7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:Q031P7"
FT                   /protein_id="ABJ72075.1"
FT                   /translation="MTTIVLDKIYKKYPNATQYAVEDFNIDIKDKEFIVFVGPSGCGKS
FT                   TTLRMVAGLEDITEGEFKIDGKVMNDVAPKDRDIAMVFQNYALYPHMTVFDNMAFGLKL
FT                   RKFKKDEIKRRVDEAGAILGLTDLLDRKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPL
FT                   SNLDAKLRVSMRTEIAKIHRRIGATTIYVTHDQTEAMTLADRIVIMSSSPNSDKTGTVG
FT                   RVEQIGTPQELYNEPANKFVAGFIGSPAMNFFNVKVTGGKLTNNEGLNMDLPEGKAKLL
FT                   KEQGYEGKEVILGIRPEDIQASNLAQQAYPNQTIEAEVVVSELLGAETMLYLKAGSTEF
FT                   VSRVEARDFRNPGEKITVALNLNKSHFFDAQTEHRIVD"
FT   gene            447269..450940
FT                   /locus_tag="LACR_0475"
FT                   /note="LactoCOG number LaCOG02428"
FT   CDS_pept        447269..450940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0475"
FT                   /product="Pyruvate:ferredoxin oxidoreductase, fusion of
FT                   alpha, beta and gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72076"
FT                   /db_xref="GOA:Q031P6"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:Q031P6"
FT                   /protein_id="ABJ72076.1"
FT                   /translation="MKKTMDGNMAAAHIAYAFSEIAVIYPITPSSPMADYTDAWSVAGR
FT                   INIWGQRVKITELQSEAGAAGAMHGVLKAGGLATTYTASQGLLLMLPNMYKMAGELLPA
FT                   VIHVAARAVAAGALNIFGDQSDVMSARTTGFAMLAESSVQEVMDLSAVAHLATLEGSVP
FT                   FLNFFDGFRTSHEIQKIDVINYQDLLPMVNQEKLADFRARAMNPDHPTVSGTNQNADIY
FT                   FQQRETVNAYYEALPEIVQKYMGKINELRGTDYDLVNYYGAPDATEVIVSMGSVAGTIE
FT                   QTVDYLNAQGRKVGFLNIHLYRPFPMENFLEKLPKTVTSVAVLDRTKEAGSNGEPLFLD
FT                   VQSALFNSNVKEVIGGRYGIGGKDTRPEHIVSIFDELLKENPKRIFTIGITDDVTNLSL
FT                   ENLSVLDLTPSDTFQAKFWGFGSDGTVGANKAAIKIIGDHTDKYVQAAFEYDSKKSGGL
FT                   TISHLRFGDSPINSEYMTATLDFVACHNMTYVRKYNLTKGLKAGGVFLLNTSWDLEHLS
FT                   KNLPNEMKRYIAENNIRFYTIDAMKIAHETGMERRINTIMQVAFFKLAHVMPFDEAYEI
FT                   LKKDAQKYAKKSPTIVEQNLKAMALALNGLHEVIVPEGWAETTENVIEAVTKETARKKY
FT                   VFEIVNKTNAFEGDELSVQTLVDNGMTFGDEPLGTTASEKRGIALEIPEWNAQACIQCN
FT                   ECSFVCPHAAIRPFLVDEDEWNQAPEGFHVMDYKGSDGLKYRIQVSVEDCTGCGLCVEA
FT                   CPKKGEALKMIPYEGQEKESVNWAFAQTLKTKENPARPGTIVASQFEKPLFEFSGACSG
FT                   CGETPYIKLLTQMFGDRMMISNATGCSAIYGGTQATPYTTNEQEQGPAWSNSLFEDNAE
FT                   YGYGMWLASQTRRQKLAAEVLEALPEMSAELQNLAKDWLEHLEDSEGTRARAEKMKGML
FT                   ASEHFNSPKLDAIYKQKDQFVKPTQWIFGGDGWAYDIGFGGLDHIVASGADVNILVMDN
FT                   EVYANTGGQVSKATPASAIAQFAAGGKSSTKKDLGAMLMTYGEVYVAQIASGANMMQTI
FT                   RAFDEAEKFKGPSVIIAYTPCISHGLYGGIHLALDEAKEAVNSGYWQLYRYNPLLEDLG
FT                   ENPMILDFKKPDFGKVRDFLLTQSRFGNLLKVDAEHAENLYDKAAKDSRKRFMRYARLS
FT                   GDLDKFLEREAKALAKKNADLGISTETNLKKERKTRPVDPEREARRAARKAERAAKK"
FT   gene            complement(451031..451921)
FT                   /locus_tag="LACR_0476"
FT                   /note="LactoCOG number LaCOG03011"
FT   CDS_pept        complement(451031..451921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0476"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72077"
FT                   /db_xref="GOA:Q030L4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q030L4"
FT                   /protein_id="ABJ72077.1"
FT                   /translation="MTYNSTLPKVFVYLLTTIETLYQTRVPLEVQNRKNVHLATSDCLV
FT                   IACYLWGVLHFSETLKAKHQLAQSLFPNFLEYSRFVRRCNALLPSIQVIRQALVFKEVE
FT                   GISVSIIDSFPIPLCQPIRNFRSKGLGDYANVGYNATKGQYFYGCKCHALVSESGYVID
FT                   YTITPASMADSSMTEEVLSQFGTPTVLGDMGYLGQSLHDRLELKGIDLMTPVRKNMKQK
FT                   KILFPNFSKRRKVIERVFSFLTNLGAERCKSRSPQGFQLKLERILLAYSLLLKSAKSLE
FT                   PETLRYSIGYQVMAK"
FT   gene            452121..452999
FT                   /locus_tag="LACR_0477"
FT                   /note="LactoCOG number LaCOG00310"
FT   CDS_pept        452121..452999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72078"
FT                   /db_xref="GOA:Q031P4"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:Q031P4"
FT                   /protein_id="ABJ72078.1"
FT                   /translation="MTDFNQFFNLEFWQKIFELNESPLRIAIAVLDIAIVSFFLYQAIR
FT                   FVQGTKLMTLVRGVIIFIFIRIIAGLIGLTTVEWLLNQVITYGVIAGVIIFQPEIRRAL
FT                   ESLGRTTTLFTPTKKGSLDGHISAYEKSFAYMSERKIGALIAIEQGQNLNEFVSTGIRL
FT                   DADITSELLINIFIPNTPLHDGAVIVQGNKIAVTSAYLPLTEKSGISKQFGTRHRAAIG
FT                   LSEVSDALILVVSEETGGISVAHNGEFFSDISKEKFHDILVAILVPKVEKTVRGTGRIR
FT                   KNKVEEKKNGK"
FT   gene            452989..453948
FT                   /locus_tag="LACR_0478"
FT                   /note="LactoCOG number LaCOG01676"
FT   CDS_pept        452989..453948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72079"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:Q031P3"
FT                   /protein_id="ABJ72079.1"
FT                   /translation="MANRFFNSKTFYILASVFFAIVLFFNANATSIRNQGTNQSGEVYT
FT                   ATINNVPVELKYNSNKYFVSGYNSSATVHLSGYNRLSITNEENSDTRNFFLSVDLTKLK
FT                   TGKFDVPIRIEQLPGGVTATIEPKTMNITVEDKAKKEFEVTPKADSTQLPEGFTIDSLT
FT                   VSDEKVKVTAGNESIQKIYAIEAALPNDVNLTENYSGTVTLHAVDSAGEILPAQIEPST
FT                   THLKVTVNKLTKDVPVKITQKGTLDKTLSEVKTKISDKNVTLSGEKSALEAINSVEGTV
FT                   DITGIVKETKITVPLHAAGVSIDPQEVEVTLTPVKIGS"
FT   gene            453993..455351
FT                   /locus_tag="LACR_0479"
FT                   /note="LactoCOG number LaCOG00311"
FT   CDS_pept        453993..455351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0479"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72080"
FT                   /db_xref="GOA:Q031P2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031P2"
FT                   /protein_id="ABJ72080.1"
FT                   /translation="MGKYFGTDGVRGEANVELTPEMAFKLGRFGGYVLSQHELETPKVY
FT                   VGRDTRISGQMLASSLISGLLSVGIEVYDLGVIATPGVAYLVKKDGASAGVMISASHNP
FT                   ALDNGIKFFGGDGYKLEDEKELEIEALIDAKEDTLPRPSAQGLGMLHDYIEGVRKYQAF
FT                   LKTTAEGDFEGYNVVLDTANGASYTSARAVFADLKANLTVIGENPDGLNINVKVGSTHP
FT                   EAMAKKVVETGSDLGLAFDGDADRLIAVDENGEIVDGDKIMFIVGKYLLEQGKLAQDTL
FT                   VTTVMSNLGFHLALEEAGINSVITAVGDRYVVEEMKKNNYNFGGEQSGHMIFLDYNTTG
FT                   DGQLSAIQLLKVMRETGKTLSELASEVTIYPQKLVNVRVKDNAAKKSAMDVPAIQKVIS
FT                   EMETSMNGKGRILVRPSGTEPLLRVMAEAPTHEQVEHVVDTIVEVVEAEIGVK"
FT   gene            complement(455425..456126)
FT                   /locus_tag="LACR_0480"
FT                   /note="LactoCOG number LaCOG00312"
FT   CDS_pept        complement(455425..456126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0480"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72081"
FT                   /db_xref="GOA:Q031P1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR012770"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q031P1"
FT                   /protein_id="ABJ72081.1"
FT                   /translation="MILQDLEKKIFNDIYKTNDILPSENELSISYESSRSTVRQALKIL
FT                   EEKGLIQRRHGYGSIVLAHDRLLFPISGLTSYKELQTSMGFHSETEVIKFESIKITPAL
FT                   SETTGFAIGDQALSILRRRKVDGKFSILDWDLFLEKYADGLTPEHAQNSTYDYLEGALG
FT                   LDIAYAQKEVTIDFACEDDFTYLDLNPKDHHVVSVKSHVYLADNTLFQYTESRHQVDRF
FT                   RFTEFARRQKR"
FT   gene            456252..456737
FT                   /locus_tag="LACR_0481"
FT                   /note="LactoCOG number LaCOG00313"
FT   CDS_pept        456252..456737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0481"
FT                   /product="PTS system IIA component, Glc family"
FT                   /note="TC 4.A.1"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72082"
FT                   /db_xref="GOA:Q031P0"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:Q031P0"
FT                   /protein_id="ABJ72082.1"
FT                   /translation="MFGIGKKKELRDDKSLYAPDSGEVINLSTVNDPVFSKKIMGDGFA
FT                   VEPKENKIFAPVSAKVTLVQGHAIGFKRADGLDVLLHLGIDTVALKGLPFKIKVKVDDI
FT                   VNGGDELGSVDWAQIEAAGLDKTTMVIFTNTKDKLSEFNVNYGPVTSGSELGKASVK"
FT   gene            456883..458448
FT                   /locus_tag="LACR_0482"
FT                   /note="LactoCOG number LaCOG00314"
FT   CDS_pept        456883..458448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0482"
FT                   /product="PTS system IIC component, Glc family / PTS system
FT                   IIB component, Glc family / PTS system IIA component, Glc
FT                   family"
FT                   /note="TC 4.A.1; TC 4.A.1; TC 4.A.1"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72083"
FT                   /db_xref="GOA:Q031N9"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q031N9"
FT                   /protein_id="ABJ72083.1"
FT                   /translation="MANYSQLATEIIANVGGAENVTKVIHCITRLRFTLKDKDKADTAA
FT                   IEALTGVAGAVYNSNLNQYQVVIGQAVEDVYDEVVEQLGDSVVDEDATAQALAATAPAN
FT                   GKKQNPIVHAFQVVIGTITGSMIPIIGLLAAGGMINGLLSIFVKGNRLIEVIDPASSTY
FT                   VIISTLAMTPFYFLPVLVGFSAAKQLAPKDTILQFIGAAVGGFMINPGITNLVNAHVGT
FT                   NAAGKNVVVEAAAPVANFLGVTFNTSYFGIPVALPSYAYTIFPIIVAVAIAKPLNAWLK
FT                   KVLPLALRPIFQPMITFFITASIVLLLVGPVISTISSGLSFVIDHILSLNLGIGSIIVG
FT                   GLYQCLVIFGLHWLVVPLISQELAATGASSLNMIVSFTMLAQGVGALTVFFKSKKADLK
FT                   GLSAPAAISAFCGVTEPAMYGINLKYIRVFIMSSIGAAIGAGIAGFGGLQMFGFSGSLI
FT                   GFPNFISNPLTHHAPAGNLMLFWIATAVCAVATFLLVWFFGYKDTDVMGQGVEQKNAFK
FT                   DAVK"
FT   gene            458515..460824
FT                   /locus_tag="LACR_0483"
FT                   /note="LactoCOG number LaCOG00315"
FT   CDS_pept        458515..460824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0483"
FT                   /product="Trehalose and maltose hydrolase (possible
FT                   phosphorylase)"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72084"
FT                   /db_xref="GOA:Q031N8"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:Q031N8"
FT                   /protein_id="ABJ72084.1"
FT                   /translation="MTDKDWMIQYDKQEVGKRSYGQESLMSLGNGYLGLRGAPLWATCS
FT                   DNHYPGLYVAGVFNHTSTEVAGHDVINEDMVNWPNPQLIKVYIDNELVDFESAIEKNSS
FT                   IDFKNGLQIESYNVSLAKGSLTLVTTKFVDPIHFHDFGFVGEIIADFSGKLRIETFIDG
FT                   SVLNQNVERYRDFDSKEFEVTQIADGLLVAKTRTTDIELAVATKTYLNGQPLKKVESGN
FT                   SEIFKESIEVDLLKNQEVQFEKSIVIASSYETKNPVEFVLTELAATSVSKIQENNAIYW
FT                   EKVWQDGDIVIESDHADLQRMVRMNIFHIRQAAQHGANQFLDASVGSRGLTGEGYRGHI
FT                   FWDEIFVLPYYAANEPETARDLLLYRINRLTAAQENAKVDGEIGAMFPWQSGLIGDEQA
FT                   QFVHLNTVNNEWEPDNSRRQRHVSLAIVYNLWIYLQLTDDESILTDGGLDLLIETTKFW
FT                   LNKAELGADNRYHIAGVMGPDEYHEAYPGQEGGICDNAYTNLMLTWQLNWLTELSVKGF
FT                   EIPADLLEESQKVRENLYLDIDENGVIAQYAKYFELKEVDFAAYEAKYGDIHRIDRLMK
FT                   AEGISPDEYQVAKQADTLMLMYNLGHEHVTKLVKQLGYELPKNWLKVNRDYYLARTVHG
FT                   STTSRPVFAGIDVKLGDFDEALDFLITAIGSDYYDIQGGTTAEGVHIGVMGETLEVIQN
FT                   EFAGLTLRDGYFSIAPHLPKSWTKLKFSQIFKGCQVEILIEKGQLLLTASSDLLIKVYD
FT                   EEVQLKAGVQANFDLK"
FT   gene            460977..461642
FT                   /locus_tag="LACR_0484"
FT                   /note="LactoCOG number LaCOG00316"
FT   CDS_pept        460977..461642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0484"
FT                   /product="Predicted sugar phosphatase of HAD family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72085"
FT                   /db_xref="GOA:Q031N7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010972"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q031N7"
FT                   /protein_id="ABJ72085.1"
FT                   /translation="MFKAVLFDLDGVITDTAEYHYRAWKALAEEIGINGVDRQFNEQLK
FT                   GVSREDSLQKILDLAGKKVSAEEFKALAQRKNDNYVTMIQDVSPADVYPGILQLLKDLR
FT                   SNHIKIALASASKNGPFLLERMALTEYFDAIADPAEVAASKPAPDIFIVAAHAVGVKPT
FT                   ESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGNDIVVVADTSHYTLDFLKEVWLKEKG"
FT   gene            complement(461700..462467)
FT                   /locus_tag="LACR_0485"
FT                   /note="LactoCOG number LaCOG00317"
FT   CDS_pept        complement(461700..462467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0485"
FT                   /product="Esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72086"
FT                   /db_xref="GOA:Q031N6"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q031N6"
FT                   /protein_id="ABJ72086.1"
FT                   /translation="MNKSTFSLNDTAWVDFYQLQNPRPEENYTFPAIIICPGGGYQHIS
FT                   NRESDPLTLAFLAQGYQVFILNYTVMNKGTDYNFLSQNITEVQAVFALINQHHEQWQIN
FT                   PEHVFLLGCSAGGHLAAWYGNSEQIYRPKGVILCYPVTSFTFGWPSDLSHFNFEIENIS
FT                   EYNISEKVTSATPPTFIWHTADDASVPIYNSLKYCDRLSKHQVPFEAHFFEAGPHGISL
FT                   ANRTTAPSDDYCLESVHRWLSWASDWLERQIKN"
FT   gene            462579..463277
FT                   /locus_tag="LACR_0486"
FT                   /note="LactoCOG number LaCOG02429"
FT   CDS_pept        462579..463277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72087"
FT                   /db_xref="GOA:Q031N5"
FT                   /db_xref="UniProtKB/TrEMBL:Q031N5"
FT                   /protein_id="ABJ72087.1"
FT                   /translation="MKKIIYGIGLISLLNVGTIAYGETATGTSASSAETTAQSSTGNST
FT                   SQSSSNSASSSSQNTSSSDGTNSTSQSQTQTSTTAQNQTDTNGQNQNQTPPVAESRDNS
FT                   TDKNSGSQKETKNSTTIINETVNNNAKGNNILLMTLTSLSASVTIIGGIIALVRHLRGQ
FT                   GKKKSSVSKTKAPKNGSALSSSLTDSPVNSDKTQNHENPLTETQQINLQADELLKNHKK
FT                   QQKEYRRRRR"
FT   gene            463436..463882
FT                   /locus_tag="LACR_0487"
FT                   /note="LactoCOG number LaCOG00318"
FT   CDS_pept        463436..463882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0487"
FT                   /product="Predicted ATPase or kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72088"
FT                   /db_xref="GOA:Q031N4"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q031N4"
FT                   /protein_id="ABJ72088.1"
FT                   /translation="MKFNEEEMLQFAQKLGRKLEAQDVIVLTGELGAGKTTFTKGLALG
FT                   LDIHQMVKSPTYTIVRTLDGRLPLHHMDVYRIGDDPDSFDLDDYLFGDGVSVIEWGEML
FT                   GADLPENYLEVIFDKYSPDLINDQEREIILKAHGKRYEELINNL"
FT   gene            463879..464397
FT                   /locus_tag="LACR_0488"
FT                   /note="LactoCOG number LaCOG00319"
FT   CDS_pept        463879..464397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0488"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72089"
FT                   /db_xref="GOA:Q031N3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q031N3"
FT                   /protein_id="ABJ72089.1"
FT                   /translation="MTTELIVREASGLDSPKVIDFLNKVGAESNFLTIDEVGILMSEAG
FT                   MTEFLNQQAEKDNNAYFIAFVGEEIAGVLHLTADYHYRVRHIAELFIAVAQDFQGYGIG
FT                   SILLEDALDWIKEVGIIKRLELTVQARNHKARHLYEKFDFALEATKKWGARDENGQFID
FT                   ICDYVLFFD"
FT   gene            464529..465881
FT                   /locus_tag="LACR_0489"
FT                   /note="LactoCOG number LaCOG00320"
FT   CDS_pept        464529..465881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0489"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72090"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:Q031N2"
FT                   /protein_id="ABJ72090.1"
FT                   /translation="MLKSIILVTAIAASGYTLTVLNSTTKAFKMTYTNAGNKQTEQVIQ
FT                   ATKPLTILLMGVDTGGEGRGTSDSWNGNSDSQILMTLNPKTHTTTMVSIERDTMTNILD
FT                   GDGNIVSKQKMNAAYPLGYNSGSSSDGLKNAVSYAMKTIGAQTGINIDSFATVNFDGLV
FT                   NMVDNVGGIDINNTTGQTLYISDTEPQYTAKVPPGKQHINGDQALVYTRDRHHLPNGDY
FT                   GRAAHQREVIAALMKKVLALDNITRYEQFLNEASKDFRTNIPINASTITSLLGYKDCFN
FT                   KVVSVQYEGIGEMVDGTSYQFMPTDIYLAMQNIMKKSLDESTVTTLPSSLITYESVFGS
FT                   GTAPFYYLPSATVTEKGKTTETYGVDTQGNLVSLNSKNSGNYVSTSGGSVQSDSSSGSS
FT                   SSSSDSTVTSSSDSTYQQNDTYNDGYNNSNNTTTYGNGTDDTTAGGYGTGQ"
FT   gene            466065..466138
FT                   /locus_tag="LACR_t0490"
FT                   /note="tRNA_Arg_TCT"
FT   tRNA            466065..466138
FT                   /locus_tag="LACR_t0490"
FT                   /product="tRNA-Arg"
FT   gene            466282..467043
FT                   /locus_tag="LACR_0491"
FT                   /note="LactoCOG number LaCOG00330"
FT   CDS_pept        466282..467043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0491"
FT                   /product="Pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72091"
FT                   /db_xref="GOA:Q031N1"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031N1"
FT                   /protein_id="ABJ72091.1"
FT                   /translation="MTRYKATIAYDGTDFAGFQSQTNQRTVQEEIEKVLSKLNSFEPVI
FT                   LQGSGRTDSGVHAFGQVIHFDLNGKARDLERLRFGLDTQTPADIAVKKVELVPDDWHAR
FT                   YQKHEKTYEYYLENSVTRSPFHRHSKAYFRYPLNFELMQGAMAKLVGQHDFTGFTASGS
FT                   SVDDKVRTIYQAEIIQLDKENFKFIFRGNGFLYKQVRNMVGTVIKIGNDRMPVSQIDKI
FT                   LTSKNRNFAGPTAAPEGLYLKEVKYEPINEI"
FT   gene            467077..467865
FT                   /locus_tag="LACR_0492"
FT                   /note="LactoCOG number LaCOG00331"
FT   CDS_pept        467077..467865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0492"
FT                   /product="Hydroxymethylpyrimidine/phosphomethylpyrimidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72092"
FT                   /db_xref="GOA:Q031N0"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q031N0"
FT                   /protein_id="ABJ72092.1"
FT                   /translation="MAEELAQTKKILTIAGSDILSGGGMQADLATFAANGLYGFCALTS
FT                   IVTVKEDKFFVHPVDEEIFQEELESLTDIDFSAIKIGLLPNKKILAMTKKWLTALSVKS
FT                   PVPIILDPVIVFKENADYSVSEMRELFISQLFPLATVITPNLKEAEILTGLSVKTEADM
FT                   KAAAKLLHRFGAKNVIIKGGNRFDQKQAIDFAYDGKDFYQLASPLLKKNNNGAGCTFAS
FT                   SIASQMAEENSFKDSVEKAKDFVYQAIQNANEFGVFQNKK"
FT   gene            467914..468405
FT                   /locus_tag="LACR_0493"
FT                   /note="LactoCOG number LaCOG00332"
FT   CDS_pept        467914..468405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0493"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72093"
FT                   /db_xref="GOA:Q031M9"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:Q031M9"
FT                   /protein_id="ABJ72093.1"
FT                   /translation="MDNKNIKKLTLLAIWTAITFVLGRLFTFPIPGSAGNILTLLDVGI
FT                   YTAVFLFGKREAAIIGGFAAFLLDLTAGFSNYMFFSLIIHGGQGYLAGLTRYKWLNFLL
FT                   SLLVMVGGYFIVGGLMYGWGSAIAGLWVNIVQVIVGFVLAKVLSPLIERTGILNGFRKA
FT                   "
FT   gene            468386..468928
FT                   /locus_tag="LACR_0494"
FT                   /note="LactoCOG number LaCOG00333"
FT   CDS_pept        468386..468928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72094"
FT                   /db_xref="InterPro:IPR006340"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031M8"
FT                   /protein_id="ABJ72094.1"
FT                   /translation="MDLEKLKEETQIIIDDVLKQTEIKSGQVFVLGLSSSEVNGGLIGH
FT                   ASSAEIGQVIVSVIHKTLSDKGIYLAVQACEHLNRALLIEEELADKKDWEIVSVVPQLH
FT                   AGGSGQVAAYQLFKSPVEVEHIVAQAGLDIGDTSIGMHVKHVQIPVRPISKELGGAHVT
FT                   SLKSRPKLIGGERARYE"
FT   gene            468929..469678
FT                   /pseudo
FT                   /locus_tag="LACR_0495"
FT   gene            469651..470064
FT                   /locus_tag="LACR_0496"
FT                   /note="LactoCOG number LaCOG02450"
FT   CDS_pept        469651..470064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0496"
FT                   /product="Serine-pyruvate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72095"
FT                   /db_xref="GOA:Q031M7"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q031M7"
FT                   /protein_id="ABJ72095.1"
FT                   /translation="MPISDIYGLDQAVDNILFDQEILKRHAMIGKATRKAIKNSPLELY
FT                   LQNGYSNTVSVIKVPNGLNDQELLRKMRQDYQVMITGSFDRLAGKVLRIGHMGENARTS
FT                   KVAYSLYALQKVLEESGLKFKTSLQEDFLQALK"
FT   gene            470341..471948
FT                   /locus_tag="LACR_0497"
FT                   /note="LactoCOG number LaCOG00334"
FT   CDS_pept        470341..471948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0497"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72096"
FT                   /db_xref="GOA:Q031M6"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:Q031M6"
FT                   /protein_id="ABJ72096.1"
FT                   /translation="MSTKYIFVTGGGTSSMGKGIVAASLGRLLKNRGLKVTVQKFDPYL
FT                   NIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTSGKVYSEILRKER
FT                   KGEYLGATVQMVPHVTNMLKEKIKRAATTTDADIIITEVGGTVGDMESLPFIEALRQMK
FT                   AEVGADNVMYIHTVPILHLRAAGELKTKIAQNATKTLREYGIQANMLVLRSEVPITTEM
FT                   RDKIAMFCDVAPEAVIQSLDVEHLYQIPLNLQAQNMDQIVCDHLKLDAPKADMAEWSAM
FT                   VDHVMNLKKKVKIALVGKYVELPDAYISVTEALKHAGYASDAEVDINWVNANDVTDENV
FT                   AELVGDAAGIIVPGGFGQRGTEGKIAAIKYARENDVPMLGICLGMQLTAVEFARNVLGL
FT                   EGAHSFELDPETKYPVIDIMRDQVDVEDMGGTLRLGLYPAKLKNGSRAKAAYNDAEVVQ
FT                   RRHRHRYEFNNKYREDFEKAGFVFSGVSPDNRLVEIVELSDKKFFVACQYHPELQSRPN
FT                   RPEELYTEFIRVAVENSK"
FT   gene            472160..473017
FT                   /locus_tag="LACR_0498"
FT   CDS_pept        472160..473017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72097"
FT                   /db_xref="UniProtKB/TrEMBL:Q031M5"
FT                   /protein_id="ABJ72097.1"
FT                   /translation="MKKLHWKISLVLLTVFLLIPYAGEFSILKVKADETGQTEISSSSS
FT                   ATSDAQSSEVKNSEQKQAPTEPTPPPSFTGTLSDMIDQVYPSMFIVPKPSPKSFVSDDG
FT                   VTINGQFYSNAEFDALLDKMTLAPNAPEFTVDANGQIHFDYDLRIFPLAAPIFVAALPI
FT                   IGKVFVTGATIIVGGLMINENNKEWNKVTSRLNAAQRAKVEAEKAKAKAKAKPTTPKKT
FT                   AKDGEDEMTADEIISKLRKASIRREFPKEYLNKKWKDIKNAADKGNAVARKAKKLLQDG
FT                   RFKK"
FT   gene            472998..473396
FT                   /locus_tag="LACR_0499"
FT   CDS_pept        472998..473396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72098"
FT                   /db_xref="InterPro:IPR025630"
FT                   /db_xref="UniProtKB/TrEMBL:Q031M4"
FT                   /protein_id="ABJ72098.1"
FT                   /translation="MDDSKNKHVYSIVLLKEAIIKNPVVTKDHKLFEESLILISISENL
FT                   LRDKEKFLIFIRNLVQNNEEIYPNEFGEMVIWKLAKIIDVFEISEDIEFSLPFQEVYSR
FT                   FLEMPANASIDDVVNKFYSDYVWEDKEM"
FT   gene            473399..473887
FT                   /locus_tag="LACR_0500"
FT   CDS_pept        473399..473887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72099"
FT                   /db_xref="UniProtKB/TrEMBL:Q031M3"
FT                   /protein_id="ABJ72099.1"
FT                   /translation="MKEYYLIRFLMENKETYCIWCSDIKDSLLTHGEKLLSFSNLQSVK
FT                   KYCAENKIELSSSDVSTYNIIELKNLMVKNDVSNYNLYLDFWNIINDAMRSVEQDFIGE
FT                   DKLYVGIYDKLFFGLNLLIRPEDEKYIPVWSQEEILKLKEIMNMGIDFFDCQFQERIL"
FT   gene            473884..474441
FT                   /locus_tag="LACR_0501"
FT   CDS_pept        473884..474441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72100"
FT                   /db_xref="UniProtKB/TrEMBL:Q031M2"
FT                   /protein_id="ABJ72100.1"
FT                   /translation="MMDKKIIYRLSHEHDKYVEYEFKLLGYYSNLEKLKEAILRYKKLE
FT                   GFKENPIDYFKMRLVIVDEDNDYINGFEAYEEQKNGRSFENEQFLTDALKQFENDHING
FT                   NELKLFALDFLYEFGEQYEYNDFYHLGVYSSVDQIKYAIERYRNLKGFKSLSEECFEFH
FT                   EIEIDKDSEWLEGYFKQNWNEY"
FT   gene            474672..475559
FT                   /locus_tag="LACR_0502"
FT   CDS_pept        474672..475559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72101"
FT                   /db_xref="UniProtKB/TrEMBL:Q031M1"
FT                   /protein_id="ABJ72101.1"
FT                   /translation="MKKLHWKIILITSTLFLLAPYAGEFGNLKVKADETVQTETSSSSS
FT                   EQASTVKSSQSASTEQSQSSTEQAHAPSQTAQSSSAQEQTKTSTTSQQSQSGTLSGMID
FT                   QMFPPQLPAPTKEKPSATIEYVNGGVKFNNKFYTEAEFAKYIEKNFVPNPQVQFHVDAS
FT                   GKIVIDSQTRIASTMNWPDIGGAAAKGAVAIGSLGGASILASAGAALLIGGGLTVGYDL
FT                   LFPHKVGGDIKATPAMIAAMARHGKNPGNKNSEHTSNARKSTQNKHQNRQDSTKNKNRQ
FT                   KPTYKPKNNLRKGK"
FT   gene            475556..476086
FT                   /locus_tag="LACR_0503"
FT                   /note="LactoCOG number LaCOG03055"
FT   CDS_pept        475556..476086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72102"
FT                   /db_xref="UniProtKB/TrEMBL:Q031M0"
FT                   /protein_id="ABJ72102.1"
FT                   /translation="MKNMFEEIFTQDDEKNEQFDVGVFLGKHDNFRLYEMTDERGRLLS
FT                   ISVINDEAITKIVKKDDYLDYIEFYKNSLEKVNAYDPLKLRQNFDVERFNFSKLKGQLV
FT                   NTLYGDEEFWDLSEVIEVNDKTITLKAVETPLFSTVNGIEKDLPLENFVTIEILSVELE
FT                   LLSKKLGYRTYGK"
FT   gene            476093..476665
FT                   /locus_tag="LACR_0504"
FT                   /note="LactoCOG number LaCOG02827"
FT   CDS_pept        476093..476665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72103"
FT                   /db_xref="UniProtKB/TrEMBL:Q031L9"
FT                   /protein_id="ABJ72103.1"
FT                   /translation="MNNIQIINFANDDNEYLNIGHIYYQSKKWLLYSFITVPGMFGGVS
FT                   LQRILPTDNLEIISEDNYIVAIKKYAKNAKKLGFYDPFGQESLLTDFDLKNLTDETICK
FT                   MFLNFIKEKEVFVKVTLLAKGKMDLENYNEGKILEVFDEAFTIWDIDTDVVKFDEKYER
FT                   EYGDVYMIDGVTLALNQMQAVIRQESE"
FT   gene            476676..477236
FT                   /locus_tag="LACR_0505"
FT                   /note="LactoCOG number LaCOG03055"
FT   CDS_pept        476676..477236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72104"
FT                   /db_xref="UniProtKB/TrEMBL:Q031L8"
FT                   /protein_id="ABJ72104.1"
FT                   /translation="MLENKLYRLDLAFFADEFYVGYIRQEFLDFYLVELIDAWGRFESL
FT                   KLVNKEKIELMTAENSYLDIMQDYIDINRSVNNYDVFELTKKWQNFTLNLLNHQLISFL
FT                   DENDENQEETLVIAGHSQNDKFDIFPVSDEVLGSSFIIQSLDEKSYLDNERFEQLNYLT
FT                   VDSLELELLRRNIGNENNWKYKS"
FT   gene            477208..477699
FT                   /locus_tag="LACR_0506"
FT   CDS_pept        477208..477699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72105"
FT                   /db_xref="UniProtKB/TrEMBL:Q031L7"
FT                   /protein_id="ABJ72105.1"
FT                   /translation="MKIIGNINLDIRPSVNRFIAKEIKKYVAWLEVNHSLPKELRIIVT
FT                   GVSFIRSIDHEHVISTFWAPFDKEEACYMKISTGDFWELEKWGKDSAIYSTLNSISHEL
FT                   IHYHQWLEDKELHGNETDKKATLLTNEYVEYRGFPHGENRIHRWGWSGIPKYRKYKKTL
FT                   "
FT   gene            477755..477913
FT                   /locus_tag="LACR_0507"
FT   CDS_pept        477755..477913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72106"
FT                   /db_xref="UniProtKB/TrEMBL:Q031L6"
FT                   /protein_id="ABJ72106.1"
FT                   /translation="MMLNKNIVLRFTPTVHRLIKKEIFRYFVWLDKNYEFPEKIVIYIS
FT                   GGKFVFG"
FT   gene            477932..478189
FT                   /locus_tag="LACR_0508"
FT   CDS_pept        477932..478189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72107"
FT                   /db_xref="UniProtKB/TrEMBL:Q031L5"
FT                   /protein_id="ABJ72107.1"
FT                   /translation="MLTNFSVFPEKGDGSILKMACGDYIELLKEYDFQDMLGIMLFSLS
FT                   ENIQNYYQWVDDLEFDEEKAKESAQEMLDEYWGYRKKAKA"
FT   gene            478193..478651
FT                   /locus_tag="LACR_0509"
FT   CDS_pept        478193..478651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72108"
FT                   /db_xref="GOA:Q031L4"
FT                   /db_xref="UniProtKB/TrEMBL:Q031L4"
FT                   /protein_id="ABJ72108.1"
FT                   /translation="MKNYEIQTLWDINSKNLYEICDEKYFFASIVVFVILEIYAIYSQS
FT                   IVGLVFGIAVPLIFYWAYYWWLVRLYKSNKGVQEFQEFIIDEEYIYQKSNISEATFDKS
FT                   YIHKIGYHKDIIIIYISKGQGFFLHRTWLENGTFEEFATFLKEYYDKK"
FT   gene            478669..479583
FT                   /locus_tag="LACR_0510"
FT                   /note="LactoCOG number LaCOG00274"
FT   CDS_pept        478669..479583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0510"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72109"
FT                   /db_xref="GOA:Q031L3"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q031L3"
FT                   /protein_id="ABJ72109.1"
FT                   /translation="MRKVGLIGCGHVGATVALDIVQGGFADELVIIDKDRKKAEAEVLD
FT                   LLDALALLPFYVKIYVGEYDDLATADIVLSTLGHIELIKPGGDRFTELKANIPEIKEVS
FT                   EQLNRINFKGILIATTNPNDVIVNIYSQLLNLPKSQIIGTGTYLDTARMKAQVSRALEI
FT                   DARSVEGYVLGEHGNSQFTAWSTVRVGGQSFLEIAKEKNLNLKDLEEKARQGGFAVFNT
FT                   KGYTNVAIAAATVSLMNLVLSDAKNIAICSHYDENFSSYISTPALIGKNGIEALIKLPL
FT                   TLEEEGKLKNSVVEIQEKINYFS"
FT   gene            complement(479618..480499)
FT                   /locus_tag="LACR_0511"
FT                   /note="LactoCOG number LaCOG00335"
FT   CDS_pept        complement(479618..480499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0511"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72110"
FT                   /db_xref="GOA:Q031L2"
FT                   /db_xref="InterPro:IPR010406"
FT                   /db_xref="UniProtKB/TrEMBL:Q031L2"
FT                   /protein_id="ABJ72110.1"
FT                   /translation="MAPTPINKNKVVCLVNGRIHRRSGGDFLENLDPSLQTVIMRDYPE
FT                   ATSHDFICNEHQVKFRLEVLDTLFHLDLQKNFTVNDLLNEELTKANFEIHDVEEQLQTQ
FT                   ETIGERVADKVTEFVGSWAFIITYLGILVVWMFVNVTGLFGVEWDKYPFILLNLFLSIT
FT                   AAMQAPLIMMSQNRAAHHDRLSAKNDFQVNVKSEKGVAALHEKLDHLMMDDQASNMQIQ
FT                   KIQTEMLGDIQILLNEVYQQNQDIRERLDDVEDQLDDFEETFDSFEETLDSIEENTDDE
FT                   EEEGIANAANAD"
FT   gene            complement(480856..481056)
FT                   /locus_tag="LACR_0512"
FT                   /note="LactoCOG number LaCOG01831"
FT   CDS_pept        complement(480856..481056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72111"
FT                   /db_xref="GOA:Q031L1"
FT                   /db_xref="InterPro:IPR021324"
FT                   /db_xref="UniProtKB/TrEMBL:Q031L1"
FT                   /protein_id="ABJ72111.1"
FT                   /translation="MERSVIMKLIVTLFWSLALGQVVGYVATALAGVPDPELWATIISL
FT                   IFGLFVYLFQAVAVEKEAKAN"
FT   gene            complement(481146..481615)
FT                   /pseudo
FT                   /locus_tag="LACR_0513"
FT   gene            complement(481608..482162)
FT                   /locus_tag="LACR_0514"
FT                   /note="LactoCOG number LaCOG00337"
FT   CDS_pept        complement(481608..482162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0514"
FT                   /product="Predicted Rossmann fold nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72112"
FT                   /db_xref="GOA:Q031L0"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q031L0"
FT                   /protein_id="ABJ72112.1"
FT                   /translation="MNVTVFLSSRDGKNPIYKDTSEKLGRLLAQSGHTLVYGGSKEGCM
FT                   GMVSDSVIQNKGQVIAVYPAGVLPLEPPRQNASKLYLTNDMAERKRKLIDLGEAFVILA
FT                   GGFGTLEESFQLLTEMSINQTRVRPVIFVGQKFYQPLFDLLRLQLKEGMISKEVIDAIS
FT                   LVDSAEETIELLGDLKLEQVV"
FT   gene            complement(482162..482815)
FT                   /locus_tag="LACR_0515"
FT                   /note="LactoCOG number LaCOG00338"
FT   CDS_pept        complement(482162..482815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0515"
FT                   /product="Deoxynucleoside kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72113"
FT                   /db_xref="GOA:Q031K9"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:Q031K9"
FT                   /protein_id="ABJ72113.1"
FT                   /translation="MTVLVLAGTIGAGKSSLTEMLAEELKTQAFYESVDDNKVLPLFYE
FT                   NPQKYAFLLQIYFLNKRFDSIKRALSDNNNVLDRSIYEDSLLFHLNADLGRADETEVEV
FT                   YDDLLKNMLEEIDSLSFKKRPDLLIHVKVSFDKMLERIKKRGRQFEQLEYDPSLYDYYK
FT                   ELNSRYDTWFEAFDICPKIQIDGDKYDFVENEQSKIQVLQQIKAKLKEIEGENN"
FT   gene            complement(483341..484516)
FT                   /locus_tag="LACR_0516"
FT                   /note="LactoCOG number LaCOG00809"
FT   CDS_pept        complement(483341..484516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0516"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72114"
FT                   /db_xref="GOA:Q02VV8"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q02VV8"
FT                   /protein_id="ABJ72114.1"
FT                   /translation="MTQFTTELLNFLAQKQDIDEFFRTSLETAMNDLLQAELSAFLGYE
FT                   PYDKVGYNSGNSRNGSYSRQFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMV
FT                   IKLYQTGVTTREISDIIERMYGHHYSPATISNISKATQENVATFHERSLEANYSVLFLD
FT                   GTYLPLRRGTVSKECIHIALGITPEGQKAVLGYEIAPNENNASWSTLLDKLQNQGIQQV
FT                   SLVVTDGFKGLEQIISQAYPLAKQQRCLIHISRNLASNVKRADRAVILEQFKTIYRAEN
FT                   LEMAVQALENFIAEWKPKYRKVMESLENTDNLLTFYQFPYQIWHSIYSTNLIESLNKEI
FT                   KRQTKKKVLFPNEEALERYLVTLFEDYNFKQSQRIHKGFGQCADTLESLFD"
FT   gene            484697..485731
FT                   /pseudo
FT                   /locus_tag="LACR_0517"
FT   gene            485751..486884
FT                   /locus_tag="LACR_0518"
FT                   /note="LactoCOG number LaCOG01500"
FT   CDS_pept        485751..486884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72115"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:Q031K7"
FT                   /protein_id="ABJ72115.1"
FT                   /translation="MKKNIVFWSALVALVFLSQGKALANEVPGGTTTINGDNVVLEAPV
FT                   KAGQSEANETQAPKEELGQNDSVSLRSRMAVAPATQAQTLAVYRMYNANSGEHFYTKNS
FT                   YERDSLKNIGWNYEGVGWQAPESGSPVYRLYNPNSGEHFYTLSAYERDDLRKHGWNYES
FT                   ISFNSAANTGIPVYRVYNPNSGWHHYTLISYERDSLVKAGWRNEGVAWYAANNGQINND
FT                   NYRLLGVRNYDQYALGAPSGCEGAALLQALQYKGKITNWGLVQFLNTIPKSTDGSPNSG
FT                   FVGSPFVEASNVYSAIYPGPLSNWSKKYDTNVQNISGTSVDGLINEVKNGNPVVVWVTI
FT                   NFQPVRWGAWPFGSAVNNNQAVTLDGFNKSSQSGSCF"
FT   gene            487112..490324
FT                   /locus_tag="LACR_0519"
FT                   /note="LactoCOG number LaCOG00339"
FT   CDS_pept        487112..490324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0519"
FT                   /product="DNA polymerase III catalytic subunit, DnaE type"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72116"
FT                   /db_xref="GOA:Q031K6"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:Q031K6"
FT                   /protein_id="ABJ72116.1"
FT                   /translation="MFAPLNTKTEYSFLDSVVKLDDYLEGALRLGYKTVGICDVGNLHA
FT                   AFRFVRKAQMLNLQPVISIELNFEWRGLPVSFSFIAKNTEGYKNLLRISTFHNYDRRQF
FT                   SDIQNHLSGIALVIPETYGALSELSELAAFADEAYIGIDQQTDKGTKFNLPTLPFPAVR
FT                   YLNFADNEILAILHAVRDGLSFDESLTVSSNELLQRPEAYESYFQKYFPQALTNLSVLT
FT                   AKIAYPFDEKLELPRFDKKREAVEHLREEAILGLSARLEEKKSLTGISSVSLANALAEE
FT                   STMIDLSVYQERLEKELSVIHQMGFDDYFLIVADLLRYAREQDIYCGMGRGSAAGSLVA
FT                   YVLGITQVDPVKHNLFFERFLNPERVAMPDIDIDMPDDRRAELLAYMKNRYGSDHVAQI
FT                   VTFSTLGKRQALRDVGKAFGMTEAELSNLTRMLVRRFGTLADEYENNQRFKAEVLKNGK
FT                   LKRIYEVARRIEGMPRQTSTHASGVVLSEESLVNYVSLKPSEDLALTQYEAPDVEAIGL
FT                   LKIDFLGLRNLTIISRLRDLVKKRQKIDIDPLKIDLEDEATLALFRAGNTMGIFQFENP
FT                   QMRRFLRNLAPSKFDDIVDATSIFRPGPSQFIPQFVARRHGKEIVPVVDDSISEILKPT
FT                   YGIMIYQEQIMQVAQAFAGFSLGKADLLRRAISKKKGSELEKLREDFLISAGEMGHSKE
FT                   KAEEIYDLIERFANYGFNRSHGFAYGALAFQIAYFKAHFPDEFYEIQLRDRKREVMILD
FT                   ALDNGFEIEKPNINQMKIGDFVKNKKIRLGLAHVQGISRDLAKWIVENQSYKNLADFVE
FT                   KLPNNFHKKESILPLIQIGAFDYADSNRGKLAYNLADHANLLNYYSDDIFMASSGGGFA
FT                   YHEAEDYSETEKYDFEKNLLGIGVTPHPLQSLAQRFSGNFTPIANLVKNSRMTILVEIN
FT                   YIRTHRTKTGQTMAFLTVSDSRENFDVTLFPEIYRQFSSELEQGKFYLISGKVTERNDE
FT                   LQLVADRMSPALETDKKLWLNLRDEKYNQKISQILCEFPGSHQVILHYSNLKKTIQTKI
FT                   YVEESEFLKKRLEGYVIGIVYK"
FT   gene            complement(490356..491009)
FT                   /locus_tag="LACR_0520"
FT                   /note="LactoCOG number LaCOG00340"
FT   CDS_pept        complement(490356..491009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0520"
FT                   /product="Predicted membrane protein, hemolysin IIIrelated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72117"
FT                   /db_xref="GOA:Q031K5"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:Q031K5"
FT                   /protein_id="ABJ72117.1"
FT                   /translation="MEETQGSRTYQILNEIFNAITHGAGTGLAIAALVLLVIKGAASGS
FT                   ALEVVAFTIYGASLVILFLCSTLAHSLHFTKAVKVFRVFDHNGIFFLIAGTYTPYCLVA
FT                   LNNWLGWIVLAVIWICSILGIVLTSIYLPKWGKTPKLSTVLYVVLGWMILIVIYPLWNA
FT                   LHPVGFWLLVAGGVVYSVGALIYHFKFRFAHVVWHLFVLLAAILMFFSVYLYVG"
FT   gene            491211..492047
FT                   /locus_tag="LACR_0521"
FT                   /note="LactoCOG number LaCOG00341"
FT   CDS_pept        491211..492047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72118"
FT                   /db_xref="GOA:Q031K4"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:Q031K4"
FT                   /protein_id="ABJ72118.1"
FT                   /translation="MPIKIVTDSSITIEPELARELDITIVPLSVTIDGTMYSDDDLKFE
FT                   DFMVKMAASKNLPKTSQPPVGVFAEVYEKIAAEDDEIISIHLTEALSGTVEAARQGGML
FT                   SGRNVTVIDSDFTDQAQKFQVVEAARLAKTGATKEEILEKIKYIRENTELFIGFSTLEN
FT                   LVKGGRVSRMTGLFGSLLQVRVIGTLKDRELNTLLRGRGSKTFYKWLEELSDTISSSGR
FT                   KIREIGISHAQGLEFSQKAKDVLQKFVEKPISILDTNTTIATHTGPGAWAIMIDYE"
FT   gene            492102..492941
FT                   /locus_tag="LACR_0522"
FT                   /note="LactoCOG number LaCOG00342"
FT   CDS_pept        492102..492941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0522"
FT                   /product="Lysophospholipase L1 related esterase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72119"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q031K3"
FT                   /protein_id="ABJ72119.1"
FT                   /translation="MMKNFIRTFAGFLLAILLILGLFLLAFPKAGDRFRTEKKVSALSV
FT                   KHLSYAALGDSLTEGVGDATGQGGFVPLFAKEIENSTGGSVSSQNFGKAGDTSTQIYNR
FT                   MMKSKKITDGLKKANIITITIGGNDVLKVIRDNVTKLSSMTEKDFVKPEELYQARVKKL
FT                   LDKIREDNPQAQIYVLGIYNPFYLNFPDLTVMQNVIDSWNTATAGVVSQEKNTYFIPIN
FT                   NLLYKGSGDKQAVEADSSTSAVANNLLYTEDHFHPNNIGYQIMADAVFASYKEVNQK"
FT   gene            492938..494149
FT                   /locus_tag="LACR_0523"
FT                   /note="LactoCOG number LaCOG00343"
FT   CDS_pept        492938..494149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0523"
FT                   /product="Beta-glucosidase-related glycosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72120"
FT                   /db_xref="GOA:Q031K2"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:Q031K2"
FT                   /protein_id="ABJ72120.1"
FT                   /translation="MTKRLKKQAKPVVFLGIVIGCALIVSGVLGLSGHLNNQEAIKSKK
FT                   KNQVSETKTNSSSQNKSDQKMPKMTLEQKVGQLFMTGMPANNYDQATFDAIEKYQVGSI
FT                   ILTGRSNLSIPEMKVITDKLQGLAPANRRLLISCDQEGGNVQVLQGTGFSEMPNGLIQG
FT                   SWAPEKLQEEAKNWGSELSTAGINFDLAPVADQVLSADFAPQNAPIGYWSRQYAYDKAN
FT                   IVSHADAFSKGMKSAGVLTTAKHFPGLGAVTGNTDISAGVRDSQTNPKSESVQIFKELI
FT                   SSGVPSIMTATAIYDQIDPELPGAFSPKMVDGLLRNQLGFDGLVITDDLSNAVQVQAWS
FT                   PGQRAVLALAAGNDLVLANEPTQIPEMISEVLQKAKSDQGFAEKINQASSRVMKVKEQM
FT                   KLVE"
FT   gene            494158..494814
FT                   /locus_tag="LACR_0524"
FT                   /note="LactoCOG number LaCOG00344"
FT   CDS_pept        494158..494814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72121"
FT                   /db_xref="GOA:Q031K1"
FT                   /db_xref="InterPro:IPR018672"
FT                   /db_xref="UniProtKB/TrEMBL:Q031K1"
FT                   /protein_id="ABJ72121.1"
FT                   /translation="MENKESQTRKSKAKDSKKPKNEAEEKVKKSAIWKWLFLVLLAINL
FT                   AGIVFVAIRVTTPRDQTVLNQKSVSSSDQKVAQISSTTSQLNELINSYLETYQTKEMTY
FT                   KFYISNQQAVLEASYKLFGTKIPLYIYFEPLALSDGSISLSVQNISAGSLSLPTSEVLQ
FT                   IVKAYDLPDFVQVESKKNQIVINLPKIKLASNLYIKVNQIDLVKGNFIFDFMKNA"
FT   gene            494919..495194
FT                   /locus_tag="LACR_0525"
FT                   /note="LactoCOG number LaCOG00345"
FT   CDS_pept        494919..495194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0525"
FT                   /product="bacterial nucleoid protein Hbs"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72122"
FT                   /db_xref="GOA:Q031K0"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:Q031K0"
FT                   /protein_id="ABJ72122.1"
FT                   /translation="MANKQDLIAEVAAKTGLTKKDSEKAVNAFGEVVTEFLAKGEKVQL
FT                   IGFGTFETRERAAREGRNPQTGEAIKIAATVVPAFKAGKALKDAVK"
FT   gene            complement(495305..495802)
FT                   /locus_tag="LACR_0526"
FT                   /note="LactoCOG number LaCOG00346"
FT   CDS_pept        complement(495305..495802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0526"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72123"
FT                   /db_xref="GOA:Q031J9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q031J9"
FT                   /protein_id="ABJ72123.1"
FT                   /translation="MKVLLRKALPEDFQEIAFVHYKAWLETYHGLLPKSFLDKRSLESS
FT                   ITIFKNNHCANTVVAIADDKVVGFCCWGSLRENSFQENLGEIQGIYLLDAYQKNKIGRK
FT                   MIEFALEQLVTEKYSKVGLWVLNTNENAINFYKKMGFSDTGIFKEENLGEVVTEIFFTK
FT                   EL"
FT   gene            495985..496362
FT                   /pseudo
FT                   /locus_tag="LACR_0527"
FT   gene            496504..497052
FT                   /pseudo
FT                   /locus_tag="LACR_0528"
FT   gene            497064..497868
FT                   /pseudo
FT                   /locus_tag="LACR_0529"
FT   gene            498015..498824
FT                   /locus_tag="LACR_0530"
FT                   /note="LactoCOG number LaCOG00349"
FT   CDS_pept        498015..498824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0530"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72124"
FT                   /db_xref="GOA:Q031J8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q031J8"
FT                   /protein_id="ABJ72124.1"
FT                   /translation="MKIKNIEKSYGKNQVLKNISFELNQGEKVALLGNNGAGKSTLMNI
FT                   INGNLEASSGQIDYGTMNLTSNNTGYIMQNMTLPPDALGNEVLSLFARDENAKNYGRRL
FT                   VKEFRMESFLNRRFSNLSGGQKQKLFLISALQNSPEYFFLDEITTGLDSESRVELFKFL
FT                   TSNLKVKEATLLLVTHYLEEALQLCDRFIILKEGQIIADLKKSDLIQEDFSYLECSMNI
FT                   SDFEEYRIKEYQYKIPKKLAAEALVRFSKEIVLYQKDYRIDLEELLS"
FT   gene            498821..499546
FT                   /locus_tag="LACR_0531"
FT                   /note="LactoCOG number LaCOG00351"
FT   CDS_pept        498821..499546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72125"
FT                   /db_xref="GOA:Q031J7"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q031J7"
FT                   /protein_id="ABJ72125.1"
FT                   /translation="MKFLKYFAFGLRLRYRNPSQIFFVFIFPLFLMFAFSSSFGKSVPH
FT                   YIENNIASILLYSVLSASLTSLSVQIAEYQSGKIYQLFIQRGIKKIFYIAAQIASFMII
FT                   IFCSTIAILLVAHFSYHYDFPKLSILLVFYLKLYLYSLPFCLLAIIIRLLAKNTATASA
FT                   IAMPIMFLSFFFSGMMIPLSQLSGGIRKIADHFFLTQLLSDLNHTLTSTYTVILNWSVI
FT                   LLSFGVLCLLSIIVYKKKA"
FT   gene            499656..500066
FT                   /locus_tag="LACR_0532"
FT                   /note="LactoCOG number LaCOG00352"
FT   CDS_pept        499656..500066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0532"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72126"
FT                   /db_xref="GOA:Q031J6"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:Q031J6"
FT                   /protein_id="ABJ72126.1"
FT                   /translation="MIIARTEEEFSQVVKQYHLQDLTANEEDKLYLATNQGFEIIKIRE
FT                   ILYIKSIKNYLEFYTVGGKIRVRSPLYFYEKKLAKDFIKISRNTLVNFEQITRLETDFV
FT                   YGVVLWISEDKLPVSRRYLANINPKLKEGAKK"
FT   gene            500063..500440
FT                   /locus_tag="LACR_0533"
FT                   /note="LactoCOG number LaCOG02458"
FT   CDS_pept        500063..500440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72127"
FT                   /db_xref="GOA:Q031J5"
FT                   /db_xref="InterPro:IPR021560"
FT                   /db_xref="UniProtKB/TrEMBL:Q031J5"
FT                   /protein_id="ABJ72127.1"
FT                   /translation="MKYLISAFKGILIALVCGLFLTLLYGGKIELESMALILLYGFIQG
FT                   FISKVIDEFISIALVEFISQALCSYLLAFIYLLVNTWLFDNSWHNHIWSFTVTWLLIFI
FT                   LVYIYSMIRNRQIVKKFNKES"
FT   gene            500549..501694
FT                   /locus_tag="LACR_0534"
FT                   /note="LactoCOG number LaCOG00353"
FT   CDS_pept        500549..501694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0534"
FT                   /product="Cysteine sulfinate desulfinase/cysteine
FT                   desulfurase related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72128"
FT                   /db_xref="GOA:Q031J4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q031J4"
FT                   /protein_id="ABJ72128.1"
FT                   /translation="MIYFDNSATTAVNPMVLRTYTDVATKIMGNPSSLHGLGTTATRLL
FT                   EASRRQIAELLGLDSQEIFFTSGGTEGDNWIIKGVAFEKRPYGNHIIVSSVEHPAVKNA
FT                   AEWLKTQGFELDYAPVDADGFVIVSELEKLIRDETILISVMAVNNEVGAIQPIQEISEL
FT                   LADKPTISFHVDAVQAIGKVPLETWLTDRLDFATLSAHKFHGPRGVGIVVAKKGKRLTP
FT                   LLHGGGQEHNWRSTTENLAGIAATSKALRLAVDEDDFKRKKMLAMKQAILEELEKYKKV
FT                   YVFSKMTDFAPNILTFGIRGVRGEVVVHAFEQHDIYISTTSACSSKKNAADGTLVAMNV
FT                   PSKLATSAVRISLDPTNNMAEVEQFLTVFRQIYQELEKVSG"
FT   misc_binding    501729..501856
FT                   /bound_moiety="S-adenosylmethionine"
FT                   /note="SAM riboswitch (S box leader)"
FT   gene            501844..502722
FT                   /locus_tag="LACR_0535"
FT                   /note="LactoCOG number LaCOG00354"
FT   CDS_pept        501844..502722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0535"
FT                   /product="Cell wall-associated hydrolase, YG repeats"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72129"
FT                   /db_xref="GOA:Q031J3"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q031J3"
FT                   /protein_id="ABJ72129.1"
FT                   /translation="MNKRTNNDKKSGSKNIDKKGQLIILTCLVLLCFLVGYKIYHSQDV
FT                   QASTIKLVNKSNKTYAYAGQKKLTGLQTINGNNYYFDSSTGVMKTGLQTVNGGTVYFSP
FT                   ANGKMVYGLHKIDGYYYYFSKKTGKDDVVKAYEAVASQLTTNNKVIEKTISSGMKLVGK
FT                   SPYVYGGGRTDESVAKNEFDCSSFIAQVFRLGGQSLVYQFAASTSLLAQTGTAEEWSDK
FT                   ARGDLLITADDASEDEQHAAIYLGGGFILHDSTSTDGVSISRLNQVINKKVLGNMTCGQ
FT                   LFEPGHVRHEV"
FT   gene            complement(502779..504428)
FT                   /locus_tag="LACR_0536"
FT                   /note="LactoCOG number LaCOG00248"
FT   CDS_pept        complement(502779..504428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0536"
FT                   /product="ABC-type oligopeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72130"
FT                   /db_xref="GOA:Q031J2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q031J2"
FT                   /protein_id="ABJ72130.1"
FT                   /translation="MNKSKIIAFSAVSLSVALLLTACGNSSSKSEQPTQKANYSFASNI
FT                   LTLDTSMAADVNSIDVLLNVDAGLVRWNPDAQVVNDLAKSIDLSKDGKTYNVTLRDGLK
FT                   WSNGAKLTAADFVYGWQRTVDPKTGSQYAYALTPVANASEIMAGKKTVDSLGIKAESDT
FT                   KLVITLATPTPYFNKLLTLPAYYPVNEAFVKKMGNKYGTSSDTSLYNGAFKFVKGKNNW
FT                   TGSNETFSIVKNDQFYDAKNVKLSGATYQIVNNPNTAVNLFKSGKLDVANLATPELVSA
FT                   NKKNKDYKALTSPRIDVLEYNQSGKVPELSNLKIRQALNLATNRKNLLEIAAPSFSITN
FT                   TVTPKKLDQAPNGQDFATYAAQPYTYDAKKAAELFKEGLKELGKTSITLELEGANDNSF
FT                   AKAAVDYLKGNLEKDLPGLTINEKLVSSAQRQKDAQNNNFQILLTSWGADYNEPSDFLM
FT                   NFVSGSSMNHGLVDNKDFDKAYNAATTTPDVLSADKRYAHYKDAERALYESANVNPLAT
FT                   ESVSLLLNPKLKGISTYNSAMIFDLRHAEITK"
FT   gene            complement(504620..505585)
FT                   /locus_tag="LACR_0537"
FT                   /note="LactoCOG number LaCOG02497"
FT   CDS_pept        complement(504620..505585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0537"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72131"
FT                   /db_xref="GOA:Q031J1"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q031J1"
FT                   /protein_id="ABJ72131.1"
FT                   /translation="MSYNENKGAKKMTKIYENITELIGHTPIIKLQNVPADSADVYVKL
FT                   EAFNPGGSVKDRIALSMIRAAEADGRLQAGGTIVEPTSGNTGIGLAFVGSALGYKVVIV
FT                   MPESFSLERRKLIQAYGAKLVLTPASGGMKAAIAKAKELSETEGYFLAMQFENPANPEV
FT                   HEKTTGAEIIDAFGPTGLDAFVAGAGTGGTITGVSHALKKVNPNIKTYVVEADESAILS
FT                   GEPAGPHKIQGISAGFIPGNLDTKSYDEIIRVKGEDAILIARHLGGKEGFLVGISSGAA
FT                   IYAALEVAKKLGKGKKVLAIAPDNGERYLSTALYDFDSEK"
FT   gene            505771..506856
FT                   /locus_tag="LACR_0538"
FT                   /note="LactoCOG number LaCOG00356"
FT   CDS_pept        505771..506856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0538"
FT                   /product="Muramidase (flagellum-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72132"
FT                   /db_xref="GOA:Q031J0"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q031J0"
FT                   /protein_id="ABJ72132.1"
FT                   /translation="MKQKHKLALGASIVALASLGGIKAQAASVQEIINAAVPVANDYGL
FT                   YPSVMIAQGILESSGGQSALASNYNNIFGVKYTSGTPVYLPTQEYLNGVMTNVVEPFQS
FT                   YSSVYYACVAQAQMLRGSSYYSGAWRENTSSYLDATDWLEGRYATDPTYASKLNSVISE
FT                   LGLSIYDQGGEVSSASAVTTSSAATPNSVGTYKVQEGDSLSAIAAQYGTTVEALVSANS
FT                   LESANDIHVGEVLQVAGASSTTTNTSNTASSTSANTYTIKSGDSLYSIAEQYGMKVSSL
FT                   MSANGIYDVNTMLQVGQVLQVSTNSSTNASTSASSGSYTIQNGDSIYSIATANGMTADQ
FT                   LAALNGFGINDMIHPGKTIKI"
FT   gene            complement(506891..507523)
FT                   /locus_tag="LACR_0539"
FT                   /note="LactoCOG number LaCOG00357"
FT   CDS_pept        complement(506891..507523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0539"
FT                   /product="Zn-dependent hydrolase, including glyoxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72133"
FT                   /db_xref="GOA:Q031I9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q031I9"
FT                   /protein_id="ABJ72133.1"
FT                   /translation="MIIEKIVNKIAQENTYVLSNSTSYLIIDPGSDSAALLEYLKLTDK
FT                   AVCAILLTHAHFDHIMGLNDLKKYFPSAPIYLHHSEKEWMKNPELNASLFFLGKAITGP
FT                   DAEQFYKIGQDYNLDGFRFRVLETPGHSIGGVSLLFESEGDSCLFSGDALFKNAIGRWD
FT                   LPTGNQAQLLESIRDQLFRLDNHIRVLPGHGPETTIGAEKLHNPFFQ"
FT   gene            complement(507524..507775)
FT                   /pseudo
FT                   /locus_tag="LACR_0540"
FT   gene            507837..508517
FT                   /locus_tag="LACR_0541"
FT                   /note="LactoCOG number LaCOG03056"
FT   CDS_pept        507837..508517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0541"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72134"
FT                   /db_xref="GOA:Q02VJ5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q02VJ5"
FT                   /protein_id="ABJ72134.1"
FT                   /translation="MNHFKGKQFQQDVIIVAVGYYLRYNLSYREVQEILYDRGINVSHT
FT                   TIYRWVQEYGKLLYQIWKKKNKKSFYSWKMDETYIKIKGKWHYLYRAIDADGLTLDIWL
FT                   RKKRDTQAAYAFLKRLVKQFDEPKVVVTDKAPSITSAFKKLKEYGFYQGTEHRTIKYLN
FT                   NLIEQDHRPVKRRNKFYRSLRTASTTIKGMEAIRGLYKKTRKEGTLFGFSVCTEIKVLL
FT                   GIPA"
FT   gene            complement(508551..510422)
FT                   /locus_tag="LACR_0542"
FT                   /note="LactoCOG number LaCOG00358"
FT   CDS_pept        complement(508551..510422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0542"
FT                   /product="Membrane carboxypeptidase (penicillin-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72135"
FT                   /db_xref="GOA:Q031I7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q031I7"
FT                   /protein_id="ABJ72135.1"
FT                   /translation="MRYSKISTKSKKNKQNKWAKSGSAKSKWWTAVKLFLIVFFSLIIL
FT                   VLAAGGAVFVYYAKDAPALNLDKLESTPSPKVYDSKEHLVATLGAEQRNLVKTDNIPVM
FT                   LVNAVTSIEDHRFFNTRGIDPIRIAGAFVNNLKGGSLNGGSTLDMQLIKLSFFSTDESD
FT                   QTLSVKVQEAWMALKLDQKWTKEQIFTAYVNKVNMANGYYGMGTAAQAYYGKDLTELSI
FT                   AQLALLAGMPQAPNTYNPYTNATSVKWRRDMVIRSMRRYNKITAEEEKSALATPIDDGL
FT                   QPLQQSVTIPSYADNFLKQAIAQAKTLAGNDILNEGVKIYTILDTTAQQNLYNIVNSGN
FT                   YITYPDDTLQVASTVTDVKTGAVIAQIGGRNQPTDVTFGFNQAVQTDRDWGSTMKPIVD
FT                   YGPAFENNIYTSTNDYVSDSPTTYPNGTPLKNWDNTYFGSMTVKSALALSRNIPAVKTL
FT                   INVGLDNSSKFVDGLGINLNPLQYSNAISSNTDTKNGGASSEKMAAAYAAFSNGGIYTK
FT                   PYYVSKVVFPDGRTVEYKPVRSRAMQASTAYIMTNILQSVLTLPLSESVGSYAAVPGLP
FT                   AAGKTGTSNYTDSEMDQITEKYGSLPGMISPDENFVGYTPQGSVAKF"
FT   gene            complement(510409..511050)
FT                   /locus_tag="LACR_0543"
FT                   /note="LactoCOG number LaCOG00359"
FT   CDS_pept        complement(510409..511050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0543"
FT                   /product="Penicillin-binding protein-related factor A,
FT                   putative recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72136"
FT                   /db_xref="GOA:Q031I6"
FT                   /db_xref="InterPro:IPR004612"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031I6"
FT                   /protein_id="ABJ72136.1"
FT                   /translation="MVNYPNGRSQSYSAVPKKQKTLTELSVAKKSAPKSKSLVAFGKRG
FT                   MNFEAEINATNDYYLSRGLAVIHKKPTPIQIVKVDYPQRSRAKITEAYFRQASTTDYSG
FT                   VYKGHYVDFEAKETHQKTVFPLKNFHEHQIVHMSNVLAQRGIAFVLLHFADLEETYLLP
FT                   SSYLITFYYEKNGLKSIPLAYIRENGYKIETNHIPRIPYLEIVNKLCEVQ"
FT   gene            511131..511655
FT                   /locus_tag="LACR_0544"
FT                   /note="LactoCOG number LaCOG00360"
FT   CDS_pept        511131..511655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72137"
FT                   /db_xref="InterPro:IPR010697"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031I5"
FT                   /protein_id="ABJ72137.1"
FT                   /translation="MNSLLIMGYTSFDLGIFNEKDIKVSIIKKTIRRKLINFLEEGLRW
FT                   VIFTGNLGFEYWALEVAKELQTDYEFQIGTIFPFETHGQNWNENNQIKLASFKQVDFVK
FT                   YAFEAYENPGQFRQYNEFLLENTEGSFVFYDEENETKLKNMVEKMKQSSNYEVYLLNFE
FT                   DLQEIFEEMND"
FT   gene            511815..512201
FT                   /locus_tag="LACR_0545"
FT                   /note="LactoCOG number LaCOG00361"
FT   CDS_pept        511815..512201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0545"
FT                   /product="Arsenate reductase related protein, glutaredoxin
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72138"
FT                   /db_xref="GOA:Q031I4"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR023731"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q031I4"
FT                   /protein_id="ABJ72138.1"
FT                   /translation="MIDLYLSPSCTSCRKARAWLQSHKVPFVEHNILTQPMTTNDLRQI
FT                   LTKTENGTEDIISTRSKVFQKLAVDVDNLTINELLDLVTEFPNLLRRPIITDSKHLQIG
FT                   FNEDEIRAFLPREYRRAEMLTTID"
FT   gene            512422..512703
FT                   /locus_tag="LACR_0546"
FT                   /note="LactoCOG number LaCOG00362"
FT   CDS_pept        512422..512703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72139"
FT                   /db_xref="InterPro:IPR007920"
FT                   /db_xref="InterPro:IPR023324"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031I3"
FT                   /protein_id="ABJ72139.1"
FT                   /translation="MKENYNYPLDLSWSTTEMTEVLSFFNQVEKFYESKVEKELFLESY
FT                   AAFKKVVPSKMQEKQLGRDFEQSSGYSLYRALKEVEASGKRFVSADKA"
FT   gene            512669..513448
FT                   /locus_tag="LACR_0547"
FT                   /note="LactoCOG number LaCOG00363"
FT   CDS_pept        512669..513448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0547"
FT                   /product="Archaeal fructose-1,6-bisphosphatase related
FT                   enzyme of inositol monophosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72140"
FT                   /db_xref="GOA:Q031I2"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:Q031I2"
FT                   /protein_id="ABJ72140.1"
FT                   /translation="MGNDLSVLTRLELAKDWVRDAGNFLKENISSPLEITEKTRYDDLV
FT                   TNFDKEVQEQLVSNILHHFPEDKILAEEDDEKIKFDPEIPHLWILDPIDGTTNFIVQKD
FT                   NFAIMLAYYEFGVGKFGLILDVMKDKLYWCDSHKAFCNQKELESKKMSLDKSLLGVNSY
FT                   MYRTNSGGLLNLSHQTLGVRIIGSAGISYGQLLEGKILGYFSNLQPWDYAAGSIIAEKI
FT                   GFVTLTTSGEKPRFNCREQVFTAPAYLVSEIQKYIKS"
FT   gene            513543..514823
FT                   /locus_tag="LACR_0548"
FT                   /note="LactoCOG number LaCOG00364"
FT   CDS_pept        513543..514823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0548"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72141"
FT                   /db_xref="GOA:Q031I1"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:Q031I1"
FT                   /protein_id="ABJ72141.1"
FT                   /translation="MDKIIVKGGQTKLQGEVEIEGAKNAVLPLLAATLLASEGEVVLTN
FT                   APILSDVFMMNNLVDHLGTSISFDQEAKKIIAKANSEIKTTAPYEYVSKMRASIVVMGP
FT                   ILARNGQARVSMPGGCSIGSRPIDLHLRGFEQMGATITQNAGYIEAKADKLKGAHIYLD
FT                   FPSVGATQNLILAATLAEGVTTLENAAREPEIVDLANLLNKMGANVKGAGTDTIIIKGV
FT                   EKMHGAKHSVVQDRIEAGTFMVAAAMTQGDVLIKDAISEHNRPLISKLSEMGVNFTQEE
FT                   TGLRVVGPGKLKATSVKTLPHPGFPTDMQSQMAAAQAIAAGESVMVETVFENRFQHLEE
FT                   MRRMGLEVDITRNTALIQGNSNLQGAAVKSTDLRASAALILLGLVAKGQTTVRRLSHLD
FT                   RGYYKFHEKLKALGADIVRVKDEDGEE"
FT   gene            514823..515014
FT                   /locus_tag="LACR_0549"
FT                   /note="LactoCOG number LaCOG02460"
FT   CDS_pept        514823..515014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72142"
FT                   /db_xref="GOA:Q031I0"
FT                   /db_xref="InterPro:IPR024596"
FT                   /db_xref="UniProtKB/TrEMBL:Q031I0"
FT                   /protein_id="ABJ72142.1"
FT                   /translation="MFKKTIKFLGLRLSIIIFVIILLVLAIVLGLMVGYGFLGGGNPSN
FT                   IFNHDLWNEVMTKLSPGK"
FT   gene            515190..516473
FT                   /locus_tag="LACR_0550"
FT                   /note="LactoCOG number LaCOG00365"
FT   CDS_pept        515190..516473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0550"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   (trigger factor)"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72143"
FT                   /db_xref="GOA:Q031H9"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031H9"
FT                   /protein_id="ABJ72143.1"
FT                   /translation="MTVSFEKTSDTKGTLSFSIDQETIKTGLDKAFNKVKANISVPGFR
FT                   KGKISRQMFNKMYGEEALFEEALNAVLPTAYDAAVKEAAIEPVAQPKIDVAKMEKGSDW
FT                   ELTAEVVVKPTITLGDYKDLTVEVDATKEVTDEEVETRLTNAQNNLAELVVKETAAENG
FT                   DTVVIDFVGSVDGVEFEGGKGSNHSLELGSGQFIPGFEEQLVGTKSGETVEVKVTFPEN
FT                   YQAEDLAGKEALFVTTVNEVKAKELPELDDELAKDIDEEVETLEELKAKFRKELEESKS
FT                   EAYDDAVETAAIEAAVANAEIKEIPEEMIHEEVHRAMNEFLGGMQQQGISPEMYFQITG
FT                   TSEDDLHKQYEADADKRVRTNLVIEAIAAAESFTTSDEEVKAEIEDLAGQYNMPVEQVE
FT                   KLLPVDMLKHDIAMKKAVEVIATTAKVK"
FT   gene            516647..517822
FT                   /locus_tag="LACR_0551"
FT                   /note="LactoCOG number LaCOG00809"
FT   CDS_pept        516647..517822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0551"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72144"
FT                   /db_xref="GOA:Q031H8"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q031H8"
FT                   /protein_id="ABJ72144.1"
FT                   /translation="MTQFTTELLNFLAQKQDIDEFFRTSLETAMNDLLQAELSAFLGYE
FT                   PYDKVGYNSGNSRNGSYSRQFETKYGTVQLSIPRDRNGNFSPALLPAYGRGDDHLEEMV
FT                   IKLYQTGVTTREISDIIERMYCHHYSPATISNISKATQENVATFHERSLEANYSVLFLD
FT                   GTYLPLRRGTVSKECIHIALGITPEGQKAVLGYEIAPNENNASWSTLLDKLQNQGIQQV
FT                   SLVVTDGFKGLEQIISQAYPLAKQQRCLIHISRNLASNVKRADRAVILEQFKTIYRAEN
FT                   LEMAVQALENFIAEWKPKYRKVMESLENTDNLLTFYQFPYQIWHSIYSTNLIESLNKEI
FT                   KRQTKKKVLFPNEEALERYLVTLFEDYNFKQSQRIHKGFGQCADTLESLFD"
FT   gene            518197..519744
FT                   /locus_tag="LACR_r0552"
FT   rRNA            518197..519744
FT                   /locus_tag="LACR_r0552"
FT                   /product="16S ribosomal RNA"
FT   gene            519838..519910
FT                   /locus_tag="LACR_t0553"
FT                   /note="tRNA_Ala_TGC"
FT   tRNA            519838..519910
FT                   /locus_tag="LACR_t0553"
FT                   /product="tRNA-Ala"
FT   gene            520049..522949
FT                   /locus_tag="LACR_r0554"
FT   rRNA            520049..522949
FT                   /locus_tag="LACR_r0554"
FT                   /product="23S ribosomal RNA"
FT   gene            523033..523148
FT                   /locus_tag="LACR_r0555"
FT   rRNA            523033..523148
FT                   /locus_tag="LACR_r0555"
FT                   /product="5S ribosomal RNA"
FT   gene            523151..523223
FT                   /locus_tag="LACR_t0556"
FT                   /note="tRNA_Val_TAC"
FT   tRNA            523151..523223
FT                   /locus_tag="LACR_t0556"
FT                   /product="tRNA-Val"
FT   gene            523253..523325
FT                   /locus_tag="LACR_t0557"
FT                   /note="tRNA_Asp_GTC"
FT   tRNA            523253..523325
FT                   /locus_tag="LACR_t0557"
FT                   /product="tRNA-Asp"
FT   gene            523343..523415
FT                   /locus_tag="LACR_t0558"
FT                   /note="tRNA_Lys_TTT"
FT   tRNA            523343..523415
FT                   /locus_tag="LACR_t0558"
FT                   /product="tRNA-Lys"
FT   gene            523425..523506
FT                   /locus_tag="LACR_t0559"
FT                   /note="tRNA_Leu_TAG"
FT   tRNA            523425..523506
FT                   /locus_tag="LACR_t0559"
FT                   /product="tRNA-Leu"
FT   gene            523520..523592
FT                   /locus_tag="LACR_t0560"
FT                   /note="tRNA_Thr_TGT"
FT   tRNA            523520..523592
FT                   /locus_tag="LACR_t0560"
FT                   /product="tRNA-Thr"
FT   gene            523618..523689
FT                   /locus_tag="LACR_t0561"
FT                   /note="tRNA_Gly_GCC"
FT   tRNA            523618..523689
FT                   /locus_tag="LACR_t0561"
FT                   /product="tRNA-Gly"
FT   gene            523728..523801
FT                   /locus_tag="LACR_t0562"
FT                   /note="tRNA_Arg_ACG"
FT   tRNA            523728..523801
FT                   /locus_tag="LACR_t0562"
FT                   /product="tRNA-Arg"
FT   gene            523807..523880
FT                   /locus_tag="LACR_t0563"
FT                   /note="tRNA_Pro_TGG"
FT   tRNA            523807..523880
FT                   /locus_tag="LACR_t0563"
FT                   /product="tRNA-Pro"
FT   gene            523918..523991
FT                   /locus_tag="LACR_t0564"
FT                   /note="tRNA_Met_CAT"
FT   tRNA            523918..523991
FT                   /locus_tag="LACR_t0564"
FT                   /product="tRNA-Met"
FT   gene            524004..524077
FT                   /locus_tag="LACR_t0565"
FT                   /note="tRNA_Met_CAT"
FT   tRNA            524004..524077
FT                   /locus_tag="LACR_t0565"
FT                   /product="tRNA-Met"
FT   gene            524085..524157
FT                   /locus_tag="LACR_t0566"
FT                   /note="tRNA_Phe_GAA"
FT   tRNA            524085..524157
FT                   /locus_tag="LACR_t0566"
FT                   /product="tRNA-Phe"
FT   gene            524168..524238
FT                   /locus_tag="LACR_t0567"
FT                   /note="tRNA_Gly_TCC"
FT   tRNA            524168..524238
FT                   /locus_tag="LACR_t0567"
FT                   /product="tRNA-Gly"
FT   gene            524264..524337
FT                   /locus_tag="LACR_t0568"
FT                   /note="tRNA_Ile_GAT"
FT   tRNA            524264..524337
FT                   /locus_tag="LACR_t0568"
FT                   /product="tRNA-Ile"
FT   gene            524380..524467
FT                   /locus_tag="LACR_t0569"
FT                   /note="tRNA_Ser_GCT"
FT   tRNA            524380..524467
FT                   /locus_tag="LACR_t0569"
FT                   /product="tRNA-Ser"
FT   gene            524653..526566
FT                   /locus_tag="LACR_0570"
FT                   /note="LactoCOG number LaCOG00366"
FT   CDS_pept        524653..526566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0570"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72145"
FT                   /db_xref="GOA:Q031H7"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:Q031H7"
FT                   /protein_id="ABJ72145.1"
FT                   /translation="MVSVDTEVVNDLKSKVNIADLILQYVALSRTGKNYIGLCPFHGEK
FT                   TPSFNVNAEKGFYHCFGCGRSGDAIEFLKEYNQVGFIDAVKELANFAGVTLDISNDREE
FT                   KNNPNAPLYEINNQAARLYNILLMSTELGERARDYLAERGITDDVIKRFNIGLAPEEND
FT                   FIFKNLSNKFDEEVMANSGLFHFSNNRVFDAFTNRIMFPITNEYGQTIGFSGRKWQEND
FT                   DSKAKYINTSATTIFDKSYELWNLDKAKPTISKRREVYLMEGFMDVIAAHKAGINNVVA
FT                   SMGTALTEKHVRRLKQIAKKFVLVYDGDSAGQNAIYKALNLVGESDVQIVKVPEGLDPD
FT                   EYSKTYGLTGLSALMETGRIQPIEFLIDFLRPENLANLQVQLDFIEQIAPMIAKLQSIT
FT                   AQDAYIRKLVEILPDFEYNQVEQAVNLRRENMNITDHSVSDYGASNLVENFADKRDYSN
FT                   LDSAIPIDFEEIFYENNIQPQVADRRNEPAQVFQPTIQVPKLSRSERAEEMLLHRMIYH
FT                   SSVLKKFSQDDNFRFVHKRYQDIFEKILLEAMVYEQIDESHLASELSEDQRSLFYQIIS
FT                   LDLPETASSQEINDLVSIFSNEMEQIKFEELQQQLATAEKAGNKERMLELTLQIINQKK
FT                   KL"
FT   gene            526643..527986
FT                   /locus_tag="LACR_0571"
FT                   /note="LactoCOG number LaCOG00367"
FT   CDS_pept        526643..527986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0571"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72146"
FT                   /db_xref="GOA:Q031H6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q031H6"
FT                   /protein_id="ABJ72146.1"
FT                   /translation="MAANKKRISQISKETGVQNRVLVEKAQEIGLLVKSHSSSVGPGEE
FT                   RRLLEALNVKPVVVEKMDSPKTLARVEIKENGDTFNVKAYEKAVKGYITKRKPLGEALD
FT                   EEIMDELSVKFGIVDDALEDLFKQIQDAGISIVDKDGNPSPLALVTDEIEKEEVSDTAM
FT                   DEIVTNVRIDDPVRMYLKEIGRYPLISLDEETKLAEAIIAGGEGAEFAKQMLAEANLRL
FT                   VVSIAKRYSGRGMQFLDLIQEGNMGLMKAVDKFDHTKGFKFSTYATWWIRQAITRAIAD
FT                   QARTIRIPVHMVETINKLIRVQRNLLQELGRDPSPEEIGKELHMAPDKVREVLKIAQEP
FT                   VSLETPIGEEDDSHLGDFIEDDVIESPVDYTNRILLREQLDEVMDTLTDREENVLRMRF
FT                   GLDDGRMHTLEDVGKQFKVTRERIRQIEAKAIKKLRHPRRSKPLRDFM"
FT   gene            528084..528828
FT                   /pseudo
FT                   /locus_tag="LACR_0572"
FT   gene            528994..530373
FT                   /locus_tag="LACR_0573"
FT                   /note="LactoCOG number LaCOG00368"
FT   CDS_pept        528994..530373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0573"
FT                   /product="glycerol-3-phosphatase transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72147"
FT                   /db_xref="GOA:Q031H5"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q031H5"
FT                   /protein_id="ABJ72147.1"
FT                   /translation="MLGFLKPAPDAEQKISEEKVPRLYKIWQIRVLISTEMVYIGYYII
FT                   RLIFTVQQNDISKAYGFSMGQIGTILSMFGIGYGISKIIMGTLADRANPNRYVATGLIV
FT                   SSIINALYGTTQSFGMIVFLMLLNSVMQGMGATACQRLVGLWFGRKGKGSIMARGTAFS
FT                   IWSSAHNAGAFMSVAVINLSALFFGASLQWSFWTASIVSIVIAVIVLFLGSDRPTTKGL
FT                   PTIEEYSGDKVVIKDGEVVEGDVSDENVFKIFFEYIVKNKLVWAVILTSLSIYVVRYGI
FT                   MSWIPNYLVNVKGFDNSTAKWLTGIFELAAVPGVIIIGFITDLLKGRRAIMVLISLIAM
FT                   LACLITYFAATNHTLIIIVLLIMGTFIYAPATIVGLMVNEAVPKFANGMSTGTMGFCQY
FT                   IIGEVTATLVIGWVVQSYGWSAGNIIVYAFAGIAILASIYILIHQNKLYKKIDNAAEIA
FT                   E"
FT   gene            530529..531398
FT                   /locus_tag="LACR_0574"
FT                   /note="LactoCOG number LaCOG01967"
FT   CDS_pept        530529..531398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0574"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72148"
FT                   /db_xref="GOA:Q031H4"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:Q031H4"
FT                   /protein_id="ABJ72148.1"
FT                   /translation="MENQPTFCPNCGKEIEAGSVFCTNCGTKMENQPANETSTANSVKP
FT                   FVTEEQREILKNGATNLWEWIVSAVKAPTKNVQENTPLWFSWLSITLTAIFGALALGKI
FT                   LVNIITNTSTSVGNALGSANNSLGSLCNQNVGNTVANTANHVFGQMIFPIIISFIILHA
FT                   ATILGGWLANFAILGDKTFTFKKMLNYYGRFYVLLFALNFVSFLFALIGINALAIFIIY
FT                   LALMLWGFISFFTYINTIHQRKMDTFYIKLLAWLANSAILGLAFLIVFAIMGSEIATLI
FT                   SNATGGIL"
FT   gene            531408..531872
FT                   /pseudo
FT                   /locus_tag="LACR_0575"
FT   gene            531911..532672
FT                   /pseudo
FT                   /locus_tag="LACR_0576"
FT   gene            532901..533245
FT                   /locus_tag="LACR_0577"
FT                   /note="LactoCOG number LaCOG02450"
FT   CDS_pept        532901..533245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0577"
FT                   /product="Serine-pyruvate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72149"
FT                   /db_xref="GOA:Q031H3"
FT                   /db_xref="UniProtKB/TrEMBL:Q031H3"
FT                   /protein_id="ABJ72149.1"
FT                   /translation="MTTTVYFEKDGGIDIELKGARKVLSLRKYIRIEPEKVENVQLISD
FT                   LKKPKFYKKVAGTNAWYYGGWFRENGENEFWDVRNNNRVLVITTNNFKYKKLYIEVGPD
FT                   FRLNSFVSGR"
FT   gene            533291..535537
FT                   /locus_tag="LACR_0578"
FT                   /note="LactoCOG number LaCOG00369"
FT   CDS_pept        533291..535537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0578"
FT                   /product="ATP-binding subunit of Clp protease and DnaK/DnaJ
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72150"
FT                   /db_xref="GOA:Q031H2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q031H2"
FT                   /protein_id="ABJ72150.1"
FT                   /translation="MLCQNCNINEATIHLYTSVNGQKKQIDLCQNCYQIMKSGGQEALF
FT                   GAGNASNGNSDEPFNPFNDIFSALQGQDFNGAASNQTPPTQTGGRGPRGPQNPRAKQPK
FT                   GMLEEFGINITESARRGEIDPVIGRDEEIKRVIEILNRRTKNNPVLIGEPGVGKTAVVE
FT                   GLAQKIVDGDVPQKLQNKEVIRLDVVSLVQGTGIRGQFEERMQKLMDEIRKRNDVIMFI
FT                   DEIHEIVGAGSAGDGNMDAGNILKPALARGELQLVGATTLNEYRIIEKDAALERRMQPV
FT                   KVDEPSVDETITILRGIQARYEDYHHVKYTDEAIEAAAHLSNRYIQDRFLPDKAIDLLD
FT                   ESGSKKNLTLKFVDPEDINRRIADAESKKNEATKAEDFEKAAHFRDQISKLRELQKQEV
FT                   TDEDMPVITEKDIEQIVEQKTQIPVGDLKEKEQTQLINLADDLKAHVIGQDEAVDKISK
FT                   AIRRSRVGLGKPNRPIGSFLFVGPTGVGKTELAKQLAKELFGSSESMIRFDMSEYMEKH
FT                   SVAKLIGAPPGYVGYEEAGQLTERVRRNPYSLILLDEIEKAHPDVMHMFLQILEDGRLT
FT                   DAQGRTVSFKDSLIIMTSNAGTGKVEASVGFGAAREGRTKSVLGQLGDFFSPEFMNRFD
FT                   GIIEFSALSKENLLKIVDLMLDEVNEQIGRNDIHLSVTQAAKEKLVDLGYNPAMGARPL
FT                   RRTIQENIEDSIADFYIEHPEYKQLVADLIDDKIVISNQTQETAETTDEEVPAE"
FT   gene            complement(535663..536133)
FT                   /locus_tag="LACR_0579"
FT                   /note="LactoCOG number LaCOG00371"
FT   CDS_pept        complement(535663..536133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0579"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72151"
FT                   /db_xref="GOA:Q031H1"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q031H1"
FT                   /protein_id="ABJ72151.1"
FT                   /translation="MKLSSGWEQSVYVLLILARLPENRTMSSIALANRLKVSPSYLKKI
FT                   IKSLVDEGLLRSTTGKNGGFSLNKDLLDISFYDVFLAIEGRGRIFQSQGLLQNFIGAES
FT                   GKAQHCAITTALDEIENTLVRTLSNVSLAQVADETQYNYNLGYLDEWIDEMD"
FT   gene            536359..537372
FT                   /locus_tag="LACR_0580"
FT                   /note="LactoCOG number LaCOG02463"
FT   CDS_pept        536359..537372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0580"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72152"
FT                   /db_xref="GOA:Q031H0"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q031H0"
FT                   /protein_id="ABJ72152.1"
FT                   /translation="MVVKVGINGFGRIGRLALRRIQEVEGVEVAQINDLTDPAMLAHLL
FT                   KYDTTQGRFKGTVEVKEDGFDVNGKFVKVTAERNPEDIQWADSGVEIVLEATGFFATKE
FT                   KAEKHLHPGGAKKVLITAPGGNDVKTVVFNTNHTILDGSETVISAGSCTTNSLAPMADA
FT                   LNKNFGVKGGTMTTVHSYTGDQMTLDGPHRGGDFRRARAAAENIVPASSGAAKAIGLVL
FT                   PELSGLMKEHAQRVSTPTGSITELVTVLEKHVTVDEINEAMKAVADESFGYNVDEIVSS
FT                   DIIGMAYGSLFDATLTEVTDLKDGGQLVKTAAWYDNEMSFTAQLIRTLEYFAKIAK"
FT   gene            complement(537596..538231)
FT                   /locus_tag="LACR_0581"
FT                   /note="LactoCOG number LaCOG00372"
FT   CDS_pept        complement(537596..538231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0581"
FT                   /product="N-formylmethionyl-tRNA deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72153"
FT                   /db_xref="GOA:Q031G9"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q031G9"
FT                   /protein_id="ABJ72153.1"
FT                   /translation="MNRDEIQANLIKASHMISMDDIIREGYPTLREVANDVTLPLSDED
FT                   IILGEKMLQFLHNSQDPVMAEKMGLRGGVGLAANQLGLLKKVIAVLIPNEPEVDEEGNE
FT                   IPPKEAYKMREIMYNAKVVSHSVQDAAVEGGEGCLSVDREVPGYVVRHARVTVEYYNKE
FT                   GEKKKIRLKDFPAICVQHEIDHTNGVMFYDHINMNDPWEIKDGMIIVK"
FT   gene            538386..538790
FT                   /locus_tag="LACR_0582"
FT                   /note="LactoCOG number LaCOG02464"
FT   CDS_pept        538386..538790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0582"
FT                   /product="NUDIX family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72154"
FT                   /db_xref="GOA:Q031G8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/TrEMBL:Q031G8"
FT                   /protein_id="ABJ72154.1"
FT                   /translation="MKEYRQNVAAIILNKENKIWLAKRADGMNWGFPQGGIEAGENPES
FT                   AIIRELSEEIGTKNFEIIGQYPGTLKYDFPKDMKFPTWTYAGQEQHYFLVRLDEQAKID
FT                   LESHPEEIEFSSYQFLSLTEILKIDFGFKS"
FT   gene            538852..540930
FT                   /locus_tag="LACR_0583"
FT                   /note="LactoCOG number LaCOG00373"
FT   CDS_pept        538852..540930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0583"
FT                   /product="Excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72155"
FT                   /db_xref="GOA:Q031G7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031G7"
FT                   /protein_id="ABJ72155.1"
FT                   /translation="MAIERITDNKFELVSKYDPAGDQGQAISELVENIENGEKAQILRG
FT                   ATGTGKTYTMSQVIAQTGKPTLVMAHNKTLAGQLYSEFKEFFPNNAVEYFVSYYDYYQP
FT                   EAYVPSSDTYIEKDSSVNDEIDKLRHSATSSLLERNDVIVVASVSCIYGLGSPKEYQDS
FT                   VVSLRPGQEISRDQLLNDLVGIQFERNDIDFQRGCFRVRGDVVEVFPASRDEHAFRVEF
FT                   FGDEIDRIREIEVLTGQVLGEVDHLAIFPATHFMTNDDRMEESIAKIEAELEAQLKVFR
FT                   SEGKLLEAQRLEQRTNYDIEMLREMGYCNGVENYSRHMDGREEGEPPYTLLDFFPDDFM
FT                   IMIDESHMTMGQVKGMYNGDRARKEMLCNYGFRLPSALDNRPLKREEFESHVHQIVYVS
FT                   ATPGDYEMEQTDTIVEQIIRPTGLLDPVVEVRPMMGQIDDLVGEIHKRAEKNERVFVTT
FT                   LTKKMSEDLTAYFKEMGIKVKYMHSDIKTLERTEIIRDLRLGVFDVLVGINLLREGIDV
FT                   PEVSLVAILDADKEGFLRNERGLIQTIGRAARNSEGHVILYSDMAKALDENDPADKEIL
FT                   DSGYYTEYEGQKYKITRSMKHAMDETARRRDIQMAYNEEHGITPQTIKKEIRDLIAITK
FT                   KTDSGELEEVDASAMNKKERKALVKKLEKEMQQAAAALDFEGAAQLRDMVLELRAMD"
FT   gene            541112..541933
FT                   /locus_tag="LACR_0584"
FT                   /note="LactoCOG number LaCOG00374"
FT   CDS_pept        541112..541933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0584"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72156"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q031G6"
FT                   /protein_id="ABJ72156.1"
FT                   /translation="MNKNVKKMTLGLVGLAAVATLAACGNGKSATNQVDKVKKAGVLKV
FT                   ALSPDYPPFEFQIIKDGKNTVVGSDVDLANAIGKKLGVKVKIESMDFNNVLASLNTGKA
FT                   DIAISGISKEPSREKSVNFSDVYYTASNYLVVKKSDLGKYSSVDDFKGKKVAAQKGSIQ
FT                   EGIVTSQFKGTTEIALPQIGDEINEVKGGQVQGAVIENLIAKSYVAANSDLAIANVEVK
FT                   TPKDSYGSAVALPKGSDELTKVVNSVIKEELKNGQINKDIQKNYTLSENNK"
FT   gene            541948..543011
FT                   /pseudo
FT                   /locus_tag="LACR_0585"
FT   gene            complement(543118..543573)
FT                   /locus_tag="LACR_0586"
FT                   /note="LactoCOG number LaCOG00376"
FT   CDS_pept        complement(543118..543573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0586"
FT                   /product="3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl
FT                   carrier protein) dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72157"
FT                   /db_xref="GOA:Q031G5"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q031G5"
FT                   /protein_id="ABJ72157.1"
FT                   /translation="MTKKYAMTATEVMEVIPNRYPIMFIDYVDEISENKIVATKNVTIN
FT                   EEVFNGHFPGNPTFPGVLILESLAQAGSILILKKEEFQGKMAYIGAIDKAKFRQKVTPG
FT                   DVMKLEFEITKFRGKVGTADAAAYVDGKKVTTCQFTFIVDEAAEQTN"
FT   gene            543849..544601
FT                   /locus_tag="LACR_0587"
FT                   /note="LactoCOG number LaCOG00377"
FT   CDS_pept        543849..544601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0587"
FT                   /product="Enoyl-[acyl-carrier-protein] reductase (NADH)"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72158"
FT                   /db_xref="GOA:Q031G4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q031G4"
FT                   /protein_id="ABJ72158.1"
FT                   /translation="MFLEGKKIVIMGVANNKSIAWGCAKAMKDQGATLIYTYQNERMEK
FT                   QLAKLAEPEDLLIECDVTSDESIRRAFGTIEARVGKIDGLVHAVAYSKKEDLGGNVTDI
FT                   SRDGYALAQDISAYSLLAVAKAAKPLLKKGSGIVTLTYMGSVRAIPNYNVMGIAKAALE
FT                   STVRYLAAEMAHVGVHVNGISAGAIKTLAVSGVSGYKDLIKESDSRTADGVGVTIEEVG
FT                   QTAAFLVSPLASGVIGDIVYVDKGVHLT"
FT   gene            complement(544787..545749)
FT                   /locus_tag="LACR_0588"
FT                   /note="LactoCOG number LaCOG00378"
FT   CDS_pept        complement(544787..545749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0588"
FT                   /product="Preprotein translocase subunit YidC"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72159"
FT                   /db_xref="GOA:Q031G3"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:Q031G3"
FT                   /protein_id="ABJ72159.1"
FT                   /translation="MKNLKKKLTLTGLMTSGLLLLSGCVQTHVVDGVRVPTEAATHGIT
FT                   YNLLVRPMSAFVDLFANNLHLGYGWGIIFVTLIIRFLILPLGLNQAYKSTYMQEKMAYL
FT                   APVFAPLQERLKKAQTPEEKMAAQQALMAAQKDNGINMLSSIGCLPMLIQWPFFIALYN
FT                   AAAYTTGISSSTFYGIPLGHPSIVLVIISGVLYFIQTWISTLSMTPEQKKSGMAMLIMS
FT                   PAMIVVFSFMSPAGVALYWAVGGFVIVIQQVIITFIMKPRMRRRIDEEFTKNPPKINDE
FT                   GIKDVTPTSVQENFKAITSERNEKERKSGGRNAGKQNRK"
FT   gene            complement(545924..546682)
FT                   /locus_tag="LACR_0589"
FT                   /note="LactoCOG number LaCOG02465"
FT   CDS_pept        complement(545924..546682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0589"
FT                   /product="Predicted hydrolase of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72160"
FT                   /db_xref="GOA:Q031G2"
FT                   /db_xref="InterPro:IPR005002"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q031G2"
FT                   /protein_id="ABJ72160.1"
FT                   /translation="MKKILSFDIDNTLNEPKMPIFPEMAELLATLSQKYIIAPISGQKY
FT                   DQFLIQIINNLPESANLDNFHLFVAQGTQYYAHKAGEWKQVFNYALTDEQANAIMGALE
FT                   KAAKELGHWDESVLLPGDEINENRESMIAYSAIGQKAGVEAKQAWDPDMTKRNEIAKLA
FT                   SQYAPEFEFEVAGTTTINGFVPGQNKEFGMNHLMEELNVTKEEILYFGDMTQPGGNDYP
FT                   VVQMGIETITVRDWKETAAILKAIIAMEEA"
FT   gene            complement(546777..547367)
FT                   /locus_tag="LACR_0590"
FT                   /note="LactoCOG number LaCOG00379"
FT   CDS_pept        complement(546777..547367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0590"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72161"
FT                   /db_xref="GOA:Q031G1"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:Q031G1"
FT                   /protein_id="ABJ72161.1"
FT                   /translation="MKKSKASDVAILAIFIAIMVVVQLFTQFVINVWPFPVKPTLLHLP
FT                   VIIGSIILGWRKGAFLGLVWGLISFVTATIVTTPTSFLFSPFQPVIGTHHGSPWGLFIA
FT                   FIPRILVGILPYFVYKIANNRLGAGLAAFAGTATNTILVLTSIFLFFGSTLKWSLSYLL
FT                   GAIVATNSLTEVIIAVILTTAIVPALTKARNNS"
FT   gene            complement(547384..547920)
FT                   /pseudo
FT                   /locus_tag="LACR_0591"
FT   gene            complement(547913..548608)
FT                   /locus_tag="LACR_0592"
FT                   /note="LactoCOG number LaCOG00381"
FT   CDS_pept        complement(547913..548608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0592"
FT                   /product="Phosphopantothenoylcysteine
FT                   synthetase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72162"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR011848"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="UniProtKB/TrEMBL:Q031G0"
FT                   /protein_id="ABJ72162.1"
FT                   /translation="MKVLITSGGTTEPIDEVRGISNFATGSLGKLAAEKFLQAGHEVFL
FT                   LAGLQAVLPENAALLTHIPIEGTKDLYQQMEKLVPKMDVVIHSMAVSDYRPVYMTGLEN
FT                   FSGSLSVDELLDYRPEQVGKISSKSDHQIMLLEKTPKIISYIKKWNPKVLLFGFKLLVD
FT                   VENSELLHVAREKLLTTEADFILANDLKNIEGQKHKALLVSKNEVTALDTKSEIADSLL
FT                   KISEELKND"
FT   gene            complement(548754..548939)
FT                   /locus_tag="LACR_0593"
FT                   /note="LactoCOG number LaCOG00382"
FT   CDS_pept        complement(548754..548939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0593"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72163"
FT                   /db_xref="GOA:Q031F9"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:Q031F9"
FT                   /protein_id="ABJ72163.1"
FT                   /translation="MPYVHVELFEGRTVEQKAAIAKEITETISKHAGAPTSGIHVIFND
FT                   LPEGMLYQGGEMKKKK"
FT   gene            549125..551452
FT                   /locus_tag="LACR_0594"
FT                   /note="LactoCOG number LaCOG00383"
FT   CDS_pept        549125..551452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0594"
FT                   /product="Cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72164"
FT                   /db_xref="GOA:Q031F8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q031F8"
FT                   /protein_id="ABJ72164.1"
FT                   /translation="MSLKGLTSLEVEERIRQGKINKNLAETDRPVWEIVKRNTFTFFNL
FT                   IFAVIAVLISLVQAWNQLIFLPIIVINTVVGIYQEIRAKRYLDEMTLLHAPQSTVIRNG
FT                   KQEKIASDDLVEEDIIILKTGNQIVADARIVEGSIFVNESLLTGEADEIEKNVDDKLLS
FT                   GSFVVSGEARVILEKVGKDSYISKLTEQAKLVSHGEDSEMLRALNKLLKWVSFIILPIA
FT                   VILFTQNYFVNHNTLQTSVVAMVAAVIGMIPEGLYLLTTIALTLSSVKLARNQVLLHNM
FT                   KSIESLARVDVLCVDKTGTITEPRMSVEQVFVSPSSEMNEQKFMGVLSNYISANSDDND
FT                   TMKAIREFMLAKGDLQNQITGVKKIIPFSSKVKYSAVCFENESYLLGAPEIVLGKNYEK
FT                   ISSEINHLLKEGFRVLVLARTEEKNYEQLNLGTQALGYVVLANPIRENARETFNYFAQQ
FT                   GVNIKVISGDNPQTVSAVAKRAGIMRAEHFIDANLLKTEEDLDQAIESYTVFGRVTPDQ
FT                   KRRLVQALKRKGHTVAMTGDGVNDILAMKSADCSIAMASGSDAATQVAQVVLLDSDFGH
FT                   MTQVVTEGRRVVNNVQRSAILFLVKNLFSIILAIISAIFVFTYPLQASQLSLISLFTIG
FT                   IPGFLLSLEENDKRIEKDFIKNVILKALPASLTEITAVLGVVIAGAAFKLTASEISTSA
FT                   VILLAVVGFMILTKISAPLNRFKMGIIIFNIVGIILSGFIFNSLFSISKISLDSFVLVA
FT                   LLSLFSESLFRNFDSLLKKYFK"
FT   gene            551485..551928
FT                   /locus_tag="LACR_0595"
FT                   /note="LactoCOG number LaCOG00384"
FT   CDS_pept        551485..551928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0595"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72165"
FT                   /db_xref="GOA:Q031F7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q031F7"
FT                   /protein_id="ABJ72165.1"
FT                   /translation="MEEISQSRRTPALIEELVVLWEKSVEVSHLFLSTEEISEIKKYVP
FT                   QALKEIKHLIIESDKKGKPIAFMGIYEQKLEMLFLNPDDMNKGLGRKLLEEAISHYLVR
FT                   ELTVNEQNPQARAFYEYMGFKIYKREAIDEQGQPYPILYMNLV"
FT   gene            552156..552323
FT                   /pseudo
FT                   /locus_tag="LACR_0596"
FT   gene            complement(552375..553229)
FT                   /locus_tag="LACR_0597"
FT                   /note="LactoCOG number LaCOG00439"
FT   CDS_pept        complement(552375..553229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0597"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72166"
FT                   /db_xref="GOA:Q02XN1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q02XN1"
FT                   /protein_id="ABJ72166.1"
FT                   /translation="MSAADMAQTIQPLALNVRLSCQLLDVPESSYYQRINRHPSKTQLR
FT                   RQYLSLKISQLFNANRGIYGAPKIHHLLLKQGEKVGLKLVQKLMKQLQLKSVVIKKFKP
FT                   GYSLSDHINRKNLIQTEPTKKNKVWSTDITYIPTQQGWAYLSTIMDRYTKKVIAWDLGK
FT                   RMTVELVQRTLNKAIKSQDYPEAVILHSDQGSQYTSLEYEELLKYYGMTHSFSRRGYPY
FT                   HNASLESWHGHLKREWVYQFKYKNFEEAYQSIFWYIEAFYNSKRIHQSLGYLTPNQFEK
FT                   VSA"
FT   gene            complement(553226..553486)
FT                   /locus_tag="LACR_0598"
FT                   /note="LactoCOG number LaCOG00049"
FT   CDS_pept        complement(553226..553486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0598"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72167"
FT                   /db_xref="GOA:Q02W89"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q02W89"
FT                   /protein_id="ABJ72167.1"
FT                   /translation="MQKRYSKEFKETLIAFYHSGQSVTQLSKEYDVAPATIYKWIDLYS
FT                   KSNESSVSKADFLELKRQLAKVKEERDILKKVLTIFAEKKK"
FT   gene            553558..553674
FT                   /locus_tag="LACR_0599"
FT   CDS_pept        553558..553674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72168"
FT                   /db_xref="UniProtKB/TrEMBL:Q031F4"
FT                   /protein_id="ABJ72168.1"
FT                   /translation="MIFGDEEEIKTAVGYVFLELSRSIMPAFVKEKLRLKKA"
FT   gene            553704..554534
FT                   /locus_tag="LACR_0600"
FT   CDS_pept        553704..554534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72169"
FT                   /db_xref="UniProtKB/TrEMBL:Q031F3"
FT                   /protein_id="ABJ72169.1"
FT                   /translation="MLTLFYTFSDFGRWYNLRQDKVLKEDENPIDFIEMERILWQVCKI
FT                   KMIRLFKEKVINPSFNEYDNKFHFNLINEKLNKNFYNDFIKILIPEIVEKLKSDSIFKI
FT                   GYMVKSLVDELLVLDLNESHLVEIPLKEYYPPTRTWSFGQSEDSADIGKFAEEIAEFNS
FT                   RKFYSYEEINEYFKKTEGQRGVTTHYLIDRTRTVNLESFVDSIIETPTIFSEVHDLRFQ
FT                   MMKVPGILNVNSQTSKVFQSKLNETILEMINELVKTQNAFINCIEFKELEEFGK"
FT   gene            554461..554586
FT                   /locus_tag="LACR_0601"
FT   CDS_pept        554461..554586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72170"
FT                   /db_xref="UniProtKB/TrEMBL:Q031F2"
FT                   /protein_id="ABJ72170.1"
FT                   /translation="MNWLKLKMRLSTVLNLKNWKNLENKGKADKSLLFFVIKLWS"
FT   gene            554741..555058
FT                   /locus_tag="LACR_0602"
FT   CDS_pept        554741..555058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72171"
FT                   /db_xref="UniProtKB/TrEMBL:Q031F1"
FT                   /protein_id="ABJ72171.1"
FT                   /translation="MKTGFQKNNQYNSETARKFVVNSLPVQCTPSFIETQYKYVDKQRT
FT                   DEITGYKLWFVQEGLNPFVVKFDKKPELPPFLSIVEFENLQGIEVRSNIYFKADSLKGV
FT                   K"
FT   gene            555058..556134
FT                   /pseudo
FT                   /locus_tag="LACR_0603"
FT   gene            556131..556745
FT                   /locus_tag="LACR_0604"
FT   CDS_pept        556131..556745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72172"
FT                   /db_xref="GOA:Q031F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q031F0"
FT                   /protein_id="ABJ72172.1"
FT                   /translation="MKKTYFMRYFIRSLPLFMSAVLMELLSLLFQFMIFFMNKLALCTK
FT                   ISSFIDLVNQGIIYLNIGSSFFKNISIVLITLAGLIMTRELYFRLRYDSLKNLALSIRG
FT                   TTKLRRYLHHIESFKASEDKTSKADMVISDYNKAIRKIVMDVNNEELLLYTKLPKEHQA
FT                   QKMLKEVVSEIKEEVSNAYPEYLISGFERHGNSLWLKGTRK"
FT   gene            556763..557806
FT                   /locus_tag="LACR_0605"
FT                   /note="LactoCOG number LaCOG03059"
FT   CDS_pept        556763..557806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72173"
FT                   /db_xref="UniProtKB/TrEMBL:Q031E9"
FT                   /protein_id="ABJ72173.1"
FT                   /translation="MPKANKESLLSLFKKDKKSMNNTVKQMNESAGISNSPLEGQKLNL
FT                   RTQLSEKYGFVSIKIDRLTIMGNIELGGNQVFQNLCQFWDVIELQSNGEYAGFYGQLFR
FT                   DSTENFYVSYMPIKAKRMKTKNFYLEFNPAKSGQDNLNYVFDYLVPLLEEVSISRIDIA
FT                   LDFERDLSSFILGGRSKKKIFFGTDGKIETRYAGSGDEFIIRLYDKKKERTEKGDKIAQ
FT                   EEVQKFDQLWRLEFELHGSGFIENQLKKEFRFLSDTPIVQLDFEDRNYIELSPQEKIIF
FT                   LSKDEHPELFAELSKATKAKYNALRKKASIIDLADMTRLPFELTEICWDYPQEIDLIQF
FT                   LNEILKV"
FT   gene            557806..558021
FT                   /locus_tag="LACR_0606"
FT                   /note="LactoCOG number LaCOG02454"
FT   CDS_pept        557806..558021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72174"
FT                   /db_xref="UniProtKB/TrEMBL:Q031E8"
FT                   /protein_id="ABJ72174.1"
FT                   /translation="MFMEKLYGNKEEICDIFGVAKGTLSNDLTRMRRNPEFSKYILQPS
FT                   HGRVNISIEGYEKFLKFRSEARKKIL"
FT   gene            558081..559205
FT                   /locus_tag="LACR_0607"
FT                   /note="LactoCOG number LaCOG02451"
FT   CDS_pept        558081..559205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0607"
FT                   /product="Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72175"
FT                   /db_xref="GOA:Q031E7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q031E7"
FT                   /protein_id="ABJ72175.1"
FT                   /translation="MYKKQQPNGKWKFFEKYQDKQDKWKQVSVTKNSGGREAQSQARTE
FT                   LELKIAEKLSEEIEAEEAPKTINECYAESRKIRQAELAESTYLSETYGLKDFIKKFGQR
FT                   EIISIEPKEMQEYLFSNKYSNTTRHTIALRIGHIFQYAYSMGFTHENIMNRIILPKQKK
FT                   SAESLAKWKEKFFTMDEMRKFLKSWRSHAVEKDDFKRADFVEFLFLTGLRIGEASGLQW
FT                   SHVDILKRVIYIQFSWNCNLKKLGPTKNPQSVRYVTLNDRCLEILENFRKDKYGSKFVF
FT                   VKSNGVQIRNADINTYLKIEGARANLFGKNYKQFSAHMLRHSHITMLAFLGAPQKAVME
FT                   RVGHMDARITNGVYTHVLPENRQDLQLKLENLNL"
FT   gene            559375..559944
FT                   /locus_tag="LACR_0608"
FT                   /note="LactoCOG number LaCOG00394"
FT   CDS_pept        559375..559944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0608"
FT                   /product="thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72176"
FT                   /db_xref="GOA:Q031E6"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR020633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q031E6"
FT                   /protein_id="ABJ72176.1"
FT                   /translation="MAQLYFKYGTMNSGKSIEILKVAHNYEEQGKPVLLMTSSLDTRAG
FT                   VGTVASRIGMKAEAIAIDDKMSVFDYVNSLSAKPFCVLIDEAQFLNKKHVYDFARVVDE
FT                   LNVPVMAFGLKNDFRNELFEGSKYLLLLADKIEEIKTICWYCSKKATMVIRTIDGKPVY
FT                   EGEQLQIGGNETYIPVCRKHYFKPEI"
FT   gene            559955..560398
FT                   /locus_tag="LACR_0609"
FT                   /note="LactoCOG number LaCOG02471"
FT   CDS_pept        559955..560398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72177"
FT                   /db_xref="GOA:Q031E5"
FT                   /db_xref="UniProtKB/TrEMBL:Q031E5"
FT                   /protein_id="ABJ72177.1"
FT                   /translation="MFYHFKGTITGEDYQRILGQMTKRMMLVFSGIMLVFLVVNLLMSK
FT                   GQWIWPVVSALLVLVLGNLFLHWQLKSRFLKNFKPQELDMYVTEEQIKAQMNVRNVEIF
FT                   SDRVHFFQGRNQVMIFKKDMLQDVTQWDSFVNMAKNLPLKTKK"
FT   gene            560416..561489
FT                   /locus_tag="LACR_0610"
FT                   /note="LactoCOG number LaCOG00395"
FT   CDS_pept        560416..561489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0610"
FT                   /product="bacterial peptide chain release factor 1 (bRF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72178"
FT                   /db_xref="GOA:Q031E4"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031E4"
FT                   /protein_id="ABJ72178.1"
FT                   /translation="MFDQLESIVGRYEELGELLSDPEVVSDTKRFMELSREEADLRDKV
FT                   ATYNEYKKVLETISDSEEMLGEGGLDDEMKEMLKEELSSAKSQKEVLEEEIKILLLPKD
FT                   PNDGKNIILEIRGAAGGDEAALFAGDLLNMYQHFSESQGWKFEIMEANITGIGGYKEVS
FT                   ALISGPSVYSKLKYESGAHRVQRVPVTETQGRVHTSTATVLVMPEVEEFEMTIEQKDLR
FT                   VDIYHASGAGGQNVNKVATAVRMVHLPTGIKVEMQEERTQQKNRDKAIKLLNTKVFDYY
FT                   QQIELDKQNAERKSTVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDSILSGKMDEVI
FT                   DALIVYDQTKKLEELNK"
FT   gene            561489..562016
FT                   /locus_tag="LACR_0611"
FT                   /note="LactoCOG number LaCOG02472"
FT   CDS_pept        561489..562016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72179"
FT                   /db_xref="UniProtKB/TrEMBL:Q031E3"
FT                   /protein_id="ABJ72179.1"
FT                   /translation="MNFEFEDFVIREVGHEQRTMQTSKKVNNVLTDVTIFQVKGLNESF
FT                   DLLYCVGKNGDSWVVAEKIESLSHHLHRAQRTRMSIEKFKGNNYCRLCQEVKKGKDWSQ
FT                   TKKSLPLSEFGKYSKNPIRKTFSELGAKIGTLAELVDETNQNRKQYALLFSPQEIKVPL
FT                   CAYLLTIISPLI"
FT   gene            561977..562093
FT                   /locus_tag="LACR_0612"
FT   CDS_pept        561977..562093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72180"
FT                   /db_xref="UniProtKB/TrEMBL:Q031E2"
FT                   /protein_id="ABJ72180.1"
FT                   /translation="MCLSSDDNFTIDLEIKVVKIEVSSKMKPVSREEFNFDE"
FT   gene            562086..562841
FT                   /locus_tag="LACR_0613"
FT                   /note="LactoCOG number LaCOG00396"
FT   CDS_pept        562086..562841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0613"
FT                   /product="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72181"
FT                   /db_xref="GOA:Q031E1"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q031E1"
FT                   /protein_id="ABJ72181.1"
FT                   /translation="MNENKIMNQTIEKMLVHASVRDFKAEPLPAQTKDLLLKAAQSGAS
FT                   SNFIQAYSIIEVADVNLRCEIAKISGSDAYVNQTGVFYVFVADWYRQAQILRAENKDVK
FT                   ALRNMEALTVAIVDTTIAAQNMTVAAESMGLGICYIGGIRNDTSKVTELLNLPELTLPL
FT                   FGLTIGLPNSRNEVKPRLPKANILSINGYNHESLTDLSTYNEQTAEYYANRSHHQKSTN
FT                   WSQEMSDFLTNPRREDLADFLKKQGFTLD"
FT   gene            562946..563761
FT                   /locus_tag="LACR_0614"
FT                   /note="LactoCOG number LaCOG00397"
FT   CDS_pept        562946..563761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0614"
FT                   /product="Methylase of polypeptide chain release factor"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72182"
FT                   /db_xref="GOA:Q031E0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:Q031E0"
FT                   /protein_id="ABJ72182.1"
FT                   /translation="MLWIEAVRTLSADLEEPFELEFVWRNLHELNKLSWLNLMREKITD
FT                   QELNLLTELSERLIKNEPPQYIVGWAEFYELKFKVDERVLIPRPETEELVEMILTENNN
FT                   DSLKILDIGTGSGAIAISLAKARQNWSVKASDISQNALELAAENAKMNHVNLEFIQSDV
FT                   MDELTDRFDIIVSNPPYIAFDETYEMDDSVIKYEPDLALFAQNQGLAIYQKIADQAVNH
FT                   LTDDGKIYLEIGYKQGKAVQAIFQEKFTDRLVSIHQDIFGKDRMISVKR"
FT   gene            563792..564256
FT                   /locus_tag="LACR_0615"
FT                   /note="LactoCOG number LaCOG00398"
FT   CDS_pept        563792..564256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0615"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72183"
FT                   /db_xref="GOA:Q031D9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q031D9"
FT                   /protein_id="ABJ72183.1"
FT                   /translation="MNSLIFEQVFQQKKDFLQILLLADDGPHLENYLENGDLFTLSLKN
FT                   GKTVACAVVIKKQKNTFEIENFAVETSFQGQGFGQQMMKQLITYLKENLAADELILGTD
FT                   DISGNVEFYEKCGFEITHIISNYFVENYDQPIFEGKQQLKDKIYLRKKLK"
FT   gene            564253..565173
FT                   /locus_tag="LACR_0616"
FT                   /note="LactoCOG number LaCOG00399"
FT   CDS_pept        564253..565173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0616"
FT                   /product="translation factor SUA5"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72184"
FT                   /db_xref="GOA:Q031D8"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:Q031D8"
FT                   /protein_id="ABJ72184.1"
FT                   /translation="MKVENDLRTMSSFLQVQLKDVKTLIESNKIDQAKETLNFVQGGLN
FT                   NFANELEKVEGGFYGIIGFLFRRPYKVPDDLKDIRENLFIEANKLQKDLDKQSEKENNS
FT                   KNRMTARAVKALKNGQLVVLPTETVYGLFADAMNEQAVQKLYSVKGRPTEKALNMNVSS
FT                   FEDILKYSINPPDYLGKIVDAFLPGPLTIILEASSEVPEWIHIGKSTVGFRMPNIAVTQ
FT                   KVIKEVGVLVGPSANLTGSKSPSFFADLSQEILENAAVAVQDDNIYGLDTTIIDLTQEK
FT                   PKLLRQGAVTKAELLKKVPELGQIE"
FT   gene            565406..566653
FT                   /locus_tag="LACR_0617"
FT                   /note="LactoCOG number LaCOG00400"
FT   CDS_pept        565406..566653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0617"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72185"
FT                   /db_xref="GOA:Q031D7"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031D7"
FT                   /protein_id="ABJ72185.1"
FT                   /translation="MIFDKEDFESFDPELWAAIHAEEIRQQQNIELIASENIVSKAVMA
FT                   AQGSVLTNKYAEGYPGKRYYGGTEAVDVVENLAIDRAKELFGAKFVNVQPHSGSQANAA
FT                   AYMALIQPGDTVLGMDLNAGGHLTHGASVNFSGKTYHFVPYGVNPQTELLDYEEILKIA
FT                   KEVQPKLIVAGASAYSRLIDFAKFRQITDSVGAKLMVDMAHIAGLVATDAHPNPLPYAD
FT                   VVTTTTHKTLRGPRGGMILTNDEVLAKKINSAIFPGTQGGPLEHVIAAKAVAFKEALDP
FT                   EFATYIEQVIKNTQAMADEFAKVEGLRLIAGGSDNHLLNLKVLDLGINGKEAQDLLDSV
FT                   HITLNKEAIPDETLSPFKTSGVRIGAAAITSRGFKEAEARKVAQLVSNALVNHDNQEKL
FT                   EEVRKAALELTHQFPL"
FT   gene            566834..567436
FT                   /locus_tag="LACR_0618"
FT                   /note="LactoCOG number LaCOG00401"
FT   CDS_pept        566834..567436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0618"
FT                   /product="Soluble lytic murein transglycosylase related
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72186"
FT                   /db_xref="GOA:Q031D6"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q031D6"
FT                   /protein_id="ABJ72186.1"
FT                   /translation="MFKKLIGLIMLILLVFGGFYVYRMHENVKHVMSYEAEVEKTLKAQ
FT                   GLSGDTKLALAIIYTETKGKQVDIMQSSESLNGKTNTFSTEEESIKQGIANLSKVLEYA
FT                   SEKKVDAWTGVQAYNYGRAYVDYIAAHGAKNTIALSKAYSKDVVAPSLGNTTGETYYHL
FT                   TFDSLFYNQGKLYSNGGNIFYAKEVEWNMLLLDLLNW"
FT   gene            567563..568660
FT                   /locus_tag="LACR_0619"
FT                   /note="LactoCOG number LaCOG00402"
FT   CDS_pept        567563..568660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0619"
FT                   /product="phosphoserine aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72187"
FT                   /db_xref="GOA:Q031D5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031D5"
FT                   /protein_id="ABJ72187.1"
FT                   /translation="MIYNFGAGPSVLPKEVLKKVQEELLDFEKSGMSVMEISHRSKSFQ
FT                   EVIDEAQSNLRDLMSIPQNYKILFLQGGASTQFSMIPMNLALGKKAYYAISGAFGKKAY
FT                   DEAVKLSQTLDFEAISLGSTQSEHYNHLLKIDKSKVDEKMAAYLHITTNNTIEGTTIFP
FT                   ENLPEVNSVPLIADMSSNILAVDYDVSKFGLIYAGAQKNLGIAGLTIVIIREDLLNQKE
FT                   SLSSMMDYRILAQNGSMYNTPPTFAIYLAGLVFKWVKEQGGVKKLEAINRQKARMLYDL
FT                   IDQSDFYQSPVLNEAERSICNVVFTSPSKELDALFVQKAEEKGFKSIKGHRSVGGMRAS
FT                   IYNAFPIEGVLELVKFMKEFEEENK"
FT   gene            568657..569853
FT                   /locus_tag="LACR_0620"
FT                   /note="LactoCOG number LaCOG02141"
FT   CDS_pept        568657..569853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0620"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72188"
FT                   /db_xref="GOA:Q031D4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q031D4"
FT                   /protein_id="ABJ72188.1"
FT                   /translation="MTYQIKTIGNNIDQVALDEVGEQFAVNRVPENKADAFICRAQPFH
FT                   DYEFSKELLAIGRAGAGFNNIPIEKCASKGIVVFNAPGGNANAVKELVLSMMIFGTRNL
FT                   KPANKWLTGQKGNDKAIDVAVENGKKAFSGSEISGKTLGVIGLGNIGSKVANDAQRLGM
FT                   KVIGYDPYLSIEHAWNLSHHVKRVNDLSEIFEKADYITVHTPATDETKGMLNWKNLSKC
FT                   KNGVILLNYARDEISDKEAILKAIDEGIVRFFGTDFGSEKFYHHPQVFLTPHLGGSTAE
FT                   ASLNCTRMALDSVQTYLKTGEIINSVNFPRVLQELNTPYRVTLINKNVPNVVAQISIAV
FT                   AEENINIANIVNRGQGDFAYTLLDLDEKDERKLAALVSRFEASENIVRVRLIENPNLF"
FT   gene            569899..570561
FT                   /locus_tag="LACR_0621"
FT                   /note="LactoCOG number LaCOG00404"
FT   CDS_pept        569899..570561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0621"
FT                   /product="phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72189"
FT                   /db_xref="GOA:Q031D3"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q031D3"
FT                   /protein_id="ABJ72189.1"
FT                   /translation="MTVKGLLVMDVDSTLIEEEVIDLLGEKAGLGEKISEITEAAMSGE
FT                   LDFKEALKERVALLSGLRTTIFDEIYKEIHLTNGATGLIETLHGRGWKVGVVSGGFHEI
FT                   VDKLAVDLKLDYVFANRLAVQEGYLTGETYGTIVDKSFKLERLKQWAKENKLDLSEVVA
FT                   VGDGANDIPMLNAAGLGIAFCAKPAVKAAVAYHIDKRNLLMVLELLEKYTDKQSLIN"
FT   gene            complement(570598..570891)
FT                   /locus_tag="LACR_0622"
FT                   /note="LactoCOG number LaCOG00405"
FT   CDS_pept        complement(570598..570891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0622"
FT                   /product="Acylphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72190"
FT                   /db_xref="GOA:Q031D2"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:Q031D2"
FT                   /protein_id="ABJ72190.1"
FT                   /translation="MFKVKMIVSGRVQGVGFRYFVIISARELGILGRIWNNDDGTVGIL
FT                   AQTDDSQKLEEFTALIRGEKSSKGRLSPFAKVTYVESTPTSFPDFTDFNIKY"
FT   gene            571003..571761
FT                   /locus_tag="LACR_0623"
FT                   /note="LactoCOG number LaCOG00406"
FT   CDS_pept        571003..571761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0623"
FT                   /product="rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72191"
FT                   /db_xref="GOA:Q031D1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q031D1"
FT                   /protein_id="ABJ72191.1"
FT                   /translation="MEIISSKDNKKVKEARKLLTKKYRKNSYLIEGFHLLEEALKAGHS
FT                   IKQIFVEENKLAKLTAMIGSEKSLTDLSVNLVSKDVLKSLADSESPQGLIAEVAKIEEV
FT                   IDFSASKFLLLENVQDPGNVGTMIRTADAAGFSAVILLGETADLYSPKVMRSMQGSNFH
FT                   LAIARMNEEECFAALKQAKISILTTTLSANSVSYKTVEESSFALVMGNEGAGVSDFAVE
FT                   SADKLVHIDMPGQAESLNVAVAAGILIFSL"
FT   gene            complement(571973..572362)
FT                   /locus_tag="LACR_0624"
FT                   /note="LactoCOG number LaCOG01005"
FT   CDS_pept        complement(571973..572362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0624"
FT                   /product="hypothetical protein, contains double-stranded
FT                   beta-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72192"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q031D0"
FT                   /protein_id="ABJ72192.1"
FT                   /translation="MFNKGNKVEKPAYSGLPFYLNILDDNIFAMVEQLTFPIGSRTNWH
FT                   KNPCGQTILVTKGAMIYQEEGSVPRLLLSNTVITIKENINHWHGAISEENSCLLITYKS
FT                   NGDELVTFTDSVSDIDFKKALINAK"
FT   gene            complement(572362..572589)
FT                   /locus_tag="LACR_0625"
FT   CDS_pept        complement(572362..572589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72193"
FT                   /db_xref="GOA:Q031C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q031C9"
FT                   /protein_id="ABJ72193.1"
FT                   /translation="MSHTFLQKQISFVLTTMIISFSLFYINLNILKLGFTNFPWLLWLR
FT                   SWAIVYLLLLILSRLIPPLVNRVFKKFGGQ"
FT   gene            572668..573015
FT                   /locus_tag="LACR_0626"
FT                   /note="LactoCOG number LaCOG00963"
FT   CDS_pept        572668..573015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0626"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72194"
FT                   /db_xref="GOA:Q031C8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q031C8"
FT                   /protein_id="ABJ72194.1"
FT                   /translation="MYKISEIAKQTGLTTATLRYYEQIGLLQTKRKTNHYREFDDSDLD
FT                   WLRFIENMKKTGMKLSEIKYFSDLKQLGAKSRQKRLELLEEQKVELIERIKEIEQSLNF
FT                   LEEAKALTKNC"
FT   gene            573029..573355
FT                   /locus_tag="LACR_0627"
FT                   /note="LactoCOG number LaCOG02122"
FT   CDS_pept        573029..573355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0627"
FT                   /product="Inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72195"
FT                   /db_xref="GOA:Q031C7"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:Q031C7"
FT                   /protein_id="ABJ72195.1"
FT                   /translation="MTNYIAKIDRPIGTIHHGTVYPINYGYIEGLIAGDGEEQDVYILS
FT                   NLPENQKALKTFTGKRIAIIHRKDDVEDKSVLTSPAENFTKSEIEKAVHFQEQYFDSEI
FT                   EMVE"
FT   gene            complement(573531..573974)
FT                   /locus_tag="LACR_0628"
FT                   /note="LactoCOG number LaCOG00407"
FT   CDS_pept        complement(573531..573974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0628"
FT                   /product="Flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72196"
FT                   /db_xref="GOA:Q031C6"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010087"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q031C6"
FT                   /protein_id="ABJ72196.1"
FT                   /translation="MPLAKIVYASMTGNTEACADIVADKLEELGFEVELDECTSVDADD
FT                   MADADLCIVGTYTYGDGELPDEIVDFYEELAEVDLSGKIYGCFGSGDTFYDDFCICVDM
FT                   FEAQFEKTGATKGAELVRVDLSPEDEDEAHLEAFAETLAAHFN"
FT   gene            complement(574234..575544)
FT                   /locus_tag="LACR_0629"
FT                   /note="LactoCOG number LaCOG00408"
FT   CDS_pept        complement(574234..575544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0629"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72197"
FT                   /db_xref="GOA:Q031C5"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q031C5"
FT                   /protein_id="ABJ72197.1"
FT                   /translation="MTRNAWILVVGAIAPMLDSTMVNIAINKLQSDLHTSLDMIQWAIT
FT                   GYVVNHIDGKKVMQWSLLSFGLFSFLSGIAWNIDSFIIFRAVQGFSAGFITLLMTTLLM
FT                   QITPPDKLGQLMAVVSTPIILGPIIGPVLGGAIVSGANWHWIFYVNIPVVIIAVLLNHF
FT                   YLSSFKPFNPKAKLDWFGTLLLAGGSVGLIYGMMKGSTNAKNFFNSQMITFVLIGLSLF
FT                   IIYGIYNQIRKNNTVLPLRFFKSKHFTAANIGIFLAEIASNGPMLLLPLFFQNTKGFTA
FT                   IEAGLMLIPQGLGMMATRPLIGKMIDRLGARPVVLVSIAISLLGTVPFIFVQENTNLIW
FT                   LGLVLFIRGMGIGGLQMPMMTDIFIGLDKQDIPGASVGQRIIHNVGSSFGSAVISAVVT
FT                   AVVTSEIAGQMTTKLHQLASSTYHFNSHGYCDCKNFC"
FT   gene            575799..576428
FT                   /locus_tag="LACR_0630"
FT                   /note="LactoCOG number LaCOG02473"
FT   CDS_pept        575799..576428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0630"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72198"
FT                   /db_xref="GOA:Q031C4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q031C4"
FT                   /protein_id="ABJ72198.1"
FT                   /translation="MLEEKVKKTPIQSRRRGSELKEAIYKAAINILENEGYEKVTFQNV
FT                   AKEAKTTRSVLYRYWNDVFDLIFEAVRFNISQNPKWRGNVIDQEINKGSLRQDLIELLT
FT                   FMRENFLLYPKGFLAFVSFMQSQGKNVLESTVGNVLPSNLIIMERLLARAQERGEAREK
FT                   IGQSAKVLPFQMTRYHMLLEGQSMNDEQIKELVDEVLLPIYIKNTK"
FT   gene            576708..577562
FT                   /locus_tag="LACR_0631"
FT                   /note="LactoCOG number LaCOG00409"
FT   CDS_pept        576708..577562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0631"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72199"
FT                   /db_xref="GOA:Q031C3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q031C3"
FT                   /protein_id="ABJ72199.1"
FT                   /translation="MITLKSQREIEQMERSSKILADIHIGLRDLIKPGIDMWEIEEYVR
FT                   KVCKEKNVLPLQIGVDEGNYNPFPYATCCCLNDEVAHAFPRHQILKEGDLIKVDMVLGL
FT                   VEDGSVDVSKLDFDDAESMVKYQEEFRGGVADSCWAYAVGEVSEEVKNLMDVTRECLYL
FT                   GIEQAKVGNRIGDIGAAIQEYAESRGYGVVRDLVGHGVGPTMHEEPMVPHYGRAGRGLR
FT                   IREGMVLTIEPMINTGDWEIDHDGERGYVTFDGSLSCQYEHQFVITKDGPVILTSQGEE
FT                   RTY"
FT   gene            577585..578490
FT                   /locus_tag="LACR_0632"
FT                   /note="LactoCOG number LaCOG00410"
FT   CDS_pept        577585..578490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0632"
FT                   /product="Ribonuclease BN-like family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72200"
FT                   /db_xref="GOA:Q031C2"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q031C2"
FT                   /protein_id="ABJ72200.1"
FT                   /translation="MRGKMKKGLQKIGELTTTFMTFFKSSEMSLSSIAVAYYLLLAIFP
FT                   LGLIIGNILPFLHIDTSGLLSFLSEQLPSDVYRGIEPVINNLLNQRNTGLLSLSVLAGF
FT                   WTFSRALSALQMSMNKAYEVFNHRDFIVSRVIGLAAGFAILLFLYFSIVLSTFGQLILE
FT                   QVHRIFAFDDHLYRTLHNMTLPAIAVATFLSLMMLYFILPNVKIRKLRYTMPGTIFSTF
FT                   VLVFLTNWIAKYVSFALQRLDDLKLIGSLVVFALMIWFIFIARVLIIGAILNAVYQKTK
FT                   VGKIETRRGEIVEFIKEIRK"
FT   gene            complement(578593..579039)
FT                   /locus_tag="LACR_0633"
FT                   /note="LactoCOG number LaCOG00411"
FT   CDS_pept        complement(578593..579039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0633"
FT                   /product="Conserved membrane protein, GtcA family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72201"
FT                   /db_xref="GOA:Q031C1"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:Q031C1"
FT                   /protein_id="ABJ72201.1"
FT                   /translation="MKKLMNVLKSETVRYLIFGVLATAVYALVKWLTWQAWHSGWGSET
FT                   AAQASSIIFAFFTNKLFVFKHQSTNLLRDFINFTSGRIVLLLVSIFINWWFIDQHPDIL
FT                   MNLFGLSKNNMVASLNLVVQVLIIVINYLYSKFFVFKEDKKIND"
FT   gene            579185..579277
FT                   /pseudo
FT                   /locus_tag="LACR_0634"
FT   gene            579440..579916
FT                   /locus_tag="LACR_0635"
FT                   /note="LactoCOG number LaCOG02475"
FT   CDS_pept        579440..579916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72202"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q031C0"
FT                   /protein_id="ABJ72202.1"
FT                   /translation="MLVGLGLYFVRNKVKLPFKKRDYHQEKTINDPALAQEIEEIFLNV
FT                   QEAWDKQDLQSLSPFYGDQLYEKHQKVLEKMRNKGQINHTRSAILDGITRYKEIKDNQF
FT                   EVDLYFVAIDYLVSIDSGQIISGNNQYRREFKQRWNFSGQKGALRVEKMREFKI"
FT   gene            579948..580223
FT                   /locus_tag="LACR_0636"
FT                   /note="LactoCOG number LaCOG00412"
FT   CDS_pept        579948..580223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0636"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72203"
FT                   /db_xref="GOA:Q031B9"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="UniProtKB/TrEMBL:Q031B9"
FT                   /protein_id="ABJ72203.1"
FT                   /translation="MIVYLLALLAVWNLIVFVFYAVDKYKAQHHLWRIPEKVLLAQALL
FT                   GGGIGALLAGHLCHHKTRKWYFNLSWYLGLLVDAVLLFLIIKFFVN"
FT   gene            580326..580502
FT                   /locus_tag="LACR_0637"
FT                   /note="LactoCOG number LaCOG02476"
FT   CDS_pept        580326..580502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72204"
FT                   /db_xref="InterPro:IPR021690"
FT                   /db_xref="UniProtKB/TrEMBL:Q031B8"
FT                   /protein_id="ABJ72204.1"
FT                   /translation="MPKQRFYSFMIGTVIEAWIFSWAFLSASWFLATFFGFLLVRRIFL
FT                   AYRLDKFIREMKM"
FT   gene            580635..581567
FT                   /locus_tag="LACR_0638"
FT                   /note="LactoCOG number LaCOG00413"
FT   CDS_pept        580635..581567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0638"
FT                   /product="Hpr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72205"
FT                   /db_xref="GOA:Q031B7"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031B7"
FT                   /protein_id="ABJ72205.1"
FT                   /translation="MAVSVQDLLDKIHFHVIYSTETALQKEITTSEIMRPGLEMAGYFD
FT                   YFTPERIQLFGMKEWSYMMTVVGDNRYDLLKKVMAKETPVVIVARNLEIPSEMVAAAKK
FT                   ADIVLLQSREATSRLNSVLTSFLDERLAERTTVHGVLMDIFGVGVLIQGASGIGKSETG
FT                   LELVKRGHRLVADDRVDVFQRDAFTLSGEPAEILRNMIEIRGVGIIDVMSLFGAGAVKD
FT                   STDIDMVIYLEYYDKEKAFDRLGNAPTIVEFSDVEVPQTRIPVKTGRNVSVIVEAAVMN
FT                   FRAKQMGFDATKTFEDRLTDLISHNKESQ"
FT   gene            581629..582414
FT                   /locus_tag="LACR_0639"
FT                   /note="LactoCOG number LaCOG00414"
FT   CDS_pept        581629..582414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0639"
FT                   /product="Prolipoprotein diacylglyceryltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72206"
FT                   /db_xref="GOA:Q031B6"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:Q031B6"
FT                   /protein_id="ABJ72206.1"
FT                   /translation="MNNLFPFLALYKIALQLGPLAIHWYAIFIVGGAALAVWLACKEAP
FT                   KRNIKVDDIIDFVLFAFPLGIVGARLYYVIFQWSYYSQHPSQIIAMWDGGGAIYGSLIA
FT                   GAIVLFVFSYYRMIHPLDLLDITIPGVFLAQAMGRWGNFVNQEAYGKIVSNLDWLPPFI
FT                   RNQMFIEGHYRMPTFLFESIGTLSGFILVMVFRHRIKGLKRGDIFSFYLVWYGAVRFIV
FT                   EGMRTDSLMLGPARVSQWLSVLLVILGIILFVYRRIKKN"
FT   gene            582581..583000
FT                   /locus_tag="LACR_0640"
FT                   /note="LactoCOG number LaCOG00415"
FT   CDS_pept        582581..583000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0640"
FT                   /product="Methyl-accepting chemotaxis-like domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72207"
FT                   /db_xref="GOA:Q031B5"
FT                   /db_xref="InterPro:IPR009293"
FT                   /db_xref="UniProtKB/TrEMBL:Q031B5"
FT                   /protein_id="ABJ72207.1"
FT                   /translation="MGNIALLIIAIAFAVLVVFLVIVLHKVSKVVEEANRTVKLVSSDV
FT                   DVLLHQADGIMTKANTLLDDVNGKVATIDPLFTAVADLSESVSDINASSRKLVTRLNRG
FT                   STKRKTTSASAVVLAKTAKKFFVKKDKSEAGVKVN"
FT   gene            583030..583590
FT                   /locus_tag="LACR_0641"
FT                   /note="LactoCOG number LaCOG00416"
FT   CDS_pept        583030..583590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72208"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:Q031B4"
FT                   /protein_id="ABJ72208.1"
FT                   /translation="MSKKTGFLVGALVGAAAALFLAPKKGSELREEAGKIYDDLKENPQ
FT                   ETLTGMRDTALDFSAEKFNEIKEKFDSGEISADKAKDFLLSKRDLIMEKVDSGELSKET
FT                   VIDFFNDTKDAVVEKINSMKESGEELFDEDESDLSDEAAEVVAKFSDAKDEVKEDIDTQ
FT                   SLAEEAKKIADEAKELTNFPDEK"
FT   gene            583724..585142
FT                   /locus_tag="LACR_0642"
FT                   /note="LactoCOG number LaCOG00417"
FT   CDS_pept        583724..585142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0642"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72209"
FT                   /db_xref="GOA:Q031B3"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q031B3"
FT                   /protein_id="ABJ72209.1"
FT                   /translation="MAQANFGVVGMAVMGKNLALNVESRGYTVAIYNRTTSKTEEVYKE
FT                   HQDKNLVFTKTLEEFVGSLEKPRRIMLMVQAGAATDATIKSLLPLLDKGDILIDGGNTH
FT                   FPDTMRRNAELADSGINFIGTGVSGGEKGALLGPSMMPGGQKEAYDLVAPIFEQIAAKA
FT                   PQDGKPCVAYMGANGAGHYVKMVHNGIEYGDMQLIAESYDLLKRILGLSNAEIQAIFEE
FT                   WNEGELDSYLIEITKEVLKRKDDEGEGYIVDKILDKAGNKGTGKWTSESALDLGVPLPL
FT                   ITESVFARYISTYKDERVKASKVLSGPALDFSGDKKEVIEKIRKALYFSKIMSYAQGFA
FT                   QLRKASEEFDWDLPYGTIAQIWRAGCIIRAEFLQNITDAFNKDSELENLLLDDYFVDIT
FT                   KRYQEAVRDVVSLAVQAGIPIPTFTSAISYYDSYRSENLPANLIQAQRDYFGAHTYERT
FT                   DKAGIFHYDWYTED"
FT   gene            585324..587345
FT                   /locus_tag="LACR_0643"
FT                   /note="LactoCOG number LaCOG00418"
FT   CDS_pept        585324..587345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0643"
FT                   /product="K+ transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72210"
FT                   /db_xref="GOA:Q031B2"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031B2"
FT                   /protein_id="ABJ72210.1"
FT                   /translation="MGYQHNRSFNKATGAGFIIAMGIVYGDIGTSPLYTMESIVQGQGG
FT                   LERISETSIIGALSLIIWTLTLITTVKYVWIALKADNNHEGGIFSLFTLVRKYAKWLII
FT                   PAMIGGAALLSDGALTPAVTVTSAIEGLRSIPAFHEAFGQQQLPIVIITLAILAILFLI
FT                   QRFGTSIVGKVFGPVMFIWFSFFGITGLINLFGDFSVLQAINPYWAIHLLLSPENKAGI
FT                   FVLGSVFLATTGAEALYSDLGHVGRGNIHVSWPFVKVCIILSYCGQAAWLLQNRGKSLG
FT                   DINPFFAVLPQSLIIFSVILATLAAIIASQALISGSFTLVSEAIRLKLLPRLRINYPGE
FT                   SFGQLYIPAVNLGLWLAASFIVVYFQSSAHMEAAYGLAITVTMLMTTILLTVYLAQHQK
FT                   VKKVFVVLFFGAFIFIEGLFFAASAVKFLHGGYVVVILAALILFVMAIWHKSDQLFYKY
FT                   LKSSNLNDYKEQMNKLRKDESYDLYHTNVVYLTAKMDKEWIDRSILYSILDKRPKKAEV
FT                   YWFVKVNVTDEPYTSEYEVDMLGTDFIVCVNLYLGFHMRQEIPRYLRTIVTNLMESGRL
FT                   PQQHQPYSIIPGRKVGDFRFILLEEKLINARQMPAFERFVLQTKEQIKKITASPARWFG
FT                   LHFSEVTVETVPLVLSDVRNLEIHERISKENEVENLSK"
FT   gene            587560..589575
FT                   /locus_tag="LACR_0644"
FT                   /note="LactoCOG number LaCOG00418"
FT   CDS_pept        587560..589575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0644"
FT                   /product="K+ transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72211"
FT                   /db_xref="GOA:Q031B1"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031B1"
FT                   /protein_id="ABJ72211.1"
FT                   /translation="MGQVHLHNRSFNKATSAGFLIALGIVYGDIGTSPLYAMQAIVRGQ
FT                   GGLANLSESFILGAVSLVIWTLTLITTVKYVLIALKADNHHEGGIFSLFTLVRRMRKWL
FT                   IVPAMIGGATLLADGALTPAVTVTSAIEGLRGVTHVYSNQTTVMVTTLIILAFLFLIQR
FT                   FGASLVGRLFGPIMFIWFGFLGVSGLINSFLDLSILKAINPYYAIHLLFSPENKAGFFI
FT                   LGSIFLVTTGAEALYSDLGHVGRGNIYVSWPFVKICIILSYCGQGAWLLAHRGEHIEKL
FT                   NPFFAVLPDNMVIYVVILSTLAAIIASQALISGSFTLVSEAIRLKLLPLFKIYYPGQTL
FT                   GQLYIPAVNFALWVTTSFFVLYFKTSEHMEAAYSLAITITMLMTTTLLTYFLIQKGMPK
FT                   IAIAFISIGLFCIEGSFFAASLVQFINGAYIVVLIALAIIFVMFIWNKSHKIVMKYIKS
FT                   LNINEYKNQLNALRHDESYDLYQTNVVYLTSKMDHEWIDRSILYSILDKRPKRAECYWF
FT                   VNVKVTDEPYTSEYKVDMMDTDFIVRVNLYLGFRMRQEVPRYLRTIVTDLMESGRLPRQ
FT                   HQHYSITPGRKVGDFRFVVVEEKLMNARQMPGFERFVLQTKAQIKRITASPIRWFGLQF
FT                   SEVTVETVPLVLSDVRNLEIHERLEQVDETEAPATN"
FT   gene            complement(589628..589798)
FT                   /locus_tag="LACR_0645"
FT   CDS_pept        complement(589628..589798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72212"
FT                   /db_xref="GOA:Q031B0"
FT                   /db_xref="InterPro:IPR021402"
FT                   /db_xref="UniProtKB/TrEMBL:Q031B0"
FT                   /protein_id="ABJ72212.1"
FT                   /translation="MKNKFIQGYLIGKSVEILVAGTALLIAKKKGYLPSADKAEFIAQK
FT                   RKEAARKRLAR"
FT   gene            589993..590658
FT                   /locus_tag="LACR_0646"
FT                   /note="LactoCOG number LaCOG02477"
FT   CDS_pept        589993..590658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0646"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72213"
FT                   /db_xref="GOA:Q031A9"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:Q031A9"
FT                   /protein_id="ABJ72213.1"
FT                   /translation="MTIIGVKIDQKFMRDLLILIIGVGLYVLSVQLFVIPNRLASNGVA
FT                   GFSVLMDFVFGINPALTFFLVNVPLFIFGGRLLPRRILLLSIPGALAMSLWLMIYEALG
FT                   VTGFQFSHVIFAGIFDGILSGIGAGLVIISEGTFGGSILLSRILEEQWDFKIDKVLFLV
FT                   DVVVLSVSLLTFLSLPNFAVTLLSCYIFSKMTLIVGREDYRKSLMSRGKKIYQKVFAA"
FT   gene            590790..591674
FT                   /locus_tag="LACR_0647"
FT                   /note="LactoCOG number LaCOG00419"
FT   CDS_pept        590790..591674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0647"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72214"
FT                   /db_xref="GOA:Q031A8"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031A8"
FT                   /protein_id="ABJ72214.1"
FT                   /translation="MKNNKVLVVVGPTAVGKTALGIDLAIKMNGEIISGDSQQVYQGLD
FT                   IGTAKVTKAEQALAVHHLIDVRKWTENFSVHDFVMEANRLIKEIIERGNVPIIVGGTGL
FT                   YIQSLIEGYHLGGQKNHQAMMELRETLSALTDEELFEKVLKLNPNFPELNRRRAIRFLE
FT                   LQTFGSTDENSGSDYNFLLIGLNAERKVLYERINQRVEQMMSEGLLAEARTLFEKAPDA
FT                   QAAKGIGYKEFFPYFSGEISLEDAVELVKRNSRRYAKRQLTWFRNRMEVEFEDVFSETY
FT                   PDSVFEKVTQFLN"
FT   gene            591820..592488
FT                   /locus_tag="LACR_0648"
FT                   /note="LactoCOG number LaCOG00420"
FT   CDS_pept        591820..592488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0648"
FT                   /product="Galactose-1-phosphate uridyltransferase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72215"
FT                   /db_xref="GOA:Q031A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q031A7"
FT                   /protein_id="ABJ72215.1"
FT                   /translation="MNDKKWIDLGMKYGGFMAQDQIFLENRLATLTDVADKRLLVTPPA
FT                   SVLNAYFAELYQKRSPKDATDYFFELSKAFDIFEENPDFQLEGKVGSEHFRFIRLNLSG
FT                   KSFGFSYKNEAEEALIFSEFPVKITAELMFEIAQIFPHYLLIEEDGKLQMKPAQFQSEF
FT                   EKVKDVTALTEQAENEEYIRLSGYNIEDLLEQAQEIGFLSPLCYGRDGRKHLVYITKGF
FT                   "
FT   gene            592653..593555
FT                   /locus_tag="LACR_0649"
FT                   /note="LactoCOG number LaCOG00421"
FT   CDS_pept        592653..593555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0649"
FT                   /product="Membrane protease subunit, stomatin/prohibitin
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72216"
FT                   /db_xref="GOA:Q031A6"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q031A6"
FT                   /protein_id="ABJ72216.1"
FT                   /translation="MDIIIFPLVILAIVLLILIFSLSTIVFVVKQQTVAIVERFGKYQF
FT                   TASPGFHLKLPWGIDRIAARIQLRLLQTEMTVETKTADNVFVTMNIATQYRVNEQSIKD
FT                   AYYKLMNPGEQIKAYIEDALRSAVPKLTLDDVFEKKDEIALEVQKTVAEEMQTYGYIIV
FT                   KTLITKVEPDAEVKQSMNEINAAQRKQDASQMLANANKIQVVTAAEAEAEKDRLHGVGI
FT                   AEQRKAIVDGLAQQITEIKKLGVALDEEQIMAILLTNQYLDTLNQFAAGGNSTIFLPSG
FT                   AEGAESLRTQILSAIKAGK"
FT   gene            593652..593723
FT                   /locus_tag="LACR_t0650"
FT                   /note="tRNA_Arg_CCG"
FT   tRNA            593652..593723
FT                   /locus_tag="LACR_t0650"
FT                   /product="tRNA-Arg"
FT   gene            complement(593804..594502)
FT                   /locus_tag="LACR_0651"
FT                   /note="LactoCOG number LaCOG02627"
FT   CDS_pept        complement(593804..594502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0651"
FT                   /product="Surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72217"
FT                   /db_xref="UniProtKB/TrEMBL:Q031A5"
FT                   /protein_id="ABJ72217.1"
FT                   /translation="MKKFSIALGVLLSLSVSGIISETSASAASTVPVYRLYNKNTGEHF
FT                   YTKSAFEKNSLKNSGWNDEGTGWIAATSGTPVYRVYNPNSVGGDHYYTMSKYEAQSLVK
FT                   SGWRWDNGGNAAFYSGGNVNLYVAYNPNAGSGSHNYTTNSFEQNSLLNGGWKFGAVAWK
FT                   VQAGGSTVTPPVGRTVYVAGKDSKVYWYSLTALIDYGNKHGHPVNQSEIFTMTESQAIS
FT                   SGRRHSLTEK"
FT   gene            complement(594929..595276)
FT                   /locus_tag="LACR_0652"
FT                   /note="LactoCOG number LaCOG00023"
FT   CDS_pept        complement(594929..595276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0652"
FT                   /product="Transcriptional regulator, xre family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72218"
FT                   /db_xref="GOA:Q031A4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR009498"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q031A4"
FT                   /protein_id="ABJ72218.1"
FT                   /translation="MTLFDRIKGLADKQGKNIKTVALDIGLSENAIYGWKKTKPKADDL
FT                   AKVADYFHVTVDFLLGREGLEIINEPIDLAQLVDDSKVDWDKWVLFEGKPLSDDVKIAM
FT                   KLILGKRLEDK"
FT   gene            595838..595913
FT                   /locus_tag="LACR_t0653"
FT                   /note="tRNA_Lys_TTT"
FT   tRNA            595838..595913
FT                   /locus_tag="LACR_t0653"
FT                   /product="tRNA-Lys"
FT   gene            596041..596964
FT                   /locus_tag="LACR_0654"
FT                   /note="LactoCOG number LaCOG00423"
FT   CDS_pept        596041..596964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0654"
FT                   /product="RNAse Z"
FT                   /EC_number="3.1.26.11"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72219"
FT                   /db_xref="GOA:Q031A3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031A3"
FT                   /protein_id="ABJ72219.1"
FT                   /translation="MEIQFLGTGAGQPSKSRNTQAIALKMLDERNEIWLFDCGEASQHQ
FT                   ILNTAIKPRKITKIFITHLHGDHIFGLPGFLSSRSFQSSDEQTDLDLYGPVGIKEFVLT
FT                   GLRISGSRLGYRINFHEIDSAGKIFEDDSFEVYTDLLDHTIFCLGYRVVEKNRVGELDA
FT                   NALKEAGLPFGPLFGKIKKGEVVAYDGKTFDPKDYIGADKVGKIVTILGDTRKTKTAVR
FT                   LAWQADLLVHEATYEASESKMARAHGHSTTKQAADVAKEAGVNRLLLTHISARYVGPLV
FT                   GQLVREAQAVHANTFVSKDLYEEKIG"
FT   gene            596957..597658
FT                   /locus_tag="LACR_0655"
FT                   /note="LactoCOG number LaCOG00424"
FT   CDS_pept        596957..597658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0655"
FT                   /product="Short-chain dehydrogenase of various substrate
FT                   specificities"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72220"
FT                   /db_xref="GOA:Q031A2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q031A2"
FT                   /protein_id="ABJ72220.1"
FT                   /translation="MVKNIVITGATGDIAKEIVSLLSKTNDHLILVSRSRTALEKLYGQ
FT                   LANVTLLTNDELLTAEQSYDVDILINNAGFGIFKDFTELTDSEITEQFVINTLMPIQLT
FT                   RQLKPRLQLINIASIAGKLPTRKSSIYAASKAALITFSDALRMENPQLIVTTVNTGPVL
FT                   TKFHKDNGDYLNKVGKSAISAAKVADKIVNNLGKRKRELNLPWTLSTAAKLRSLFPSLV
FT                   DFLSTRFFNFK"
FT   gene            597831..600059
FT                   /locus_tag="LACR_0656"
FT                   /note="LactoCOG number LaCOG00425"
FT   CDS_pept        597831..600059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0656"
FT                   /product="exonuclease RecJ"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72221"
FT                   /db_xref="GOA:Q031A1"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR018779"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:Q031A1"
FT                   /protein_id="ABJ72221.1"
FT                   /translation="MIKAKYDWKLDETVLSEDFLKISKKHKLDELTSRVLYQRGIHDES
FT                   EIEKFLKPNLEDLHDPFLLHDMEKATQRILSAIEQGEHILIYGDYDADGMTAASVMKSA
FT                   LDELGAEAQVYLPNRFTDGYGPNLDVYQYYINNENINLIITVDNGVAGVEAIAWAQENG
FT                   VDVIITDHHSMPDQLPNAYAIIHPEHPESQYPFKYLAGVGVAFKVACALLEYAPREMLD
FT                   LVAIGTIADMVSLTDENRILVAHGLKVLAQTERAGLQELMKYAGVDFDKVTEETVGFQI
FT                   APRLNALGRLDDPNPAIELLTGWDEDEAHEIAKMIDQKNSERKDIVEKIHNEALAMLTD
FT                   EPVQILYHKDWHKGVLGIVAGRLLEQIHKPVIMLAEEEGILRGSARSIDSFDIFKALNA
FT                   HRELFIAFGGHKQAVGMTLALENVEAVKKAMSDFVVDNHLDLSKKSPLEVADRCHLAEI
FT                   SLATINNLAKLAPFGMDNPKPRFLVEDYKVIQSRSMGKDNAHLKLKIQEEKQQIDAVYF
FT                   QHGSEELEFEQAETKLVVTLSSNSWNGNTSLQLMIEDADSIGVELLDIRSRQISIPKEA
FT                   NIFSQNQLKHGIMEDVLVIEETPVDLAGLSVLEEAVSKAASDDFKIIYFKNKITDSYYL
FT                   TGSGTREQFANLYKAIYQFPEFDVRYKLESLADYLNIPHLLLVKMIKIFEELEFVNIDN
FT                   GLMTVNKAAQKREISESTIYQELEKIVKMQELFALAPVKEIYQKLLEK"
FT   gene            600183..600695
FT                   /locus_tag="LACR_0657"
FT                   /note="LactoCOG number LaCOG00426"
FT   CDS_pept        600183..600695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0657"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72222"
FT                   /db_xref="GOA:Q031A0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q031A0"
FT                   /protein_id="ABJ72222.1"
FT                   /translation="MELKDYIATIENYPKEGVVFRDISPLMADGNAYNYAATEIVQYAR
FT                   DKEIDMVVGPEARGFIIGCPVAFALGVGFAPVRKPGKLPREVIEATYEKEYGTDTLTMH
FT                   SDSIKPGQRVLIVDDLLATGGTIAATIELVEKMGGVVVGCAFLIELDELKGREKIGNYV
FT                   YKVLMHY"
FT   gene            600886..601449
FT                   /locus_tag="LACR_0658"
FT                   /note="LactoCOG number LaCOG00427"
FT   CDS_pept        600886..601449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0658"
FT                   /product="DNA-directed RNA polymerase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72223"
FT                   /db_xref="GOA:Q030Z9"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="InterPro:IPR029757"
FT                   /db_xref="InterPro:IPR038087"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q030Z9"
FT                   /protein_id="ABJ72223.1"
FT                   /translation="MKITALEGQKISELSMIEVAHALLEQNGKEMQFSEIIRAIQDYLE
FT                   KSDDEIKASISSFYTEINTDGSFIPLGNNVWALRSWYAIDEIDEEVIALDEIEDEEEEK
FT                   PAKKRKKVNAFGIEDEIDPEDEEGTKETTEEDMSYDTQAEDEDKDDVAAYDAELAEVEL
FT                   DNVDEEVDIELEDDEDDSDDTDED"
FT   gene            601585..603225
FT                   /locus_tag="LACR_0659"
FT                   /note="LactoCOG number LaCOG00428"
FT   CDS_pept        601585..603225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0659"
FT                   /product="Aminodeoxychorismate lyase family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72224"
FT                   /db_xref="GOA:Q030Z8"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:Q030Z8"
FT                   /protein_id="ABJ72224.1"
FT                   /translation="MVDKETTEFSRGSFKEKILRQLEENAAKQAETKFPDPEDFERPKG
FT                   SEPVTSERKIEPRKVELEPFKLPVFKFPEADEEEDFQAQVEENTSQETGSLRQKLEEIV
FT                   SDENQEQTFPPPFSRSESVVQEEPIEQENISEKRESEKMVKHQPSRRTTAPSKKNFSGK
FT                   KNKNKKKKKVTAGKIITVIVVLLILVVGGTGWYGYNFVKSGIQPLDSKNTTVKSISIPA
FT                   GSSSKQIGEILQRQSIIKNGMIFQYYTKFKNYSEFKSGYYNLSPNMSLSTIASKLEEGG
FT                   TEKPVAPTLGKILIPEGYTLTQIAKAVTVNSNSQEKNAKTPFSESDFMKTVQDPTFIAK
FT                   MVKAYPKLFASLPTKDSGIKYQLEGYLFPATYDYTKSSTVESVIENMIETMNAQLTPYY
FT                   DTMTQKNLTVNDVLSLAALVEKEANNDDDRRNVAATFYNRMNQGMTLGSNLSILYAEGK
FT                   LGEKTSLAEDANIDTNLDSPYNLYANTGFGPGPVDSPSLSSIKAVLNPAQNDYLYFVAD
FT                   VTTGKVYFAKTLEEQNANVQKYVNDKLSK"
FT   gene            603286..603756
FT                   /locus_tag="LACR_0660"
FT                   /note="LactoCOG number LaCOG00429"
FT   CDS_pept        603286..603756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0660"
FT                   /product="transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72225"
FT                   /db_xref="GOA:Q030Z7"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q030Z7"
FT                   /protein_id="ABJ72225.1"
FT                   /translation="MEKTFPMTKEGLDKLKAELENLKLVKRPEVIDRIKVARSYGDLSE
FT                   NSEYEAAKDEQAFIEGRISTVETMIRYAEIVNNAKIAKDEVALGKNVTFVEVGETDEES
FT                   YQIVGTAEADPFTGKISNESPIARVLIGKKVGDIVNVPLPVGEMTVKIVKVD"
FT   gene            603848..604405
FT                   /locus_tag="LACR_0661"
FT                   /note="LactoCOG number LaCOG00084"
FT   CDS_pept        603848..604405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0661"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72226"
FT                   /db_xref="GOA:Q02Y06"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q02Y06"
FT                   /protein_id="ABJ72226.1"
FT                   /translation="MVKYSIELKQRVIQDYLSGKGGSTYLAKLHNVGSSSQVRRWIRNY
FT                   RAEGLPTAHSKVNKNYSMELKENAVQCYLTTDLTYEAVARKFEITNFTLLASWVNHFKI
FT                   YGEVPISKKRGRRKKLESIASSMTQNPNDSQRIKELEQELRYAQIEVAYLKGLRRLEKN
FT                   ALMNKNQDSSTVSVKPSNSKKS"
FT   gene            604402..605223
FT                   /locus_tag="LACR_0662"
FT                   /note="LactoCOG number LaCOG00270"
FT   CDS_pept        604402..605223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0662"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72227"
FT                   /db_xref="GOA:Q030Z5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q030Z5"
FT                   /protein_id="ABJ72227.1"
FT                   /translation="MKVTGFPKATYYYWVNCFERVNKDELIEKEMLKIRQEHANAGYRP
FT                   MSELLKQRGYHHVNHKKVQRLMKKLGLRVTSYWHKSRKYNSYKGKVGTVAKNKLHRRFR
FT                   TSIPHQKITTDTTEFKYYEDGIQKKCYLNPYIDLFNSEVISYHISKQPSYQSIDIALNQ
FT                   ALAVTSDCPYRRTFHSDQGWGYQMRDYVSKLKSHRIFQSMSRKGNCHDNSVMENFFGLL
FT                   KQEIYYGHIFSSFEELEQVIVIWIRYYNTKRIKQKLNWMSPIQFRLNYQNN"
FT   gene            complement(605278..606117)
FT                   /locus_tag="LACR_0663"
FT                   /note="LactoCOG number LaCOG00439"
FT   CDS_pept        complement(605278..606117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0663"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72228"
FT                   /db_xref="GOA:Q02Y04"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q02Y04"
FT                   /protein_id="ABJ72228.1"
FT                   /translation="MKHHGKIKIKHAVKVLKVSRSGFYEYMHRRPSKQQVEREILSEKI
FT                   KAVFHEHKGRYGAVRITKVLHNTGIMTNTKRVGKLMHLMGLYAKGSRYKYKHYNRKGAS
FT                   LSRPNLINQIFKATAPNKVWLGDMTYIPTKEGTLYLAVNIDVFSRKIVGWSMSSRMQDK
FT                   LVRDCFLQACGKEHPQPGLIVHTDQGSQYTSSRYQSTLRQVGAQSSMSRKGNPYDNAMM
FT                   ESFYKTLKRELINDAHFETRAEATQEIFKYIETYYNTKRMHSGLDYKSPKDFEKYNS"
FT   gene            complement(606135..606425)
FT                   /locus_tag="LACR_0664"
FT                   /note="LactoCOG number LaCOG00049"
FT   CDS_pept        complement(606135..606425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0664"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72229"
FT                   /db_xref="GOA:Q030Z3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q030Z3"
FT                   /protein_id="ABJ72229.1"
FT                   /translation="MARRKFDKQFKNSAVKLILEEGYSVKEVSQELEVHANSLYRWVQE
FT                   VEEYGESAFPGNGTALADTQHKIKLLEKENRYLQEELELLKKFRVFLKRSK"
FT   gene            606672..607127
FT                   /locus_tag="LACR_0665"
FT                   /note="LactoCOG number LaCOG00431"
FT   CDS_pept        606672..607127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0665"
FT                   /product="Transcriptional repressor of class III stress
FT                   genes"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72230"
FT                   /db_xref="GOA:Q030Z2"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:Q030Z2"
FT                   /protein_id="ABJ72230.1"
FT                   /translation="MAGQKNTSDIIEAYLRQLLEEAQVIEIKRADLANQFDVVPSQINY
FT                   VIKTRFTASKGFDVESKRGGGGYIKIVKYQYSARHEFLTALYQKVPENLSSKAAHDIVQ
FT                   LLFDEKVLTEREGNLLLLVITDGAISPFTRGIMMKSIINRLDRDDEI"
FT   gene            607117..609567
FT                   /locus_tag="LACR_0666"
FT                   /note="LactoCOG number LaCOG00432"
FT   CDS_pept        607117..609567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0666"
FT                   /product="ATP-binding subunit of Clp protease and DnaK/DnaJ
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72231"
FT                   /db_xref="GOA:Q030Z1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q030Z1"
FT                   /protein_id="ABJ72231.1"
FT                   /translation="MKFENVKYTPTLDRIFEKAAEDAHQYQYGTIESAHLLAAMATTSG
FT                   SIAYSILAGMNVDSSDLLIDLEDLSSHVKVKRSELRFSPRAEEVVTVASFLAVHNNAEA
FT                   VGTEHLLYALLQVEDGFGIQLLKLQKINIVSLRKEIEKRTGLKVPENKKAVTPMSKRKM
FT                   AKGVAENSSTPTLDSVSSDLTEAARSGKLDPMIGREAEVDRLIHILSRRTKNNPVLVGE
FT                   PGVGKSAIIEGLAQRIVNGQVPIGLMNSRIMALNMATVVAGTKFRGEFEDRLTAIVEEV
FT                   SADPDVIIFIDELHTIIGAGGGMDSVNDAANILKPALARGDFQMVGATTYHEYQKYIEK
FT                   DEALERRLARINVDEPSPDEAIAILQGLREKFEDYHQVKFTDQAIKSAVTLSVRYMTSR
FT                   KLPDKAIDLLDEAAAAVKISVKNQETKRLELEKDLVKAQEELAEAVIKLDVKASRIKEK
FT                   AVEKISDKIYKFSIKEEKRQEVTDQAVIAVASTLTGVPITQMTKSESDRLINLEKELHK
FT                   RVVGQEEAISAVSRAIRRARSGVADSRRPMGSFMFLGPTGVGKTELAKALADSVFGSED
FT                   NMIRVDMSEFMEKHSTSRLIGAPPGYVGYDEGGQLTERVRNKPYSVVLLDEVEKAHPDV
FT                   FNIMLQILDDGFVTDTKGRKVDFRNTIIIMTSNLGATALRDDKTVGFGAKNITADYSAM
FT                   QSRILEELKRHYRPEFLNRIDENIVFHSLESQEIEQIVKIMSKSLIKRLAEQDIHVKLT
FT                   PSAIKLIAEVGFDPEYGARPLRKALQKEVEDLLSEQLLSGEIKAGNHISIGASNKKIKI
FT                   AQIV"
FT   gene            609702..610259
FT                   /locus_tag="LACR_0667"
FT                   /note="LactoCOG number LaCOG00433"
FT   CDS_pept        609702..610259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0667"
FT                   /product="SSU ribosomal protein S30P"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72232"
FT                   /db_xref="GOA:Q030Z0"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q030Z0"
FT                   /protein_id="ABJ72232.1"
FT                   /translation="MIKFNIRGENVEVTDAIRDYVEDKIGKLDKYFNDGHEVTAYVNLK
FT                   VYTEKRAKVEVTLPAKNVTLRAEDTSQDMYSSIDFVEEKLERQIRKYKTRMNRKPRNAV
FT                   PTGQVFGDEFAPLDTTDEVAEDHVDIVRTKHVALKPMDAEEAVLQMDMLGHDFYVFTDA
FT                   DSNGTHVVYRRTDGRYGLIETE"
FT   gene            610447..611748
FT                   /locus_tag="LACR_0668"
FT                   /note="LactoCOG number LaCOG00434"
FT   CDS_pept        610447..611748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0668"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72233"
FT                   /db_xref="GOA:Q030Y9"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q030Y9"
FT                   /protein_id="ABJ72233.1"
FT                   /translation="MSIITDIYAREVLDSRGNPTLEVEVYTEDGAFGRGMVPSGASTGE
FT                   HEAVELRDGDKSRYNGLGTQKAVDNVNNIIAEAIIGYEVTDQQAIDRAMIALDGTENKG
FT                   KLGANAILGVSIAAARAAADELGVPLYNYLGGFNAKVLPTPMMNIINGGSHSDAPIAFQ
FT                   EFMIVPVGAPTFKEALRWGAEIFHALKKILKARGLETAVGDEGGFAPKFDGTEDGVETI
FT                   LKAIEAAGYKAGEDGVMIGFDCASSEFYENGVYDYTKFEGEGGKKLSASEQVDYLEELV
FT                   SKYPIITIEDGMDENDWDGWKILTERLGKKVQLVGDDFFVTNTKYLERGIRENASNAIL
FT                   IKVNQIGTLTETFEAIEMAKEAGFTAIVSHRSGETEDSTISDIAVATNAGQIKTGSLSR
FT                   TDRMAKYNQLLRIEDQLAEVAQYKGLKAFYNLKK"
FT   gene            611836..612771
FT                   /locus_tag="LACR_0669"
FT                   /note="LactoCOG number LaCOG00435"
FT   CDS_pept        611836..612771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0669"
FT                   /product="Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72234"
FT                   /db_xref="GOA:Q030Y8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q030Y8"
FT                   /protein_id="ABJ72234.1"
FT                   /translation="MPFEKLVKEYLLELKLGNYSKETMETYRQHIDKFIDFYKKEISNE
FT                   MDIYAINKIHYKLFISQLLDNSLRATYINAILKSNKAFYSYLIREQVLKTSPMDSIKLL
FT                   KETKQALTTFNDDEVKAMLNVWNFNTYLNARNKCIIAVLADTGIRISELINIKDSDLTD
FT                   QYIRVLGKGDKWRVVPISNELNYLLTKYKRLRDNHFNKIRNRNGKVRELDSELFLGKTG
FT                   RSIKTITNIEVMIAQTGLQANVRASVRCSPHQFRHYWTCKSLELGQDIFTISKLLGHTN
FT                   LSTTQIYLQKLTNEQLISKAVKFSPLKHLK"
FT   gene            612898..613023
FT                   /locus_tag="LACR_0670"
FT   CDS_pept        612898..613023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72235"
FT                   /db_xref="UniProtKB/TrEMBL:Q030Y7"
FT                   /protein_id="ABJ72235.1"
FT                   /translation="MRKLTSIGAIALCGISLSGYSQDKDTAETKSTTQSTVRNLI"
FT   gene            613044..613811
FT                   /locus_tag="LACR_0671"
FT                   /note="LactoCOG number LaCOG02478"
FT   CDS_pept        613044..613811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0671"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72236"
FT                   /db_xref="GOA:Q030Y6"
FT                   /db_xref="UniProtKB/TrEMBL:Q030Y6"
FT                   /protein_id="ABJ72236.1"
FT                   /translation="METIIKNKKIAIIIAIIVVLGTILLGAYHQSVSRYSSKIAVQIDN
FT                   VEKLSENNFAPQNHVNDYGQWIVLSKNANNKSNLFQMIKMTREYDKKFSKDESEAKKNE
FT                   KKITDEVNNKWIEIYTQSMLKASESESYGNKITKVWRDAIFENYATVNGKHYTDFKDAI
FT                   HAFQTQYSNEFSELNNFFQDNIDSANNLSELIRIYFPEKSNRADDLENFAQDVFNFNDE
FT                   AINPSGSYSTRSSKLSELDTKALSSSKTVGMSF"
FT   gene            613924..614121
FT                   /locus_tag="LACR_0672"
FT   CDS_pept        613924..614121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0672"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72237"
FT                   /db_xref="UniProtKB/TrEMBL:Q030Y5"
FT                   /protein_id="ABJ72237.1"
FT                   /translation="MNDIERQLAQTWVIVLLEILPCVYESNVHGLSEGDIIIKIKKARL
FT                   EKLMILSIIMCKHSSRVEEY"
FT   gene            complement(614118..615293)
FT                   /locus_tag="LACR_0673"
FT                   /note="LactoCOG number LaCOG00809"
FT   CDS_pept        complement(614118..615293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0673"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72238"
FT                   /db_xref="GOA:Q02VV8"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q02VV8"
FT                   /protein_id="ABJ72238.1"
FT                   /translation="MTQFTTELLNFLAQKQDIDEFFRTSLETAMNDLLQAELSAFLGYE
FT                   PYDKVGYNSGNSRNGSYSRQFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMV
FT                   IKLYQTGVTTREISDIIERMYGHHYSPATISNISKATQENVATFHERSLEANYSVLFLD
FT                   GTYLPLRRGTVSKECIHIALGITPEGQKAVLGYEIAPNENNASWSTLLDKLQNQGIQQV
FT                   SLVVTDGFKGLEQIISQAYPLAKQQRCLIHISRNLASNVKRADRAVILEQFKTIYRAEN
FT                   LEMAVQALENFIAEWKPKYRKVMESLENTDNLLTFYQFPYQIWHSIYSTNLIESLNKEI
FT                   KRQTKKKVLFPNEEALERYLVTLFEDYNFKQSQRIHKGFGQCADTLESLFD"
FT   gene            615915..616064
FT                   /locus_tag="LACR_0674"
FT   CDS_pept        615915..616064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72239"
FT                   /db_xref="UniProtKB/TrEMBL:Q030Y3"
FT                   /protein_id="ABJ72239.1"
FT                   /translation="MKEKSGLVVKSYMLYDQNKNILLYPSYKFNEQQNKAINKQIMRYT
FT                   RIAS"
FT   gene            complement(616065..616955)
FT                   /locus_tag="LACR_0675"
FT                   /note="LactoCOG number LaCOG03011"
FT   CDS_pept        complement(616065..616955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0675"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72240"
FT                   /db_xref="GOA:Q02ZY1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q02ZY1"
FT                   /protein_id="ABJ72240.1"
FT                   /translation="MTYNSTLPKVFVYLLTTIETLYQTRVPLEVQNRKNVHLATSDCLV
FT                   IACYLWGVLHFSETLKAKHQLAQSLFPNFLEYSRFVRRCNALLPSIQVIRQALVFKEVE
FT                   GISVSIIDSFPIPLCQPIRNFRSKGLGDYANVGYNATKGQYFYGCKCHALVSESGYVID
FT                   YTITPASMADSSMTEEVLSQFGTPTVLGDMGYLGQSLHDRLELKGIDLITPVRKNMKQK
FT                   KILFPNFSKRRKVIERVFSFLTNLGAERCKSRSPQGFQLKLEMILLAYSLLLKSAKSLE
FT                   PETLRYSIGYQVMPK"
FT   gene            617497..617673
FT                   /locus_tag="LACR_0676"
FT                   /note="LactoCOG number LaCOG02479"
FT   CDS_pept        617497..617673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0676"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72241"
FT                   /db_xref="UniProtKB/TrEMBL:Q030Y1"
FT                   /protein_id="ABJ72241.1"
FT                   /translation="MEDLKKDIYVCYSTRQFDYIYRVKSINYIITGIHVKTKQQFWAFK
FT                   RDEALNNALASYK"
FT   gene            617711..618979
FT                   /locus_tag="LACR_0677"
FT   CDS_pept        617711..618979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72242"
FT                   /db_xref="UniProtKB/TrEMBL:Q030Y0"
FT                   /protein_id="ABJ72242.1"
FT                   /translation="MKLEISECIEVDTKILIEEYGQLLTESSKKSIIKNNYKFKGDTKD
FT                   SVIAQLENQFESVKVISKKGRYGGTTFELKGFKGLVEYERENKGGRPSLDWTNELLVIR
FT                   ELINQEVALGQEQEFYRGFTINQLLNKLLGFNKYEIEDIVKYEVQNHDIFTLSGNKEDD
FT                   YYGLKETVNNLIRNQRHIYVSKIEEEISKTIHKISYLDSNKNEISIELYEEYMVFKKEV
FT                   ETKIKAENEKIRDKRSKAYREGLNIKDLPKAKNEHKEIENAVQEKYGFKFAYRLFNVFD
FT                   SVEKDGEGDISLVRENFYNRIMKNASSSQAKNAITGKINYYEKIFYRLTHSGQYEELMN
FT                   LIFSQLVGIESKTQKFDAVQEYEKAQAEQSLERYMAEQRLEQEEFYNQDDFIYVDIARI
FT                   LYELENPLTDEECEERYLELFSY"
FT   gene            619016..619141
FT                   /locus_tag="LACR_0678"
FT   CDS_pept        619016..619141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0678"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72243"
FT                   /db_xref="UniProtKB/TrEMBL:Q030X9"
FT                   /protein_id="ABJ72243.1"
FT                   /translation="MYKTTVRKRPERQPDRFNVTFKRCSQGYLMTITDVLSDKVY"
FT   gene            619712..620602
FT                   /locus_tag="LACR_0679"
FT                   /note="LactoCOG number LaCOG03011"
FT   CDS_pept        619712..620602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0679"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72244"
FT                   /db_xref="GOA:Q02VX2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q02VX2"
FT                   /protein_id="ABJ72244.1"
FT                   /translation="MTYNSTLPKVFVYLLTTIETLYQTRVPLEVQNRKNVHLATSDCLV
FT                   IACYLWGVLHFSETLKAKHQLAQSLFPNFLEYSRFVRRCNALLPSIQVIRQALVFKEVE
FT                   GISVSIIDSFPIPLCQPIRNFRSKGLGDYANVGYNATKGQYFYGCKCHALVSESGYVID
FT                   YTITPASMADSSMTEEVLSQFGTPTVLGDMGYLGQSLHDRLELKGIDLMTPVRKNMKQK
FT                   KILFPNFSKRRKVIERVFSFLTNLGAERCKSRSPQGFQLKLEMILLAYSLLLKSAKSLE
FT                   PETLRYSIGYQVMAK"
FT   gene            621066..621326
FT                   /locus_tag="LACR_0680"
FT                   /note="LactoCOG number LaCOG00049"
FT   CDS_pept        621066..621326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0680"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72245"
FT                   /db_xref="GOA:Q030X7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q030X7"
FT                   /protein_id="ABJ72245.1"
FT                   /translation="MQKRYSKEFKETLIAFYHSGQFVTQLSKEYDVAPATIYKWIDLYS
FT                   ESNESSVSKADFLELKRQLAKVKEERDILKKVLTIFAEKKK"
FT   gene            621323..622177
FT                   /locus_tag="LACR_0681"
FT                   /note="LactoCOG number LaCOG00439"
FT   CDS_pept        621323..622177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0681"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72246"
FT                   /db_xref="GOA:Q030X6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q030X6"
FT                   /protein_id="ABJ72246.1"
FT                   /translation="MSAADMAQTIQTLALNVRLSYQLIDVPESSYYERINRHPSKTQLR
FT                   RQYLSLKISQLFNANREIYGAPKIHHLLLKQGEKVGLKLVQKLMKQLQLKSVVIKKFKP
FT                   GYSLSDHINRKNLIQTEPTKKNKVWSTDITYIPTQQGWAYLSTIMDRYTKKVIAWDLGK
FT                   RMTVELVQRTLNKAIKSQDYPEAVILHSDQGSQYTSLEYEELLKYYGMTHSFSRRGYPY
FT                   HNASLESWHGHLKREWVYQFKYKNFEEAYQSIFWYIEAFYNSKRIHQSLGYLTPNQFEK
FT                   VSA"
FT   gene            622234..622959
FT                   /locus_tag="LACR_0682"
FT   CDS_pept        622234..622959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0682"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72247"
FT                   /db_xref="GOA:Q030X5"
FT                   /db_xref="InterPro:IPR031709"
FT                   /db_xref="UniProtKB/TrEMBL:Q030X5"
FT                   /protein_id="ABJ72247.1"
FT                   /translation="MDILFLEKALDNSDWLGFGGNVASGIIGAILGVYGAYYVMQKQLK
FT                   AENEQYRKDRIDNTFFNLLGLFQNIREELDSSEIISDIKKLRGLKIGKDPYSIFKSIDV
FT                   NNMINKQDDIVEIINEVFKSSTGYSGNYFRALYRCLKYIMDSDLKMEDKKFYSGVLRGV
FT                   LSSKEMLLVFYNCMYFEKGEKFKELLEREENGKRIDFFGDEEDLKNLDKGYDLPFFSKE
FT                   DLLFSETDMQKLEELIKGN"
FT   gene            623588..624586
FT                   /locus_tag="LACR_0683"
FT                   /note="LactoCOG number LaCOG03060"
FT   CDS_pept        623588..624586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0683"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72248"
FT                   /db_xref="InterPro:IPR025935"
FT                   /db_xref="UniProtKB/TrEMBL:Q030X4"
FT                   /protein_id="ABJ72248.1"
FT                   /translation="MKLKIIFGNGFDKNLGLNTTYKDFYKWLDENQKKESDEIYCNIKE
FT                   MPENWSDLELALGKYTFDNEIIPDKFEESYANLIEDLNEYLLLEQEKIGTQFSIEDSIT
FT                   ELFYSIEKNLVETGQNKNSQIIHRYLSEQTEVNFVTFNYTDTVEKTMSKKTIGISKDGK
FT                   TVLVILRNPIHVHGTLNSSMVLGVNDETQFKSEIFDNDFPEFFIKNKNLTDHVNSTELD
FT                   KALEVIDSSDVLFLFGVSLGDTDKVYWEKIAEWLLYGGDEHIVLLYDYETPMGSISKVV
FT                   QRRMERSWNKTKDKFLKQSGLSSDDQKLISKQIFPLYGNGFFNIEEAQKNQ"
FT   gene            complement(624829..625683)
FT                   /locus_tag="LACR_0684"
FT                   /note="LactoCOG number LaCOG00439"
FT   CDS_pept        complement(624829..625683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0684"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72249"
FT                   /db_xref="GOA:Q030X3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q030X3"
FT                   /protein_id="ABJ72249.1"
FT                   /translation="MSAADMAQTIQPLALNVRLSCQLLDVPESSYYERINRHPSKTQLR
FT                   RQYLSLKISQLFNANRGIYGAPKIHHLLLKQGEKVGLKLVQKLMKQLQLKSVVIKKFKP
FT                   GYSLSDHINRKNLIQTEPTKKNKVWSTDITYIPTQQGWAYLSTIMDRYTKKVIAWDLGK
FT                   RMTVELVQRTLNKAIKSQDYPEAVILHSDQGSQYTSLEYEELLKYYGMTHSFSRRGYPY
FT                   HNASLESWHGHLKREWVYQFKYKNFEEAYQSIFWYIEAFYNSKRIHQSLGYLTPNQFEK
FT                   VSA"
FT   gene            complement(625680..625940)
FT                   /locus_tag="LACR_0685"
FT                   /note="LactoCOG number LaCOG00049"
FT   CDS_pept        complement(625680..625940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0685"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72250"
FT                   /db_xref="GOA:Q02W89"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q02W89"
FT                   /protein_id="ABJ72250.1"
FT                   /translation="MQKRYSKEFKETLIAFYHSGQSVTQLSKEYDVAPATIYKWIDLYS
FT                   KSNESSVSKADFLELKRQLAKVKEERDILKKVLTIFAEKKK"
FT   gene            complement(626273..626944)
FT                   /locus_tag="LACR_0686"
FT                   /note="LactoCOG number LaCOG00440"
FT   CDS_pept        complement(626273..626944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0686"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72251"
FT                   /db_xref="GOA:Q030X1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q030X1"
FT                   /protein_id="ABJ72251.1"
FT                   /translation="MKAILKMDNITKSFGSGHNKIQALKGINLEVNQGEFVSIIGPSGS
FT                   GKSTFLTISGGLQSPTSGNITINGLNFTPLSEKKRSKLRFKEIGFILQSSNLIPYLTLE
FT                   EQFLLIDKINHEKLASKKGLELLDSLDILDLKNKYPSDLSGGERQRAAIARALFNEPNL
FT                   ILADEPTASLDTEHAYQVVELLRQEAHLKNKATIMVTHDQRMIKNSDSVYQIEDGLLSK
FT                   I"
FT   gene            complement(626946..628019)
FT                   /locus_tag="LACR_0687"
FT                   /note="LactoCOG number LaCOG01523"
FT   CDS_pept        complement(626946..628019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0687"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72252"
FT                   /db_xref="GOA:Q030X0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q030X0"
FT                   /protein_id="ABJ72252.1"
FT                   /translation="MFLALREIRYNKARYTLIGAIIFLIAYVVFILSGLSVGLANQFKQ
FT                   SVIDWNAEKIILSTSSNNIISASQISSSDLEKIKVENGSELSLFSTSMRKANSERSNIT
FT                   VMALPSDSNIMPKVFDGKKFADNSLDIIISKKLANQVYKIGQEVSIGNNNIKLKIVGIS
FT                   KASSYSASPTVYTSFSALNQIKYGKNSKTPFSVNALVVKSGKIDINSAISNQYKVISIP
FT                   ELINDIPGYSAQNMTLSAMIYFLLLIVLLIIGVFMYVITLQKVPIFGIMKAQGISNTTI
FT                   MNSLLGQTFILSLLGVLVAFVASYGTSFILPEAMPFEVSITNWLLYSLILIIVSIIGSL
FT                   FSIITIRKIDPTKAIGG"
FT   gene            complement(628031..628600)
FT                   /locus_tag="LACR_0688"
FT                   /note="LactoCOG number LaCOG00441"
FT   CDS_pept        complement(628031..628600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0688"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72253"
FT                   /db_xref="GOA:Q030W9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q030W9"
FT                   /protein_id="ABJ72253.1"
FT                   /translation="MPKSTYFSLSDEKRKRVYDACLLEFQTHSFHEAKIMHIVKALDIP
FT                   RGSFYQYFEDLKDSYYYILSQETVEIHDLFFNLLKEYPLEVALDKYKYLLLENLVNSPQ
FT                   YNLYKYRFLDWTYELERDWKPKGEVTVPARELDNPISQVLKSVIHNLVYRMFSENWNEQ
FT                   KFIETYDKEIKLLTEGLLNYVTENKK"
FT   gene            complement(628787..630310)
FT                   /locus_tag="LACR_0689"
FT                   /note="LactoCOG number LaCOG02483"
FT   CDS_pept        complement(628787..630310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0689"
FT                   /product="Acyl-coenzyme A synthetase/AMP-(fatty) acid
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72254"
FT                   /db_xref="GOA:Q030W8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q030W8"
FT                   /protein_id="ABJ72254.1"
FT                   /translation="MKFKHEPLNLYLNFKKSAEQFPDSPIIFDQTVGAFPELALETTYQ
FT                   KTHQAIVDKASLLSELGIKKSDKVIIFKSSAFDTYLLAVAVSYLGAVPAMISYHLPAET
FT                   MDILAGRLDDPWLIYDQVTDQTVTEMKNLKNSKKLSVSKFASQKPSHLVDSQQLDNDEI
FT                   AYLTHTSGTTGVPKLIAHSANSMGWRWVLQRTVMDWMPDKEEILAFHISPVHSRFNIGV
FT                   SSAMTFGFGLMPLNDLSRANLVNLFSKHQPYAFETHPNDFVRLANLAKQEPEIFSSIRY
FT                   LHSTFDAINKETMHTFLSTSKHDNPVFLQIYGQSECGPMIWKKHRLSTLADTDAREMGI
FT                   GMPGLSKARIADENGNECPAGIPGRIHFLSKGRALTYYKEEDRFNKEVYGDWWDTGDWG
FT                   LMNEEGNLFLHDRQVDLIDKIESNLAIEDLLLDQHDFLDEVVIIRDKSGKPQPILALAD
FT                   NAEMDWSAWWASIVDLPFLNEPILMAYDEIPRTATMKVQRLALERDLAK"
FT   gene            630539..631420
FT                   /locus_tag="LACR_0690"
FT                   /note="LactoCOG number LaCOG00442"
FT   CDS_pept        630539..631420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0690"
FT                   /product="Mg2+ and Co2+ transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72255"
FT                   /db_xref="GOA:Q030W7"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q030W7"
FT                   /protein_id="ABJ72255.1"
FT                   /translation="MISTSEMKNFTYVLNPTREEIGNISEHYDFPFDYLSGILDDYENA
FT                   RFETDDNDNNLILLQYPALSKYGEVATFPYSLVWTKNESVILALNHEIDNGLIFEREYD
FT                   YKRYKHQLIFQVMYQMTHTFHDYLRDFRTRRRRLEVGIKNSTKNDQIVDLIAIQASLIY
FT                   FEDALHNNMQVLQNFIDYLREDYEDGFAEKIYDIFVETDQAYTETKIQLKLLENLRDLF
FT                   SNIVSNNLNIVMKIMTSATFVLGIPAVIVGFYGMNVPIPGQNFNWMVWLILVLGILLCV
FT                   WVTWWLHKKDML"
FT   gene            631681..634044
FT                   /locus_tag="LACR_0691"
FT                   /note="LactoCOG number LaCOG00443"
FT   CDS_pept        631681..634044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0691"
FT                   /product="Pyruvate-formate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72256"
FT                   /db_xref="GOA:Q030W6"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:Q030W6"
FT                   /protein_id="ABJ72256.1"
FT                   /translation="MKTEVTENIFEQAWDGFKGTNWRDKASVTRFVQENYKPYDGDESF
FT                   LAGPTERTLKVKKIIEDTKNHYEEVGFPFDTDRVTSIDKIPAGYIDANDKELELIYGMQ
FT                   NSELFRLNFMPRGGLRVAEKILTEHGLSVDPGLHDVLSQTMTSVNDGIFRAYTSAIRKA
FT                   RHAHTVTGLPDAYSRGRIIGVYARLALYGADYLMKEKAKEWDAITEINDDNIRLKEEIN
FT                   MQYQALQEVVNFGALYGLDVSRPAMNVKEAIQWVNIAYMAVCRVINGAATSLGRVPIVL
FT                   DIFAERDLARGTFTEQEIQEFIDDFVLKLRTMKFARAAAYDELYSGDPTFITTSMAGMG
FT                   NDGRHRVTKMDYRFLNTLDTIGNAPEPNLTVLWDYKLPYSFKRYSMSMSHKHSSIQYEG
FT                   VETMAKDGYGEMSCISCCVSPLDPENEEGRHNLQYFGARVNVLKAMLTGLNGGYDDVHK
FT                   DYKVFDIEPVRDEILDYDTVMENFDKSLNWLTDTYVDAMNIIHYMTDKYNYEAVQMAFL
FT                   PTKVRANMGFGICGFANTVDSLSAIKYAKVKTLRDENGYIYDYEVEGDFPRYGEDDDRA
FT                   DDIAKLVMKMYHEKLASHKLYKNAEATVSLLTITSNVAYSKQTGNSPVHKGVFLNEDGT
FT                   VNKSKLEFFSPGANPSNKAKGGWLQNLRSLAKLEFKDANDGISLTTQVSPRALGKTRDE
FT                   QVDNLVQILDGYFTPGALINGTEFAGQHVNLNVMDLKDVYDKIMRGEDVIVRISGYCVN
FT                   TKYLTPEQKQELTERVFHEVLSNDDEEVMHTSNI"
FT   gene            634275..634934
FT                   /locus_tag="LACR_0692"
FT                   /note="LactoCOG number LaCOG00444"
FT   CDS_pept        634275..634934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0692"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72257"
FT                   /db_xref="GOA:Q030W5"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q030W5"
FT                   /protein_id="ABJ72257.1"
FT                   /translation="MIKVIGLTGGIASGKSTVVDFLISEGYQVIDADKVVRQLQEPDGK
FT                   LFNVIMETFGSDFTDENGKLNRAKLSALVFSDPNQRQKLSNLQDEIIRKELYARRDQLI
FT                   KELSEKSVSNSFDTEAQPKNSSVNQIIFMDIPLLLEYHYEGFDEIWLVAIPENLQIERL
FT                   MERNSFTEEEAKKRISSQMSLSEKKKYADIILDNSGTIDALKKQIQQELARIIKEK"
FT   gene            634937..636154
FT                   /locus_tag="LACR_0693"
FT                   /note="LactoCOG number LaCOG00078"
FT   CDS_pept        634937..636154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0693"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72258"
FT                   /db_xref="GOA:Q030W4"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q030W4"
FT                   /protein_id="ABJ72258.1"
FT                   /translation="MNHTKTVNWKRNLFITWIGCFFVGSSFSLVMPFLPLYIQGLGVSG
FT                   GNVELYSGLAFSLPALASGLVAPIWGRLADEHGRKVMMVRASIVMTLTMGGIAFVPNVW
FT                   WLLGLRLLMGFFSGYIPNSTAMIASQAPKDKSGYALGTLATAMVSGTLIGPSLGGLLAE
FT                   WFGMANVFLIVGALLALATLLTIFFVHENFEPIAKGEMLSSREIINKVSNKQILFGLLV
FT                   TTFIIQITSQSIEPFVTLYIKTLTTSTNNLMFISGLIVSAVGLSAMISSSFLGRLGDKY
FT                   GSHRLILIGLVFTFVIYLPMAFVQSPLQLGILRFLLGFGTGALMPSVNSLLSKITPKEG
FT                   VSRIFAYAQMCSNLGMVTGPLVGSAIAGYISYRAAIVGTSLFVIVNIIWSFINFRKYLR
FT                   KRSIME"
FT   gene            636151..636297
FT                   /locus_tag="LACR_0694"
FT                   /note="LactoCOG number LaCOG00050"
FT   CDS_pept        636151..636297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0694"
FT                   /product="LSU ribosomal protein L33P"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72259"
FT                   /db_xref="GOA:Q030W3"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q030W3"
FT                   /protein_id="ABJ72259.1"
FT                   /translation="MRVKITLICSSCGNKNYISSKNKATHPEKVETMKFCPKERIVTLH
FT                   REG"
FT   gene            636675..637937
FT                   /locus_tag="LACR_0695"
FT                   /note="LactoCOG number LaCOG00446"
FT   CDS_pept        636675..637937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0695"
FT                   /product="cell division-specific peptidoglycan biosynthesis
FT                   regulator FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72260"
FT                   /db_xref="GOA:Q030W2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q030W2"
FT                   /protein_id="ABJ72260.1"
FT                   /translation="MNLNKNNFLNYSILIPYLILAGIGIVMVFSTTVPDQLQKGLNPYK
FT                   LVINQTAFVLLSIIMIAVIYRLKLRALKNRKMIGIIMVILILSLIFCRIMPSSFALTAP
FT                   VNGARGWIHIPGIGTVQPAEFAKVFIIWYLASVFSTKQEEIEKNDINEIFKGKTLTQKL
FT                   FGGWRLPVVAILLVDLIMPDLGNTMIIGAVALVMIGASGISWRWYSGYSRLILSLMVIF
FT                   LGFLFIVGGDIIPSFLPIAYINKRFEAFVNPFTDLANSGHQLANSYYAVVNGGWTGRGL
FT                   GNSIQKNGFLPEAQTDFIFPIVVEELGIIGGIIILAILFFLISRMLIVGIKAKSVFNSL
FT                   IMIGVSGLLLIQVFVNVGGAIGIIPETGVTFPFLSQGGSSFLVLSLGIAFALNISADEK
FT                   RREVSELSNHYSSSVPNYEND"
FT   gene            638042..641455
FT                   /locus_tag="LACR_0696"
FT                   /note="LactoCOG number LaCOG00447"
FT   CDS_pept        638042..641455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0696"
FT                   /product="Pyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72261"
FT                   /db_xref="GOA:Q030W1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q030W1"
FT                   /protein_id="ABJ72261.1"
FT                   /translation="MKKLLVANRGEIAVRVFRACNELGLSTVAVYAREDEYSVHRFKAD
FT                   ESYLIGQGKKPIDAYLDIDDIIRVALESGADAIHPGYGLLSENLEFATKVRAAGLVFVG
FT                   PELHHLDIFGDKIKAKAAADEAQVPGIPGTNGAVDIDGALEFAQTYGYPVMIKAALGGG
FT                   GRGMRVARNDAEMHDGYARAKSEAIGAFGSGEIYVEKYIENPKHIEVQILGDSHGNIVH
FT                   LHERDCSVQRRNQKVIEIAPAVGLSPEFRNEICEAAVKLCKNVGYVNAGTVEFLVKDDK
FT                   FYFIEVNPRVQVEHTITELITGVDIVQAQILIAQGKDLHTEIGLPAQAEIPLLGSAIQC
FT                   RITTEDPQNGFLPDTGKIDTYRSPGGFGIRLDVGNAYAGYEVTPYFDSLLVKVCTFANE
FT                   FSDSVRKMDRVLHEFRIRGVKTNIPFLINVIANENFTSGQATTTFIDNTPSLFNFPRLR
FT                   DRGTKALHYLSMITVNGFPGIENTEKRHFEEPRQPQLNIEKKKTAKNILDEQGADAVVE
FT                   YVKNTKEVLLTDTTLRDAHQSLLATRLRLQDMKGIALAIDQGLPELFSAEMWGGATFDV
FT                   AYRFLNESPWYRLRKLRKLMPNTMFQMLFRGSNAVGYQNYPDNVIEEFIRVAAHEGIDV
FT                   FRIFDSLNWLPQMEKSIQAVRDNGKIAEATICYTGDILDPSRPKYNIQYYKDLAKELEA
FT                   TGAHILAVKDMAGLLKPQAAYRLISELKDTVDLPIHLHTHDTSGNGIITYSGATQAGVD
FT                   IIDVATASLAGGTSQPSMQSIYYALEHGPRHASINVKNAEQIDHYWEDVRKYYAPFEAG
FT                   ITSPQTEVYMHEMPGGQYTNLKSQAAAVGLGHRFDEIKQMYRKVNMMFGDIIKVTPSSK
FT                   VVGDMALFMIQNELTEEDVYARGNELNFPESVVSFFRGDLGQPVGGFPEELQKIIVKDK
FT                   SVITDRPGLHAEKVDFATVKADLEQKIGYEPGDHEVISYIMYPQVFLDYQKMQREFGAV
FT                   TLLDTPTFLHGMRLNEKIEVQIEKGKTLSIRLDEIGEPDLAGNRVLFFNLNGQRREVVI
FT                   NDQSVQTQIVAKRKAETGNPNQIGATMPGSVLEILVKAGDKVKKGQALMVTEAMKMETT
FT                   IESPFDGEVIALHVVKGEAIQTQDLLIEID"
FT   gene            641581..642905
FT                   /pseudo
FT                   /locus_tag="LACR_0697"
FT   gene            642902..645448
FT                   /pseudo
FT                   /locus_tag="LACR_0698"
FT   gene            645468..646706
FT                   /locus_tag="LACR_0699"
FT                   /note="LactoCOG number LaCOG00450"
FT   CDS_pept        645468..646706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0699"
FT                   /product="isocitrate dehydrogenase (NADP)"
FT                   /EC_number="1.1.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72262"
FT                   /db_xref="GOA:Q030W0"
FT                   /db_xref="InterPro:IPR004439"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q030W0"
FT                   /protein_id="ABJ72262.1"
FT                   /translation="MKIEMKNGKLIVPDYPTIGYIRGDGVGEDIFPQAKRVFDAAVLKI
FT                   FGEKKKIDWQKLLAGGEAFASRGEYLPDETLEQIKENMIAIKGPLMTPVGESFRSINVT
FT                   LRQKLDLYACVRPVEYFTGIKSPIRAPEKVNMTIFRENTEDIYAGIEFSSSSKESKKLI
FT                   NFLERELSVHSIRFAETSAIGIKPVSPDGSKRLVSAAFDYAIKMNKKRVTFVHKGNIMK
FT                   FTEGGFRKWGYEVAKNYPTFTKLEHDKIKEEKGTEQAEKEKNIALKSGKIYVDDVIADN
FT                   FLQQIILNPDNFEVVATLNLNGDYISDALAAQVGGIGIAPGANINYESGHAIFEATHGT
FT                   APDIAGLNLANPSSLLLSGVMMFEYIGWQDVAYIIRRALVSTFKLKKYTSDLGGNLSTS
FT                   SFGDLLIAYIEND"
FT   gene            complement(646746..647345)
FT                   /locus_tag="LACR_0700"
FT                   /note="LactoCOG number LaCOG00451"
FT   CDS_pept        complement(646746..647345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0700"
FT                   /product="ATP-dependent Clp protease proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72263"
FT                   /db_xref="GOA:Q030V9"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q030V9"
FT                   /protein_id="ABJ72263.1"
FT                   /translation="MGYLVPTVIEQSSRGERAYDIYSRLLKDRIIMLTGPVEDGMANSI
FT                   IAQLLFLDAQDNTKDIYLYVNTPGGSVSAGLAIVDTMNFIKSDVLTIVMGMAASMGTII
FT                   ASSGTKGKRFMLPNAEYLIHQPMGGAGQGTQQTDMAIVAEQLLKTRKRLEQILADNSNR
FT                   SLEQIHKDAERDHWMDAKETLEYGFIDEIMENNSLK"
FT   gene            647542..648072
FT                   /locus_tag="LACR_0701"
FT                   /note="LactoCOG number LaCOG02484"
FT   CDS_pept        647542..648072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72264"
FT                   /db_xref="GOA:Q030V8"
FT                   /db_xref="UniProtKB/TrEMBL:Q030V8"
FT                   /protein_id="ABJ72264.1"
FT                   /translation="MNTELIIAMIFGLIIGAWLMIAGIYIYKIYDENRYKKRLTIEKLL
FT                   REIEVRNTLNQKVIEILNRPITGNDKELINPQSDVKVPFYDYNFLKNYTSMYNLYIPTY
FT                   FLNTFFKKLSHHLAVFDDEQDLKNGGYIFKESRTIFENFSVEITDDIEAKKRELQKAKN
FT                   VYPSMLKKQHYNI"
FT   gene            648242..648640
FT                   /locus_tag="LACR_0702"
FT                   /note="LactoCOG number LaCOG00361"
FT   CDS_pept        648242..648640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0702"
FT                   /product="Arsenate reductase related protein, glutaredoxin
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72265"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q030V7"
FT                   /protein_id="ABJ72265.1"
FT                   /translation="MITIYTAPSCTSCKKAKTWLSYHHIPFNERNLIADPLSTTEISQI
FT                   LQKCDDGVEGLISSRNRFVKTLGVDFEDISLSQAIKIISENPQIMRRPIIMDEKRLHVG
FT                   YNEEEIRAFLPRTVRVLENGGARLRSAI"
FT   gene            complement(648791..648844)
FT                   /locus_tag="LACR_0703"
FT   CDS_pept        complement(648791..648844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0703"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72266"
FT                   /db_xref="UniProtKB/TrEMBL:Q030V6"
FT                   /protein_id="ABJ72266.1"
FT                   /translation="MEFKSLLLLSLAAVASN"
FT   gene            complement(648941..650104)
FT                   /locus_tag="LACR_0704"
FT                   /note="LactoCOG number LaCOG00453"
FT   CDS_pept        complement(648941..650104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0704"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72267"
FT                   /db_xref="GOA:Q030V5"
FT                   /db_xref="UniProtKB/TrEMBL:Q030V5"
FT                   /protein_id="ABJ72267.1"
FT                   /translation="MTKNYLEIPDELFNKLSDYAQNDQLSIRLENQRILLENPDASHPN
FT                   KQTLALHYFIVPSLLSGIVAMVIFLFAKHPQIAFTGSRHLSVASLSIILSTLLGFFGFL
FT                   WIYLKKSCDLSKSKFKILRESLTLSVAYTSIAFAVQIIFWYIIGKTFSGVTFDPFTAGL
FT                   LVLVFVGIVLYFLISAAVSVTLSNLILLLFTTFIGGILVSMATNNQKDWWQHNFSFLGT
FT                   GEATQRWQFNITLIFSALILLTITDFLFAEFSKSKLYNYKFKIIRIFYIIISILIAFVG
FT                   IFPAQSWTMPIHNNSAFGLVGVVLLMIIFLKWLVPSISKEFLTLSWTALIALIVSAFAF
FT                   MSIHYLSLTVFEIIAFAISFTWLVMFINSLRGVVQEESEWKVRLFQK"
FT   gene            complement(650161..651336)
FT                   /locus_tag="LACR_0705"
FT                   /note="LactoCOG number LaCOG00809"
FT   CDS_pept        complement(650161..651336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0705"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72268"
FT                   /db_xref="GOA:Q02VV8"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q02VV8"
FT                   /protein_id="ABJ72268.1"
FT                   /translation="MTQFTTELLNFLAQKQDIDEFFRTSLETAMNDLLQAELSAFLGYE
FT                   PYDKVGYNSGNSRNGSYSRQFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMV
FT                   IKLYQTGVTTREISDIIERMYGHHYSPATISNISKATQENVATFHERSLEANYSVLFLD
FT                   GTYLPLRRGTVSKECIHIALGITPEGQKAVLGYEIAPNENNASWSTLLDKLQNQGIQQV
FT                   SLVVTDGFKGLEQIISQAYPLAKQQRCLIHISRNLASNVKRADRAVILEQFKTIYRAEN
FT                   LEMAVQALENFIAEWKPKYRKVMESLENTDNLLTFYQFPYQIWHSIYSTNLIESLNKEI
FT                   KRQTKKKVLFPNEEALERYLVTLFEDYNFKQSQRIHKGFGQCADTLESLFD"
FT   gene            651751..654434
FT                   /pseudo
FT                   /locus_tag="LACR_0706"
FT   gene            654490..654750
FT                   /locus_tag="LACR_0707"
FT                   /note="LactoCOG number LaCOG00049"
FT   CDS_pept        654490..654750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0707"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72269"
FT                   /db_xref="GOA:Q02W89"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q02W89"
FT                   /protein_id="ABJ72269.1"
FT                   /translation="MQKRYSKEFKETLIAFYHSGQSVTQLSKEYDVAPATIYKWIDLYS
FT                   KSNESSVSKADFLELKRQLAKVKEERDILKKVLTIFAEKKK"
FT   gene            654747..655601
FT                   /locus_tag="LACR_0708"
FT                   /note="LactoCOG number LaCOG00439"
FT   CDS_pept        654747..655601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0708"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72270"
FT                   /db_xref="GOA:Q02YT6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q02YT6"
FT                   /protein_id="ABJ72270.1"
FT                   /translation="MSAADMAQTIQTLALNVRLSCQLLDVPESSYYERINRHPSKTQLR
FT                   RQYLSLKISQLFNANRGIYGAPKIHHLLLKQGEKVGLKLVQKLMKQLQLKSVVIKKFKP
FT                   GYSLSDHINRKNLIQTEPTKKNKVWSTDITYIPTQQGWAYLSTIMDRYTKKVIAWDLGK
FT                   RMTVELVQRTLNKAIKSQDYPEAVILHSDQGSQYTSLEYEELLKYYGMTHSFSRRGYPY
FT                   HNASLESWHGHLKREWVYQFKYKNFEEAYQSIFWYIEAFYNSKRIHQSLGYLTPNQFEK
FT                   VSA"
FT   gene            655769..655915
FT                   /locus_tag="LACR_0709"
FT   CDS_pept        655769..655915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0709"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72271"
FT                   /db_xref="UniProtKB/TrEMBL:Q030V1"
FT                   /protein_id="ABJ72271.1"
FT                   /translation="MSLSDKMILPVYLVAYWILNLVSAISAEIVVLSNRTNKGKWESPD
FT                   RGI"
FT   gene            656022..656912
FT                   /locus_tag="LACR_0710"
FT                   /note="LactoCOG number LaCOG03011"
FT   CDS_pept        656022..656912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0710"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72272"
FT                   /db_xref="GOA:Q030V0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q030V0"
FT                   /protein_id="ABJ72272.1"
FT                   /translation="MTYNSTLPKVFVYLLTTIETLYQTRVPLEVQNRKNVHLATSDCLV
FT                   IACYLWGVLHFSETLKAKHQLAQSLFPNFLEYSRFVRRCNALLPSIQVIRQALVFKEVE
FT                   GISVSIIDSFPIPLCQPIRNFRSKGLGDYANVGYNATKGQYFYGCKCHALVSESGYVID
FT                   YTITPASMADSSMTEEVLSQFGTPTVLGDMGYLGQSLHDRLELKGIDLITPVRKNMKQK
FT                   KILFPNFSKRRKVIERVFSFLTNLGAERCKSRSPQGFQLKLEMILLAYSLLLKSAKSLE
FT                   PETLRYSIGYQVMAK"
FT   gene            657127..658074
FT                   /locus_tag="LACR_0711"
FT                   /note="LactoCOG number LaCOG00059"
FT   CDS_pept        657127..658074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0711"
FT                   /product="Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72273"
FT                   /db_xref="GOA:Q030U9"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q030U9"
FT                   /protein_id="ABJ72273.1"
FT                   /translation="MYAFNTYDSISVYSNKGGLEADEIQEKNVILLVMFLIIGFLVIMS
FT                   TRETEEYVKESKKEQPDFAYESLLQDNDGIIVLCYHRVLKDTPITSFASTISQNSQLHE
FT                   YNVFLEDFEKQMEFLKENHISVLTSEQLISKINKKEVIGKAVVITFDDIDKSLTENAYP
FT                   VMKEFDLPFTQFIITGKVGQTIDGSQMSSWKEIKEMDENPLVISGLHTNDLHYQENLEP
FT                   VLSTNISKKVVQKDYLKSQKTFQEELNKKGNVFAYPYGAQNKDLENYMLKDGISGIFTL
FT                   SPGVVTNETKYSNIPRLIVTKENWKTIEHWLVKK"
FT   gene            complement(658161..659510)
FT                   /locus_tag="LACR_0712"
FT                   /note="LactoCOG number LaCOG01877"
FT   CDS_pept        complement(658161..659510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0712"
FT                   /product="Branched-chain amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72274"
FT                   /db_xref="GOA:Q030U8"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:Q030U8"
FT                   /protein_id="ABJ72274.1"
FT                   /translation="MKEKLAGKDYLFIGSMLFGLFFGAGNLIFPIHMGQEAGAAISQAN
FT                   FGFLVTAVGFPFLGIIALGISQSNGVFELATRVNRIYAYIFTILLYLVIGPFFALPRLA
FT                   TTSFEIGISPFLSNKLQTPLLALFSILFFGTAWFLSRKPTKLLDYIGKFLNPLFLVLLG
FT                   LILIIAFSHPLGSVHQAEVGKLYQNSAFMNGFTQGYNTLDALAALAFGIIIITTIRQRG
FT                   VKNPKIIAKETIKAGLISVGLMAIIYTCLSYLGAMSVGKFAISENGGIALAQISNYYLG
FT                   TFGMIILALIVIIACLKTAVGLMSAFSETFVELFPKREYRFYLMIVSILPCIFANIGLT
FT                   KIIELSVPVLMFLYPLAITLILLALLGPVFQHSKLVYQITTAFTLLAAIADGLNALPNP
FT                   LKSLKPIAAILNFAKDFLPFFSLGMGWILPAVLGFIIGCLVHFLKRITNK"
FT   gene            complement(659727..659999)
FT                   /locus_tag="LACR_0713"
FT                   /note="LactoCOG number LaCOG00456"
FT   CDS_pept        complement(659727..659999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0713"
FT                   /product="Predicted acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72275"
FT                   /db_xref="GOA:Q030U7"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:Q030U7"
FT                   /protein_id="ABJ72275.1"
FT                   /translation="MEIIEKQNLFELLSDNGEVIGEMNYMNMKNSIIITHTGVALDYRG
FT                   QGLAEKLVLAGIEKARHENIKLGATCPYAAEYFRKHKEELADILK"
FT   gene            complement(660003..660272)
FT                   /locus_tag="LACR_0714"
FT                   /note="LactoCOG number LaCOG02489"
FT   CDS_pept        complement(660003..660272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0714"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72276"
FT                   /db_xref="InterPro:IPR010693"
FT                   /db_xref="UniProtKB/TrEMBL:Q030U6"
FT                   /protein_id="ABJ72276.1"
FT                   /translation="MDNSKLFDDVATEEELLKNDYRKYHGENMDIYYNATICEHAGECV
FT                   RGNPLVFEVGRKPWIIPDNGDTPSNQTVINRCPSGALKYLIKEK"
FT   gene            660726..661502
FT                   /locus_tag="LACR_0715"
FT                   /note="LactoCOG number LaCOG00457"
FT   CDS_pept        660726..661502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0715"
FT                   /product="Mg-dependent DNase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72277"
FT                   /db_xref="GOA:Q030U5"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q030U5"
FT                   /protein_id="ABJ72277.1"
FT                   /translation="MIEIFDTHTHLNTIEFEGRVKEEISKAQSFGVTKINNVGSNYQLN
FT                   DAALLLADKFESAYATIGWHPDDAAEFDTAAEEYLLTKGRSKKVIAVGEIGLDYHWMVS
FT                   PKAVQERVFRRQIQISKELGIPFQVHTRDALSDTYEIIKSEGVGTAGAIMHSFSGTAEE
FT                   ALKFVELGMNISFSGVVTFKKALDVQEAARLLPLDKILVETDAPYLTPTPYRGKENTPG
FT                   YTKYVVEKIADLRGISMEEVAEATNENALKIFDLKK"
FT   gene            661536..662069
FT                   /locus_tag="LACR_0716"
FT                   /note="LactoCOG number LaCOG00458"
FT   CDS_pept        661536..662069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0716"
FT                   /product="Adenylate kinase related kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72278"
FT                   /db_xref="GOA:Q030U4"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q030U4"
FT                   /protein_id="ABJ72278.1"
FT                   /translation="MKIIIIGSSGSGKSTLARELAKKTDYPVLHLDKVFHKHPSDLGRI
FT                   KLREATRDFISQNENGIIDGNYGSSLSERLPYIDEIVWLKGSRFKTVFRVIKRSILVRL
FT                   FHKNRSDMAEEFREKWDKDYLEFLNFVWTFPEKEFPQIEQKISEFAVWDKVIILKNRKD
FT                   KEKYLIKYDRKTKN"
FT   gene            662047..662607
FT                   /locus_tag="LACR_0717"
FT                   /note="LactoCOG number LaCOG00459"
FT   CDS_pept        662047..662607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0717"
FT                   /product="RNAse M5"
FT                   /EC_number="3.1.26.8"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72279"
FT                   /db_xref="GOA:Q030U3"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:Q030U3"
FT                   /protein_id="ABJ72279.1"
FT                   /translation="MIEKPKINEVIVVEGRDDTANLKRYFDCDTYETGGSSIDDRDLER
FT                   LKVLEEKRGIIVFTDPDFQGERIRKIIMQAIPQAGHAFLNRDEAKPKGKGSLGVEHANF
FT                   AALNQALSEVFGEKSSLTDSSADLTQTDLMRFGLIMAADSRKRREFLCEELRIGYANGK
FT                   QIKKRLNMFKITIEQIEKVMKNY"
FT   gene            662737..663621
FT                   /locus_tag="LACR_0718"
FT                   /note="LactoCOG number LaCOG00460"
FT   CDS_pept        662737..663621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0718"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72280"
FT                   /db_xref="GOA:Q030U2"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q030U2"
FT                   /protein_id="ABJ72280.1"
FT                   /translation="MTENNIDRISNIIRTQDILRRHDFNFKKKFGQNFLTDHNILTKIT
FT                   ETADLSKEVNVIEIGPGIGSLTQYLLEEAAEVMAFEIDKSLIPILEETMAPYDNFTLVS
FT                   EDILKVDLLSEIQKFKNPNLPIKVVANLPYYITTPILMHLIESKIPFSEFVVMMQKEVA
FT                   DRIAARPKTKAYGSLSIAVQYYMEASVAFIVPRTVFIPAPNVDSAILKMVRREEPLVEV
FT                   EDEEWFFKTMHSSFVHRRKTLMNNMQAAFGKESKPEIEKLLAQAEISPTIRGEALSIEE
FT                   FAKLADALLPLKK"
FT   gene            663729..664787
FT                   /locus_tag="LACR_0719"
FT                   /note="LactoCOG number LaCOG00461"
FT   CDS_pept        663729..664787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0719"
FT                   /product="aminopeptidase P"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72281"
FT                   /db_xref="GOA:Q030U1"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q030U1"
FT                   /protein_id="ABJ72281.1"
FT                   /translation="MRIEKLKAKMLTENIDSLLITDMKNIFYLTGFSGTAGTVFLTKKR
FT                   NIFMTDSRYSEMARGLIKNFEIIETRDPISLLTELSASESVKNMAFEETVDYAFFKRLS
FT                   KAATKLDLFSTSNFVLKLRQIKDESEISLIKKACEIADEAFMSALRFIEPGRTEIEVAN
FT                   FLDFKMRDLEASGISFETIVASGKRSSLPHGVATSKMIQFGDPVTIDFGCYYEHYASDM
FT                   TRTIFVGSVDDKMRTIYETVRKANEALIKQVKAGMTYAQYDNIPREVIEKADFGQYFTH
FT                   GIGHGLGLDVHEIPYFNQSMTENQLKSGMIITDEPGIYLPEFGGVRIEDDLLVTENGCE
FT                   VLTKAPKELIVI"
FT   gene            664919..665476
FT                   /locus_tag="LACR_0720"
FT                   /note="LactoCOG number LaCOG00462"
FT   CDS_pept        664919..665476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0720"
FT                   /product="translation elongation factor P (EF-P)"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72282"
FT                   /db_xref="GOA:Q030U0"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q030U0"
FT                   /protein_id="ABJ72282.1"
FT                   /translation="MVLAKDLKSGMTFLNGEKLLRVMEASHHKPGKGNTIMRMKLKDVR
FT                   SGSTFDDTYRPEDKFEQAVIETVTAQYLYSMDDIANFMNNETYEQYEIPVEQVKDELLY
FT                   VLENTDVKIQFYGTEVIGIQLPTTVVLEVTETQPSIKGATVTGSGKPATMETGLVVNVP
FT                   DFVEVGTKLEINTQTGEYLKRA"
FT   gene            665623..666024
FT                   /locus_tag="LACR_0721"
FT                   /note="LactoCOG number LaCOG00463"
FT   CDS_pept        665623..666024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0721"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72283"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:Q030T9"
FT                   /protein_id="ABJ72283.1"
FT                   /translation="MAEKTVHSEELGDIVIAPEVLEVIIGITTAKIEGVHALRNKRFSD
FT                   RLGKKNEGRGVYIDSKDDKVAVDIYVYLTYGVSLPAVATKIQKEVKEAVAQATEIVVDE
FT                   VNIHVVGIMTEKQPKPALEDLFDEGFFDA"
FT   gene            666017..666994
FT                   /locus_tag="LACR_0722"
FT                   /note="LactoCOG number LaCOG00464"
FT   CDS_pept        666017..666994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0722"
FT                   /product="Transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72284"
FT                   /db_xref="GOA:Q030T8"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q030T8"
FT                   /protein_id="ABJ72284.1"
FT                   /translation="MPKTLTQHQIRQRAVQVLFSYAVQKEMATSVVSSFRENVEKIETE
FT                   LSQTIRFDVDFRDERITVRKFPKGLSQPLEAIYEIYEILGVKDIEKTNVAKALAFMRDF
FT                   GGYAKKMNEYEATNLFSGIMDNLKLIRLFQIELDEEPVAPKVLEFFKNLPENATTEETF
FT                   ETFQKTFSFLHENILEKYTSDLFVPNTLKEELDEQLQQAETTAESHLSDLLKETKHFVL
FT                   NYDNDRAEDLEAPEYFTQLVDGVLEKKEDLEINISKYLAKNWSFSRLTLVEQAILQVST
FT                   YEILFTDTPNVVAVNEAIELSKDFSDEKSSRFINGVLTNFLKED"
FT   gene            667218..669221
FT                   /locus_tag="LACR_0723"
FT                   /note="LactoCOG number LaCOG00465"
FT   CDS_pept        667218..669221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0723"
FT                   /product="4-alpha-glucanotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72285"
FT                   /db_xref="GOA:Q030T7"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q030T7"
FT                   /protein_id="ABJ72285.1"
FT                   /translation="MVTNTFSIEPYGEKAYHTGIAVPVFSLRTENSSGVGQFSDLKKLA
FT                   DFTYRSGMDVIQLLPINDTTTFMDWRDSYPYRAISVFALHPLYLDIHEFWKSYTKEQQE
FT                   KLLILESELNSLEKIDYERCLALKWEYAQIIYQNLAVKYQKTKSYQQFYKQNEEWLKAY
FT                   ACFSYLRDINKSANFLAWGKNANYDKNLFDKLKKETSQLDLYIFVQYLLHSQLTEAVDY
FT                   CHKLGIALKGDIAIGIAHDSVDAWTHPELFHLDKQAGAPPDVFAVNGQNWGFPTYNWEK
FT                   MAEDGYDWWKKRLTAMSNYFDAYRLDHILGFFRIWQMPENSVRGLLGQFSPALALSAEE
FT                   IENNYGIPFRQWGIERFILPFIKDWVIDEVFGRDNRDWIIQTFLDYIGDSNYRFKAEFN
FT                   NQKAIENTQMENWVREGLYKLQENVIFLKDDENSEKYHPRIGLLSTISFREFGDDYKGR
FT                   LERLYNDYFYGRNYDFWKEKAYEKLPALKNATKMLACGEDLGMVPDNVPDVMYHLDILR
FT                   LIIERMPADERFVSSLSEVPYLSVVTTSSHDTSPLRAWWEENHDLTQRYYNEVMGWYGE
FT                   APNYASVEIIQEIIKRNLNSNAMMVILPIQDWLAMSEHFRKENAKSEQINIPADPYHYW
FT                   NYRLHCNLQALIENQEWTDFLKNFIKESKRAY"
FT   gene            669321..670463
FT                   /locus_tag="LACR_0724"
FT                   /note="LactoCOG number LaCOG00466"
FT   CDS_pept        669321..670463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0724"
FT                   /product="ADP-glucose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72286"
FT                   /db_xref="GOA:Q030T6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q030T6"
FT                   /protein_id="ABJ72286.1"
FT                   /translation="MAIEMLGLILAGGQGTRLGKLTKDVAKPAVPFGGRYRIIDFALSN
FT                   CANSNVKNVGVITQYQPLTLNAHIGNGAPWGLNGINSGVTILQPYSSQEGSKWFEGTSH
FT                   AVYQNISYIDQQNPEYVLILSGDHIYKMDYEAMLESHKEREASLTVSVMEVPLEEASRF
FT                   GIMNTDDNDRIIEFEEKPKEPKSNLASMGIYIFNWKRLREVLVNGYSKGNPIEDFGGDV
FT                   IPAYIEAGENVFAYRFKGYWKDVGTIDSLHQSSMEFLDLNNELNITDKSWRIYSHNDIS
FT                   APQFITEKLKVKNALVGDGCYVDGTVIHSILSQNIHVQEGTTIEDSFIMSGTFIGENVT
FT                   IKNAIIGENAKIGDNVEIIGEDEVAVIGHGEIKGENKNEQ"
FT   gene            670453..671592
FT                   /pseudo
FT                   /locus_tag="LACR_0725"
FT   gene            671646..673124
FT                   /locus_tag="LACR_0726"
FT                   /note="LactoCOG number LaCOG00468"
FT   CDS_pept        671646..673124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0726"
FT                   /product="glycogen synthase (ADP-glucose)"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72287"
FT                   /db_xref="GOA:Q030T5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:Q030T5"
FT                   /protein_id="ABJ72287.1"
FT                   /translation="MAIREMKREKMKVLFASSECAPFFKTGGLGDVAGALPKELAKKSE
FT                   ISSVGVILPYFKNEMKEEYRSLLVDEFYDFVDLGWRHEYFGVKTLLKDNVKYYFLDNEH
FT                   YFGRGQLYGYGDDGERFAFFDLAVCQLLEKLDFIPDILHVNDWQTAMIPFLLKEKYKWI
FT                   NAYSDIQSVLTIHNIEFQGVMQGDALTELFGMGMERYFEGVVRHNGMLNMLKTGILYAD
FT                   RVNTVSPTYAKEIQTSEFGGGLEGVLQYVKGKISGILNGIDYEIYDPEKDKQISYHFNS
FT                   LDLTGKAKMKAELQKRVFLPINPDIPVIGMVSRLTNQKGFDLVLSQLEELLKEEVQIVL
FT                   LGTGFPELEEGFKYFAQKYPDKLSANIAFDLQFAQEIYAGSDLFLMPSAFEPCGLSQMI
FT                   AMRYGTLPIVHEIGGLRDTVVPFNPVTKEGTGFGFGFIDFDRDILLETIKRALEVYKKE
FT                   PKTLNRIIVSAMEQDFSWETKAQQYIELYQTILK"
FT   gene            673208..675610
FT                   /locus_tag="LACR_0727"
FT                   /note="LactoCOG number LaCOG00469"
FT   CDS_pept        673208..675610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0727"
FT                   /product="Glucan phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72288"
FT                   /db_xref="GOA:Q030T4"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:Q030T4"
FT                   /protein_id="ABJ72288.1"
FT                   /translation="MKLSKKQFKQDFEERLTSKFATDLTKAGYQEIYDALASVVKHYYA
FT                   NIWVSDNQYKDETGKKQAYYFSIEFLPGKMLKSNLLNLGILKTVREGLEDFGIELDEVA
FT                   KVEPDMAIGNGGLGRLASCFMDSLASTGLPGNGNGIRYRYGLFKQKIIDGYQVELPDSW
FT                   LNNGNPWEVRRADKAVEVTFGGEVWLEDDGKGNLIPHYKDQERVLAVPYDTPMIGYENT
FT                   TVNNMCLWRSEVPEELDPKFQNLEYMRQTSMLSAELYPDDSNYDGRLLRLKQEYFFVSA
FT                   GLQRILHHYKGTQKKDIRRISDYIAVHINDTHPALCVPEFMRLLVDDYGVGWNRAWDTT
FT                   VKVMSYTNHTILSEALEKWPEEMVKQLLPRIYQIIVEIDRRRTAELLPKIGASLVHNTR
FT                   IIKDGQIHMANLSIIGSHSTNGVAKLHSDLLKDVELHDFYEIYPERFNNKTNGIADRRW
FT                   IQIANERLSGIIDETIGKSWRHDLDELKLLKNFKDDEKTLEKLQKAKYDDKLRLAALIK
FT                   EKNGIIVNPDAIFDVQVKRLHAYKRQLLNALHILKLYFDLKDNPELDRLPRVFIFGAKA
FT                   APSYHYAKSIIKCINEIANMINNDQTVKDKLKVVFMENYNVSLAEMIIPAANVGEQISL
FT                   ASKEASGTSNMKFMLNGALTIGTLDGANIEIFEAAGDGNNFVFGLTKDEVYEYYRNGNY
FT                   NARDIFEQNPVVNRILNALIDGTIPNIKSEGREIFDSLTVYNDEYFVLRDFNDYVRAQA
FT                   DLEKLYRDPKAWAQASLMNIANVGRFSSDRTVKEYADDIWYIKDPNC"
FT   gene            complement(675615..676505)
FT                   /locus_tag="LACR_0728"
FT                   /note="LactoCOG number LaCOG03011"
FT   CDS_pept        complement(675615..676505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0728"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72289"
FT                   /db_xref="GOA:Q02X23"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q02X23"
FT                   /protein_id="ABJ72289.1"
FT                   /translation="MTYNSTLPKVFVYLLTTIETLYQTRVPLEVQNRKNVHLATSDCLV
FT                   IACYLWGVLHFSETLKAKHQLAQSLFPNFLEYSRFVPRCNALLPSIQVIRQALVFKEVE
FT                   GMSVSIIDSFPIPLCQPIRNFRSKGLGDYANVGYNATKGQYFYGCKCHALVSESGYVID
FT                   YTITPASMADSSMTEEVLSQFGTPTVLGDMGYLGQSLHDRLELKGIDLMTPVRKNMKQK
FT                   KILFPNFSKRRKVIERVFSFLTNLGAERCKSRSPQGFQLKLEMILLAYSLLLKSAKSLE
FT                   PETLRYSIGYQVMAK"
FT   gene            676847..678649
FT                   /locus_tag="LACR_0729"
FT                   /note="LactoCOG number LaCOG00470"
FT   CDS_pept        676847..678649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0729"
FT                   /product="amylopullulanase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72290"
FT                   /db_xref="GOA:Q030T2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q030T2"
FT                   /protein_id="ABJ72290.1"
FT                   /translation="MYYYNPWNLDYKQPFGAVKVGQAILLKFDANQTQVEVKCIIRRDF
FT                   GKRYEFLMSRDESGFFTVTIPFDENAGLYFYYFEILEGSDWEQNKRFYGSSGIGGEGLL
FT                   YTNENDIKPYQLTVFEKEDKAPAWYRDAVFYQIFPDRFHNGNENGQVSHPKPNSFIYGT
FT                   KSDTPFYVKEENGDIARWDFFGGNLRGIINKISYLKELGINAIYLNPVFSGTSNHRYDT
FT                   NDYLKIDSMLGTQEDFQELINLLHQEQMHLVLDGVFSHVGKNSLYFNINGDYGDDEGAA
FT                   KNPDSPYFDWFKFENYPFDYKSWWGIKDLPEIDKDNESFRDFIYGRKNSVLSKWNDLGI
FT                   DGWRLDVADELPDSFIKGIRENLDRYSEKILIGEIWEDASNKISYGTRRKYILGGSLQA
FT                   CMNYPFRDLIINLLNGNRSCQDVAHQLMTLQENYPKDIFYNNLNNLGTHDTERILTMVG
FT                   KENLPLAVSLLFVLPGIPCIYYGDEAGLSGGKDPENRKYFPWDDISPEIYDYYKSWTKK
FT                   RLLENSLKEGEFSSFYSDRLLGILRYTDSEVFVEVINPSEDEIKIDYSEITFLQKFDFM
FT                   PKLKDLLTEQVISGKSNIDLKIER"
FT   gene            678725..678982
FT                   /locus_tag="LACR_0730"
FT                   /note="LactoCOG number LaCOG00006"
FT   CDS_pept        678725..678982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0730"
FT                   /product="Transcriptional regulator, xre family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72291"
FT                   /db_xref="GOA:Q030T1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q030T1"
FT                   /protein_id="ABJ72291.1"
FT                   /translation="MAEDSLKDFQTLGDNELMEIKGGDLSTNIRNERLAIGLTQNQLAE
FT                   QLQFSKQAVYNWEKGKCEPNIETLKALATLFNISVDKLIR"
FT   gene            679082..679231
FT                   /locus_tag="LACR_0731"
FT   CDS_pept        679082..679231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0731"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72292"
FT                   /db_xref="GOA:Q030T0"
FT                   /db_xref="InterPro:IPR004288"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="UniProtKB/TrEMBL:Q030T0"
FT                   /protein_id="ABJ72292.1"
FT                   /translation="MENVKNSLELFTELTDEELENIHGGQNMSMTDGGFEWIYMFGQPY
FT                   ARVA"
FT   gene            679251..679949
FT                   /locus_tag="LACR_0732"
FT                   /note="LactoCOG number LaCOG01370"
FT   CDS_pept        679251..679949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0732"
FT                   /product="Predicted metal-dependent membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72293"
FT                   /db_xref="GOA:Q030S9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q030S9"
FT                   /protein_id="ABJ72293.1"
FT                   /translation="MIKKYWMNKLKYFGLFILIWTIYWFPDVIFAYPEIFFKSLIGYER
FT                   QLASTWLLFANLLISIGLGIFLGVKFGYFKNTLSMFKIKNLLIILMTFFFASILYFVTL
FT                   TYYSSHFPLAGIAQTQMEYSNQIVFPWINAISFGISSPLFEEMAFRGTIYRFFKNDKLA
FT                   FILASITFAWIHTGFSPVLLVYLPMSVILTTIYHRRKVLSESILLHILFNTFLPIMFSF
FT                   LQFLTGIYYL"
FT   gene            complement(680140..680994)
FT                   /locus_tag="LACR_0733"
FT                   /note="LactoCOG number LaCOG03011"
FT   CDS_pept        complement(680140..680994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0733"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72294"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q030S8"
FT                   /protein_id="ABJ72294.1"
FT                   /translation="MTYNSTLPKVFVYLLTTIETLYQTSVSLEVQNRKNIHLATSDCLV
FT                   IACYLWGVLHFSETLKAKHQLAQSLFPNFLEYSRFVRRCNALLPSIQVIRQALVFKEVE
FT                   GMSVSIIDSFPIPLCQPIRNFRSKVLGDYANVGYNATKGQYFYGCKCHALVSESGYVID
FT                   YTITPASMADSSMTEEVLSQFGTPTVLGDMGYLGQSLHDRLELEGIDLMTPVRKNMKQK
FT                   KILFPNFSKRRKVIERVFSFLTNLGAERCKSRSPQGFQLKLEMILLAYSLLLNQLNHWN
FT                   QRL"
FT   gene            681110..682603
FT                   /locus_tag="LACR_0734"
FT                   /note="LactoCOG number LaCOG00471"
FT   CDS_pept        681110..682603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0734"
FT                   /product="Dipeptide/tripeptide permease"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72295"
FT                   /db_xref="GOA:Q030S7"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q030S7"
FT                   /protein_id="ABJ72295.1"
FT                   /translation="MQNLNKTEKTFFGQPRGLLTLFQTEFWERFSYYGMRAILVYYLYA
FT                   LTTADNAGLGLPKAQAMAIVSIYGALVYLSTIVGGWVADRLLGASRTIFLGGILITLGH
FT                   VALATPFGLSSLFVALFLIILGTGMLKPNISNMVGHLYSKDDSRRDTGFNIFVVGINMG
FT                   SLIAPLIVGTVGQGVNYHLGFSLAAIGMIFALFAYWYGRLRHFPEIGREPSNPMDAKAK
FT                   RNFIITLTIVLIVALIGFFLIYQASPANFINNFINVLSIIGIVVPIIYFVMMFTSKKVE
FT                   SDERRKLTAYIPLFLSAIVFWAIEEQSSTIIAVWGESRSNLNPTWFGFTFHIDPSWYQL
FT                   LNPLFIVLLSPIFVRIWNKLGDRQPSTIVKFGLGLMLTGASYLIMTLPGFLNGTSGRAS
FT                   ALWLVLMFAVQMAGELLVSPVGLSVSTKLAPVAFQSQMMAMWFLADSTSQAINAQITPI
FT                   FKAATEVHFFAITGIIGIIVGIILLIIKKPILKLMGDVR"
FT   gene            682755..683012
FT                   /locus_tag="LACR_0735"
FT   CDS_pept        682755..683012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72296"
FT                   /db_xref="UniProtKB/TrEMBL:Q030S6"
FT                   /protein_id="ABJ72296.1"
FT                   /translation="MILNYLQMLVPLFKRSKTFTNANINFKNHSLIVLFKENRGGKGTY
FT                   FYLRLKVSALLLKNEKIQSRNTHYSYELNWVTRKYEFQKL"
FT   gene            683009..683152
FT                   /locus_tag="LACR_0736"
FT   CDS_pept        683009..683152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0736"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72297"
FT                   /db_xref="UniProtKB/TrEMBL:Q030S5"
FT                   /protein_id="ABJ72297.1"
FT                   /translation="MNILCLESELIGGLKKALIVFLKKLINNLMGNKKFNSLLIKTDLF
FT                   NS"
FT   gene            683324..684799
FT                   /locus_tag="LACR_0737"
FT                   /note="LactoCOG number LaCOG00472"
FT   CDS_pept        683324..684799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0737"
FT                   /product="cytochrome bd quinol oxidase subunit 1
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72298"
FT                   /db_xref="GOA:Q030S4"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q030S4"
FT                   /protein_id="ABJ72298.1"
FT                   /translation="MLTIENLARFQFAMTTIFHFFFVPLSVGMVLMTAIMETIYVKTGD
FT                   EKWKKRTKFFGSIMLLSFAVGVVTGIIQEFQFGMNWSEYSRYVGDIFGAPLAVEALLAF
FT                   FLESTFLGVWMFGWDKLGKKLHNATLWIVFVGTFLSSLWILAANSWMQNPVGYEVKGGR
FT                   ATLTSFSALLTNPQTILEFSHVATGFLVTGGFVVAGIAAYQILKNREIDMFKPVLRLGL
FT                   LVALIGAVGNFVAGDQQMIEVKNSQPMKFAATEGVYETTPDPAAWDMVAFFNEADHKEV
FT                   FGIQIPYMLSILTYHRPSGSVEGMNEINAQLQKKYPDVAKEIGGNFFPPVNVLFWTFRI
FT                   MAGLSMLMILLSALGLFWTRKKKPSLYKNKFGLQVYRWMLFAPFLAITSGWLVTELGRY
FT                   PWTVYGLFTMKDSVSPNISVGSLLFSNIVYFFLFCFLGAVMVYFTLQRMREGVEGAETA
FT                   YVSLDSFSQENFDSSSKEENEIQKETKEKGVDE"
FT   gene            684799..685794
FT                   /locus_tag="LACR_0738"
FT                   /note="LactoCOG number LaCOG00473"
FT   CDS_pept        684799..685794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0738"
FT                   /product="cytochrome bd quinol oxidase subunit 2
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72299"
FT                   /db_xref="GOA:Q030S3"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q030S3"
FT                   /protein_id="ABJ72299.1"
FT                   /translation="MTGLQLFWFIIVGVLFSGFFFLEGFDYGVGMSAITVAKDKREVEQ
FT                   AIGSIGPVWDLNEVWLLTAGGAMFASFPYWYASLFSGFYLILFLILVGLIFRGVTFEFR
FT                   HHSHTEKGKMIWTKVLGVASFAIPFLFGLMFTGMIQGVPMDAKGNVTATFTTYVNFLSV
FT                   VGGVAVMLLAWLHGLNYLALKTEGDLRKRAAKVANFLYFVLYAGEVVFAILLAVFTDFF
FT                   EKHFIGTLLLLALIVILTLVAHLSVRSGKEMSAFLASGLTFIALVALIFQGIFPRVMIA
FT                   TNPAHSILIKNASSTGYTLKTMTIITLAILPFVLIYMGWTYYIFRKRIQK"
FT   gene            686059..687768
FT                   /locus_tag="LACR_0739"
FT                   /note="LactoCOG number LaCOG00474"
FT   CDS_pept        686059..687768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0739"
FT                   /product="ABC-type transport system for cytochrome bd
FT                   biosynthesis, ATPase and permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72300"
FT                   /db_xref="GOA:Q030S2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q030S2"
FT                   /protein_id="ABJ72300.1"
FT                   /translation="MFPILGMLAVLQFVAIAGQALFLAAAITKLWQGQLFSHVIPWVMG
FT                   FLVCFLSREIINFIRAKSLDKLAYNLATKLRGDMLDKFFRLGPVAIANLGSGSAATTVI
FT                   TGIDQVENYIKLVLSKVLNMMIVPMLILIPVYFLDWQSGIVLTLTFPFAIIFMILLGYA
FT                   AQGRAERQYKTFQYLSNHFLDSLRGISTLKYFGLSKDYSNSIYKTSEDFRKETMGALRV
FT                   AMLSTFALDFFASLSVAIVALFLGLRLMSGDILLFPALAALILAPEYFLPLRDFASDYH
FT                   ATLNGKNALSAVNEVLSTDENTLSVLKDRVTWTEDSSLKLTDLAKIYDTGRGISEVNLT
FT                   VKGFKKVALVGSSGSGKSTLLSMLAGFLEPTAGKFKLNDQTLTSLTDEKYRQSVQFIPQ
FT                   KTYIFAGTFRQNLAFYEPESTDEQINQAAELAGLGSLLNEIGLDGQIGASGRTISGGQA
FT                   QRVALARAFLSRTRNILFLDEPTAHLDIETELEIKANILPLLENKLVFIATHRLHWLLS
FT                   MDLVIVLNEGQVEGIGTHEQLLAENGYYQKLLSQMRGVDDDKKLLTENGGHE"
FT   gene            687768..689489
FT                   /locus_tag="LACR_0740"
FT                   /note="LactoCOG number LaCOG00475"
FT   CDS_pept        687768..689489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0740"
FT                   /product="ABC-type transport system for cytochrome bd
FT                   biosynthesis, ATPase and permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72301"
FT                   /db_xref="GOA:Q030S1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q030S1"
FT                   /protein_id="ABJ72301.1"
FT                   /translation="MKLKNILFGNDWISPFLKKNRSGFILSIFLGTITISMAGLLMFSS
FT                   GYVISKSATKPENILMIYVPVLFVRIFGIGRPVMHYVERLTSHNWILKITSLLRQKLYL
FT                   RLEKTAVTLADRYRLGDLLGVLNEDIGNLQDLFLRTLFPVLIAGSLSVALIIAGGFLSL
FT                   WFAFGLAIFLGFLIVILPLISLKFTVKLDEELKIYRNQLFSHLTDDILGLQDWVLSGRK
FT                   EDFLTAYRGSELSARKIQAKLLAFGRRRNLFLQVVYGALVIYLMIWSSGILKLGDAPNY
FT                   IAAVSLAAFPLFDAFSPLSDAVVETNRYGDSINRLNALPDQDEEIRSEEITRTDLVINN
FT                   LQFYFEENNKIFNDFDLEVKKGEHIAILGRSGVGKSTLASLIRGDLIPQKGEITFSGVE
FT                   PSKAKNVEEKIGVINQSPYLFATTVRSNLTLAKLDATDEEIWEALELVGLRKMVESLPQ
FT                   KLLTPVDEAGERFSGGERQRLALARVLLSDVDVVILDEPTVSLDPITENQLLTLFFERL
FT                   RDKSIIFITHHLLGVHQMDRVLFLENGSIKFDGKPAVLLESNPTFKQLYQLDLGNE"
FT   gene            689692..689805
FT                   /locus_tag="LACR_0741"
FT   CDS_pept        689692..689805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0741"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72302"
FT                   /db_xref="UniProtKB/TrEMBL:Q030S0"
FT                   /protein_id="ABJ72302.1"
FT                   /translation="MLKMIKKLIQKFNWFIRLIEQPDALLVYAFDEQLQPI"
FT   gene            689823..690701
FT                   /locus_tag="LACR_0742"
FT                   /note="LactoCOG number LaCOG00476"
FT   CDS_pept        689823..690701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0742"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72303"
FT                   /db_xref="GOA:Q030R9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q030R9"
FT                   /protein_id="ABJ72303.1"
FT                   /translation="MSEQTNNLLNLFSKLLHNPSVLFALRADGISKQMKNRGNRNGAQG
FT                   LLVELWNKDGLTNAEIAELLDIKPSSVTAQVKQLEEAEMVIRKQDENDKRVNRIFLTEK
FT                   GREAQETRDTMHNDISETIFGNLTDEEQKQLANLMEKLVETNDAHEDRDFQKMTQFFGN
FT                   PFMENMMNAHDRHAFGNHMRREMQNWQREMRRSSQEMKRGQNRMRHDDRSQAPFGEDWK
FT                   IFGKQIKENFRNSFGKRDEAEFNEHWEHFSDEMKNRFGDFDGHHRPEFDPRAGHSDKHA
FT                   EPKKPENWDDF"
FT   gene            690728..691216
FT                   /locus_tag="LACR_0743"
FT                   /note="LactoCOG number LaCOG02490"
FT   CDS_pept        690728..691216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0743"
FT                   /product="Flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72304"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q030R8"
FT                   /protein_id="ABJ72304.1"
FT                   /translation="MNTLIAYAGKTGNTAKCVRRLAIRLKNVTLIDLNVEEVSPKDFDA
FT                   VIVASPVYSHKFERSVQIFLRTYQNILENKLFAAFVTMVEYGTFNKVIAKEIAEPLRKN
FT                   AVAIANFGGEVNNLTPFDWHDKIVAKSMIKLESKKHPIEFLSEAPQKFIEELKKVNWD"
FT   gene            691364..691906
FT                   /locus_tag="LACR_0744"
FT                   /note="LactoCOG number LaCOG00477"
FT   CDS_pept        691364..691906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0744"
FT                   /product="Lysophospholipase L1 related esterase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72305"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q030R7"
FT                   /protein_id="ABJ72305.1"
FT                   /translation="MEIFPIEKWEEEGKVKFSKYIYNRAVRATTTAFLLKHLESQIINL
FT                   EPSKIFINIGTNDIGFEVPEAEFMSNYNEILTQIGEKLPQAQVYVMRYYPINTLDFGQD
FT                   SDEKTLFETRSNEKFQKASDKIEKLAQKHHFHFIDVNDGLSDKDGNLKKELTFDGAHLN
FT                   PAGYSIVLENLKVYLEE"
FT   gene            691998..693770
FT                   /pseudo
FT                   /locus_tag="LACR_0745"
FT   gene            complement(693744..694400)
FT                   /locus_tag="LACR_0746"
FT                   /note="LactoCOG number LaCOG02491"
FT   CDS_pept        complement(693744..694400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0746"
FT                   /product="Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72306"
FT                   /db_xref="GOA:Q030R6"
FT                   /db_xref="InterPro:IPR010617"
FT                   /db_xref="UniProtKB/TrEMBL:Q030R6"
FT                   /protein_id="ABJ72306.1"
FT                   /translation="MVSKGRLAGFIDAIIAVVMTIMLLEFELPKTGGIIEFLRDNLVYL
FT                   IAYLLSFIYVTTSWFNQQYMLQQAENISRRIYHSCMLWVLSLSMLPVLSAWAGRTIDFF
FT                   HDFGLHSPKAPALLFIMMIYLWGFAYTYMTKCFIEDNPKEKAELIAQMEVYHYLRHPFW
FT                   KIGMIVSFILTFIYPPFVFIYTAGEMIFATVRSQNKKAQRFKLSFFILLTNSQLF"
FT   gene            complement(694474..695118)
FT                   /locus_tag="LACR_0747"
FT                   /note="LactoCOG number LaCOG00480"
FT   CDS_pept        complement(694474..695118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0747"
FT                   /product="Uncharacterized membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72307"
FT                   /db_xref="GOA:Q030R5"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q030R5"
FT                   /protein_id="ABJ72307.1"
FT                   /translation="MQEIIIQVMNQFGYFGVAFLIMIENIFPPIPSEVILTFGGFMTTY
FT                   SELGIIGMIIVATIGSVLGALILYFVGRLLSVERLERLVSGRLGKVLRLKPEDITKAEK
FT                   WFLKRGYATIFFCRFIPLIRSLISVPAGSAKMKLPSFLILTTLGTLIWNIVLVSLGAAL
FT                   GDNWEMIAGILDSYSSVVVAILGVIFILGLLHFVKKRFFPKNKNYSPDSEK"
FT   gene            complement(695393..697387)
FT                   /locus_tag="LACR_0748"
FT                   /note="LactoCOG number LaCOG00481"
FT   CDS_pept        complement(695393..697387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0748"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72308"
FT                   /db_xref="GOA:Q030R4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q030R4"
FT                   /protein_id="ABJ72308.1"
FT                   /translation="MAVLELKNIRKSYFLGKEEFPVLKGIDLEFERGDFVSLLGESGGG
FT                   KSTLMNIIGGLDRKYEGDVIVDGLAQKTKKEKDMDAYRRDTIGFIFQSFNLVSYLSVLD
FT                   NILISLKMTSLSDKERHERAIELTKQVGLYEHRKKNPSQLSGGQKQRVAIARALASDPE
FT                   IILADEPTGALDSQNTKEVLALLRQIAQSGKTVIVVTHSQEVADYGTRIIRLADGQIIG
FT                   DERLKPPYPVESHQRMQSKALSYRDTFRTAFKHFTHSWKINLLIAIGTAIGLFSVIFFL
FT                   GLGNGATKYMNDTITSSVNPNVVTIFKRTTTDNKLGNEQALQQTQQELGNASTNLDSDH
FT                   LSKLKKVDNVKKVEPTYSISGLGTLTNNDKSKSGLITLDTWTQSNINDDYVSGSKPADG
FT                   EIAIYAKDAKELNKDYKSLVGKKITLKFPAKTAAGASVEVTKEFTVSGILKDPQGPAGS
FT                   SSSVIATYNTVKSALEAANADTDATYAVVTVNKVDNVKSTTSDIQDLKIDGTKAFVTYS
FT                   VTSFLDVITNITNIVSYVLAAIAGISLIVSIFMIVVTTYMSVAERTKEIGVIRALGGRK
FT                   KDISRLFTAESLILGLSSAAIAIGFAYLGQFLINKVLSSFLEGASIVQISGGHIIFAII
FT                   IAVLIALLASLAPSGRAARLNTIEALASE"
FT   gene            complement(697493..697711)
FT                   /locus_tag="LACR_0749"
FT                   /note="LactoCOG number LaCOG00482"
FT   CDS_pept        complement(697493..697711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0749"
FT                   /product="Predicted nucleic-acid-binding protein containing
FT                   a Zn-ribbon domain"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72309"
FT                   /db_xref="InterPro:IPR018652"
FT                   /db_xref="UniProtKB/TrEMBL:Q030R3"
FT                   /protein_id="ABJ72309.1"
FT                   /translation="MNGYQQQYTCIKCGNHNFEEDQLQATGGNFSKLFDVQNKKFITIS
FT                   CSQCGYTELYKSQTSNGMNILDFLLNG"
FT   gene            697922..698584
FT                   /locus_tag="LACR_0750"
FT                   /note="LactoCOG number LaCOG00483"
FT   CDS_pept        697922..698584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0750"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72310"
FT                   /db_xref="GOA:Q030R2"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q030R2"
FT                   /protein_id="ABJ72310.1"
FT                   /translation="MDRQVKEKLRIALIFALNAGFMDGFSFFHFNDRFIGAQSGNVIQA
FT                   GINIAKGDFARFWDFEIPIIFFILGVMTRGFYSHYLMKRRHFDASYLLLVQWLGVTIFA
FT                   LAYGLGLKIPVSFYVGIFSYFMAIQYDTFTKVHGRAYGSIFMTGNMKSMSANLAQYIIT
FT                   KDKQKLRSVGIYAALISIFFAGAAIATLAGNWFGSWTMMGSTFMIGAVYLIVRFDEI"
FT   gene            complement(698613..699599)
FT                   /locus_tag="LACR_0751"
FT                   /note="LactoCOG number LaCOG00484"
FT   CDS_pept        complement(698613..699599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0751"
FT                   /product="NADPH:quinone reductase related Zn-dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72311"
FT                   /db_xref="GOA:Q030R1"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014182"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q030R1"
FT                   /protein_id="ABJ72311.1"
FT                   /translation="MKAIGTVDSGRNFIDFEIEKPILRPHDLLIKVEAISINPVDTKVR
FT                   KSIKGTLTQPKILGWDGLGTVVEVGSQSKLFKVGDSVFWAGDVTRAGSNAEFQAVDERI
FT                   VGFAPKNLSKEKAVAMPLTSLTAYELLFEKLQVTSESKGKSILIINGAGGVGSVATQMA
FT                   KNSGLTVIATASNPQAIEWVKNFGADYTVNHHENLVPQVHELGFKFVDYILILNAVVEH
FT                   MPAVNELIAPQGSIANIVEPGQAINLDKLAHKSARFNFEWMFTKVVSDTDDLQSQHDIL
FT                   NQASEWLDNGTLTSTMTQNLGALTADNVRKAHELIEENHTIGKIVLT"
FT   gene            699767..700876
FT                   /locus_tag="LACR_0752"
FT                   /note="LactoCOG number LaCOG00485"
FT   CDS_pept        699767..700876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_0752"
FT                   /product="Methionine synthase II (cobalamin-independent)"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ72312"
FT                   /db_xref="GOA:Q030R0"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:Q030R0"
FT                   /protein_id="ABJ72312.1"
FT                   /translation="MTKTYNHYHFDHVGSFLRPKALKDARSAYSEGQLSLTDLKKVQEV
FT                   EIERLVKEEVKVGLKAVTDGEFNRSWWHLDFLWGLNGVGVYEQEASYKFHGAKTRTTNI
FT                   ELTGKVAFNPEHPFFADFEYLKSILPEGVEPKVTIPSPSLIPNRDGRSDRWPEFYGSWE
FT                   EFLDDLAQAYHETLLHFYELGARYIQLDDTTWAYLIARLLDDPENHEKYVKMCEDIVYV
FT                   VNKLLEDLPEDLRVSTHICRGNFKSTYLFEGSYEPVAKYLGQLNYDTFFLEYDDARSGS
FT                   FAPLAEIWNQRNDVLIVLGLFTSKHPELEKYEEIKARLDEALESVPLKNLALSTQCGFA
FT                   STEEGNSLTQAEQWAKLAHIKNIVDKIWE"
FT   gene            701024..701097
FT                   /locus_tag="LACR_t0753"
FT                   /note="tRNA_Met_CAT"
FT   tRNA            701024..701097
FT                   /locus_tag="LACR_t0753"
FT                   /product="tRNA-Met"
FT   gene            701216..701416
FT                   /locus_tag="LACR_0754"
FT                   /note=