(data stored in ACNUC7421 zone)

EMBL: CP000427

ID   CP000427; SV 1; circular; genomic DNA; STD; PRO; 9554 BP.
XX
AC   CP000427; AAGO01000000-AAGO01000201;
XX
PR   Project:PRJNA401;
XX
DT   15-OCT-2006 (Rel. 89, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Lactococcus lactis subsp. cremoris SK11 plasmid 2, complete sequence.
XX
KW   .
XX
OS   Lactococcus lactis subsp. cremoris SK11
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Lactococcus.
OG   Plasmid 2
XX
RN   [1]
RP   1-9554
RX   DOI; 10.1073/pnas.0607117103.
RX   PUBMED; 17030793.
RA   Makarova K., Slesarev A., Wolf Y., Sorokin A., Mirkin B., Koonin E.,
RA   Pavlov A., Pavlova N., Karamychev V., Polouchine N., Shakhova V.,
RA   Grigoriev I., Lou Y., Rohksar D., Lucas S., Huang K., Goodstein D.M.,
RA   Hawkins T., Plengvidhya V., Welker D., Hughes J., Goh Y., Benson A.,
RA   Baldwin K., Lee J.H., Diaz-Muniz I., Dosti B., Smeianov V., Wechter W.,
RA   Barabote R., Lorca G., Altermann E., Barrangou R., Ganesan B., Xie Y.,
RA   Rawsthorne H., Tamir D., Parker C., Breidt F., Broadbent J., Hutkins R.,
RA   O'Sullivan D., Steele J., Unlu G., Saier M., Klaenhammer T., Richardson P.,
RA   Kozyavkin S., Weimer B., Mills D.;
RT   "Comparative genomics of the lactic acid bacteria";
RL   Proc. Natl. Acad. Sci. U.S.A. 103(42):15611-15616(2006).
XX
RN   [2]
RP   1-9554
RG   US DOE Joint Genome Institute (JGI), The Lactic Acid Bacteria Genome
RG   Consortium and Fidelity Systems Inc.
RA   Lucas S., Copeland A., Detter J.C., Glavina del Rio T., Pitluck S.,
RA   Grigoriev I., Rokhsar D., Slesarev E.A., Pavlov A., Karamychev V.,
RA   Polouchine N., Shakhova V., Kozyavkin E.S., Makarova K., Koonin E.,
RA   Mills D.A., Richardson P.;
RT   ;
RL   Submitted (23-JUN-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 67fdb36b436b3108cb3fa41a4e402d3f.
DR   BioSample; SAMN02598527.
DR   EnsemblGenomes-Gn; EBG00001190312.
DR   EnsemblGenomes-Gn; EBG00001190313.
DR   EnsemblGenomes-Tr; EBT00001768741.
DR   EnsemblGenomes-Tr; EBT00001768742.
DR   RFAM; RF00238; ctRNA_pND324.
DR   RFAM; RF01742; lactis-plasmid.
DR   StrainInfo; 348311; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2662180
CC   Source DNA and bacteria available from Bart Weimer
CC   (milkbugs@cc.usu.edu)
CC   Contacts: Bart Weimer (milkbugs@cc.usu.edu)
CC             Larry McKay (lmckay@umn.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Annotation done by Kira Makarova and Eugene Koonin
CC   Finishing done by Fidelity Systems Inc. (Gaithersburg)
CC   http://www.fidelitysystems.com
CC   Project Information available at:
CC   http://genome.jgi-psf.org/mic_home.html
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..9554
FT                   /organism="Lactococcus lactis subsp. cremoris SK11"
FT                   /plasmid="2"
FT                   /sub_species="cremoris"
FT                   /strain="SK11"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:272622"
FT   gene            complement(28..717)
FT                   /locus_tag="LACR_B1"
FT                   /note="LactoCOG number LaCOG01630"
FT   CDS_pept        complement(28..717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_B1"
FT                   /product="Diadenosine tetraphosphatase related
FT                   serine/threonine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_B1"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ74032"
FT                   /db_xref="GOA:Q02VJ0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q02VJ0"
FT                   /protein_id="ABJ74032.1"
FT                   /translation="MYNEVFVVSDIHGEYKKFKEILKYWDSNRQQLILLGDLCDRGLQS
FT                   YECFYLAKYLCDNYGAILIKGNHEDLFLKFLNKTEDFKENYIKNGGLKTLESFGYSENN
FT                   TFKDIVLDIKKNNDKLIEFLTYLPNFYEWNDYIFVHAGVNLKINNWKDTSIRDFMWIRE
FT                   DFHFTPNRLNKTIVFGHTETKILNKNNKYDIWIHDNKIGIDGGAVYGGYLYGVILDVHG
FT                   IKDYVYV"
FT   gene            846..1106
FT                   /locus_tag="LACR_B2"
FT                   /note="LactoCOG number LaCOG00049"
FT   CDS_pept        846..1106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_B2"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_B2"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ74033"
FT                   /db_xref="GOA:Q02VB5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q02VB5"
FT                   /protein_id="ABJ74033.1"
FT                   /translation="MQKRYSKEFKETLIAFYHSGQSVTQLSKEYDVAPATIYKWIDLYS
FT                   KSNESSISKADFLELKRQLAKVKEERDILKKVLTIFAEKKK"
FT   gene            2505..2816
FT                   /pseudo
FT                   /locus_tag="LACR_B3"
FT   gene            4328..4765
FT                   /locus_tag="LACR_B4"
FT                   /note="LactoCOG number LaCOG03295"
FT   CDS_pept        4328..4765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_B4"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_B4"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ74034"
FT                   /db_xref="GOA:Q02VI8"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:Q02VI8"
FT                   /protein_id="ABJ74034.1"
FT                   /translation="MEIHININKDLSEDTVNFSIKEMTPELSQIINNLQNLNFKIVANR
FT                   SGKNYQLDFNDIVTIYSENKKIIVFTEDKQQYFLNGSLKNIIEKLPYYFLKISSSEIIN
FT                   TTKITCFEFTFGGKVKIYFKNKNFTYSSRSYLKNIRRFFGL"
FT   gene            5520..6125
FT                   /pseudo
FT                   /locus_tag="LACR_B5"
FT   gene            7100..8257
FT                   /locus_tag="LACR_B6"
FT   CDS_pept        7100..8257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_B6"
FT                   /product="Replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_B6"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ74035"
FT                   /db_xref="GOA:Q02VI7"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR010931"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q02VI7"
FT                   /protein_id="ABJ74035.1"
FT                   /translation="MSIIPNNNELNEKKVVYPLKEIEKRKIVEHNDLITSVAKMDKVPL
FT                   KIFELAVSCIDTDNPPKDHTILLSKTELFAFFKVSDNDKHSRFKEAIEKMQKQAFFQIK
FT                   EVKGKGYNMKSIVPIPFVEWNSYNDEVKIEFHREIMPYLIELKEKFTQYALSDIMELNS
FT                   KYSIILYKWLSMNYNQYEHYSVKGGRRTEQVESYRNPSILVKELRIMSDTVNEYKDFRN
FT                   FDKWVLKKPIEEINKYTSFNVSYEKIKKGRSIDNIVFHIEKKRMADDNSYKLDDRAYQE
FT                   DKARKAETEDQLVLQAMDSPYTKLLMEHFLLSYLDLMDKKILAGLQKNVYPLYDELKEL
FT                   RGLNGVKDHLSYVSSKQEAYSKRNVAKYLKKAIEQYLPTVKRQNL"
FT   gene            8271..8798
FT                   /locus_tag="LACR_B7"
FT   CDS_pept        8271..8798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_B7"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_B7"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ74036"
FT                   /db_xref="GOA:Q02VI6"
FT                   /db_xref="UniProtKB/TrEMBL:Q02VI6"
FT                   /protein_id="ABJ74036.1"
FT                   /translation="MKDKMTNQTISGGFIFLIGMAMFTLLGGNYKKPILFGSIYIIAII
FT                   IQLFLMKKIRKGNRSTENKKWVNRAFIFLVITCWVSIFIGLKLLGNLNILWILILFFVG
FT                   LHFLFFIPANENKKWQAQVIFVILLTVNTLLGLCLYSNQIETIFIIDGLIKMGYGAYMV
FT                   KTTYKVNSENLS"
FT   gene            8795..9439
FT                   /locus_tag="LACR_B8"
FT   CDS_pept        8795..9439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LACR_B8"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LACR_B8"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ74037"
FT                   /db_xref="UniProtKB/TrEMBL:Q02VI5"
FT                   /protein_id="ABJ74037.1"
FT                   /translation="MSEDLKTIRELADELGVSKNKIHYQVSKIPSEYIVRNNSMKLLTA
FT                   EAIKQIKENLGVELNSGLNSKLNTVKHQNNTNIKGNLSVEDVELNSTLNSYLNSLKHQI
FT                   EYLESQNINKDEQIKSLVEAQKQTQNLLDQQQRLALQDKKLLEEYKAENDSLKALKMPS
FT                   QETEFKHLDNQYKDEVNALKEKLENLQEQIKDQKRIEEQEKPRKWWGLWRK"
XX
SQ   Sequence 9554 BP; 3608 A; 1379 C; 1529 G; 3038 T; 0 other;
     ggggcttaag ctcaaaattt acaaatatca aacatataca taatctttaa taccatggac        60
     atctaaaatc acaccatata aataacctcc ataaacagca cctccatcaa tacctatttt       120
     attatcatgt atccatatat catatttatt atttttatta aggattttcg tttcagtatg       180
     accaaaaact atagttttat ttaacctatt tggcgtaaaa tgaaagtctt ctctaatcca       240
     cataaaatct ctaatacttg tatctttcca attattaatt ttgagattta cacctgcatg       300
     aacaaaaata tagtcattcc attcataaaa atttggtaaa taagttaaaa actctattaa       360
     tttatcatta ttttttttta tatctaatac tatatcctta aatgtattat tctcggaata       420
     accaaaactt tctaatgttt tcaatccccc atttttaata taattttctt taaaatcttc       480
     agttttattt aaaaatttta aaaataaatc ttcatgattt cctttaatta atatagctcc       540
     atagttatca cataaatact ttgctaaata aaaacattca taagattgta aacctctatc       600
     acacaaatcc cctaataata ttagctgttg tctattcgaa tcccagtatt taagtatttc       660
     tttaaatttt ttatattctc catgtatatc actaactaca aatacttcgt tatacatcca       720
     aacactccaa tacattattt ttaatttaat tataatttaa aatattactc taattatttt       780
     atttatgtga tgttatcctt aaatcttaga gtcactattg tataatttag acaaaggaca       840
     aaaacatgca aaaacgctac tcaaaagaat ttaaagaaac ccttatcgcc ttctatcatt       900
     ctggtcaatc cgtcacccag ctgtctaaag aatacgacgt ggcccctgca acaatttata       960
     aatggataga cctctactct aaatctaatg aaagctccat ctctaaagct gattttctag      1020
     aattaaaaag acaactggct aaagttaagg aagaacgaga catcttaaaa aaagtattga      1080
     ccatattcgc cgagaaaaag aagtgagtgc tgcggatatg gctcaaacca tacaaacttt      1140
     agcactcaat gtcagactaa gctgtcaact ccttgatgtt cctgaatcaa gttattatga      1200
     acggattaac cgacatccat ctaaaactca attaaggaga caataccctt atcataatgc      1260
     cagtcttgaa tcttggcatg gacatttaaa aagagagtgg gtgtatcaat ttaaatataa      1320
     gaactttgaa gaagcctatc agagtatttt ctggtacatc gaagcctttt ataattcaaa      1380
     acgaatccat caaagtttag ggtatcttac acctaatcaa tttgaaaagg taagtgctta      1440
     aaataaatag attaaaattc tacgtttgtt actctaaaaa cttgacttaa cgtcaataaa      1500
     cttttcaaat atagtataaa agtcctaact gattctatct tgattaatgc attactattc      1560
     cgaatttaag aacttgactt aatatcataa taaaaaacct ccaaaagttt aaattttgga      1620
     ggtcatataa gatatatgtt tattttattt gcttactgtg gttagaatga ataaaataaa      1680
     tactatagct atactaaaag cacctaaaat aatagtatta gttgagtcag acttagtatc      1740
     tttagaaaac ttagctatta tcactgcact tagaatgaaa catagaaata taaaagctaa      1800
     aaacattgtt ggagagatgc caacttgaaa tttctcaaaa aacaaatgat aaatagaagt      1860
     aactacaact cctaacattc ctattatata aagtagagtt acgagaaaat ttaaattaat      1920
     taattgatga tcgagatttt tattagtcat acttaaaaga ctttccttaa aaaatttatt      1980
     atatttatat tctaacataa taaaattggt tctgttgcga aatttccaag ttccaaaatt      2040
     ttagtgtaaa attgaataat aagttagtgt atctataata cccgaattgc tagttatttt      2100
     ccaatgaaat taactagcaa ttcgggtaat ttataaataa tggaggtgtg ttttgaaaag      2160
     aaaaaagacc tatggacaga agaagacaat caaatcaatt tttgatactt tagtcgattc      2220
     tatcactaca ttatttttat ttttacgata gggattttaa tttaaatact ataaattttt      2280
     aagagagaat gataacaatg aaatataaaa ggtattaatg ggcataacag cctaagatat      2340
     ttggagttca gagagggcgc gtttgatttt caaacttcgc aacagaaccc aatcaaccac      2400
     aagaggaagt cgaagctttg caggaacagc taaaggaaca agcaacaaca aaacccaaag      2460
     aagaacaaaa aaatggtgga aattttggaa gtgaggataa aatcatgcca aagataagat      2520
     tatcgaggac gtcaaaaggt gctaacaaat taagagcata cagagtctta atagacgata      2580
     aatatgttgg ggtaatacac agaaatcaaa ccaaagaatt tgatgttgac tttggagaac      2640
     atacaattca atgtacaatt gactgggaaa gaagtaatca tataaccgtt gatattcaag      2700
     atgacttgga agaactagaa gtaatcgcta aaggtgtgtt tgagtctgcc atacgtgcta      2760
     tctttccatt tgacggaaga gataaatact taactctatc aaaaaaatca aagtaaccac      2820
     gaccgcaagg gatttttcct aaaggcagaa cgtccgattt tttcaattga ggtgtacaag      2880
     cggagcgaca aaagtgaaca gggagacttt atgctataat gagtttaaag aaaactgaca      2940
     cgaagagcat gcggttaaat tgttccatag agaagtctaa tttcttgatg agtggttgac      3000
     gcatctatgc cacataaaaa aacgaagcgg tgcaagcaga gtggggacta cggcttaacc      3060
     acgaaatacc aatctgtgcc gattgatgat ttgattttag gtttaaaata aaaaagttgc      3120
     tgacaataag ttggtggctt ttttattttt ttaagacaaa aatttactgt taggaatgta      3180
     aacgtataat tagaaaacac ttataaaaag aggtaagata tccctataag atataagggc      3240
     gcacttatat accatgattt ttcatggtat ataagtgcca atattttaga ttaaacgtgt      3300
     tggaaaaact cgctttgctc atgtaaataa aaacgttata aagtattata gcgagcttag      3360
     taagtggata tacacttacg gtaaaaaggg ttctgttgcg aagtcaaaga tttatacgaa      3420
     aatgtcttaa aagaatttga aattaagctc taattttttt caaaaagggg gattggggga      3480
     caccaccaaa aataaaaaga ttcgtctgaa acgaacaaaa ataaaattgg aaattttagg      3540
     ttttgtgagt gaaagatgaa tactttttac tgtacttggg tacccaagtg cgaagttcac      3600
     taaagacact aaccccctat tttgagcttt tagagtttac agatatttgt gaggttgaca      3660
     agatgaaaat aattgaaaat cgtgagagaa gtatacagaa aaaatttcgt gtaaatgaaa      3720
     aagagaacga aagaattaaa ttgatgatga gaaaaactgg catcactaat ttttctattt      3780
     ttgctagacg agcctgttgc aataaagaga ttttttctat tgatttttca gaatataaaa      3840
     atattatttc tgaaatttct gcgacaaaat ctgaactaaa acgtatcgga aataatatca      3900
     atcaaattgc taaacattta aacgaaaata aaaataatca gacaaaagaa ttgatgtctg      3960
     attatcaaaa tcaattagaa aatttggaag ataaaattca aaaagtgatt cattatattt      4020
     cggagggcta gaaaaaatga ctgtcattaa aatgccaaaa caatcgaacg gaacggttca      4080
     aaacttaaca gttttgacct cttttttgag agctgataaa tagtgatatt agagtcggtc      4140
     ataaatggta gtcaaaactg tttctaacag tactaaaatc ggtacagaaa aaatttaatg      4200
     taccgatttt ctttattttc gatccattta tccattacaa atgcacatta tcgcaaaaaa      4260
     tagtttacaa aaaaaaaatt atgagataat cattttataa attagagggg gagaaaattt      4320
     aaatgttatg gagattcata taaatattaa caaagattta tctgaagata ctgttaattt      4380
     ttcaattaaa gaaatgactc ctgagttatc acaaataatt aataatttac aaaatttaaa      4440
     tttcaaaata gtcgctaata gaagtgggaa aaattatcaa ctggatttta atgacatcgt      4500
     aaccatttat tcagaaaata aaaaaataat agtctttaca gaggacaaac aacaatattt      4560
     tttgaacggt tcattaaaaa atattattga aaaactccct tattattttt tgaaaatatc      4620
     aagttccgag attattaaca cgactaaaat aacttgtttt gaatttactt ttggtggaaa      4680
     agttaaaatt tactttaaaa acaagaactt tacttactca agtagaagct atttaaaaaa      4740
     cattaggagg ttttttggat tatgaatatc aaatataata taaaaactct attaaactca      4800
     attactatca gtatttctat ttgtacaatt ttcagtgtaa tattatatta ttttttaggt      4860
     cgtggcagtt ttcaattgat caatccatat accatggatc tctctagtcc aatatataat      4920
     gctactatct ctttaattct ttacacagca acaggcgtgt acttttatta ttttatcaat      4980
     cttgttcaaa acgataaatt aggattaaat aaatatactt tcactcactt tattttgagc      5040
     gtaataacat tctcagcact aggttttata agtagtattc ctatcaatgc acccagcgat      5100
     gcatttgcat cgtattacac aaatggaaat ttagattttc tagttctgta cccaataata      5160
     atcaccctta ttggttattt tttaacttat attattatgt gggcctattg cgtttatcaa      5220
     acaaaaaagt taaacaaagt gataaacggt cataagtaaa caagaccatt tgcaccaaaa      5280
     aacttaaaaa tcagttgaat atcagaaaag cacttctaaa aaagtgcttt tttttggtct      5340
     tgcacaattt cttacaaaaa cgccaaattt gcgtttttag cgttcggtcg ataataatac      5400
     taaaaacatt ttaaagttgc ttaaaatgca atctatgagc ttctaggggt attctagttt      5460
     aactccgcca cttgtctaaa aaagttgtaa aataacaaag taaatacatt ctttttcata      5520
     aaggggcgtc cttagacgtt cttttttgta ttttttttca attcgttttc ggcaaagtct      5580
     aatgagcttt tttaaagttg attaaaccgt tagaaaatga aagtccacta gcctatactc      5640
     aaataagccc tattaaattg cttttaaggg gcttttcttt tgtatatgat aaatatatcc      5700
     aaaaacattt taaagttgct taaaatgcaa aatatgagct tataggacta ttcaaagcgt      5760
     ttagactaaa caaagtagcc acgaccgtta gggagttctt tttagtggat gaacgaacaa      5820
     aaaatctctc gtattttgtt tgttcatcca tggttttaga aaaaagaggg acgatttcgg      5880
     aagaagaaaa tcgtctcttt ttttcttctt tttgtatgac aaaaagaaag atcttttgcc      5940
     cattttattt ttataaaatg ggtaggtggc gtttgcgtaa agcaaatcga cacactccaa      6000
     aggggataaa aggggaaagt gaaacttccc ccttttcaag ccacattgta atacaagaac      6060
     gaagtgcttt gtattacaat gtgatagctt gcagtattta tgggtttata tttcctattt      6120
     tgttgtgagg attgtaaccg aatagggcgc aatacttatt acaaaatcaa tgacaaaggg      6180
     cgattgagga atgagcgctg aggcatttta tctttgagga agttcttgat ggatcagaaa      6240
     aatgtatcac aaatttaaac aaagactcac tcatttaaga gacgctacta gcatgaaatt      6300
     ttgttgttgc gataagcaac ttctgataca cgatttttag ccattacatc actcgttttt      6360
     agagtgatgt gtaagtgcgc attgcactct tttttaacga aacaagccga ccagcgtttg      6420
     aaacttttta gtttttcatc attctatttt aaaacgctct aaaactcgat ttaagcgact      6480
     ttaattcgaa actgtctatt tgttcaaagg gaacattaag aatgcttaaa cgagctttta      6540
     agtgggttta aagtgatttt gaattgaata gcttgttgta agttgtaaaa aaacaagtta      6600
     aacaaagtat aggttttcca tttaagggtt gttagggctt gccctgaccg aacagtgtcg      6660
     actgttcgcc ttaaaaacaa gacagactgt atccactaac aaagggactg actgctaatg      6720
     aaattgatta gccaacccca atccgtcctt gcggagcggt tttgattttg accttttctt      6780
     ttgaccttga tttttagatt ttttaaacgt agtgaaaaaa ggcgaagcct atattaattt      6840
     atcatatata ttttaatctt ttgttctttt gcgtggggaa aaagtcagtg ttttcaatgt      6900
     aattcgagtt tataggtgta gaaaaaactg tgtataggtg tagaaaaaac tgtgtatagg      6960
     tgtagaaaaa actgtgtata ggtgtagaaa atattcggaa tactatactt gttttgatat      7020
     aataaaagca tgaagaaaaa accttttgca gagcatttct tcatgcttaa ccaaaattac      7080
     tcacaaagga gcaattacta tgtctattat accaaataac aatgaattaa acgaaaaaaa      7140
     ggtggtttat cccttgaaag aaatcgaaaa acgaaaaatc gtggagcata acgatctcat      7200
     cacatcagtt gccaaaatgg ataaagttcc tttaaagatt tttgaattag ccgtatcttg      7260
     tattgatacg gacaatccac ccaaagacca tacgatttta ttatcaaaga ctgaactatt      7320
     tgcttttttt aaagtatctg acaacgacaa gcatagtcgc tttaaagaag ccattgaaaa      7380
     aatgcaaaag caagcttttt ttcagattaa agaagttaag ggaaaaggtt ataacatgaa      7440
     aagtattgtg cctatccctt ttgtagaatg gaatagctac aatgacgaag taaaaataga      7500
     atttcatcgt gaaattatgc cttatttgat tgaactgaaa gaaaaattca cgcaatatgc      7560
     cttgtcagat attatggagc taaactctaa atacagcatt attctttata aatggttatc      7620
     aatgaattac aaccagtacg agcattacag tgtcaaaggg gggcggagaa cggagcaagt      7680
     ggaaagctac cgcaatccct caatattggt taaagaattg aggataatgt ctgataccgt      7740
     caatgagtat aaagacttta gaaattttga caaatgggtg ctaaaaaaac caatcgaaga      7800
     aattaacaaa tatacctctt ttaatgtgtc ttatgagaaa atcaaaaaag ggcgctccat      7860
     tgataatatt gtctttcata ttgagaagaa acgcatggca gacgataaca gttacaagtt      7920
     ggacgatagg gcttatcaag aagataaagc acgtaaagct gaaacagaag accaattagt      7980
     cttgcaggca atggatagcc cttatactaa gttacttatg gaacatttct tattgtctta      8040
     tcttgacctt atggacaaaa agatattggc aggcttacag aaaaacgttt atccgcttta      8100
     tgacgaactg aaagaattaa gagggttgaa tggggtcaaa gaccacttgt cttatgtatc      8160
     tagcaaacaa gaagcctatt ctaaacgcaa tgtagcgaag tatttgaaga aagccattga      8220
     acaatattta ccaacggtta aacgacaaaa tttgtaagga gaggtttgaa atgaaagata      8280
     aaatgactaa tcaaacaatt tcaggaggat ttatttttct aattggtatg gcgatgttta      8340
     ctttgttagg aggtaactat aaaaagccaa tactatttgg atctatatat attatagcta      8400
     ttattattca acttttttta atgaaaaaaa taagaaaagg gaacaggtct actgaaaata      8460
     agaaatgggt aaatagagca tttatttttc tagtaataac atgttgggtt agtattttta      8520
     taggtttaaa attacttggc aacttaaata ttttatggat attgatatta ttttttgtag      8580
     gtctacactt tttatttttt attcctgcta atgaaaataa aaagtggcaa gcacaagtaa      8640
     ttttcgtcat tttattgaca gttaacactc tcttaggact atgtttgtat tcaaaccaaa      8700
     tagaaaccat ttttattatt gatggtttaa ttaaaatggg atacggagct tacatggtaa      8760
     aaaccactta taaagttaat agtgagaatt tgtcatgagt gaagatttaa agaccattcg      8820
     agagcttgct gacgaattag gagttagtaa gaataaaatt cattatcaag tttctaaaat      8880
     accaagcgaa tatatagtta gaaataacag tatgaagcta ctaaccgctg aagcgattaa      8940
     acaaataaaa gaaaatctag gtgttgaatt aaacagcggt ttaaacagta agttaaatac      9000
     cgttaaacac caaaataaca ctaatataaa aggaaatcta agtgttgaag atgttgaatt      9060
     aaacagcact ttaaatagtt atttaaacag tcttaaacac caaattgaat accttgaatc      9120
     tcaaaatata aataaagacg aacaaataaa aagtttagtg gaagcacaaa aacaaactca      9180
     aaacctctta gaccaacagc aacgcctagc cttgcaagat aaaaagttgc tagaagagta      9240
     caaggcggaa aatgacagtc taaaagccct caaaatgccc tcacaggaaa cagaattcaa      9300
     acacttagac aatcaatata aagatgaagt gaacgctctt aaagagaagt tggaaaattt      9360
     gcaggaacaa atcaaagatc aaaaaaggat agaagaacaa gaaaaaccaa gaaaatggtg      9420
     gggactatgg cgaaaataga tgattcagtt aaaaagaaag ttccagaatt aaggtttccg      9480
     ggatttacgt atgattggga agagcgtaag ttaaaagata tagctcaatt taacccttat      9540
     tttgcatttt aaaa                                                        9554
//

If you have problems or comments...

PBIL Back to PBIL home page