(data stored in SCRATCH zone)

EMBL: CP000431

ID   CP000431; SV 1; linear; genomic DNA; STD; PRO; 7804765 BP.
XX
AC   CP000431;
XX
PR   Project:PRJNA13693;
XX
DT   07-AUG-2006 (Rel. 88, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Rhodococcus jostii RHA1, complete genome.
XX
KW   .
XX
OS   Rhodococcus jostii RHA1
OC   Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae; Rhodococcus.
XX
RN   [1]
RP   1-7804765
RA   McLeod M.P., Warren R.L., Araki N., Hsiao W.W.L., Myhre M., Fernandes C.,
RA   Miyazawa D., Wong W., Lillquist A.L., Wang D., Dosanjh M., Petrescu A.,
RA   Morin R.D., Yang G., Stott J.M., Schein J.E., Shin H., Smailus D.,
RA   Siddiqui A.S., Marra M.A., Jones S.J.M., Holt R., Brinkman F.S.L.,
RA   Miyauchi K., Fukuda M., Davies J.E., Mohn W.W., Eltis L.D.;
RT   ;
RL   Submitted (24-JUL-2006) to the INSDC.
RL   Microbiology and Immunology, University of British Columbia, 1365-2350
RL   Health Sciences Mall, Vancouver, BC V6T 1Z3, Canada
XX
DR   MD5; 5ed40b931468bc78cb3434bb244a9db1.
DR   BioSample; SAMN02604146.
DR   EnsemblGenomes-Gn; EBG00001040736.
DR   EnsemblGenomes-Gn; EBG00001040737.
DR   EnsemblGenomes-Gn; EBG00001040738.
DR   EnsemblGenomes-Gn; EBG00001040739.
DR   EnsemblGenomes-Gn; EBG00001040740.
DR   EnsemblGenomes-Gn; EBG00001040741.
DR   EnsemblGenomes-Gn; EBG00001040742.
DR   EnsemblGenomes-Gn; EBG00001040743.
DR   EnsemblGenomes-Gn; EBG00001040744.
DR   EnsemblGenomes-Gn; EBG00001040745.
DR   EnsemblGenomes-Gn; EBG00001040746.
DR   EnsemblGenomes-Gn; EBG00001040747.
DR   EnsemblGenomes-Gn; EBG00001040748.
DR   EnsemblGenomes-Gn; EBG00001040749.
DR   EnsemblGenomes-Gn; EBG00001040750.
DR   EnsemblGenomes-Gn; EBG00001040751.
DR   EnsemblGenomes-Gn; EBG00001040752.
DR   EnsemblGenomes-Gn; EBG00001040753.
DR   EnsemblGenomes-Gn; EBG00001040754.
DR   EnsemblGenomes-Gn; EBG00001040755.
DR   EnsemblGenomes-Gn; EBG00001040756.
DR   EnsemblGenomes-Gn; EBG00001040757.
DR   EnsemblGenomes-Gn; EBG00001040758.
DR   EnsemblGenomes-Gn; EBG00001040759.
DR   EnsemblGenomes-Gn; EBG00001040760.
DR   EnsemblGenomes-Gn; EBG00001040761.
DR   EnsemblGenomes-Gn; EBG00001040762.
DR   EnsemblGenomes-Gn; EBG00001040763.
DR   EnsemblGenomes-Gn; EBG00001040764.
DR   EnsemblGenomes-Gn; EBG00001040765.
DR   EnsemblGenomes-Gn; EBG00001040766.
DR   EnsemblGenomes-Gn; EBG00001040767.
DR   EnsemblGenomes-Gn; EBG00001040768.
DR   EnsemblGenomes-Gn; EBG00001040769.
DR   EnsemblGenomes-Gn; EBG00001040770.
DR   EnsemblGenomes-Gn; EBG00001040771.
DR   EnsemblGenomes-Gn; EBG00001040772.
DR   EnsemblGenomes-Gn; EBG00001040773.
DR   EnsemblGenomes-Gn; EBG00001040774.
DR   EnsemblGenomes-Gn; EBG00001040775.
DR   EnsemblGenomes-Gn; EBG00001040776.
DR   EnsemblGenomes-Gn; EBG00001040777.
DR   EnsemblGenomes-Gn; EBG00001040778.
DR   EnsemblGenomes-Gn; EBG00001040779.
DR   EnsemblGenomes-Gn; EBG00001040780.
DR   EnsemblGenomes-Gn; EBG00001040781.
DR   EnsemblGenomes-Gn; EBG00001040782.
DR   EnsemblGenomes-Gn; EBG00001040783.
DR   EnsemblGenomes-Gn; EBG00001040784.
DR   EnsemblGenomes-Gn; EBG00001040785.
DR   EnsemblGenomes-Gn; EBG00001040786.
DR   EnsemblGenomes-Gn; EBG00001040787.
DR   EnsemblGenomes-Gn; EBG00001040788.
DR   EnsemblGenomes-Gn; EBG00001040789.
DR   EnsemblGenomes-Gn; EBG00001040790.
DR   EnsemblGenomes-Gn; EBG00001040791.
DR   EnsemblGenomes-Gn; EBG00001040792.
DR   EnsemblGenomes-Gn; EBG00001040793.
DR   EnsemblGenomes-Gn; EBG00001040794.
DR   EnsemblGenomes-Gn; EBG00001040795.
DR   EnsemblGenomes-Gn; EBG00001040796.
DR   EnsemblGenomes-Gn; EBG00001040797.
DR   EnsemblGenomes-Gn; EBG00001040798.
DR   EnsemblGenomes-Gn; EBG00001040799.
DR   EnsemblGenomes-Gn; EBG00001040800.
DR   EnsemblGenomes-Gn; EBG00001040801.
DR   EnsemblGenomes-Gn; EBG00001040802.
DR   EnsemblGenomes-Gn; EBG00001040803.
DR   EnsemblGenomes-Gn; EBG00001040804.
DR   EnsemblGenomes-Gn; EBG00001040805.
DR   EnsemblGenomes-Gn; EBG00001040806.
DR   EnsemblGenomes-Gn; EBG00001040807.
DR   EnsemblGenomes-Gn; EBG00001040808.
DR   EnsemblGenomes-Gn; EBG00001040809.
DR   EnsemblGenomes-Gn; EBG00001040810.
DR   EnsemblGenomes-Gn; EBG00001040811.
DR   EnsemblGenomes-Gn; EBG00001040812.
DR   EnsemblGenomes-Gn; RHA1_ro00893.
DR   EnsemblGenomes-Gn; RHA1_ro00922.
DR   EnsemblGenomes-Gn; RHA1_ro00939.
DR   EnsemblGenomes-Gn; RHA1_ro00940.
DR   EnsemblGenomes-Gn; RHA1_ro00941.
DR   EnsemblGenomes-Gn; RHA1_ro00999.
DR   EnsemblGenomes-Gn; RHA1_ro01193.
DR   EnsemblGenomes-Gn; RHA1_ro01209.
DR   EnsemblGenomes-Gn; RHA1_ro01212.
DR   EnsemblGenomes-Gn; RHA1_ro01374.
DR   EnsemblGenomes-Gn; RHA1_ro01375.
DR   EnsemblGenomes-Gn; RHA1_ro01399.
DR   EnsemblGenomes-Gn; RHA1_ro01419.
DR   EnsemblGenomes-Gn; RHA1_ro01421.
DR   EnsemblGenomes-Gn; RHA1_ro01429.
DR   EnsemblGenomes-Gn; RHA1_ro01465.
DR   EnsemblGenomes-Gn; RHA1_ro01466.
DR   EnsemblGenomes-Gn; RHA1_ro01467.
DR   EnsemblGenomes-Gn; RHA1_ro01494.
DR   EnsemblGenomes-Gn; RHA1_ro01535.
DR   EnsemblGenomes-Gn; RHA1_ro01982.
DR   EnsemblGenomes-Gn; RHA1_ro01986.
DR   EnsemblGenomes-Gn; RHA1_ro01987.
DR   EnsemblGenomes-Gn; RHA1_ro01988.
DR   EnsemblGenomes-Gn; RHA1_ro02272.
DR   EnsemblGenomes-Gn; RHA1_ro02354.
DR   EnsemblGenomes-Gn; RHA1_ro03682.
DR   EnsemblGenomes-Gn; RHA1_ro03683.
DR   EnsemblGenomes-Gn; RHA1_ro03704.
DR   EnsemblGenomes-Gn; RHA1_ro03936.
DR   EnsemblGenomes-Gn; RHA1_ro03938.
DR   EnsemblGenomes-Gn; RHA1_ro03939.
DR   EnsemblGenomes-Gn; RHA1_ro04120.
DR   EnsemblGenomes-Gn; RHA1_ro04130.
DR   EnsemblGenomes-Gn; RHA1_ro04131.
DR   EnsemblGenomes-Gn; RHA1_ro04156.
DR   EnsemblGenomes-Gn; RHA1_ro04190.
DR   EnsemblGenomes-Gn; RHA1_ro04312.
DR   EnsemblGenomes-Gn; RHA1_ro04355.
DR   EnsemblGenomes-Gn; RHA1_ro04359.
DR   EnsemblGenomes-Gn; RHA1_ro04360.
DR   EnsemblGenomes-Gn; RHA1_ro04361.
DR   EnsemblGenomes-Gn; RHA1_ro04720.
DR   EnsemblGenomes-Gn; RHA1_ro04876.
DR   EnsemblGenomes-Gn; RHA1_ro04878.
DR   EnsemblGenomes-Gn; RHA1_ro04879.
DR   EnsemblGenomes-Gn; RHA1_ro04880.
DR   EnsemblGenomes-Gn; RHA1_ro05339.
DR   EnsemblGenomes-Gn; RHA1_ro05636.
DR   EnsemblGenomes-Gn; RHA1_ro05725.
DR   EnsemblGenomes-Gn; RHA1_ro05781.
DR   EnsemblGenomes-Gn; RHA1_ro06392.
DR   EnsemblGenomes-Gn; RHA1_ro06417.
DR   EnsemblGenomes-Gn; RHA1_ro06494.
DR   EnsemblGenomes-Gn; RHA1_ro06495.
DR   EnsemblGenomes-Gn; RHA1_ro06714.
DR   EnsemblGenomes-Gn; RHA1_ro06870.
DR   EnsemblGenomes-Gn; RHA1_ro06871.
DR   EnsemblGenomes-Gn; RHA1_ro06872.
DR   EnsemblGenomes-Gn; RHA1_ro06873.
DR   EnsemblGenomes-Gn; RHA1_ro06874.
DR   EnsemblGenomes-Gn; RHA1_ro06875.
DR   EnsemblGenomes-Tr; EBT00001642816.
DR   EnsemblGenomes-Tr; EBT00001642817.
DR   EnsemblGenomes-Tr; EBT00001642818.
DR   EnsemblGenomes-Tr; EBT00001642819.
DR   EnsemblGenomes-Tr; EBT00001642820.
DR   EnsemblGenomes-Tr; EBT00001642821.
DR   EnsemblGenomes-Tr; EBT00001642822.
DR   EnsemblGenomes-Tr; EBT00001642823.
DR   EnsemblGenomes-Tr; EBT00001642824.
DR   EnsemblGenomes-Tr; EBT00001642825.
DR   EnsemblGenomes-Tr; EBT00001642826.
DR   EnsemblGenomes-Tr; EBT00001642827.
DR   EnsemblGenomes-Tr; EBT00001642828.
DR   EnsemblGenomes-Tr; EBT00001642829.
DR   EnsemblGenomes-Tr; EBT00001642830.
DR   EnsemblGenomes-Tr; EBT00001642831.
DR   EnsemblGenomes-Tr; EBT00001642832.
DR   EnsemblGenomes-Tr; EBT00001642833.
DR   EnsemblGenomes-Tr; EBT00001642834.
DR   EnsemblGenomes-Tr; EBT00001642835.
DR   EnsemblGenomes-Tr; EBT00001642836.
DR   EnsemblGenomes-Tr; EBT00001642837.
DR   EnsemblGenomes-Tr; EBT00001642838.
DR   EnsemblGenomes-Tr; EBT00001642839.
DR   EnsemblGenomes-Tr; EBT00001642840.
DR   EnsemblGenomes-Tr; EBT00001642841.
DR   EnsemblGenomes-Tr; EBT00001642842.
DR   EnsemblGenomes-Tr; EBT00001642843.
DR   EnsemblGenomes-Tr; EBT00001642844.
DR   EnsemblGenomes-Tr; EBT00001642845.
DR   EnsemblGenomes-Tr; EBT00001642846.
DR   EnsemblGenomes-Tr; EBT00001642847.
DR   EnsemblGenomes-Tr; EBT00001642848.
DR   EnsemblGenomes-Tr; EBT00001642849.
DR   EnsemblGenomes-Tr; EBT00001642850.
DR   EnsemblGenomes-Tr; EBT00001642851.
DR   EnsemblGenomes-Tr; EBT00001642852.
DR   EnsemblGenomes-Tr; EBT00001642853.
DR   EnsemblGenomes-Tr; EBT00001642854.
DR   EnsemblGenomes-Tr; EBT00001642855.
DR   EnsemblGenomes-Tr; EBT00001642856.
DR   EnsemblGenomes-Tr; EBT00001642857.
DR   EnsemblGenomes-Tr; EBT00001642858.
DR   EnsemblGenomes-Tr; EBT00001642859.
DR   EnsemblGenomes-Tr; EBT00001642860.
DR   EnsemblGenomes-Tr; EBT00001642861.
DR   EnsemblGenomes-Tr; EBT00001642862.
DR   EnsemblGenomes-Tr; EBT00001642863.
DR   EnsemblGenomes-Tr; EBT00001642864.
DR   EnsemblGenomes-Tr; EBT00001642865.
DR   EnsemblGenomes-Tr; EBT00001642866.
DR   EnsemblGenomes-Tr; EBT00001642867.
DR   EnsemblGenomes-Tr; EBT00001642868.
DR   EnsemblGenomes-Tr; EBT00001642869.
DR   EnsemblGenomes-Tr; EBT00001642870.
DR   EnsemblGenomes-Tr; EBT00001642871.
DR   EnsemblGenomes-Tr; EBT00001642872.
DR   EnsemblGenomes-Tr; EBT00001642873.
DR   EnsemblGenomes-Tr; EBT00001642874.
DR   EnsemblGenomes-Tr; EBT00001642875.
DR   EnsemblGenomes-Tr; EBT00001642876.
DR   EnsemblGenomes-Tr; EBT00001642877.
DR   EnsemblGenomes-Tr; EBT00001642878.
DR   EnsemblGenomes-Tr; EBT00001642879.
DR   EnsemblGenomes-Tr; EBT00001642880.
DR   EnsemblGenomes-Tr; EBT00001642881.
DR   EnsemblGenomes-Tr; EBT00001642882.
DR   EnsemblGenomes-Tr; EBT00001642883.
DR   EnsemblGenomes-Tr; EBT00001642884.
DR   EnsemblGenomes-Tr; EBT00001642885.
DR   EnsemblGenomes-Tr; EBT00001642886.
DR   EnsemblGenomes-Tr; EBT00001642887.
DR   EnsemblGenomes-Tr; EBT00001642888.
DR   EnsemblGenomes-Tr; EBT00001642889.
DR   EnsemblGenomes-Tr; EBT00001642890.
DR   EnsemblGenomes-Tr; EBT00001642891.
DR   EnsemblGenomes-Tr; EBT00001642892.
DR   EnsemblGenomes-Tr; RHA1_ro00893-1.
DR   EnsemblGenomes-Tr; RHA1_ro00922-1.
DR   EnsemblGenomes-Tr; RHA1_ro00939-1.
DR   EnsemblGenomes-Tr; RHA1_ro00940-1.
DR   EnsemblGenomes-Tr; RHA1_ro00941-1.
DR   EnsemblGenomes-Tr; RHA1_ro00999-1.
DR   EnsemblGenomes-Tr; RHA1_ro01193-1.
DR   EnsemblGenomes-Tr; RHA1_ro01209-1.
DR   EnsemblGenomes-Tr; RHA1_ro01212-1.
DR   EnsemblGenomes-Tr; RHA1_ro01374-1.
DR   EnsemblGenomes-Tr; RHA1_ro01375-1.
DR   EnsemblGenomes-Tr; RHA1_ro01399-1.
DR   EnsemblGenomes-Tr; RHA1_ro01419-1.
DR   EnsemblGenomes-Tr; RHA1_ro01421-1.
DR   EnsemblGenomes-Tr; RHA1_ro01429-1.
DR   EnsemblGenomes-Tr; RHA1_ro01465-1.
DR   EnsemblGenomes-Tr; RHA1_ro01466-1.
DR   EnsemblGenomes-Tr; RHA1_ro01467-1.
DR   EnsemblGenomes-Tr; RHA1_ro01494-1.
DR   EnsemblGenomes-Tr; RHA1_ro01535-1.
DR   EnsemblGenomes-Tr; RHA1_ro01982-1.
DR   EnsemblGenomes-Tr; RHA1_ro01986-1.
DR   EnsemblGenomes-Tr; RHA1_ro01987-1.
DR   EnsemblGenomes-Tr; RHA1_ro01988-1.
DR   EnsemblGenomes-Tr; RHA1_ro02272-1.
DR   EnsemblGenomes-Tr; RHA1_ro02354-1.
DR   EnsemblGenomes-Tr; RHA1_ro03682-1.
DR   EnsemblGenomes-Tr; RHA1_ro03683-1.
DR   EnsemblGenomes-Tr; RHA1_ro03704-1.
DR   EnsemblGenomes-Tr; RHA1_ro03936-1.
DR   EnsemblGenomes-Tr; RHA1_ro03938-1.
DR   EnsemblGenomes-Tr; RHA1_ro03939-1.
DR   EnsemblGenomes-Tr; RHA1_ro04120-1.
DR   EnsemblGenomes-Tr; RHA1_ro04130-1.
DR   EnsemblGenomes-Tr; RHA1_ro04131-1.
DR   EnsemblGenomes-Tr; RHA1_ro04156-1.
DR   EnsemblGenomes-Tr; RHA1_ro04190-1.
DR   EnsemblGenomes-Tr; RHA1_ro04312-1.
DR   EnsemblGenomes-Tr; RHA1_ro04355-1.
DR   EnsemblGenomes-Tr; RHA1_ro04359-1.
DR   EnsemblGenomes-Tr; RHA1_ro04360-1.
DR   EnsemblGenomes-Tr; RHA1_ro04361-1.
DR   EnsemblGenomes-Tr; RHA1_ro04720-1.
DR   EnsemblGenomes-Tr; RHA1_ro04876-1.
DR   EnsemblGenomes-Tr; RHA1_ro04878-1.
DR   EnsemblGenomes-Tr; RHA1_ro04879-1.
DR   EnsemblGenomes-Tr; RHA1_ro04880-1.
DR   EnsemblGenomes-Tr; RHA1_ro05339-1.
DR   EnsemblGenomes-Tr; RHA1_ro05636-1.
DR   EnsemblGenomes-Tr; RHA1_ro05725-1.
DR   EnsemblGenomes-Tr; RHA1_ro05781-1.
DR   EnsemblGenomes-Tr; RHA1_ro06392-1.
DR   EnsemblGenomes-Tr; RHA1_ro06417-1.
DR   EnsemblGenomes-Tr; RHA1_ro06494-1.
DR   EnsemblGenomes-Tr; RHA1_ro06495-1.
DR   EnsemblGenomes-Tr; RHA1_ro06714-1.
DR   EnsemblGenomes-Tr; RHA1_ro06870-1.
DR   EnsemblGenomes-Tr; RHA1_ro06871-1.
DR   EnsemblGenomes-Tr; RHA1_ro06872-1.
DR   EnsemblGenomes-Tr; RHA1_ro06873-1.
DR   EnsemblGenomes-Tr; RHA1_ro06874-1.
DR   EnsemblGenomes-Tr; RHA1_ro06875-1.
DR   EuropePMC; PMC4222082; 24266988.
DR   EuropePMC; PMC4592853; 26319878.
DR   EuropePMC; PMC5472690; 28670303.
DR   EuropePMC; PMC5550956; 28793878.
DR   EuropePMC; PMC5640789; 29062941.
DR   EuropePMC; PMC6134474; 30203150.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01782; ASpks.
DR   RFAM; RF01791; F6.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02003; group-II-D1D4-4.
DR   SILVA-LSU; CP000431.
DR   SILVA-SSU; CP000431.
XX
CC   Bacteria available by contacting Lindsay Eltis (leltis [at]
CC   interchange.ubc.ca).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7804765
FT                   /organism="Rhodococcus jostii RHA1"
FT                   /strain="RHA1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:101510"
FT   gene            complement(1391..2581)
FT                   /locus_tag="RHA1_ro00001"
FT   CDS_pept        complement(1391..2581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00001"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0000074 - regulation of progression through cell cycle"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00001"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91837"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKU9"
FT                   /protein_id="ABG91837.1"
FT                   /translation="MIWPEHRIETRPWNPRHRQGSRADRTLETVDVMIPPMIGALDCDL
FT                   VGVVARAHEEAVIAVARLEAGFGEHLAPLSDFLLRSESVASSKIEHIDAGWRAFGKALA
FT                   GGKSSAEAKSQLAAVKALIAMVDAAGDGPITGDTLLGAHRLLMAPDYYTARDSGRFRDV
FT                   QNWIGGSDYTPIDALFVPPPPELVDELLADLLEFANRTDLPILAQAAIAHAQLESIHPF
FT                   TDGNGRIGRALISAILRRRRLTHRVTVPLASVMLADTRRYFDHLTRYRAGDADGFVEYV
FT                   ARAAIVSSEAAQDSARALAELPSYWRDIARPRSNSADEKIIDALLGTPIFGADTAQQIT
FT                   GTTDASAYRALGRLTAAGVLEVLSESKRNQIWAATGVLAELDALSTTIGRRTTEHL"
FT   gene            3556..4122
FT                   /locus_tag="RHA1_ro00002"
FT   CDS_pept        3556..4122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00002"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00002"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91838"
FT                   /db_xref="UniProtKB/TrEMBL:Q0S090"
FT                   /protein_id="ABG91838.1"
FT                   /translation="MPTVAAHCTLHLVSGPEPPPPSSWSIGTRPDWPSPVSSSPPAASG
FT                   SGGDPRSAARTERVGPERPHRRAACDPPLPPADREEPQCRHPNLTTRRPDDQTIVSLNA
FT                   VRQRTTDDLLSGHVPLTSLLYRRRDRIAADLLVSDVLTTYMRGHGIGPAGVMVMLGIAD
FT                   DARARDPTAEQRGQITDAIAATSER"
FT   gene            4147..5319
FT                   /locus_tag="RHA1_ro00003"
FT   CDS_pept        4147..5319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00003"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00003"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91839"
FT                   /db_xref="UniProtKB/TrEMBL:Q0S091"
FT                   /protein_id="ABG91839.1"
FT                   /translation="MALLVRVRTRPGPTAPGGHGRGTAPGNVAAHRLDHRVLAVDACAC
FT                   GWIWRRSSTRGAHRALRRRLHALPATGIAPQLPPPKPRCARAELAARALLVSRTDMPTL
FT                   RCCTKFAHHCGSPDPTASAPRKLSASDPAPVAEPAIRSGAAFIPVACRRRTMGELVDRP
FT                   DVVERSDQEAPMPRPSSWVRTTASALGEELARIGLTVPADRLEDLLTDRVAAVAERMHI
FT                   TERTARRYFDPHALRTLARELALRINDEAPGADLLTLPRTIAMPLPTLGATIAALVEVA
FT                   ALAGADTGPDEPATAMSMISTLGVLTREHDGHLPTVWVPEPLLVRAVRLIENTADLVHH
FT                   GCTLPPGVAEDVRPHLRKALSDDAARLRALTPHTGRRTGPGLWAVPDDPR"
FT   gene            complement(6182..6940)
FT                   /locus_tag="RHA1_ro00004"
FT   CDS_pept        complement(6182..6940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00004"
FT                   /product="probable dehydrogenase"
FT                   /note="GO_function: GO:0004022 - alcohol dehydrogenase
FT                   activity; GO_function: GO:0004316 - 3-oxoacyl-[acyl-carrier
FT                   protein] reductase activity; GO_process: GO:0008152 -
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00004"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91840"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKU6"
FT                   /protein_id="ABG91840.1"
FT                   /translation="MHKVLPGLGEPTCWASPQGVTPTLRRGAPPVVSEQVVDRIRAELR
FT                   STISNWRTPIFELRRRCVRTRATARVRADLPVCPDTRELGDRTEYGKNLRRGSVREVGL
FT                   THRLFDSVERELGNVAALVFCHCESVDSGRLDTTVESFDRHFAVSTRASWLLIRGYGLR
FT                   FRGQHGTGRVVSLTSDHTVGNLACGASKGAMDRITLAAARELADLGVTCNAINPGPTDT
FT                   GWMNRTAEGAHDHLHISGTPRYTAGLARIW"
FT   gene            6935..8449
FT                   /locus_tag="RHA1_ro00005"
FT   CDS_pept        6935..8449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00005"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0005554 - molecular function
FT                   unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00005"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91841"
FT                   /db_xref="GOA:Q0S093"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="UniProtKB/TrEMBL:Q0S093"
FT                   /protein_id="ABG91841.1"
FT                   /translation="MHQLSSLDAQFLDAETSTTCTHVGILSVLGPTTPGGGLTVQALRA
FT                   LADGRLHLVGPLRWRLQQVPLGLDRPYWVDSEFLDLGYHIREVTLTGPGTDEQLAEQIS
FT                   GLAARPLSRDRPLWQCYLVNGLTGGRQAIYTKVHPAVIDGLTAAQALAVLMDTTPQPRT
FT                   VPHRFSDEQYQAAGALGMLGNSAWHLALLPARLMWSSLRLAPHLPELADALTVPGADLL
FT                   GTLARGLTPRTWRRPADEATAGAPAPAPAPPDTPFPGPDTARRRFAFTSLPLGEVDAVR
FT                   TALGCTVDDVVTALCTTVLRRWLIDHDAPPNTTLAAAMPIARRTDAQFAAADHRLSLLP
FT                   IALPINEADPARRLHKVHTSLTAAPQRFRAAPATLVRDVGAALPRALRGPISRTPLRAL
FT                   TMPTPPVNLIISHAAGPARPLYTAGIEVTGNFPVSAVSDMTGGITIAAMSYGRHLDVGI
FT                   ITCRNLVPDVWDVTGQLHQALSELTACTRNVRYLRPARPPHRPMSR"
FT   gene            complement(11208..11435)
FT                   /locus_tag="RHA1_ro00006"
FT   CDS_pept        complement(11208..11435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00006"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91842"
FT                   /db_xref="UniProtKB/TrEMBL:Q0S094"
FT                   /protein_id="ABG91842.1"
FT                   /translation="MFVRALHTEMMARNAYIHHKKIEGSQLPLMIAVLDEFFILSGKWQ
FT                   RLAKTGDDATREQPESDSRNSTRERRATRE"
FT   gene            12456..12710
FT                   /locus_tag="RHA1_ro00007"
FT   CDS_pept        12456..12710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00007"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91843"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKU3"
FT                   /protein_id="ABG91843.1"
FT                   /translation="MPSTAGSSRGAYTAAAAPATAIGEVGVKRPMRARSGGRIDLRACA
FT                   CGVAVAEDLAVLLNHPVLDRVTTCVHRGLLSLGPTPLRE"
FT   gene            15092..15310
FT                   /locus_tag="RHA1_ro00008"
FT   CDS_pept        15092..15310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00008"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0005576 - extracellular region;
FT                   GO_function: GO:0004222 - metalloendopeptidase activity;
FT                   GO_process: GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00008"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91844"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKU2"
FT                   /protein_id="ABG91844.1"
FT                   /translation="MQIDSIRIMRTIAAAFPEITTLGGWRPTGDVTPDHPDGRAVDIMI
FT                   PDSASAPGKALGDTIARAAEGDCRDNG"
FT   gene            15359..15568
FT                   /locus_tag="RHA1_ro00009"
FT   CDS_pept        15359..15568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00009"
FT                   /product="probable transposase"
FT                   /note="GO_function: GO:0004803 - transposase activity;
FT                   GO_process: GO:0006313 - DNA transposition"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00009"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91845"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKU1"
FT                   /protein_id="ABG91845.1"
FT                   /translation="MTETLDHMDQSKIDHQKLAQQLLAQAKAEGVELVGPNGLLNQLTA
FT                   NVLETALEAEMDEHLGYEKHHVTG"
FT   gene            15608..16624
FT                   /locus_tag="RHA1_ro00010"
FT   CDS_pept        15608..16624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00010"
FT                   /product="probable transposase, mutator family protein"
FT                   /note="GO_function: GO:0004803 - transposase activity;
FT                   GO_process: GO:0006313 - DNA transposition"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00010"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91846"
FT                   /db_xref="GOA:Q0SKU0"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKU0"
FT                   /protein_id="ABG91846.1"
FT                   /translation="MLTEIGPVQIQVPRDTDASFDPQIVKKRQRRLTGVDEIILSLSAK
FT                   GLTTGEIAAHFDDVYGASVSKETISKITDKVLTEMAEWSVRPLDPVYPVLFIDAIHVKI
FT                   RDGQVANRPVYVAIGVTTAGEREILGLWAGDGGEGAKFWLAVLTEIRNRGVADVCIAVC
FT                   DGLKGLPDAITTVWPLTVVQTCLIHLLRNTFRYASRQYWDEMSRDLRPIYTAVNEAAAK
FT                   EQFTEFADKWGPRYPAIVRLWESAWSEFVPFLDYDPEIRRVICSTNAIESLNARYRRAV
FT                   RARGHFPSEQAALKCLYLATRSLDPSGKGRARWVTRWKPALNAFAITFEGRITPTVI"
FT   gene            18122..20401
FT                   /locus_tag="RHA1_ro00011"
FT   CDS_pept        18122..20401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00011"
FT                   /product="possible transposase"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0005524 - ATP binding; GO_function: GO:0017111 -
FT                   nucleoside-triphosphatase activity; GO_process: GO:0006313
FT                   - DNA transposition; GO_process: GO:0006811 - ion
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00011"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91847"
FT                   /db_xref="GOA:Q0SKT9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKT9"
FT                   /protein_id="ABG91847.1"
FT                   /translation="MPSQRSLYRLLEKLAVGKHTTGSARTRRSLADRPDGPFGEADAWA
FT                   PGEVMQIDCTPLDVLVRLDDGVTGRIDLTGMIDVATRTVTAAVLPPTTKSVDASVLLAR
FT                   TVTPEPMRPGCSQALAMSRSALPFERLLDIDARMQHAAARPVVIPETIVVDQGKVFISR
FT                   NFRASCNFLGINFQPVHDASGWEKGHIERMLGSVGTLFAQFVAGYTGFNAERRGRHVEQ
FT                   QAVWSVTELQELLDEWLVAAWQNRPHDGLGDPVHPGRMFSPNEKYAALIETAGYVPVAL
FT                   SADDYVELLPATRRAINAYGVKISHRTYHDKALNPLRHQRSGVTDHRDLWEIHYDPYDV
FT                   SRVWGRNHWKGGWLTLFWRHLHRVAAPFGELAWDHTHRALPGATEEEVADAVADLLKRA
FT                   HQGPSDSEGKASAKLSRRDRRVAARTKASSPAAPIPPRPAPRDSIDEEPDPVRNNSSGR
FT                   QGDSAADLRPLRRGGQAMVTRTARHGSDDESGDADYGHLQLTTPDGWRGFVAEMHTAPN
FT                   LLPTAVWTGLAEDKRDYYDDDRIDHHSRLLVVQTPTIRQVIASGRRLVQLNRNAHSGRC
FT                   GLMVSGPAGTGKTTALTQLGKTVEVIHRRRHPHAADDIPLVYITIAPAATPKMIAMEFA
FT                   RFFDLPISRRANITDIADAVCGVSRDARVTLVAVDELHNLNTRTRTRAGADASDTLKYF
FT                   SERTPATCTYAGTSLERTGLLSGTRGEQIAGRFEHGPHRSVQPGPTMDRAHRRLGRQSA
FT                   TTPAPA"
FT   gene            complement(21689..21916)
FT                   /locus_tag="RHA1_ro00012"
FT   CDS_pept        complement(21689..21916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00012"
FT                   /product="probable glutaredoxin-like protein"
FT                   /note="GO_function: GO:0005489 - electron transporter
FT                   activity; GO_process: GO:0006118 - electron transport;
FT                   GO_process: GO:0045454 - cell redox homeostasis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00012"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91848"
FT                   /db_xref="GOA:Q0SKT8"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011909"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKT8"
FT                   /protein_id="ABG91848.1"
FT                   /translation="MTITIYSKPACVQCTATYRALDNEGLDYTIVDITRDPDAHDYVLG
FT                   LGYLQAPVIVVGDDHWAGFRPDRIRALAAA"
FT   gene            complement(22043..23263)
FT                   /locus_tag="RHA1_ro00013"
FT   CDS_pept        complement(22043..23263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00013"
FT                   /product="transposase"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0004803 - transposase activity; GO_process: GO:0006310 -
FT                   DNA recombination"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00013"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91849"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKT7"
FT                   /protein_id="ABG91849.1"
FT                   /translation="MRVSTAFNRLLQIPGASVSDVSITDDSVEVTLRLAARRVKCPCGY
FT                   TSAAAYDHAPRRWRHLDFGRHKVWLKYPIRRIECPTCGVRTEDIPWARPTARHTRDFED
FT                   MVLWLVTRTDRTSVSTLMRCAWRTVTSIVTRAVDALIDSRRLENLYRIGVDEICYRHPH
FT                   KYLTIVGDHDTGKVVYITEGRGRDSFSEFFEQQSAKERDKVQVVSMDGSPAFRAAAEDH
FT                   VPRARQCMDPFHVMQWVNRALDRVFSDAASVRRTLSMQAPEWRQARTVLRLGKNRLTKK
FT                   HKSLLRTVTAADTEVGTAWRLKEQFRDLYRKIAPRNAARYLRRWIEEARSCGIDAFVQL
FT                   ARMIDKKSEQICAAIELGISNALIEGINSKIRLINARGYGHHSAKSLTAMIYLNLGGIE
FT                   VKLPTQT"
FT   gene            complement(23518..24447)
FT                   /locus_tag="RHA1_ro00014"
FT   CDS_pept        complement(23518..24447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00014"
FT                   /product="possible oxidoreductase"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0016491 - oxidoreductase activity; GO_process:
FT                   GO:0006118 - electron transport; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00014"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91850"
FT                   /db_xref="GOA:Q0SKT6"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKT6"
FT                   /protein_id="ABG91850.1"
FT                   /translation="MLERAFGQDRLIGLHRVVGLTSFTLMFAHIAAITFGYAGGDVLAA
FT                   SATAWELATDYPGMLLAVVGTALLLMVVITSVRPIRDRLRYESWHLLHLYGYLGVGLVL
FT                   PHQLWTGQEFLGSTAATLYWWTLWILVAAAVLVWRIGLPLWRSVRHALRVAAVVPEADG
FT                   VLSVYISGRHLDRLPIVAGQFCNWRFLGRHGWSRANPYSLSAAPHGRHLRISIKSLGDN
FT                   SARTRTLQPGTRILFEGPYGCGNRERVRPSLNAAESGTKGWKPPWPRRPGTAQRPTRRA
FT                   GRSGRIPTLLPVPILRNWPTSIARQRLL"
FT   gene            25021..25911
FT                   /locus_tag="RHA1_ro00015"
FT   CDS_pept        25021..25911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00015"
FT                   /product="possible DNA-ligase (ATP), C-terminal"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0003910 - DNA ligase (ATP) activity; GO_function:
FT                   GO:0005524 - ATP binding; GO_process: GO:0006260 - DNA
FT                   replication; GO_process: GO:0006281 - DNA repair;
FT                   GO_process: GO:0006310 - DNA recombination"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00015"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91851"
FT                   /db_xref="GOA:Q0SKT5"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKT5"
FT                   /protein_id="ABG91851.1"
FT                   /translation="MKWDGQRAIATVDDGGSRLFSRNGNDITATFPELAGPVSDALGGR
FT                   EAILDGEIVALDASGRPSFSRLQRRMHVLSPTTELRNEVPVTYYVFDVLSLDGKSTTGL
FT                   PYLRRRAELADLALSGPRLQVPPYWTDVDGEEMLDRARRHHLEGAVAKRVDSTYQPGRR
FT                   SPAWIKQPLRANTEGIIVGWVDGTGAARDGIGSLLLAAYDDDHRLVYIGHVGTGFTTAT
FT                   RKSLREQLAALERPTTPLSSPPPARDTKGAHWVEPQLVGDVEYREHISGRLRHPSWKGL
FT                   REDKAPSEVDLPGRH"
FT   gene            25986..26459
FT                   /locus_tag="RHA1_ro00016"
FT   CDS_pept        25986..26459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00016"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00016"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91852"
FT                   /db_xref="GOA:Q0SKT4"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKT4"
FT                   /protein_id="ABG91852.1"
FT                   /translation="MSTVSGLPAHVLLVHFIVVLAPLTAVLIVVCSVWPAARRRLVWLT
FT                   LVLAAVTVIVTPLTTDAGEWLEKHVARSSAVHTHAELGDSMIYFSVALLLSALAVTAVQ
FT                   LRERKSDPPRSLTVIVAVLAVVVAVGTIVQVYRIGESGSRATWGDVVTSGSEP"
FT   gene            26833..27300
FT                   /locus_tag="RHA1_ro00017"
FT   CDS_pept        26833..27300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00017"
FT                   /product="possible Mg(2+) transporter"
FT                   /note="GO_function: GO:0008324 - cation transporter
FT                   activity; GO_process: GO:0006812 - cation transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00017"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91853"
FT                   /db_xref="GOA:Q0SKT3"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKT3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91853.1"
FT                   /translation="MRFCATSWIRIRRRSDPILTRNGPRGRRSSTGSRSWRWSMTTGRF
FT                   RRLIAPQQLLAVLLQEHEEDLSRLGGFLHSVETTRATSVESVRRRLWHRVPWLLVGLLG
FT                   AMVSAVFMAAFEVTLEANVAVAYFVPGIVYLADADRDPGDPWLVCRGGNST"
FT   gene            27302..27541
FT                   /locus_tag="RHA1_ro00018"
FT   CDS_pept        27302..27541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00018"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91854"
FT                   /db_xref="GOA:Q0SKT2"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKT2"
FT                   /protein_id="ABG91854.1"
FT                   /translation="MRREALTGLSVGALLGAVMLPVVSLMTGDTMLAFAVAVAVLAASA
FT                   IATVVAMVLHVVAITLQGSRKRRRPSRPARTTPE"
FT   gene            complement(27477..27659)
FT                   /locus_tag="RHA1_ro00019"
FT   CDS_pept        complement(27477..27659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00019"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00019"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91855"
FT                   /db_xref="GOA:Q0SKT1"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKT1"
FT                   /protein_id="ABG91855.1"
FT                   /translation="MSDSNTGAAGGGAIYALGIFGAWVWFWQQADAFWEYVLAIIQGLF
FT                   WPAWMVYDVFETLAG"
FT   gene            complement(27656..27904)
FT                   /locus_tag="RHA1_ro00020"
FT   CDS_pept        complement(27656..27904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00020"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91856"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKT0"
FT                   /protein_id="ABG91856.1"
FT                   /translation="MLVPNFCLDLHRCRPRMTPVGEKVTNPRSAPGPIDSVTAASRPGD
FT                   QRLCRRGPAVTTLRRGARSKVARVPISPTPAAEGMRP"
FT   gene            27922..28803
FT                   /locus_tag="RHA1_ro00021"
FT   CDS_pept        27922..28803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00021"
FT                   /product="probable universal stress protein"
FT                   /note="GO_process: GO:0006950 - response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00021"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91857"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS9"
FT                   /protein_id="ABG91857.1"
FT                   /translation="MSGHRPIVVGIDGSPSSLQAVSWAAREAALRSSPLSLITTMFVPG
FT                   RYGVPIGVPASFFQDEERDGKERLERAAQTARAAVPGHDIEIDTTVCTGTPAGELLDRS
FT                   ADASMLVVGANRRGIVDRAVLGSVSSAVATHASCPVAVIRGEPDRDINDIPGPIVVGVD
FT                   GSQHSEPAISTAFEEAGLRQSELVAVHAWSDIVLQLSPDGGSEAEWLRDAANETALLSE
FT                   NLAGRAENYPDVKVRTLVVRDRPTRHLREQAENAQLLVVGSRGRGGFSSMLLGSTSRAL
FT                   MHSVVCPLLIVR"
FT   gene            28827..29423
FT                   /locus_tag="RHA1_ro00022"
FT   CDS_pept        28827..29423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00022"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91858"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS8"
FT                   /protein_id="ABG91858.1"
FT                   /translation="MHSPGPGSTLIEAQLPRYEQRILRTQAVRASAPATFAAIRRVDFF
FT                   RSPVVALPNRARIAIDTVRPRRGGAPIQRSRSEFRFDRLLEPDGGFHLLAEKPGHAMVL
FT                   GFIGRWWERGYGRVEWSPAEFGRFALPGYGVGAWGFTVLPYGAHTSVLLTEVRVHGTDD
FT                   TARRMFRRYWTVVGPFVTAMGGPILRLIRDEAESR"
FT   gene            complement(29439..30749)
FT                   /locus_tag="RHA1_ro00023"
FT   CDS_pept        complement(29439..30749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00023"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0005554 - molecular function
FT                   unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00023"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91859"
FT                   /db_xref="GOA:Q0SKS7"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS7"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91859.1"
FT                   /translation="MMSDDRHEQLGSGDLITLVSDVGPVPMNVGAILFVAGEGDVDAAT
FT                   VEATFTRRLTSIRRLQQRLATPRRGLGRPYWVDDSDFDVHAHVSRVRCPCPGERDAALA
FT                   IAVDAVTRPLPRSRPLWRAVVVTGLTGGHIGLVLVLHHVVADGIGGLAVLARVVDGADA
FT                   AGPADNTAAPPRGRFVDCVADRTRTLRRLPRTVSRIRDGWAELGRGRLGWAPRCSLNVP
FT                   TGSRRTVTTVDVGLDRVRAAGRRSGATVNDVLLVAVTGALATLLHERKEFPQELVVSVP
FT                   VSARSTTTSGYLGNQVGVMPVRVPLEGSVEERLAAVSRITRARKMRTRGTSSALIGPLF
FT                   RILAAVRLFRRLVDRQRLVNSFLTNLPGPAGQLVIAGAPITDITPITVTAGNVGVAFAA
FT                   LSYAGTLTVTIVVDPDVVPEIRELAAYLREQFRAAIE"
FT   gene            complement(30746..32179)
FT                   /locus_tag="RHA1_ro00024"
FT   CDS_pept        complement(30746..32179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00024"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91860"
FT                   /db_xref="GOA:Q0SKS6"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91860.1"
FT                   /translation="MDDNLSFLDAGFLETEDSDPHASLTIGALAIMEGPVPGQDEFRDT
FT                   VAARFATLPHTRDRVHTVPLDFSAPSWSPDPHFDLGHHLRRVALPEPGEEEALFGFVAR
FT                   VMAHRLDRDRPLWECWVVESLTGDRWAILTKIHHCMADGITGTKLFEAMCDEVVAEASG
FT                   TTEADTDTDAVPARTAGTRLASVEGLIRSTIEFLSPMRQLRLVSAALAVPRRLTAAGIG
FT                   VATGLTHLLSEMLTSSTDTSLIGPIGRQRRYCAARVRMHDVREICATYRVTVNDVALAA
FT                   ITTGLRQLLLKRGEHPDPHTVRTLVPVSVRSATEEHSIHNQVSLMLPFLPVDIDDPVAQ
FT                   LVAVHDRLTTHKASKEAEGGKAFTAVAQYGPFMPMAWAVRLATRFPQHSVVAVATNVPG
FT                   PKATRHVMGRTILEIFPYVPIALRLRIGIAILSYSDHLAFGLTGDYDTTPDLADLTDAI
FT                   ERGVLTLLAASRAAAAASE"
FT   gene            complement(32241..32774)
FT                   /locus_tag="RHA1_ro00025"
FT   CDS_pept        complement(32241..32774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00025"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91861"
FT                   /db_xref="GOA:Q0SKS5"
FT                   /db_xref="InterPro:IPR039708"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS5"
FT                   /protein_id="ABG91861.1"
FT                   /translation="MRGSCRLESSVFLLVVAVVLSLVPLAAAFGTATRTRLDDQSRADR
FT                   ATRQQIAAVLLEDANVNLADTTPATGATGQAPARWAVAGTTHTGLVQTAPEAKTGQTIS
FT                   IWIDPAGKIVSAPKTGTENAFEAVGAALALWTMGTTICLTMMIGIRWAGTRYRMSQWDR
FT                   EWRNLGKAPGWPVS"
FT   gene            complement(32906..33760)
FT                   /locus_tag="RHA1_ro00026"
FT   CDS_pept        complement(32906..33760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00026"
FT                   /product="possible universal stress protein"
FT                   /note="GO_process: GO:0006950 - response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00026"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91862"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS4"
FT                   /protein_id="ABG91862.1"
FT                   /translation="MVDPAIVVGVDGSGPALDAVRWAAREATVRRAPLLLLSCITYRGT
FT                   EDGPRLAETLHARAERNVAEARETARAGSADADLDIRAEVSHQNAPGSLVDRSAGAEMV
FT                   VLGRRGLGEFTDGLIGSVTSAVVRHAQCPVAVIDGWSRVADGTGPVVVGIDGSPSSARA
FT                   VGLAFEECSLHNAELIALHAWSDQDLSILPVGVEQTAERSVLDAAVAEWCERFPDVSVR
FT                   RTLVRDRPVRHLLEMADEAQMIVVGSRGRGGFPGMTLGSTSAALVHITPCPLLIAGPIR
FT                   PGR"
FT   gene            complement(33810..34826)
FT                   /locus_tag="RHA1_ro00027"
FT   CDS_pept        complement(33810..34826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00027"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00027"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91863"
FT                   /db_xref="GOA:Q0SKS3"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91863.1"
FT                   /translation="MNTRAVPTVPDRRTVESAVALACRAPSLHNSQPWRWVMGTALRLY
FT                   SDPDRLLPATDGFGRQMVISCGAALNHLEYAFTANHWRLVIERLPHSSDRQLLSTINFI
FT                   PAPAPTDFVARMAVAIGRRRTERLPMDPPPAWADTLEQLVRITAGTGVELEDLGQRSRP
FT                   ALEEASRRMTGLRHDDPTYQAELRWWSGRGLFPDGVPEQARPSDRQQHSVHLSREFPPG
FT                   RASTPDGGPSEDRAAILLLSTSADSRLDWLRSGEVLSAVLLACTDRGLGTCPVTHLTER
FT                   AVTRTLLRELSSGEGMPQVLIRVGAGTGVGEPSTTPRRPLSEVLVRERPAPGHLPGE"
FT   gene            complement(35002..35940)
FT                   /locus_tag="RHA1_ro00028"
FT   CDS_pept        complement(35002..35940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00028"
FT                   /product="possible universal stress protein"
FT                   /note="GO_process: GO:0006950 - response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00028"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91864"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS2"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91864.1"
FT                   /translation="MTDARTRSLAPVVVGVDGSVAARGAARWAAAVADKQGATVHLIHV
FT                   LPSPPVFYTEPRPLPSEDEDRIAGERFLADAVRNIRSDRHTVAVECSLPTGSTAADVLL
FT                   PLADSASMVVIGSTARGPVEGYLNATALRLAHHSPCPVVVWRGAEEHAIPDRRAVVVGV
FT                   DGSRCSVAAVADAADFAGRFAAPLVAVHSWKSRVPPDAENAPDGAAARPRERAVLAESL
FT                   AGLADRYPDLAVREIVESGGAGEVLLRWCVDAQLLVVGNHGHGALGRAVLGSTSQDVLH
FT                   RARCPVMISKVQRDTGTVPDQAVEFGDRGHR"
FT   gene            complement(35943..36743)
FT                   /locus_tag="RHA1_ro00029"
FT   CDS_pept        complement(35943..36743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00029"
FT                   /product="probable ABC transporter, permease component"
FT                   /note="tc: 3.A.1"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00029"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91865"
FT                   /db_xref="GOA:Q0SKS1"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS1"
FT                   /protein_id="ABG91865.1"
FT                   /translation="MLRSVLTKTLYDQRRAFPAWVVGIALLVAMYVVIWPSVRDQPAMN
FT                   QFLDQMPEAFRALFAMSGADMSTPVGYIQIELLSFMGPLLLLIYAVGTGAAAVAGEEDR
FT                   GTLDQLLATPLSRGRILAEKFGALTAGTVALSAVMGLALLGEGILADMDLPVGNVAAAM
FT                   VHLALLALVFGALAFAIGAATGHPAPSRSVPAVIAILAYVLNGLGPVVSWLAPWQRYSP
FT                   FYQYAGHDPLRHGFSLAAASVSALTIAVLLGVALVGFAHRDVVR"
FT   gene            complement(36733..37650)
FT                   /locus_tag="RHA1_ro00030"
FT   CDS_pept        complement(36733..37650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00030"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="tc: 3.A.1; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0015087 - cobalt ion transporter activity; GO_function:
FT                   GO:0016887 - ATPase activity; GO_process: GO:0006824 -
FT                   cobalt ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00030"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91866"
FT                   /db_xref="GOA:Q0SKS0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS0"
FT                   /protein_id="ABG91866.1"
FT                   /translation="MSDTIAMCTVGLSKRFGSVLALDAVDLNVVEGEVFGYLGPNGAGK
FT                   STTLRLLTGLLRPTAGSARVLGLDAWSAAPAVHRRIGYVPGELALYDRLTGRQHITFFG
FT                   HLRGDPVDKAATVFADRLDLDLDLDRTARTMSKGNRQKLALVLALMSGPQLLILDEPTG
FT                   GLDPLVQHEFHAIIREHTASGGTVLLSSHVLGEVQQVADRVGVLREGRLIAVESLHELR
FT                   QKSLHHVTAECSTPIQESDFRDVAGIRGLTVAGTSLTCSAPQSALDALIRRISHYGIVD
FT                   FECAEADLEETFMAFYEIRDRHAA"
FT   gene            37808..38821
FT                   /locus_tag="RHA1_ro00031"
FT   CDS_pept        37808..38821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00031"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91867"
FT                   /db_xref="GOA:Q0SKR9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKR9"
FT                   /protein_id="ABG91867.1"
FT                   /translation="MRSTEEAIVDSTIPDENVVRIAVDLACRAPSVHNSQPWQWTYADG
FT                   QLDLYTERGRLLASTDPSGRQLVVSCGAALNHLETALTGLKWSVDIRRVPEGPHSGHLA
FT                   TIRFRHDARPQSHDFDLLAAIRHRYSDRRPFGPVSMKTPLPPALTDVTRRVDVHLTLLA
FT                   QDARPTLAKATELTAAARKYDSAYQAELHWWAGHSIPQGGIPADSLATAENRDRVDIGR
FT                   RFPAGRDNDASPGIDRSTVLVLSTDTDGREAWLRAGEALSAVLLEATVGGLATCPLTHM
FT                   TELRQSREMIRELVPDRGFPQALIRVGTTEKKSPPRQTPRRPVESVFSIGRRHSTR"
FT   gene            complement(38846..39313)
FT                   /locus_tag="RHA1_ro00032"
FT   CDS_pept        complement(38846..39313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00032"
FT                   /product="hydrogenase maturation protease"
FT                   /note="GO_component: GO:0009375 - ferredoxin hydrogenase
FT                   complex; GO_function: GO:0004222 - metalloendopeptidase
FT                   activity; GO_function: GO:0008901 - ferredoxin hydrogenase
FT                   activity; GO_function: GO:0046872 - metal ion binding;
FT                   GO_process: GO:0016485 - protein processing"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00032"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91868"
FT                   /db_xref="GOA:Q0SKR8"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKR8"
FT                   /protein_id="ABG91868.1"
FT                   /translation="MTVVVIGLGNELRRDDGIGPAVARQVADRVAPDVRVSVSDGDPAA
FT                   LLDAWAGAQLAVLVDAVVCEPSRPGTVHRFTPDELAGVRAGRFSTHGISLGDIIQLGTV
FT                   LDRLPHRMVVLAVEVADLAAGGGLSPAVGRAVETAVAAVLSVLGEPLAEMS"
FT   gene            complement(39310..40578)
FT                   /locus_tag="RHA1_ro00033"
FT   CDS_pept        complement(39310..40578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00033"
FT                   /product="Ni-dependent hydrogenase large subunit"
FT                   /note="GO_function: GO:0008901 - ferredoxin hydrogenase
FT                   activity; GO_function: GO:0016151 - nickel ion binding;
FT                   GO_function: GO:0047806 - cytochrome-c3 hydrogenase
FT                   activity; GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00033"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91869"
FT                   /db_xref="GOA:Q0SKR7"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKR7"
FT                   /protein_id="ABG91869.1"
FT                   /translation="MVRALARVEGEGRVDVTVREGRAEHVTLDIYEPPRFFESFLRDRH
FT                   FLEPPDITSRICGICPVAYQVSACNAIEQACGLELDDDVRDLRRLLYCGEWIASHVLHI
FT                   YFLHAPDFLGLPDSIALARHDREAVERGLSLKKAGNAILDAIGGRPIHPVNVRIGGFHR
FT                   APTAAELIPLSDQLRTALDHAVATVRWVSSFDFPDIELDHDLLALHDDSRYAIEDGEIR
FT                   SSTGLRCTADEFPKHVVEHQVPHSTALHAELDGRRYLTGPLARYSLNSSRLGGVAARTA
FT                   ADAGLGAQCRNPYRSIVVRAVEVVYAVEEALRIIDRYERPPQPFTAGSPIRTVGHGVSE
FT                   APRGLLYHRYEVDPAGLIRAATIVPPTSQNQAAIEHDLRRAVDGNLMLADDELTTLCER
FT                   TIRNYDPCISCATHFLTLTVDRR"
FT   gene            complement(40586..41371)
FT                   /locus_tag="RHA1_ro00034"
FT   CDS_pept        complement(40586..41371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00034"
FT                   /product="hydrogenase"
FT                   /EC_number="1.12.-.-"
FT                   /note="GO_function: GO:0005506 - iron ion binding;
FT                   GO_function: GO:0008137 - NADH dehydrogenase (ubiquinone)
FT                   activity; GO_process: GO:0006120 - mitochondrial electron
FT                   transport, NADH to ubiquinone; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00034"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91870"
FT                   /db_xref="GOA:Q0SKR6"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKR6"
FT                   /protein_id="ABG91870.1"
FT                   /translation="MSAPPTTKPKLAVWKFASCDGCQLTLLDCEDELLALSEAVEISHF
FT                   LELSDTITAGPYDLSLVEGSITTAADRDRIRAVREQSRFLVTIGACATAGGIQALRNFA
FT                   DIDEFLSVVYARPEYIDTLATSTAISAHVPVDFELRGCPIDRRQLLEVITAYLAGRRPN
FT                   IPDTSVCTECKRRGLTCVMVADGTPCLGPVTHSGCGALCPSVSRGCYGCFGPTTDPNLA
FT                   AMRGWLRTCGMSEDAMGRVFATFNVAAYGSEGKVYGTPQ"
FT   gene            complement(41371..42219)
FT                   /locus_tag="RHA1_ro00035"
FT   CDS_pept        complement(41371..42219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00035"
FT                   /product="probable hydrogenase/ sulfur reductase"
FT                   /note="bifunctional; GO_function: GO:0016491 -
FT                   oxidoreductase activity; GO_process: GO:0006118 - electron
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00035"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91871"
FT                   /db_xref="GOA:Q0SKR5"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKR5"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91871.1"
FT                   /translation="MTALPDDRMLPTGYRVVSRSVETRDSVTVTLAPAAPPAMPLAQFT
FT                   PGQFMMLYAHGVGEVAISVSGDPSATDGTLVHTIRNVGAVSRALHDAPRGTIIGVRGPF
FT                   GRGWTMPTGPDRDLVIVAGGVGLAPLRPVVLAALAARDKFRRLVLVVGARTPADILYRA
FT                   ELGTWQARTDLTVEVTIDQPIAGWTGGVGFVTESLHRVDLDPGRTTALLCGPEPMMRFC
FT                   ARALTDRRVRPDDIQVSVERNMQCGIGACGHCQLGELLLCRDGPVVDYATAEPLLRVPE
FT                   L"
FT   gene            complement(42216..42677)
FT                   /locus_tag="RHA1_ro00036"
FT   CDS_pept        complement(42216..42677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00036"
FT                   /product="possible cAMP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00036"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91872"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKR4"
FT                   /protein_id="ABG91872.1"
FT                   /translation="MNADESTLPPVLGRLDHQHRLRLAELSTPVRFAAGEFVFRENEPA
FT                   TRCWLLGTGSVVLTTLVPGRGTVALETLHGGDVLGWSWLGARQVWQFDAQATTTTDAAE
FT                   VDVAALEQMALSRPDFGYAVTRALSGVLIARLQSTRARLLDLYANRGDR"
FT   gene            complement(42674..43831)
FT                   /locus_tag="RHA1_ro00037"
FT   CDS_pept        complement(42674..43831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00037"
FT                   /product="probable ferredoxin"
FT                   /note="GO_function: GO:0005489 - electron transporter
FT                   activity; GO_function: GO:0005506 - iron ion binding;
FT                   GO_process: GO:0006118 - electron transport; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00037"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91873"
FT                   /db_xref="GOA:Q0SKR3"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKR3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91873.1"
FT                   /translation="MEGQPTAHADASVLDRRGLDQLIEALRARGYRVVGPTVEDSAIVL
FT                   AELDSGAQLPSGWGVTTGPGTYRLRRRDDAAVFGHSAGPQSWKRFLHPPRQQQWSVDRD
FT                   GTFVAPAHDERPYAFVGIRGCDLAAISVLRRVLCPDPDSDSTTALRFRKLFIVAAHCTE
FT                   PGGVCFCASMGTGPAAGPGYDLALTERIDEHGHRFVVEVGTESGADVLADVAHRAAATA
FT                   EADDARQAVSTATGRMGRAMPDVDLRALLRDARGADVWEDVASRCLTCGNCTMVCPTCF
FT                   CTTSEDVTDLTGEHAERWQHWSSCFEPDFSYVHGGNVRTSGESRYRQWMSHKLGTWFDQ
FT                   FGSSGCVGCGRCIDWCPVGIDITAEAARLVQVMPAYRPEDDREQR"
FT   gene            complement(43864..44145)
FT                   /locus_tag="RHA1_ro00038"
FT   CDS_pept        complement(43864..44145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00038"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00038"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91874"
FT                   /db_xref="InterPro:IPR015057"
FT                   /db_xref="InterPro:IPR038070"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKR2"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91874.1"
FT                   /translation="MNEKTWSVEIVIDEHDADEGGSRTRAQARLRTRDTHTLVGVGLAR
FT                   RNPADTEIPEIGDELATARALADLAHQLIELTAADVEAATHSRVHLTE"
FT   gene            complement(44222..45643)
FT                   /locus_tag="RHA1_ro00039"
FT   CDS_pept        complement(44222..45643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00039"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00039"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91875"
FT                   /db_xref="GOA:Q0SKR1"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKR1"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91875.1"
FT                   /translation="MTDVITTNQRYMTQTDFMSWRMEEDPILRSTIVAVALLDRRPDQS
FT                   RFVDMMRRAVDLVPLFRRTAIEDPLGLAPPRWADDRDFDLSWHLRRYTLAEPRTWDGVL
FT                   DFARTAEMTAFDKRRPLWEFTILDGLNDGRSALVMKVHHSLTDGVSGMQIAREIVDFTR
FT                   EGTPRPGRTDRATAVPHGGSSRPPSRLSWYRDTAADVTHRAANILGRNSVRLVRAPRAT
FT                   WREATALAGSTLRLTRPVVSTLSPVMTKRSTRRHCAVIDVPVEALAQAAAAAAGSINDA
FT                   FLAAVLLGMAKYHRLHGAEIRELRMTLPISLRTETDPLGGNRISLARFALPTDIDDPAE
FT                   LMRRVHATVDAWRREPAIPFSPMIAGAVNLLPASTLGNMLKHVDFVASNVAGSPVPLFI
FT                   AGSEILHYYAFSPTLGSAFNVTLMSYTTQCCVGINADTDAVPDLATLTESLADGFRAVL
FT                   GLCAKTTDTRVVVAS"
FT   gene            complement(45853..46104)
FT                   /locus_tag="RHA1_ro00040"
FT   CDS_pept        complement(45853..46104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00040"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91876"
FT                   /db_xref="GOA:Q0SKR0"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKR0"
FT                   /protein_id="ABG91876.1"
FT                   /translation="MYDDDVGGWGYALMFTGMALIWGLLIVGIILLIRYVSHPFPAPPG
FT                   EPPHRSAEAVLAERFARGEIDEQEYRNRLSILRAGTTP"
FT   gene            46395..47549
FT                   /locus_tag="RHA1_ro00041"
FT   CDS_pept        46395..47549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00041"
FT                   /product="probable penicillin-binding protein"
FT                   /note="GO_component: GO:0005618 - cell wall; GO_function:
FT                   GO:0016787 - hydrolase activity; GO_process: GO:0000902 -
FT                   cellular morphogenesis; GO_process: GO:0009252 -
FT                   peptidoglycan biosynthesis; GO_process: GO:0046677 -
FT                   response to antibiotic"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00041"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91877"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKQ9"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91877.1"
FT                   /translation="MMLVDPRFGELAGQFFRLFGQPSDGGGALALYLHGEPVVDIWSGW
FT                   AARDTRWQSDTVSVSFSTGKGVASTVLHRLVDRGLIDYDAPVATYWPEFASAGKELVTV
FT                   RDLLTHRAGLHRVRGLVPGRAALFDHDSVVGALASAAPDRRRAVMPGYHAVTFGSLVAE
FT                   LTTRATGSSFTDLVRTEIAEPLGIREFWFQVPAEERHRIAKSFPRITPFGVPWETASFA
FT                   LSCLPVLRNIAHAGMPEGFDELVRNPAIHDYVMPGWNGVFSARALARMYAALANKGMVG
FT                   GRRFLTEDTLAQIGEVQTTARDYVLGIRMNWRLGYHAAFVASRNQYPHAFGHYGLGGSG
FT                   AFADPETGLSVAFVTNRMGGALTPLADLRLAKLGAQAESIARRL"
FT   gene            complement(47559..48437)
FT                   /locus_tag="RHA1_ro00042"
FT   CDS_pept        complement(47559..48437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00042"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_process: GO:0006950 - response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00042"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91878"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKQ8"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91878.1"
FT                   /translation="MTYAPTDAVVASETVTMTGGVADHEYSRATSGHRRRCRRSPGYHY
FT                   SEAALLFQNEFAEEVEKSAHEILDRAQQHVKSAVPDVTVSCSTHPGPAGPALAGLSAHA
FT                   EMVVVGSTGAGALQSILTGSTVLQVVNRAHCPVTVFRSEAPSPVPDHRPVVVGVDGSDL
FT                   SSLAITTAVEFATFFEVPLLAVHGWGAGDLPERPAALPMVNWAVVEEEQSVLMAENLAG
FT                   WREKCPDLQLTTVIEQAGPAELILEYARDAQLVVVGSHGHNRLAGAFLGSTSQNLLHHV
FT                   ACLITICRRAS"
FT   gene            complement(48504..48797)
FT                   /locus_tag="RHA1_ro00043"
FT   CDS_pept        complement(48504..48797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00043"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91879"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKQ7"
FT                   /protein_id="ABG91879.1"
FT                   /translation="MSTPSEVGGSAPRSGPERVLADGSRRRVRAEHHARPPVGQRARIG
FT                   PVDSVVIRLRHWRLCVSRRRPRSLSTTLRWGIHGELRGVVSLRIQPTMATTE"
FT   gene            48796..49329
FT                   /locus_tag="RHA1_ro00044"
FT   CDS_pept        48796..49329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00044"
FT                   /product="possible flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00044"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91880"
FT                   /db_xref="GOA:Q0SKQ6"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKQ6"
FT                   /protein_id="ABG91880.1"
FT                   /translation="MRTLVVYESMFGNTRHVAEAIARGLESAGPVTAVPVTRAGDEDLS
FT                   GYDLVMVGGPTHVHGMSRESTRRGAAVTAQKPDSTVTLEPDAESEGLREWLDGLPPTHG
FT                   KAVAFDTRANGPALLTGRASKGICRKLRLHGFDLVADSESFLVDKESRLEDGEETRAEQ
FT                   WGRTLARQVTSSHA"
FT   gene            49933..53064
FT                   /locus_tag="RHA1_ro00045"
FT   CDS_pept        49933..53064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00045"
FT                   /product="trehalose-phosphatase"
FT                   /EC_number="3.1.3.12"
FT                   /note="GO_function: GO:0004555 - alpha,alpha-trehalase
FT                   activity; GO_function: GO:0004805 - trehalose-phosphatase
FT                   activity; GO_function: GO:0016740 - transferase activity;
FT                   GO_process: GO:0005992 - trehalose biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00045"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91881"
FT                   /db_xref="GOA:Q0SKQ5"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKQ5"
FT                   /protein_id="ABG91881.1"
FT                   /translation="MFLDFDGTLANIVSDPSKAVLVDGVGDELVRLTHECPVAVISGRD
FT                   LADVQTRVGLADIWYAGSHGFELAGPQGQYYQNPDALAAVPLLHHATRALTDRLRDVPG
FT                   VLIEPKKYTVAVHYRNVAPDRIDEVVATVHDVATTGEVRLRVTGGRKVVELRPDVDWDK
FT                   GRALNWVLEHIHDAKSLLPIYIGDDLTDEDAFDAVTTNGVGIVVRSTEVGDRRSAARFA
FT                   VNDPAQVRELLQRLADLLGRDPETAATADAWMLFYDGYDPATEKLREAICTLGNGYFAT
FT                   RGCAPEATAGSVHYPGTYIAGLYNRLRDERAGTEIVNESMVNAPNWLTTTFRIEGGPWF
FT                   DVDATDLLEYRQYLNLRRAVLTRRFRYRDGAGRTTSVIQRRFVAMHLPHVCALQTTIVA
FT                   ENWSGSFEVRSALDGAVRNTLVERYRDLAAEHLAPLQSGALSADTVLLAMQTTQSRIPV
FT                   AMAARTTLSPRDRHRECTYRLHDDDGRIGHDLTVDLTEGESVTFEKMVTVFTGRDHALS
FT                   EPADEAARWVPSIGGFEEVLDGHVLAWEHLWDRIGISLGHYQDGLRIARLHQMQLLQTV
FT                   SPNTADLDVGVPARGLHGEAYRGHVFWDELFVFPVLNLRVPTLTRSLLRYRYRRLPEAR
FT                   RAARAAGHRGAMFPWQSGSDGREESQQVHLNPRSGRWLPDPSWRQHHIGIAIAYNVWNY
FT                   YQVTGDLEFLSDFGAEMLVEIARFFAGLASYESARRRYTIRGVMGPDEFHSGYPDAPHE
FT                   GVDNNAYTNVMAVWVILRAREALDMIPAPDRADLVDTLSLDAHEMARWADVSRRMFVPF
FT                   HDRVISQFEGYEALAELDWAGYRQRYTDIQRLDRILEAEGDDVNRYRASKQADVLMLFY
FT                   LLSADELRDLFGRLGYQLEPEAIPRTIDYYIARTSHGSTLSAVVHSWVLARANRDKAME
FT                   FFDRVLASDITDIQGGTTSEGIHLAAMAGSIDLLQRCFTGLETRGDRLVFSPEWPHTLG
FT                   ALEFPIVYRGHQLWLTISGRRVQVSAGAGNQRAIEISCRDQVVRLEPGCTVSLG"
FT   gene            complement(53107..53709)
FT                   /locus_tag="RHA1_ro00046"
FT   CDS_pept        complement(53107..53709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00046"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00046"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91882"
FT                   /db_xref="GOA:Q0SKQ4"
FT                   /db_xref="InterPro:IPR039708"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKQ4"
FT                   /protein_id="ABG91882.1"
FT                   /translation="MTIDQALRWWRLAPWSRNPLMRATDRCDSVVAAVLITVVLIVVPF
FT                   AAAFGTVTYTGLAERSHTELQTRHAQSAVLVDDPRQVVVADARSRSPETQDRGTAQWKA
FT                   PDGTLRSTAVETRPGTHRGDTVTVWVDTNGNVVAEPRSGVQNAAIAVSAALSVWAGAAV
FT                   GALLLYSGVRWISGRSRMRQWDREWNDLGRTPGWPVS"
FT   gene            53898..54266
FT                   /locus_tag="RHA1_ro00047"
FT   CDS_pept        53898..54266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00047"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91883"
FT                   /db_xref="GOA:Q0SKQ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKQ3"
FT                   /protein_id="ABG91883.1"
FT                   /translation="MRAPLSHRCGRGRRTTSEPVGEGTRNIMFEGHATASPCDDRHRRD
FT                   DEPEEFLYVHPAGFALSVVTGAAAAGLVVLLGAWLATPLVGVGAAATLVATVGLAAAML
FT                   MPHRPRRHGTRPVRSTAR"
FT   gene            54366..55013
FT                   /locus_tag="RHA1_ro00048"
FT   CDS_pept        54366..55013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00048"
FT                   /product="response regulator, two-component system"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0000156 - two-component response regulator
FT                   activity; GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0000160 - two-component signal
FT                   transduction system (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00048"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91884"
FT                   /db_xref="GOA:Q0SKQ2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKQ2"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91884.1"
FT                   /translation="MINVFLVDDHEVVRRGIADLLTADPDLTVVGEAASYSQAMARVPA
FT                   LKPDVAVLDVRLPDGNGIELCRELHSLMPELHCLILTSFSDDQAMLDAILAGASGYVVK
FT                   DIRGMELTRAVHDVGAGRSLLDSRAAAALMVKVRANAGEKDGIFGHLTNQERTLLALLG
FT                   EGLTNRQIAARMFLAEKTVKNYVSRLLTKLGVERRTQAAVLATKMQSRQSGT"
FT   gene            55092..56813
FT                   /locus_tag="RHA1_ro00049"
FT   CDS_pept        55092..56813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00049"
FT                   /product="sensor kinase, two-component system"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0000155 - two-component sensor activity;
FT                   GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0046983 - protein dimerization activity; GO_process:
FT                   GO:0000160 - two-component signal transduction system
FT                   (phosphorelay); GO_process: GO:0006468 - protein amino acid
FT                   phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00049"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91885"
FT                   /db_xref="GOA:Q0SKQ1"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKQ1"
FT                   /protein_id="ABG91885.1"
FT                   /translation="MTRQPDAGDRGPLLGSLSELRLRELLAEVQERIEQIVDARDHVDG
FT                   LLEAMLAVTSGLDLDNTLHTIVHAAINLVDARYGALGVLGPGGGLSEFVFEGIDEETRE
FT                   RIGDLPRGRGVLGFLITNPKPVRLDDLSHHSASVGFPAEHPPMKTFLGVPIQIRDEVFG
FT                   NLYLTEKANGSQFTEDDEVLLRALAAAAGIAIENARLYEESRTRQAWLEATREIATELL
FT                   AGSETAEVLQVIADDALALTGADSAFLAVPDDPDIPSDEVTELVVTASAGTVSDRIIGR
FT                   TIPVDKSTSGEAFRERTPLRVTALAFDPGFETGTRFGPALALPLRAAQSVTGVLVTLRH
FT                   VDALPFTDDQLALMSGFADQAAVALQLANSQRRMRELDVLSDRDRIARDLHDHVIQRLF
FT                   AVGLSLQSTLQRAKAPIVKQRLEQSIDDLHDIVRDIRTAIFDLHGGSGGMTQFRRRLHE
FT                   IVAETTADSGLRTTVHMSGPLSVIDAALADHAEAVLREALSNAVRHAGADTVTVSISVY
FT                   DDLAIEVADDGKGFVENVVTSGLENLAARAREVNGHFAIDTTPGGGTTLRWTAPLP"
FT   gene            56936..57817
FT                   /locus_tag="RHA1_ro00050"
FT   CDS_pept        56936..57817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00050"
FT                   /product="possible universal stress protein"
FT                   /note="GO_process: GO:0006950 - response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00050"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91886"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKQ0"
FT                   /protein_id="ABG91886.1"
FT                   /translation="MTARHPIVVGTDGSPSSLQAVAWAAQEAALRNSPLSVIATTFVPG
FT                   AYGVPIGMPESFFDDEERNGKNRLAAAAEIAARTVPGQSLDIHTTLCTGTPAGELLERA
FT                   KSAAMVVVGSNRQGIIERGFLGSVSAAVATHAPCPVAIIHDLPDSEVTRLEGPVVVGVD
FT                   GSAHSEPAISMAFAEAGLRQCELVAVHAWSDVDLPVHYEGGSVSGWKQIVTQETALLSE
FT                   SLAGRAEDFPDVKVRTMVVMDRPVRNLREQADNARLLVVGSRGRGGFTSMLLGSTSRAL
FT                   MHSVRCPLLVVR"
FT   gene            complement(57830..58978)
FT                   /locus_tag="RHA1_ro00051"
FT   CDS_pept        complement(57830..58978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00051"
FT                   /product="cation transporting ATPase"
FT                   /note="tc: 3.A.3; GO_component: GO:0016021 - integral to
FT                   membrane; GO_function: GO:0000287 - magnesium ion binding;
FT                   GO_function: GO:0004008 - copper-exporting ATPase activity;
FT                   GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0008551 - cadmium-exporting ATPase activity; GO_process:
FT                   GO:0006825 - copper ion transport; GO_process: GO:0008152 -
FT                   metabolism; GO_process: GO:0015992 - proton transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00051"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91887"
FT                   /db_xref="GOA:Q0SKP9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKP9"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91887.1"
FT                   /translation="MNGRAVKVSADYGVLPDWAEAVSTRSALDGAAAAWVQIDSTLAGA
FT                   ILLRDPLRRDAPRTLRRLRAAGLNRLIILTGDRRAPALEIGSIVGLDAVLAEQTPVDKV
FT                   AAVREEKRRAVTIMVGDGINDAPALAASVGVAMGARGATASSEAADIVLTTDHLARLAD
FT                   AMEIPRRSRRIAIQSAGIGMTLSLLAMTAAAFGWIAPAPGALLQEGIDVAFILNALRAL
FT                   RGGRSSELTVTRETGLLLQRFDHQHDDLRGALTLIRNAAEQVSSQPGPETVAAVRRAHT
FT                   VLAERVLPHERAEETQLYPALAEAFGTAEATAPMSRAHAEIDRLSRRLGTHLGAVEAQG
FT                   EVRPDQRDDLLACLYGLYAVLRFFAQEEEDYFALAPGIEDER"
FT   gene            complement(58975..59250)
FT                   /locus_tag="RHA1_ro00052"
FT   CDS_pept        complement(58975..59250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00052"
FT                   /product="probable cation transporting ATPase"
FT                   /note="tc: 3.A.3; GO_component: GO:0016021 - integral to
FT                   membrane; GO_function: GO:0000287 - magnesium ion binding;
FT                   GO_function: GO:0004008 - copper-exporting ATPase activity;
FT                   GO_function: GO:0005261 - cation channel activity;
FT                   GO_function: GO:0005524 - ATP binding; GO_process:
FT                   GO:0006825 - copper ion transport; GO_process: GO:0008152 -
FT                   metabolism; GO_process: GO:0015992 - proton transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00052"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91888"
FT                   /db_xref="GOA:Q0SKP8"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKP8"
FT                   /protein_id="ABG91888.1"
FT                   /translation="MRSAAGQGRVERGPWWMDKTGTLTTGRPSGLDVAAAPGHDPDEVL
FT                   RLAAAVDQLSPHVLAESIVHFARARGCALPLPTDVSEQPEPGSAAS"
FT   gene            complement(59344..60093)
FT                   /locus_tag="RHA1_ro00053"
FT   CDS_pept        complement(59344..60093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00053"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91889"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKP7"
FT                   /protein_id="ABG91889.1"
FT                   /translation="MTSTSSDTETTAMVHTQAPVVERLIPEFEGSFTRDAIARTVAGSI
FT                   ADLARVPIADMPELAERVARQRLFTALERHPERSSSGRCEPTPDNRVIVSHRSGGPGPL
FT                   PSVTTRQSNRRGHDGPAAWARCARVRGGGDQTGARDHVARGDRDTRTRRGADLLPGHGA
FT                   PAPARQGPPRRAGRGRLPLSTRRHSAGQSPDGRRSCFDRPCAPIVRAGSHTGRGCVRTR
FT                   TVISGYEHDSHIVVHPRGGTELHRLRR"
FT   gene            60270..60833
FT                   /locus_tag="RHA1_ro00054"
FT   CDS_pept        60270..60833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00054"
FT                   /product="possible acyl-CoA synthetase"
FT                   /note="GO_function: GO:0004467 - long-chain-fatty-acid-CoA
FT                   ligase activity; GO_function: GO:0008080 -
FT                   N-acetyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00054"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91890"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKP6"
FT                   /protein_id="ABG91890.1"
FT                   /translation="MKTRTPHAVTTGVVVRSLRPTDRDDVQSLHERMDQHDAYLRFFGA
FT                   RPKHLEDLAESLCLQDPRHCALGAFIGGILVGVANYVSPAHQLDNDSTPVEFALVVDHE
FT                   YQSHGIGTMLLTRLVDAARAHGIERMTAEVLAQNTLMLEVIRDRGWAHALRRDGTTLHL
FT                   DLDLDLDEDAQADGPSARRRPVVM"
FT   gene            60843..62357
FT                   /locus_tag="RHA1_ro00055"
FT   CDS_pept        60843..62357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00055"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91891"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKP5"
FT                   /protein_id="ABG91891.1"
FT                   /translation="MSATERTQRCSPPQAVGGLEVSGVETHTAYVVMVGDVVFKAKKPI
FT                   RTAFADFGTAERRRAACEREVTLNRRLCPDVYLGVAELTDPAGGPTEALVKMRRMPSDR
FT                   RLARLVGGGGDDTTAQVDAIAAVVARFHAGAEQSAEIDCDATPGAVAARWRANVSEVTS
FT                   YRCDVLPAADVHEVQARALRYLKGRKRLFEYRVREGRIVDGHGDLLADDIFCLADGPRI
FT                   LDCLDFDDHLRHVDCIDDAACLAMDLEYLGREDLGSRFLDRYCAAARDEPPASLQHHYI
FT                   AYRAFVRAKVACLRYTQGSRAAGEDARAHCNLALRQLRAGTVRMALVGGLPGTGKSTLS
FT                   RKLADVTGSVVISSDHVRKELDGLDPHSRQVAGFGEGLYSGTMTDRTYAEVLRRARDHL
FT                   TAGRSVVLDASWTQSMRRERAALVASCTHSDLVELECRAPRAMAIARIGSRPTGDSDAT
FT                   PAVYDAMAASAAAWPSATAVDTDTAAGDSVQTAERIWHSTSGWRDE"
FT   gene            62407..63360
FT                   /locus_tag="RHA1_ro00056"
FT   CDS_pept        62407..63360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00056"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /note="GO_function: GO:0003872 - 6-phosphofructokinase
FT                   activity; GO_process: GO:0005975 - carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00056"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91892"
FT                   /db_xref="GOA:Q0SKP4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKP4"
FT                   /protein_id="ABG91892.1"
FT                   /translation="MPDIVTLTMNPALDITTSTNRVVPTDKVRCGAPRRDPGGGGLNVA
FT                   RVLHVLGTPATAVFPSGGHTGRALEDLVATEGVEIRSLTIRGSTRESLTINENETGLQY
FT                   RFVLPGPTVTAREQVACLDLVIEVASGADYVVVSGSLPPGVPADFYQQVADVVGDLGAR
FT                   VIVDTSGPALRQLRGGVFLVKPSIRELRDWTGRELSAIDDQVAAAREVIDRGVSQIVVL
FT                   SLGADGALLVTRDRDEHFPSVQVPVVSGVGAGDSMVAGVVCGLAHGRSLSDSVRYGIAA
FT                   GAAMLQTPGTALCRRPDVERFYQLLTDGSAAGTIVG"
FT   gene            complement(63638..64513)
FT                   /locus_tag="RHA1_ro00057"
FT   CDS_pept        complement(63638..64513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00057"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="GO_function: GO:0008415 - acyltransferase activity;
FT                   GO_process: GO:0008610 - lipid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00057"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91893"
FT                   /db_xref="GOA:Q0SKP3"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKP3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91893.1"
FT                   /translation="MGTVIDRLDVTRGGWRTRHSALHLAVSAAQTCLERAGRNADDLDL
FT                   LVNVGLYRDRNLGEPALAALIQEDIGAHPEDPHDDTHGTFSFDVANGSCGALNGLQIVD
FT                   GFLRSHTINWALVVASDADPGRGMSEHFPFAPTGGAILCRWTDDEFGLGPVHWVNCSDA
FT                   GESFCATVGLEDSRNVLRFRESDSMDERFATAGAQAARECLEASSLELADVDLIVAAPA
FT                   RPKFRAALAEHLGVPVPRIVVAYDERMHTASLVAALDRRTGGIPAGNRVLIVAVGAGVT
FT                   AGAALYSEHP"
FT   gene            complement(64497..65552)
FT                   /locus_tag="RHA1_ro00058"
FT   CDS_pept        complement(64497..65552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00058"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="GO_function: GO:0008415 - acyltransferase activity;
FT                   GO_process: GO:0008610 - lipid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00058"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91894"
FT                   /db_xref="GOA:Q0SKP2"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKP2"
FT                   /protein_id="ABG91894.1"
FT                   /translation="MPFATRLAGAGRHLPTTHLTTTDLMSTTRHSTHIDLERLTGIRER
FT                   RVSVGDEDSYTLAISAALDCLERSNRDAASIDVVVSCSITKFHGGLTQWLEPTMSSAVA
FT                   QAIGAPGAMTFDLSNACAGMLTGVTVMNNWIRQGIVERALVVSGEYISQLGQNAAQHIR
FT                   NIMSKELACLTLGDAGAALLLERAPAGSAGIGLAGFTTVADYSRLCLAYPKGDDPGARM
FT                   FTNSRGIQRAAIADTPLLLHEVLDAAGISLHDIDHVITHQTSARAIRKGMAEVTATLGD
FT                   SPRHDAVITVDRYGNTASTTHTVALVEELEAGRIRAGETVALIALASGLEIGVVLLTLD
FT                   EELVARYGHSH"
FT   gene            65779..66369
FT                   /locus_tag="RHA1_ro00059"
FT   CDS_pept        65779..66369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00059"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003723 - RNA binding; GO_function:
FT                   GO:0016779 - nucleotidyltransferase activity; GO_process:
FT                   GO:0006396 - RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00059"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91895"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKP1"
FT                   /protein_id="ABG91895.1"
FT                   /translation="MQARHVMSSPVTTVDRSTSVDECLRLVGSSGFTVLPVVDERKHLV
FT                   GIVSEGDLLRARFRELGGADRGTDPQPDEMSAGDVMASPVVAMTADAEVSELASAMLRS
FT                   RLRGIPIVHDHDILGIVTRPDLIAVLTTDDAQVAKEVQHRLDVYGGAGRWRVDVAHGSA
FT                   AIYGVTPQDPERNVIAALADTVPGIAEVHFPPE"
FT   gene            66421..66678
FT                   /locus_tag="RHA1_ro00060"
FT   CDS_pept        66421..66678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00060"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91896"
FT                   /db_xref="GOA:Q0SKP0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKP0"
FT                   /protein_id="ABG91896.1"
FT                   /translation="MQARYLDAGDLRWPWVAAAAVVGFAALSMTSPLAVLGGAAAVVFI
FT                   GLGVFRNPHQRVVGAAIVSVGVGLLVPGLPALLLHGVNSL"
FT   gene            66752..67639
FT                   /locus_tag="RHA1_ro00061"
FT   CDS_pept        66752..67639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00061"
FT                   /product="possible universal stress protein"
FT                   /note="GO_process: GO:0006950 - response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00061"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91897"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKN9"
FT                   /protein_id="ABG91897.1"
FT                   /translation="MTTDSPIVVGVDGSAHSLDAVCWAADAAVHHRAPLSSLLGAPGTF
FT                   GDAVNLSAGVFSGVEYAGTQSLATASELARRSVPGNHLTLRTSLRHGSAVAALLDAAES
FT                   ARMLVVGSRGLGEFTGGLVGSVSAAVASHAPCPVAVIRGMPEMDAPPLDGPVVVGVDGS
FT                   PNSEPAIAAAFEEASLRGVDLVAVHAWSDFSLLTVTPADPSDNELPWSAIETAERAVLS
FT                   ERLAGWKDKYPDVSVRKVVVRDRPVHHLLQQARESQLVVTGSRGRGGFASLLLGSTSRA
FT                   LLHALTCPLLIVRR"
FT   gene            67975..68571
FT                   /locus_tag="RHA1_ro00062"
FT   CDS_pept        67975..68571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00062"
FT                   /product="possible potassium channel protein TrkA"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00062"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91898"
FT                   /db_xref="GOA:Q0SKN8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKN8"
FT                   /protein_id="ABG91898.1"
FT                   /translation="MDRHISRMTGHAIVCGFGRVGRAGVQYLATLGMPVVVVDRDPERL
FT                   AELDVPTVVGDVTDDQVLEAAGIGHAHALIRAGANRVVTLISSGAPDGCLRAPATRRRV
FT                   LARRDARRDAGLPDRGGRGLACLAAGRANTGGSGPRGATGSLLMALWSPTGQFVADPTP
FT                   EQRLDPGTILIALGTAPQLDALRREVRQSEGIYSP"
FT   gene            complement(68585..68827)
FT                   /locus_tag="RHA1_ro00063"
FT   CDS_pept        complement(68585..68827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00063"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00063"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91899"
FT                   /db_xref="GOA:Q0SKN7"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKN7"
FT                   /protein_id="ABG91899.1"
FT                   /translation="MSPWKRPVTWSRLTASQRAALVVMAAVQVGLAVAAWADLAKRDPH
FT                   EIRGSRTTWAAAIAVNFIGPIAYFRWARRAPAQAR"
FT   gene            complement(68903..69748)
FT                   /locus_tag="RHA1_ro00064"
FT   CDS_pept        complement(68903..69748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00064"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00064"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91900"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKN6"
FT                   /protein_id="ABG91900.1"
FT                   /translation="MTVLVAYATAKGSTRGIAERLGSCIEGLGQSVDVRPVAAVSDVHS
FT                   YDVIVFGSAIHNGQWLAEASDAVGRLRSQFEGRRVWAFSVSSVGVTSTTLSKRLARFLR
FT                   RVTPEPGAVRILRDAADVRDHRFFAGVIAPGDWPGFGRVVFTLMGGHYGDARDWADVCA
FT                   WAGAIAAESTRDTERRRVWAFSVSSVGVTSTTLSKRLARFLRRVTPEPGAVRILRDAAD
FT                   VRDHRFFAGVIAPGDWPGFGRVVFTLMGGHYGDARDWADVCAWAGAIAAESTRDTERWT
FT                   "
FT   gene            complement(69745..71229)
FT                   /locus_tag="RHA1_ro00065"
FT   CDS_pept        complement(69745..71229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00065"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00065"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91901"
FT                   /db_xref="GOA:Q0SKN5"
FT                   /db_xref="InterPro:IPR025498"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKN5"
FT                   /protein_id="ABG91901.1"
FT                   /translation="MRTGRVAVLVLGCLSALTGFALLTAAVFLGWAYFMQRDGGHFTSP
FT                   REHFETSESALVSEKVDLFEGADLPKGFSTEDLGRVLVRATATDPDQEIFIGIGPRDEV
FT                   DKYFTDVARTEVTDVQFDPFRPTYRQIPGTRPAALPGTQPFWSASSSGTGTQEVRWELQ
FT                   QGSWTAVVMKADATPGLSVDIQAGARLTFLGPLALSVLVGAVVLLIIGIPLIVAGAIGL
FT                   GRHGPPQPHPVAQIAGDGTIAGDAHVPWTVYPARLVGELDAPLSRWLWLVKWLLALPHY
FT                   FVLFFLGIAFVVTTLVSGFAILFTARYPRTLFDFNVGVLRWVWRVQFYTYSALATDRYP
FT                   PFTLNRTDYPADFDVDYPVRLSRGLVLVKWWLLAIPHYLILALLAGGWFGSWRAGVTVT
FT                   DGTHYGQPWLLGSVLGLAVTFSAIALLFTGRYPHGLFDFVMGINRWAFRVAAYATLMRD
FT                   EYPPFRLDQGPCEPHEPTPHSGGDDSGETSPERPRT"
FT   gene            complement(71478..71909)
FT                   /locus_tag="RHA1_ro00066"
FT   CDS_pept        complement(71478..71909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00066"
FT                   /product="possible transcriptional regulator"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00066"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91902"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041583"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKN4"
FT                   /protein_id="ABG91902.1"
FT                   /translation="MTGLSNYFRTRAALVTGTVDAIVEREMSEVGVLAPTSAEDLVDAL
FT                   CGLIDYTNVANRTVTAARLVLFLEASHDPALREALARGRAAMEASAVSAFHRLGARDPQ
FT                   TAATAVMACAEGLILHRIARHDTADPRPTFELVVRAAVS"
FT   gene            71919..72722
FT                   /locus_tag="RHA1_ro00067"
FT   CDS_pept        71919..72722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00067"
FT                   /product="probable epoxide hydrolase"
FT                   /EC_number="3.3.2.9"
FT                   /note="GO_function: GO:0004301 - epoxide hydrolase
FT                   activity; GO_process: GO:0006725 - aromatic compound
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00067"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91903"
FT                   /db_xref="GOA:Q0SKN3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKN3"
FT                   /protein_id="ABG91903.1"
FT                   /translation="MVLLHGFPQHWWEWRGVLPGLAAHYRVICPDLRGAGWTDAPPTGY
FT                   TSEQLLADVVALLDALELDQVCLIAHDWGALLGYELCLRAPHRVRKYVSLGVPPVRPVR
FT                   STAARTGASTPDLPPAAGFHHEPEHLFGERHRAVRRQLRAPARAAAASALYRCGCSSAP
FT                   KTPSCARSSSADARSAPMTSVSSSSTAPHTSLSTRGRRQCSNARSHSSRRRARITRRRR
FT                   APDGRDRCSPNVRARPGRTPRRARCGRRTAIRRPPASVAGSRYRH"
FT   gene            complement(72568..73314)
FT                   /locus_tag="RHA1_ro00068"
FT   CDS_pept        complement(72568..73314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00068"
FT                   /product="response regulator, two-component system"
FT                   /note="GO_function: GO:0000156 - two-component response
FT                   regulator activity; GO_function: GO:0003677 - DNA binding;
FT                   GO_function: GO:0016831 - carboxy-lyase activity;
FT                   GO_process: GO:0000160 - two-component signal transduction
FT                   system (phosphorelay); GO_process: GO:0007600 - sensory
FT                   perception"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00068"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91904"
FT                   /db_xref="GOA:Q0SKN2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKN2"
FT                   /protein_id="ABG91904.1"
FT                   /translation="MNAVSSSAIARPRVLLIDADVERSLVERLRDAGFFVTRTYAEPVR
FT                   SRIEPPDVVIVDARSPHLDADTTVRALKAMRFALAVVVIGTFRSGNRRSDLLEAGADDV
FT                   MEMPVGADELVARLRAILRRVKPAVPAQAPDDAQDVCQCEEPHEPDHDGLRTTLTRTEF
FT                   VLFTVLAQNVDRVVTRRDLMLMVWGVTVESKTNVLNAYICSLRRKLVAVGSPYVVHTVR
FT                   GVGFALGELERSGSIDPVRQVPVAAS"
FT   gene            73472..74320
FT                   /locus_tag="RHA1_ro00069"
FT   CDS_pept        73472..74320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00069"
FT                   /product="probable hydrolase"
FT                   /note="GO_function: GO:0008415 - acyltransferase activity;
FT                   GO_function: GO:0016787 - hydrolase activity; GO_process:
FT                   GO:0006725 - aromatic compound metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00069"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91905"
FT                   /db_xref="GOA:Q0SKN1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKN1"
FT                   /protein_id="ABG91905.1"
FT                   /translation="MSQLQHLALHGDAVAYRLSGEGETLLLVHGMAGSSATWRAVLPQL
FT                   ARRYRVLAPDLPGHGDSAKPRGDYSLGAFAAWLRDLLNELDIERVTVIGQSLGGGVAMQ
FT                   FSYQHPELCDRLVLIGSGGLGPDVNWTLRLLAAPGSEFVLPLVAPSAVRDAGNKVRGWL
FT                   AAVGIHSVRGDEMWNAYSSLSDSDTRQAFLRTLRAVVDHRGQAVSALSRLYLNEGLPTQ
FT                   LIWGDSDGIIPVAHGYAAHEAIPGSRLAVLDGVGHYPHLEDPAAVVEIIDDFVSTTPAR
FT                   T"
FT   gene            complement(74280..74984)
FT                   /locus_tag="RHA1_ro00070"
FT   CDS_pept        complement(74280..74984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00070"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91906"
FT                   /db_xref="GOA:Q0SKN0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKN0"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91906.1"
FT                   /translation="MAETQRAQEFRRLRTPRSAAVAGIVFAVLFAASLVLLRTALPADP
FT                   FDETPWVGSGETRIKTALLLAPFAGIAFLWFIGVIRDRLGDLEDRFFATVFLGSGLLFL
FT                   AMGFVSMGVAGGVLAIARHSGSSANDIVYFGREIMLQINHVYALRMAAVFMISLGTIWL
FT                   RTGLMPRWLVMTTYLLALALLAIVDFSLWSTLAFPAWVLLISVYILVTGRRASAADRSF
FT                   RSAPVSWRRSRR"
FT   gene            75236..76717
FT                   /locus_tag="RHA1_ro00071"
FT   CDS_pept        75236..76717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00071"
FT                   /product="multidrug resistance transporter, MFS superfamily
FT                   protein"
FT                   /note="tc: 2.A.1.3; GO_component: GO:0016021 - integral to
FT                   membrane; GO_function: GO:0003824 - catalytic activity;
FT                   GO_function: GO:0005215 - transporter activity;
FT                   GO_function: GO:0008199 - ferric iron binding; GO_process:
FT                   GO:0006725 - aromatic compound metabolism; GO_process:
FT                   GO:0006810 - transport; GO_process: GO:0046677 - response
FT                   to antibiotic"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00071"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91907"
FT                   /db_xref="GOA:Q0SKM9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKM9"
FT                   /protein_id="ABG91907.1"
FT                   /translation="MMVTHATTERWTPRLIFSLASIVLLLEMLAVSYMMISIALPQIVT
FT                   HYQTTQGAWLLTAFLLVGAITCPLIGKLADTHGKRRLLLTAVGLSALGSLISAIAPTYA
FT                   VLIAGRALTGLLVPCLFLSYSLIRDVFPARTVALAVSIATSGMGLIAIPAPFFTGWLID
FT                   NFGFRSIFWFFVAGLVILAVLIRATTGESTVRLRSRIDLIGAALLGAGLAGILVGVSFG
FT                   PSWGWTSGATIGFLAGGAALLVAWMVSARLLADPLIDIRFFGKRPVFLTALGAGFCYGT
FT                   SAVFTIMLPMMCMTPAILGLGYGFGISAEGFAIFQAPLGGAVVIGGLIVGTLVPRNVRP
FT                   RILMVVGMLVMAAACLLTAMVHDDKALLIGFAALLGVGMGMGYASVPNLLIAAVPPQLQ
FT                   ATTASMVAVFQSILPAILPVIVFSVLNSHIATVVQGAVFYTDTGITIAFVIGAVSALLG
FT                   AVVAFALPRRISQLSAPGSGAAAAADTDGAVVLAH"
FT   gene            76857..81278
FT                   /locus_tag="RHA1_ro00072"
FT   CDS_pept        76857..81278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00072"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /EC_number="5.1.1.11"
FT                   /note="GO_function: GO:0005554 - molecular function
FT                   unknown; GO_function: GO:0016788 - hydrolase activity,
FT                   acting on ester bonds; GO_function: GO:0016874 - ligase
FT                   activity; GO_function: GO:0048037 - cofactor binding;
FT                   GO_process: GO:0009058 - biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00072"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91908"
FT                   /db_xref="GOA:Q0SKM8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKM8"
FT                   /protein_id="ABG91908.1"
FT                   /translation="MRVRIPGRVVPLTEAQHAIWFAQQLAPEIPYVIAQYVDLRGPVRL
FT                   DLLTEASARAVHELGSFTVREVDGRPHQVFGAGTSERVPVVDLRDEHDPVDAAERWMRK
FT                   DCIAPVDMYGESLVLSTILQVGDERTYWYTRAHHVAMDGYAAMMLMRRTAELYVAGIDG
FT                   DRPPEFRAVDPGRIAADDAGYRSSPRFQRDRAYWREQVRDLPPTVGLSGRRTPNPGASV
FT                   LVARGSADRSSDLLRPTGDGNAHSPTVVVVAAFAAYLARMTGADDVILSLPVSARTSAR
FT                   LRGTGGSVSNVLPLPLRGVGTGTVRDAVRAARTALTGALRHQRYRREDIGKDIASAGTG
FT                   LTHFGPVLNLMLFKQEITLGAVTGRVQVLTTGPTADLAVNIYPGPPGSVPRIDVEANPA
FT                   LYDEDEVTGHHRRFTMFLARFQAAAGTDRSVAELDVFHDAEREAFSPACGRPDSEPAPL
FT                   DRILAATVVTRPDAVAVRDRGRVVTYRELDEAADRWARVLTGHGVGPEDLVAVSIPRSY
FT                   ESVLALWAVARTGAAYVPVDPTHPTDRIAYTLGDSGAALGLTVRSARDRLPTTIRWLSI
FT                   DDGDDHPPTVERDRPVHLGHPAYVIYTSGSTGVPKGAVVTHDGLANLVQEIREKYAVAA
FT                   DSRVLHFASPSFDTALVEVLAACIGGATLVIAPTDVYGGAELRELLRAERITHLLSTPS
FT                   ALATVDPDGLDSLELVLVGGEVCPQDLADRWAVGRTMRNAYGPTETTCSVTLTDPLDPG
FT                   GRVTIGSLMRGVRATVCDPLLRPLPPGAVGELYLATPALARGYHRRPALTATRFVADPS
FT                   GKPGSRMFRTGDRVRWTNSATLEFLERTDDQVKVRGFRIELGEIDAALRRNPDIDFATT
FT                   IVHRTPVGDPVLVSYIMVRRESQTTPESARHAIARFLPEYMVPGSITVLDAVPLTPTKK
FT                   LDRGALPAPDFGTTTVPRRDPETTTERTVADVFGRLLGVPAVAAGDSFFDLGGDSLSAT
FT                   RVVATLNAELDATLGVRELFETPTVSALAERIDDRDASRSGAVRAPRIAATAVPDRVPL
FT                   SPSQQFIDRSATTPPLYSIPFTVRVAGAVDVDALRSAVADVLARHGALRTVFPDSAAGP
FT                   YQRLLSVDDALPDLAPIPAGPDDVADRVDRVLGAPFDVRTEPPLRATLFALDARDHLLA
FT                   CVLHHITADGWSLALVARDLVTAYASRTAGAPPGWEPPRVTYPQYSVWRRDMLGAEDDP
FT                   GSVASQQLAYWTEELSGLPGAVGLPLDRRRPHHWTYGAGRATFRIDHTAHHTLASLAHR
FT                   HHATVFTALRSAVAILLARLSGDTDIAVGTPVAGRNDPELDDVVGMFVNTVVLRTRVDP
FT                   GDTLADVIRDSHDIELRAFAHADVQFERLVEVIDPPRSSSLHPFFQVALSLNNFTPATL
FT                   DVAGLRFDITPRPLDVAKCDLHFHFTERHDTTGRPAGIDAELVYATDLFDGATATSFVD
FT                   ALLAVIGGDPGA"
FT   gene            81330..82697
FT                   /locus_tag="RHA1_ro00073"
FT   CDS_pept        81330..82697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00073"
FT                   /product="sensor kinase, two-component system"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0000155 - two-component sensor activity; GO_function:
FT                   GO:0005524 - ATP binding; GO_process: GO:0000160 -
FT                   two-component signal transduction system (phosphorelay);
FT                   GO_process: GO:0006468 - protein amino acid
FT                   phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00073"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91909"
FT                   /db_xref="GOA:Q0SKM7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKM7"
FT                   /protein_id="ABG91909.1"
FT                   /translation="MRARSAAAAALVVTICLVLAGGALLLVLYRTLEHSARDAADARAR
FT                   QIVEQLRTTAPGGLDSSLFATDGQVGTIQVIDSAGTVVATSPGADRLPVTFEPVPPGES
FT                   RYLGNIDLGDEPDYWIVERGAQSPQGPATVVVGADREPIEGILGTVALLMAIGGPVVVA
FT                   MVAVASYRLVGAALLPVERIRARVAAISTDRLDERVPVPHTQDEIARLAETMNSMLGRL
FT                   ESGHRAQQRFVSDASHELRSPLATITAALELAHTRPELVDTSLVDESLLPEARRMNHLL
FT                   ADLLLLARADENGLTHTSVDVDIDDLMYAESARVRDMSPELVVRTAIAPVRVVGDPQQL
FT                   ARVVRNLVDNARRHARREIRLNCRTSSDGAVLEVADDGPGIAVPDRQRIFERFVRLDTP
FT                   RTRDSGGAGLGLAIVAEIVATHGGTIDVTDSGTGGARFVITLPADGTRQSSPDFSR"
FT   gene            complement(82670..83347)
FT                   /locus_tag="RHA1_ro00074"
FT   CDS_pept        complement(82670..83347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00074"
FT                   /product="response regulator, two-component system"
FT                   /note="GO_function: GO:0000156 - two-component response
FT                   regulator activity; GO_function: GO:0003677 - DNA binding;
FT                   GO_function: GO:0016831 - carboxy-lyase activity;
FT                   GO_process: GO:0000160 - two-component signal transduction
FT                   system (phosphorelay); GO_process: GO:0007600 - sensory
FT                   perception"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00074"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91910"
FT                   /db_xref="GOA:Q0SKM6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKM6"
FT                   /protein_id="ABG91910.1"
FT                   /translation="MRVLLVEDERRLAETVRRGLTAEGFVVDVEHDGLSGFEAALSGDF
FT                   DVVVLDIMLPGKHGYDIVRDLRRREVWTPVLMLSAKDGEYDLADAFDLGADDYLIKPFS
FT                   FVVLVARLRALVRRGAPRRPTVLTADGLELDPARHRVTRDGTALALTPREYSVLEFLMR
FT                   NAGSAVTKQEILQSVWDTHYEGDDNIVEVYIGYLRRKVDTPFGRNSIDTVRGVGYRLKS
FT                   GDD"
FT   gene            83452..84138
FT                   /locus_tag="RHA1_ro00075"
FT   CDS_pept        83452..84138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00075"
FT                   /product="phosphatidic acid phosphatase, type 2"
FT                   /EC_number="3.1.3.-"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0005554 - molecular function unknown;
FT                   GO_function: GO:0016787 - hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00075"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91911"
FT                   /db_xref="GOA:Q0SKM5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKM5"
FT                   /protein_id="ABG91911.1"
FT                   /translation="MPHTSIATAGLRVSALTLILAVLCVQVRDGGPLTGADVPATSWVV
FT                   GHRSATLDHVALLVTALGSPVATVALAVICGLALAWRRRSAIPAAVVVGTVGAATAAST
FT                   ALKLVVERSRPAVDLQEVLETDYSFPSGHVTGTAALLGVTAAILLGRRHLRVRVCGAAV
FT                   AGCGVVIVAVTRVYLGVHWMSDVVAGAILGAVFVTVGAATYERVHRPLVAVAPSKPLAV
FT                   LDRVGG"
FT   gene            84185..84610
FT                   /locus_tag="RHA1_ro00076"
FT   CDS_pept        84185..84610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00076"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00076"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91912"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKM4"
FT                   /protein_id="ABG91912.1"
FT                   /translation="MRLTTLGDLPARIATGGFILHSGIQKWSADEQTAQGIHGMAAGAF
FT                   PFLNAIPPERFIKLLSVAEIGTGAALLTPFVPSAVAGAALTGFSGGLVAMYARTPALRN
FT                   PGSIWPNENGIAVAKDVWMLGIGLGFVLDGLSRSRCR"
FT   gene            complement(84652..85188)
FT                   /locus_tag="RHA1_ro00077"
FT   CDS_pept        complement(84652..85188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00077"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0004803 - transposase activity; GO_process: GO:0006313 -
FT                   DNA transposition; GO_process: GO:0006725 - aromatic
FT                   compound metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00077"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91913"
FT                   /db_xref="GOA:Q0SKM3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKM3"
FT                   /protein_id="ABG91913.1"
FT                   /translation="MSVLGQMDSFRRVFPTARRNRADLLRWLRRRPQLLAAVGFHEFAL
FT                   ATSARVDPRLKALGEIKAAALTNCEYCLDIGSAFSRALGVSDAQLRALPKFRESSEFDD
FT                   TEKLVLEFAEAITRTPAHIGEGLRRSLLAEFSEAQLTELAAAIAWENHRGRLNQALGVR
FT                   PSGFSDSDFCVVPEQ"
FT   gene            85312..85698
FT                   /locus_tag="RHA1_ro00078"
FT   CDS_pept        85312..85698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00078"
FT                   /product="possible Zn-containing alcohol dehydrogenase,
FT                   C-terminal"
FT                   /note="GO_function: GO:0008270 - zinc ion binding;
FT                   GO_function: GO:0016616 - oxidoreductase activity, acting
FT                   on the CH-OH group of donors, NAD or NADP as acceptor;
FT                   GO_function: GO:0051287 - NAD binding; GO_process:
FT                   GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00078"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91914"
FT                   /db_xref="GOA:Q0SKM2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKM2"
FT                   /protein_id="ABG91914.1"
FT                   /translation="MKAVICTETRLEVGDIPAPIPARGQVLIDVSRCGICGSDLHARVH
FT                   ADAMAELAAETGYRDFMRSHQRVVLGHEFSGTVAGYGPGCRKRWPVGTAVVALPGRSPR
FT                   DVDTNSYAAVASVADRCSNSIGQI"
FT   gene            complement(85641..86534)
FT                   /locus_tag="RHA1_ro00079"
FT   CDS_pept        complement(85641..86534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00079"
FT                   /product="probable transposase"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0004803 - transposase activity; GO_process: GO:0006313 -
FT                   DNA transposition"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00079"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91915"
FT                   /db_xref="GOA:Q0RVL3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVL3"
FT                   /protein_id="ABG91915.1"
FT                   /translation="MSRFQFVDDHCDTVPVKWLCQILEVSRSGFYRWRTSGPARAARAR
FT                   ADEELAERIRAIHADFDGTYGAPRITAELREAGIEVNHKRVERVMREHGIVGVHLRKPV
FT                   RTTVPDPDAAAVPDLIRRDFTASAPNTRYVGDITYLPVGDGEFLYLATVLDLGSRRLAG
FT                   WSIADHMRTELVTDAMRAAAACRGAAGLEGSIFHSDNGAQYASAEFADLCRELGVTRSR
FT                   GAVGTSADNAAAESLNATLKRETLQGRKRWNSAGEARAAIFRWITRYNTRRRHSTLGQI
FT                   CPIEFEQRSATLATAA"
FT   gene            complement(86531..86872)
FT                   /locus_tag="RHA1_ro00080"
FT   CDS_pept        complement(86531..86872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00080"
FT                   /product="possible transposase"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_function: GO:0004803 - transposase activity;
FT                   GO_process: GO:0006313 - DNA transposition; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent;
FT                   GO_process: GO:0006412 - protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00080"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91916"
FT                   /db_xref="GOA:Q0RVL2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVL2"
FT                   /protein_id="ABG91916.1"
FT                   /translation="MAMKAYSAEFKADAVALYLSDPSHTFEGIGNDLGVSRETLRNWVR
FT                   AERKRTGTSTAELRADGAARPASRAGEVSSESVLEEENKQLKAQIRKLETEREILRKAA
FT                   KYFAGETNW"
FT   gene            86875..87810
FT                   /locus_tag="RHA1_ro00081"
FT   CDS_pept        86875..87810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00081"
FT                   /product="possible Zn-containing alcohol dehydrogenase,
FT                   N-terminal"
FT                   /note="GO_function: GO:0008270 - zinc ion binding;
FT                   GO_function: GO:0016616 - oxidoreductase activity, acting
FT                   on the CH-OH group of donors, NAD or NADP as acceptor;
FT                   GO_function: GO:0051287 - NAD binding; GO_process:
FT                   GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00081"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91917"
FT                   /db_xref="GOA:Q0SKL9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKL9"
FT                   /protein_id="ABG91917.1"
FT                   /translation="MTSLPLGPSRPSVHDVLTQGGTPPIVRTGSDIHLTGLSASAPGGY
FT                   AEQVVVQESMTLPVPNGLSEEAAALTEPMAVAWHAVRKGDVGTRRTAIVIGCGPIGLAV
FT                   ISMLKASGVRTVVAADFSTRRRELARQCGADVVVDAAAASPWTSYPRRRETTSITEVLA
FT                   LGLDTMERLRRIPKLPWWHAFALADAVGATPSGPVVFECVGMPGVIDGILAGAPLRSRV
FT                   VVVGVCMETDTFRPALAINKEIDLRFAIAYDPREFRDTLHMLADGKVDPTPLITGTVGL
FT                   AGVESAFTALGSPEVHAKILIDPENTTAAL"
FT   gene            87818..88729
FT                   /locus_tag="RHA1_ro00082"
FT   CDS_pept        87818..88729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00082"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00082"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91918"
FT                   /db_xref="GOA:Q0SKL8"
FT                   /db_xref="InterPro:IPR027948"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKL8"
FT                   /protein_id="ABG91918.1"
FT                   /translation="MPMTSHHPRLQWAVPALLLTLIYAASLTVYGLSSRTGDDDGPFEI
FT                   GSDEVVVLVTAKSLQPTTDRVQAEVTIAVGEDFLHANGDTLNRDITLLLVPSTSHEEIV
FT                   FRAGASATTFDTEFIATGNAAYWPFDRFEVNPMVVEAYQGLGADRELVPTALLLEGRVD
FT                   GWKARAEEVAVDTDLSRNGTGAALMFARTGGNLIYAGILLLMMTILAGLAAFVALQTFR
FT                   RKRAVNTDMLGWMAAMLFAVVPLRGILPGSPPIGSWVDIALTVWVVSTLVASLALFVFC
FT                   WWRDSEAPAQHEVVATRAPGSE"
FT   gene            88738..89190
FT                   /locus_tag="RHA1_ro00083"
FT   CDS_pept        88738..89190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00083"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0005554 - molecular function
FT                   unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00083"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91919"
FT                   /db_xref="GOA:Q0SKL7"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKL7"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91919.1"
FT                   /translation="MVRRTGTVRPPWYLAHVNKVIVGLHRLGVPMPMPALTVPGRKTGV
FT                   LRSTPVSPYEVDGRRYVVAGYAESDWAKNVLAAGRGELTRGRRRERVRLVALPMSERGR
FT                   ILREFPIRVPHGVTMFLKAGTVANSSPEAFAAAADRCEVFRIEPLD"
FT   gene            complement(89196..89708)
FT                   /locus_tag="RHA1_ro00084"
FT   CDS_pept        complement(89196..89708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00084"
FT                   /product="possible secreted copper binding protein"
FT                   /note="GO_function: GO:0005489 - electron transporter
FT                   activity; GO_function: GO:0005507 - copper ion binding;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00084"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91920"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKL6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91920.1"
FT                   /translation="MKTGTTPARSGASGIRSHRHPEATTMKRVLTLVLPILLAVFALAA
FT                   CGSDGDDSSGSAESAHGGDHPMSGMPSMSMSMPMSMPAGAGQAGGHEILISDFKYTLPG
FT                   TFAPGEEVTVRNNDTAEHTVTADTGDLFDVEVEPGATATFTVPGQPGTFAFHCAYHPNM
FT                   VGTLEVR"
FT   gene            complement(89741..90451)
FT                   /locus_tag="RHA1_ro00085"
FT   CDS_pept        complement(89741..90451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00085"
FT                   /product="enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="GO_function: GO:0004601 - peroxidase activity;
FT                   GO_function: GO:0016853 - isomerase activity; GO_process:
FT                   GO:0006979 - response to oxidative stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00085"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91921"
FT                   /db_xref="GOA:Q0SKL5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKL5"
FT                   /experiment="2DGE; MS"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91921.1"
FT                   /translation="MPYVERSGDVFVLYFGEEGEPDSENAFHPDWIDRVDSLLDRIEQH
FT                   DGPAALVTTGLGKFYSTGLDTAWVVANTDKLNSYIDRVQALFARILTFPLPTVAALTGH
FT                   TFGGGAILAAAHDHRVMREDRGYFCLPGITIGASYAPGSIALLAARLPARAVHTALVTG
FT                   RRYGGVAASELGFVDEVAPEQQVLTRAVEHAQGLVATRGRTLGEIKSSLYADAVASLRT
FT                   PVANLESQEALNGG"
FT   gene            90746..92182
FT                   /locus_tag="RHA1_ro00086"
FT   CDS_pept        90746..92182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00086"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00086"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91922"
FT                   /db_xref="GOA:Q0SKL4"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKL4"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91922.1"
FT                   /translation="MEPHVRLVTRRRRTGPPQCHRDRRPRHRADAVAHRLRGTCSGVDR
FT                   RLLPLDTRIAGSAEHRTRHDRRGPVSPHRPGHRRQRTAGQSRQTTVTTGAGGHDDSVAQ
FT                   PHSPEQEQPIVAAEEGAARISTAAHPLGKPGPRFDRRSPFFIGMAGAAGVAVTYALIEV
FT                   VLAARGVLVLIAVAAFLAIGLEPAVSWLVRHGFPRWAAVATVFVLAFAVLAGFLAAAIP
FT                   PMVTQGGALVHNAPDYLGHLEQRYPVLEELSTRFHLQDELRRALDASNAPMVVGGLVGA
FT                   GKFVFSAISGTVIVVVLTAYFLADFAHIRSSIYRLAPNSRRPRTILIGDEIFAKVGGYV
FT                   LGNLLISLITAVLTFVWLVAFDVPYPLLLAVLVAVLDLIPVVGSTLAGVVVALVALTVS
FT                   LLVSLATIVFFIALRLFEDYLLVPRIIGRTVKVPPMVTVVAVLIGGALLGIVGALLAIP
FT                   VAAAVLLLARETVFPQLDRG"
FT   gene            92302..93687
FT                   /locus_tag="RHA1_ro00087"
FT   CDS_pept        92302..93687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00087"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0004144 - diacylglycerol
FT                   O-acyltransferase activity; GO_function: GO:0005554 -
FT                   molecular function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00087"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91923"
FT                   /db_xref="GOA:Q0SKL3"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKL3"
FT                   /protein_id="ABG91923.1"
FT                   /translation="MSVMSPTEAMFVLFETPSHPMHVGALELFEPPRESGPDHARAMFE
FT                   ALISHEGASDTFRRRAVRPLRGASYPWWSFDDRIDLGYHVRHTAVPGRGRMEDLLSLVS
FT                   QMHGMPLDPQHPMWEMHVIEGLADGRTAVFSKIHLSLMDGPAGLRLLHHALSTDPDARD
FT                   CPAPWTPGVAGVPRRESVLPVAVVRAGVRAATSIVGVLPALAKVAYDGVREQHLTLPLQ
FT                   SPPTMLNVPVGRARKLAARSWPIRRLVSVATAAHTTINAVVLAMCSGALRRYLLEQYAL
FT                   PDAPLTAMLPVPLDLGGTMIGPRGRDHGVGAMVVGLATDEADPAARLARISESVEHTNR
FT                   VFGALSHTQFQLMSALAISPILLEPVRRFVDDTPPPFNVMISYMPGPSRPRYWNGARLD
FT                   AVYPAPTVLGGQALSITLTSRSGQLDVGVVGDRHAVPHLQRIITHLETSLSDLEHAVAA
FT                   SGT"
FT   gene            complement(93691..94737)
FT                   /locus_tag="RHA1_ro00088"
FT   CDS_pept        complement(93691..94737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00088"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00088"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91924"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKL2"
FT                   /protein_id="ABG91924.1"
FT                   /translation="MSDTVAQSGTSMPFPKPRGPVSDLLFSILRADVADAEPFVAAARS
FT                   LASSARDSPRAFLFDEDAQICLTALYELHLQGITGVGDEWEWNSDLIAARSALEVPFDA
FT                   AIRDVADAPTGADDVVAALWAMTAPSTAPGLSGHMAHEADLTQFRELLIHRSLNQLREA
FT                   DVHTFGIPRLAGAPKAALVEVQSDEYGGGRPERMHSALFATTMRELGLSDDYAHYIDAV
FT                   PAVTLASLNALSLFGLHRSRLGALVGHLCAVETTSALPSKKYAAGLRRLGFGKAATLFF
FT                   DEHVEADSVHEQIVCRDLAGGLVAARPDVAGDILLGAAACLAFDDLVGDHVARCWEENR
FT                   TSLRQPPG"
FT   gene            95348..95803
FT                   /locus_tag="RHA1_ro00089"
FT   CDS_pept        95348..95803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00089"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91925"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKL1"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91925.1"
FT                   /translation="MKSVLSALPTRYGPPDSSTLFSWAVEPEHGRLSVVSAPGAGGILV
FT                   VRISGDIDVTTLHTFGNHLDEAINERLPFVLDLTDVQFFCASALPVLGTMAARARRLTV
FT                   PWAVTGNNALRRPLTAMKMAAQIPFCADLEDAFLLVAQGVHQGGRSA"
FT   gene            95800..97224
FT                   /locus_tag="RHA1_ro00090"
FT   CDS_pept        95800..97224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00090"
FT                   /product="alpha,alpha-trehalose-phosphate synthase
FT                   (UDP-forming)"
FT                   /EC_number="2.4.1.15"
FT                   /note="GO_function: GO:0003825 -
FT                   alpha,alpha-trehalose-phosphate synthase (UDP-forming)
FT                   activity; GO_process: GO:0005992 - trehalose biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00090"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91926"
FT                   /db_xref="GOA:Q0SKL0"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKL0"
FT                   /protein_id="ABG91926.1"
FT                   /translation="MKDSVPHGTSDFVVVANRLPVDMETLDDGTTRWKRSPGGLVTALE
FT                   PILHDRERGSWVGWPGVPDTKVEPIVSGGVDLYPVELSSDEVKLYYEGFSNATLWPLYH
FT                   DVLVAPVFDRDWWHSYLDVNRHFAEETARTAAEGATVWVQDYQLQLVPRLLREMRPDLT
FT                   IGFFLHIPFPPVELFMQLPWRKEIVEGLLGADLIGFHLPGGANNFLFLARRLLGLDTTT
FT                   AGVGVRSALGKVTLDGRVVQVGAFPISVDSRQLVEQATDPAIVERAAEIRRELGNPRKI
FT                   LLGVDRLDYTKGIDLRLSALGELLDEGRLDPSDTAMVQLATPSRERVEHYMKMRSSIEE
FT                   QVSHINGDHGQIGRPFVHYLYQPVDRSELIALFLAADVMLVTPMRDGMNLVAKEYVACR
FT                   ADLGGALVLSEFAGAAAELRGAYLVNPHDLDGVKNTIMAALDPEREQGRRRMSRLHRQV
FT                   LDHDVHRWAQSFLGAL"
FT   gene            97292..98362
FT                   /locus_tag="RHA1_ro00091"
FT   CDS_pept        97292..98362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00091"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00091"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91927"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKK9"
FT                   /protein_id="ABG91927.1"
FT                   /translation="MIRVASVPESHVYVRHLGEPDGGGGDVVRLADPVPADGRKVPGGW
FT                   WPPLMLDPGWISRHHREFDVFHIHFGFDAIEPADMKDIVHELSARGKPLVYTVHDLRNP
FT                   HHPDAGPHLEVLDVLVPAATELATLTEGAAAVIDANWARTATVLAHPHVVERPLVERPR
FT                   PDSDDFVVGVHVKSLRANMDPFPVLDALTRTVAALRGARLQIDIHDEIFRPDSYWYAPN
FT                   AAARLLRYRDADRVDVRVHPYFTDAQLWKYLSSLSVSVLPYRFGTHSGWLEACYDLGTA
FT                   VVAPTCGFYAQQQDCATFGFDEDSFDAASLDRAVRTLHRSATARATWHERATQRRLLAQ
FT                   AHHNLYERALSWRALP"
FT   gene            98359..99471
FT                   /locus_tag="RHA1_ro00092"
FT   CDS_pept        98359..99471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00092"
FT                   /product="probable glycosyltransferase"
FT                   /note="GO_function: GO:0016757 - transferase activity,
FT                   transferring glycosyl groups; GO_process: GO:0009058 -
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00092"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91928"
FT                   /db_xref="GOA:Q0SKK8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKK8"
FT                   /protein_id="ABG91928.1"
FT                   /translation="MNVDALRIALIASSRHPIRQPFPGGLESHVWHLARSLCADGHRVS
FT                   LFAGPGSDPGLGCAQLTVETLETSAAARQDVSMPPMDFLRDHHAYLRLMLDLAGPLADS
FT                   SDVVHNHSLHYLPVAMAPAVPTPVLSTLHTPPTPWLESALAVRAGTDAHFVAVSKHTAA
FT                   AWSHAIDRIDVVPNGVDVDRWPQGDGGPHLIWFGRLVAEKGAHVAIAAARRAGFAIRLA
FT                   GPISDPGYFESTIAPLLGPGVTYLGHLAQPELATAIGGSAAAVITPLWDEPYGLVVAEA
FT                   LACGTPVAAFARGGIPEVLSADCGRLVVPDDVDALARVIPQVVALPRRVAREHARSHCS
FT                   ERRMVDAYVNIYRRLAANRVRADGDRKVAS"
FT   gene            99468..100463
FT                   /locus_tag="RHA1_ro00093"
FT   CDS_pept        99468..100463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00093"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91929"
FT                   /db_xref="GOA:Q0SKK7"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKK7"
FT                   /protein_id="ABG91929.1"
FT                   /translation="MIGYYIHHHGTGHRVRASSICAALEAPVTALSSAPVDPGGPFVDR
FT                   VRLARDDRGSSPENPTADGALHWVPAHDVGLRTRMSRIASWVDATRPSLMVVDVSVEVA
FT                   AFVRLLGVPVVMIAMPGERTDPAHRLGYRLADHIVAAWPQAMYDPEWLREFAHKTTFVG
FT                   GISRFDGRASAAGPASSRPRILVLSGTAVTVGDVRRCAHVHRDYRWQALGVPGAPWIED
FT                   PWPELCGADVVVSDAGQNSVAEIAAARRPAIVIAQPRPFGEQSATAHSLASGGLAVSIP
FT                   QWPEVTRWPALLDRALALGGDSWVRWQTAGAATRAAAVIDSLAKRAESAP"
FT   gene            100460..101284
FT                   /locus_tag="RHA1_ro00094"
FT   CDS_pept        100460..101284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00094"
FT                   /product="possible sugar transferase"
FT                   /note="GO_function: GO:0016757 - transferase activity,
FT                   transferring glycosyl groups"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00094"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91930"
FT                   /db_xref="GOA:Q0SKK6"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKK6"
FT                   /protein_id="ABG91930.1"
FT                   /translation="MKVAVVTIAARRDRHLRMQLRSLERSQRTCDDHIVVAMGDPRTMD
FT                   TVSENGHARGIWLDHDDGPLPLAAARNAGADAALAAGADLLVFLDVDCLASEGLLGCYV
FT                   SAAEHPDNRSALLSGPVTYLPPPEPAGYDLAGLGRLRSPHPARPAPPHGTVTAGSDFDL
FT                   FWSLSFAVGRATWQHIGGFCTDYTGYGGEDTDFAQTARAAGVGLRWVGGADAFHQYHPV
FT                   SDPPVEHLRDILTNAHTFHRRWGWWPMQGWLRAFEADGLIEYDRDRRTWVRS"
FT   gene            complement(101287..102057)
FT                   /locus_tag="RHA1_ro00095"
FT   CDS_pept        complement(101287..102057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00095"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_process: GO:0007582 - physiological process"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00095"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91931"
FT                   /db_xref="GOA:Q0SKK5"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKK5"
FT                   /protein_id="ABG91931.1"
FT                   /translation="MAETVGERPESMSPKLDNATIAAQLGSLATALDEFNRNSGSQVEM
FT                   SLLLQRVCDQVVDAIADADMAGISLLRDGRVVTVAYTDEAVREIDIPNFQALDGDYFGV
FT                   AGTRKVVKARLGEAAARWPSVADNLDQAGMRSFLSAPLAVDEALAGTLNIYGQGDHGFS
FT                   ELDAVVLLVYTTAIEGLLRSARSVELARNEVSGLTKAMKSRAVIEQAKGIVMALRGVPA
FT                   DQAFEILVAQSQQEHVKLAEVARRIVESVTTNPE"
FT   gene            complement(102144..103286)
FT                   /locus_tag="RHA1_ro00096"
FT   CDS_pept        complement(102144..103286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00096"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00096"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91932"
FT                   /db_xref="GOA:Q0SKK4"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKK4"
FT                   /protein_id="ABG91932.1"
FT                   /translation="MHVTTLRRLRSWAGDGQRNTVVVQSAKAATAAVLAWILAERLLGL
FT                   PQPFLAPYAAVFMIEVTVSRSLRVAGEQLAAVSLGVLLAAAVGMLLDSVTVGVGVAVLT
FT                   GLLLGRWHRFGSSGVWVAVTALLMVTYGDSDQPAILGDRILAIALGAGTGVAVNALLLP
FT                   PLYLRRSERAVTGLGSTATSLLCDVARELREPGTGGQPDRWAERAAHVRVQLDDALDAV
FT                   AWTDESARANMRRAAGPAAAGRKWKPAVVALSEGWPQCTEIVRATSLALAPQPPFGPLD
FT                   PEIRESAAAFVDALADVIRAEFAFADSRDAPVAACRTAEERLRNFEDAVSSHSGLTRGS
FT                   SMSAGSILRPSAAALSLLTGESPASPSGTGSVDGGGPGVE"
FT   gene            103391..103645
FT                   /locus_tag="RHA1_ro00097"
FT   CDS_pept        103391..103645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00097"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91933"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKK3"
FT                   /protein_id="ABG91933.1"
FT                   /translation="MNTHVTATHLQTLLDSPLPDPALILQGGAPTIVDSGELGDEHQSL
FT                   IIVTRTELREQLPQDRNCSQSDLEFHAASLESTVAGLGG"
FT   gene            complement(103656..104453)
FT                   /locus_tag="RHA1_ro00098"
FT   CDS_pept        complement(103656..104453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00098"
FT                   /product="sigma factor, sigma 70 type, group 3"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_function: GO:0003899 - DNA-directed RNA
FT                   polymerase activity; GO_function: GO:0016987 - sigma factor
FT                   activity; GO_process: GO:0006352 - transcription
FT                   initiation; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00098"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91934"
FT                   /db_xref="GOA:Q0SKK2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKK2"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91934.1"
FT                   /translation="MSPVSERGERHRPGRDDYKDVAPTVARLRALDASSGEASALRDEV
FT                   ITRCLPLADHIARRFGGRGEAHEDLLQVARLGLVKAVDRFDPDRGFDFVSYAVPTIMGE
FT                   VRRYFRDTGWSMRVPRRMQELHALITKAVDELSQELGRSPSASEIAAQLELDVREVSEG
FT                   LLAKNAYQTLSMDAAMGDDPDDLPLAETLGEEDPELANVESHAAVRPALQKLPPLERRV
FT                   LMLRFFGSMTQTEIAQRVGVSQMQVSRILARTLSGLRAQLGDG"
FT   gene            complement(104453..104884)
FT                   /locus_tag="RHA1_ro00099"
FT   CDS_pept        complement(104453..104884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00099"
FT                   /product="anti-sigma factor, possible RsbW"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00099"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91935"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKK1"
FT                   /protein_id="ABG91935.1"
FT                   /translation="MAEVDEVRRMRTRSGVPVELRVAAEFEQLPVVRAVAETLAVLGDF
FT                   TLDDVADIKLAVDEVCSELIAAAPGSAELTCSFVVTEPGLHVTISAPLTRGGVPNRESF
FT                   GWHVLETLMNAVSVSEGPVGNGSVERTVAVELVKYRGTI"
FT   gene            complement(105031..105390)
FT                   /locus_tag="RHA1_ro00100"
FT   CDS_pept        complement(105031..105390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00100"
FT                   /product="cold shock protein"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00100"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91936"
FT                   /db_xref="GOA:Q0SKK0"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKK0"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91936.1"
FT                   /translation="MRTPRRSNAQRGSACGSARCESGGRRCAPRPGRSKGGTMSAGHTL
FT                   PARQSTALRTGTVRWFNAEQGFGFLAPADGSDDIFVHVSEIAGDGHRILEEGQRVSFAV
FT                   CRTETGDQARDVRIA"
FT   gene            105754..106293
FT                   /gene="dps"
FT                   /locus_tag="RHA1_ro00101"
FT   CDS_pept        105754..106293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dps"
FT                   /locus_tag="RHA1_ro00101"
FT                   /product="DNA protection during starvation protein"
FT                   /note="GO_component: GO:0009289 - fimbrium; GO_function:
FT                   GO:0003677 - DNA binding; GO_function: GO:0008199 - ferric
FT                   iron binding; GO_process: GO:0006879 - iron ion
FT                   homeostasis; GO_process: GO:0006950 - response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00101"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91937"
FT                   /db_xref="GOA:Q0SKJ9"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ9"
FT                   /protein_id="ABG91937.1"
FT                   /translation="MSKFTVPGLSDDQGARVADILQKRLSAYNDLHLTLKHIHWNVVGP
FT                   NFIGVHEMIDPQVELVRGYADAVAERIAALGNSPDGTPAAIARDRTWDDYSVKRDTAQA
FT                   HLGALDLVYSGVVGDNRKAIAETGDLDPITEDLLIGQTGELEKFQWFVRAHLENSGGSL
FT                   SNNGAHSEKQAAAQAR"
FT   gene            106333..106569
FT                   /locus_tag="RHA1_ro00102"
FT   CDS_pept        106333..106569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00102"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00102"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91938"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ8"
FT                   /protein_id="ABG91938.1"
FT                   /translation="MADNNSGPAEAVKGVVEDVKGKAKEAAGAVSGQDDLTREGKAQQD
FT                   KAAAQREAAAKEAEAEKARGKAEAQEARQRAEQ"
FT   gene            106670..106948
FT                   /locus_tag="RHA1_ro00103"
FT   CDS_pept        106670..106948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00103"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00103"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91939"
FT                   /db_xref="GOA:Q0SKJ7"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ7"
FT                   /protein_id="ABG91939.1"
FT                   /translation="MLGLGILGWIIIGGLAGWIGSKIMKTDAQMGIILNIVVGIVGGLL
FT                   GGFILRLFGTDVEGGGLWFSFFTCLLGAVILLFLVKLVTGRSTAGRR"
FT   gene            107026..107589
FT                   /locus_tag="RHA1_ro00104"
FT   CDS_pept        107026..107589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00104"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91940"
FT                   /db_xref="GOA:Q0SKJ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ6"
FT                   /protein_id="ABG91940.1"
FT                   /translation="MASTPAVGYSWGMDSRGPARDDANWNFRARHETETQRLDRNWSGL
FT                   LQELRVVQTGVQLLTGFLLTLPFQQRFEDLSDSEVAIYLATVALSVTSTMLLVAPAGLH
FT                   RMLFRRHALPDLVSASHRLAICGIATLALALIGVVALIFSFVISPIAGVVAAAVALAMF
FT                   CGLWVFAAILRSRHRSTDGDSADR"
FT   gene            107669..108112
FT                   /locus_tag="RHA1_ro00105"
FT   CDS_pept        107669..108112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00105"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00105"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91941"
FT                   /db_xref="GOA:Q0SKJ5"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ5"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91941.1"
FT                   /translation="MTDIHRGDTPRVQPPGAAHDLDDLSTVQLVERLTDQVTGLVRTEM
FT                   THALTEVKDKGTRFGIGAGVSGAGVLLLLSGFGALVATAILGLATALDPWLAALIVAAV
FT                   LIVVGSVVAAVGARRAKNALPPVPARTANSVRADVDTVKEGLR"
FT   gene            108548..108871
FT                   /locus_tag="RHA1_ro00106"
FT   CDS_pept        108548..108871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00106"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00106"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91942"
FT                   /db_xref="GOA:Q0SKJ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ4"
FT                   /protein_id="ABG91942.1"
FT                   /translation="MTYQPDNGPSRELNSEHHPQDDAHTMRNHAGEAITDSRNWPGYIL
FT                   IAAGIAVLGLTLVAAGYGFEGWALIGGIACVLCLVVGTGLVLLERRRVKALEGRELTDQ
FT                   EGH"
FT   gene            108868..109449
FT                   /locus_tag="RHA1_ro00107"
FT   CDS_pept        108868..109449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00107"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00107"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91943"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91943.1"
FT                   /translation="MTDPKVDLHQYLQAARDALLWKLDGLSEYDIRRPMTPTGTNLLGL
FT                   VKHLTGVEIGYFGETFGRSVEYPPWVTGAAEDNVDMWATPGESREYIVGQYRTAWAHAD
FT                   HTIRALPLDAPGRVPHWPGDRRDVTLHRILVHVIAETHRHAGHADIVRELVDGTVGMRA
FT                   DNTNVPAEDRMWWETYRTRLERAAREAGQG"
FT   gene            complement(109457..111190)
FT                   /locus_tag="RHA1_ro00108"
FT   CDS_pept        complement(109457..111190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00108"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0016787 - hydrolase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00108"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91944"
FT                   /db_xref="GOA:Q0SKJ2"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ2"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91944.1"
FT                   /translation="MERRVSARKVAHRRRIAGSLIAPGALGLAALLATPWSNPGSPATT
FT                   ATALTAAASDACYDMVSIAVAGRGDTPRDGTRMLVAPDGTRLPASYSSDYSSPWIDEVV
FT                   NAPQQSVGGGSYAAVYIEYPANMNSYEDAVNAGVDNTETVMRSIHASCPDTKFSIVGYS
FT                   EGADVARRVAMEVGNQDGRDGSYDILDPAAVVGVVILADAGRNLGGGPFPGSENEFRNP
FT                   DGFDLAYQSGQKGTSGRGALPGTSGSFGALDGKVASFCSEGDLTCSAPENIALLQLAIN
FT                   VGRQLNVDSLQKDGLTPATGQDLAVVLGQIALAAFADIQSQGDWMQSDETFLDVLIKVS
FT                   DPAYKPDSGAAQSDTSTGPISSNQAVDLVYLPAKVRNEIIGFIADNQNTIQVAMSDPYQ
FT                   QTLGEGTGHHFDYWRDANAGSGKPLTSAQYAAAWLTHLAQEAEKGESRAAAAEASTAKL
FT                   ASASTKETETEAARVAPTTTDSAKKAQLAGNPVSATTTTSSSPTPTTTVATTTSPEPTT
FT                   AVEVAAETTTSVSAPQAVAGTPDTSVVTTTAAEPTTTTESESPTTTTPVVTTTTLQPAA
FT                   G"
FT   gene            complement(111306..111737)
FT                   /locus_tag="RHA1_ro00109"
FT   CDS_pept        complement(111306..111737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00109"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91945"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ1"
FT                   /protein_id="ABG91945.1"
FT                   /translation="MHQRGVNRRRKTRDVRSILPERQRPLERRGVEVGRVRGAGGDHRR
FT                   RRHPYSRGAKGCGVYRRWSGTGVSRRRFAQALVREMPHTLALLQTGRLNEWRATLLVRE
FT                   TACLSAADRAIVDRRLCSDPAAARDSAVETLLITHLRAS"
FT   gene            111753..112478
FT                   /locus_tag="RHA1_ro00110"
FT   CDS_pept        111753..112478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00110"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent; GO_process: GO:0007600 -
FT                   sensory perception"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00110"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91946"
FT                   /db_xref="GOA:Q0SKJ0"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKJ0"
FT                   /protein_id="ABG91946.1"
FT                   /translation="MPNGPSEMTHTGGDAPSAVFARLAEMVYDGDDFTQVYQAICDAAA
FT                   TLVPGCAHASLMLKENDRHVTVAASDDIAAQVDALERAEQEGPCLDAIENDAPQVESEL
FT                   ARSTQWPRLARRAIAETPVRGAAGFRLMIRGRKVGALNLFSDNAGEFTDKSIDQAILIT
FT                   AFAAVTLTALHEHQEAQTLREGLASNREIGKAIGLLMAFHDISEGRAFDLLRKTSQDMN
FT                   IKLTGVAREVIAHHNSKFD"
FT   gene            112600..113136
FT                   /locus_tag="RHA1_ro00111"
FT   CDS_pept        112600..113136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00111"
FT                   /product="possible anti-sigma factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00111"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91947"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKI9"
FT                   /protein_id="ABG91947.1"
FT                   /translation="MDRYCVRSHCGLGAVALLAAHGLAQSARDRRVMKLLRTSFRVTPR
FT                   TARATRHRTRNAHTNNSRVRMAVEFAPDATVGRISGDIDVLAAPSFALALAHLIDRTSS
FT                   RIIVDMTAVDFVGTSGLSILSEFAESARRQHITWALAGNRAVLRPVEAIGLDAMIPTCR
FT                   TVRDAFDTVEKIAHG"
FT   gene            113149..113472
FT                   /locus_tag="RHA1_ro00112"
FT   CDS_pept        113149..113472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00112"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0004518 - nuclease activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00112"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91948"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKI8"
FT                   /protein_id="ABG91948.1"
FT                   /translation="MSGRQPPRGHPTASVAETVRVLLDTAGPTYVSESHVTLKDTPTFL
FT                   FQLLSPAHRRTSISALGRAGYVRYDGSTATRLHAAAVRVDDEYGGDLRRPARACDQETS
FT                   ATS"
FT   gene            complement(113665..114009)
FT                   /locus_tag="RHA1_ro00113"
FT   CDS_pept        complement(113665..114009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00113"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91949"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKI7"
FT                   /protein_id="ABG91949.1"
FT                   /translation="MTHVTQLLRRGTPTHDPHHGAPGRPAHNVAALCRGAAAPPHAPSD
FT                   RIHRLCLGGNRNCAGRRRDGIRPRRRRHLRVSARRCSTRRAPDLTVHLADAPFDHHAAL
FT                   AGAEDRKHFT"
FT   gene            114072..114644
FT                   /locus_tag="RHA1_ro00114"
FT   CDS_pept        114072..114644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00114"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91950"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKI6"
FT                   /protein_id="ABG91950.1"
FT                   /translation="MCRPKGSSSNGGAVDRPSRKATIEKIRAGMSRSRARLRPRSEHGQ
FT                   NGPYRTKESTMAKYLLLGHYRGAPASVNDVAMDQWTPEEISAYVQYMNDFAARLESTGE
FT                   FVDSQALSPEGTFVRYDGEGRPPITDGPFAETKDLIAGWMVIDVETHERALELAGELSA
FT                   APGADGKPIHEWLGVRPFLAVSPTATE"
FT   gene            114651..115796
FT                   /locus_tag="RHA1_ro00115"
FT   CDS_pept        114651..115796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00115"
FT                   /product="probable sigma factor, includes region 2"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_function: GO:0003899 - DNA-directed RNA
FT                   polymerase activity; GO_function: GO:0016987 - sigma factor
FT                   activity; GO_process: GO:0006352 - transcription
FT                   initiation; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00115"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91951"
FT                   /db_xref="GOA:Q0SKI5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKI5"
FT                   /protein_id="ABG91951.1"
FT                   /translation="MDDALLRTLTPTVIGVLVRRGADFAAAEDAVQDALIEAVRAWPDD
FT                   PPRDPRGWLVTVAWRKFLDATRSDSSRRYREARVDAEPSPEPGEAVDDTLQLYFLCAHP
FT                   SLTPASAVALTLRAVSGLTTRQIAQAYLVPESTMAQRISRAKRTVSDVRFNQPGDVATV
FT                   LRVLYLVYNEGYGGSIDLAAEAIRLTRQLAAKTDHEEVAGLLALMLLHHARRPARTRTD
FT                   GSLVPLAEQDRSLWDTRLIAEGVVVLQSALDRDRLGEFQAQAAIAALHADARTSAETDW
FT                   VQIVEWYDELVRLTDSPVARLNRAVAVGEADGARAGLAALSGLDPTLPRYSAAAAYLHE
FT                   RDGDPVTAAQLYAEAARSAPNLPERDHLTRQAARLNAQLRS"
FT   gene            complement(116172..117194)
FT                   /locus_tag="RHA1_ro00116"
FT   CDS_pept        complement(116172..117194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00116"
FT                   /product="possible resolvase, N-terminal"
FT                   /note="GO_function: GO:0000150 - recombinase activity;
FT                   GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006310 - DNA recombination; GO_process: GO:0045449 -
FT                   regulation of transcription"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00116"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91952"
FT                   /db_xref="GOA:Q0SKI4"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKI4"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91952.1"
FT                   /translation="MSQQPCSHDFRYAQSVELGYARVSTSKQDLDRQIDALTKAGIEQA
FT                   NIYVDKKSGTTTDRPGLQALLGYARPGDVIVVHTLDRLGRTVRDTLNLIHDLHQRGIGF
FT                   RNLADPIRIDSTNPDDPMGQLAVVLLALFGQMERTYAVERAAHARTVATAKGRRTGRPS
FT                   VVTDAQLAYATQLREGGATVAEITAQTGLTRSTLYRHLPPRETDPVTAATASTGGIRTG
FT                   SASTVSAGQPRAERGTLVCPTCGHRPATRSEAIPHRDDLATIWLQLDERRRRVREQHHC
FT                   ARCQPHDHVLVISCSRCGDGPLVTGIDPASTQPPQPILDWLEHHGWTTTPELVCGNHRR
FT                   "
FT   gene            complement(117414..117848)
FT                   /locus_tag="RHA1_ro00117"
FT   CDS_pept        complement(117414..117848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00117"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91953"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKI3"
FT                   /protein_id="ABG91953.1"
FT                   /translation="MNITTLVLEKSRVVVQWREDGMSYVAREEDLPRLEARPDTIGSIW
FT                   HPPFTERQVVGFEEAPPGDLDRPSWWAMYGYADPEVQVTVTVDDQPDPIVHRIGLVWAC
FT                   EWISYPTRAHVHRSDWDTPDLIRFIRPEFLPPAPYPEHVR"
FT   gene            complement(117896..119854)
FT                   /locus_tag="RHA1_ro00118"
FT   CDS_pept        complement(117896..119854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00118"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003824 - catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00118"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91954"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKI2"
FT                   /protein_id="ABG91954.1"
FT                   /translation="MARVTKYLNLPRPKRASPAKTLILASLASVLFATGGGIAAAQPTT
FT                   TPTPTPSTTTTTPTSPTPTETTAERVTPSSTVPSSPPASPSGTVPAVESTPEASAAPDV
FT                   TTPAPSGSAQTDSSAPTTTPSESTTPSSAPANGKKIPYTGLPTENPNATIVPGKMRSDR
FT                   EELPEGFTKEDADKAEMKEAELQKQASGLRAAVAPGCQVYWPSDFQVCGAIRDKYNSLG
FT                   AQFSFLGFPTTNELTNPDGFGRRSVFVNGPIYWSAASGAHPVVNHFFAAWQRNNWETGP
FT                   LGYPTTDEIVNPDGLGRRQEFQNTAAIYWKLNEAWAIRGAIRDKWNTVNAERPGSLLGY
FT                   PLSDEIVLPDGQGRMNRFERGVLYWHPSHGAHPVVSGILDQWTASGYETGAYGYPTADE
FT                   VTLQDIARQQQFQNGILYSPKRVAADAAYKDYMQAPAAAQCAAPLGSRVGAWTCTKAGG
FT                   AAAALPAPPQFNGPGEYCDVNFGGCWNVYDDFRADYQGDVVFGAGPQIIGNGSVVVEWK
FT                   LAGPYTQITRATVSSNDAVMGRVVFAGALQNGAVGVANGGSLIHSTQPQFAPGPHMTGR
FT                   AVGLPNPSGMELEDRRMRDHNYVVQISVEFSEWPGYWYFYVRSPVAHYDDDDPNDIYRF
FT                   MGADQLPGNPVGGDWKW"
FT   gene            120244..120813
FT                   /locus_tag="RHA1_ro00119"
FT   CDS_pept        120244..120813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00119"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91955"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKI1"
FT                   /protein_id="ABG91955.1"
FT                   /translation="MELVPQPPPDDDEFVYELTERQRRAIMATAAVLAATAYGDTEALG
FT                   DQVIESEDHGSLLAALPPCTWGQDASWRRQMARAFDDLAGDITAGTDPEPTCTGEEMAL
FT                   HIILTRASSDHLAGHLDQMLAKAPAHDNDTDWAAPTSFLFQDHDVLTLYDEDGVPVRDG
FT                   VNLEPEDWFLPFGDAVARDPGRGFRF"
FT   gene            complement(120928..124050)
FT                   /locus_tag="RHA1_ro00120"
FT   CDS_pept        complement(120928..124050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00120"
FT                   /product="transposase"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0004803 - transposase activity; GO_function: GO:0005351
FT                   - sugar porter activity; GO_process: GO:0006313 - DNA
FT                   transposition; GO_process: GO:0009401 -
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00120"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91956"
FT                   /db_xref="GOA:Q0SKI0"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKI0"
FT                   /protein_id="ABG91956.1"
FT                   /translation="MASIDRTAYPRFSRMVSVGELAEAFTPSVEEVEWARGRTRDAQHL
FT                   LVLLVWLKSFQRLGYFPKLVDVPEVVAAHLCGVLELPAGTVLVQDAERTAKRHRQWVRD
FT                   RLGVTYEPARVRDIAERAIRDAVQTKDNPADLINVALEELVRTRCELPGFTTLDAMAST
FT                   IRAEVNTALFTKVAGRLGPADRSRLGRLLLVDPITRRSEFDRVKDTAKAASLGKFKARL
FT                   DYLRQLDDLGPTEVWLADVPPGKVAHFAGEAKVTDVADLRKVGEDKRITLVASLLHTAR
FT                   AGARDEVVTMFCKRMAALHKKGREHLEALREEHRAESERLLGVFGDVLTAVREALDPTT
FT                   GDGRPDIRPGESADAGAASARPMEAVAEQAGRLVLKTLARAGGMDALVGAHEAVTAHHG
FT                   NNYLPLLERHYRSHRSALFTLLDCLELEATSADRSVLDAVEFLRAHRNTRANLIPEHVT
FT                   VEQPGADGAPSTVTLTIDVGVFASAAWRKILRDRDRPGLLVRRHLEVCVFSALAAELRS
FT                   GDVAVAGSDSFANLHAQLMSWDECAPLVPAFCAQAGIPAEASALTAFYREKLTATAAAV
FT                   DAGYPGNTDLMLEDGRPVLRRRKGADRCPEALALERAIHDRLPHRALLDILTRTAFLLC
FT                   WHRHFGPASGSDPKIRDALGRYVLTVFAHGTLLGPSQVAAHMRGQVSVHELSLAGNKHT
FT                   TATKIDQASTVVVNAFHRLDVAGMWGDGKVAAADGTQVETWENNLLAESHIRYGGYGGI
FT                   AYRHISNTYIALFSHFIPCGVWEAVYIVEGLLRNDSDIQPDTVHADTQGQSLPVFGLAT
FT                   LLGFDLLPRIRNWHDLTFYRPDPRSRYQHIDRLFGDESIDWDLIETHWEDLLRTTISIR
FT                   EGRLSSVTLLRRLGNHSRRNRLYRAFRELGRVIRTITLLRYLSEPQLREQITAITNRNE
FT                   AFHGFADWLMFGGKLIGHNDPDHQEKAIKFNELIANCVIYSTACDITDAANEIAADGEP
FT                   VDPDDLATIAPYITHTVRRFGNWVINLTPPEQTPTTRLDLEPRVLFRAAPA"
FT   gene            complement(124505..125488)
FT                   /locus_tag="RHA1_ro00121"
FT   CDS_pept        complement(124505..125488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00121"
FT                   /product="probable magnesium and cobalt transport protein"
FT                   /note="tc: 1.A.35; GO_function: GO:0015082 - di-,
FT                   tri-valent inorganic cation transporter activity;
FT                   GO_function: GO:0046873 - metal ion transporter activity;
FT                   GO_process: GO:0030001 - metal ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00121"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91957"
FT                   /db_xref="GOA:Q0SKH9"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKH9"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91957.1"
FT                   /translation="MDVRFISRDDVRSCAVTELRALLDRPDGLVWVDVPTWDEQANDAL
FT                   TTIFGFHPLAVRDSMNRNQVPKVHRYEDHFFVVLHAPQSGAHGHVHYVELDQFIGGRYL
FT                   VTVHGPVNPAIDPATAMVEVNAVLGRLKSGKLQPSNAFELSFAVLAALTARMRAYTAEL
FT                   TKDVWKLEQQVTGGHLGNPETFLDEMFRVRHGLLTVGTMAALSREVYGRMVTIEAFGAG
FT                   KGQDLLLDAVDQFQHLTVMAKGQKDYLQGTIEFYQARTNTKMTIAAERLAVIAAVTLPI
FT                   TALSSIIGMNVIVNERTQWLSVAAIVLVMLAMSGALLVWAKRKGWF"
FT   gene            125574..125984
FT                   /locus_tag="RHA1_ro00122"
FT   CDS_pept        125574..125984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00122"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00122"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91958"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKH8"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91958.1"
FT                   /translation="MVDDKIALVVVDAANVVGSRPDGWWRDRAGAARQLLAKLGTLEQR
FT                   LDRPAEVVVVLEGAAKAAVTGETNPEFEGLHVVSAPGSGDDAIVDVVAAAAEEDGDRPI
FT                   TVVTADRELRDRVEALGATTIGPRWLLDRINT"
FT   gene            complement(125981..127603)
FT                   /locus_tag="RHA1_ro00123"
FT   CDS_pept        complement(125981..127603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00123"
FT                   /product="probable dehydrogenase"
FT                   /note="GO_function: GO:0016705 - oxidoreductase activity,
FT                   acting on paired donors, with incorporation or reduction of
FT                   molecular oxygen; GO_function: GO:0050660 - FAD binding;
FT                   GO_process: GO:0006118 - electron transport; GO_process:
FT                   GO:0016117 - carotenoid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00123"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91959"
FT                   /db_xref="GOA:Q0SKH7"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKH7"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91959.1"
FT                   /translation="MTVRTVDAVVIGAGPNGLAATATLAEAGWDVVLLEQQPEPGGAVR
FT                   SAELFPGFRTDLFSAFYPLAAVSPAIRHLDLEGVGLRWSQAPAAVGHPRHPHDDDAPLI
FT                   HRDPTDTAADLERRQPGDGQAWLRLFEQWKDVKEPFLDTLFSPFPPVRGPRRLLSQLGT
FT                   AEALRLVRFLMLPARRMTHELFDGESARVLLLGNAMHADTPVDAPGSGVMGYLLTMLAQ
FT                   DDGYVVPVGGAGALSAAMAERARRNGAEIRCGEEVTSIEATGGVATEVRTAGGDRYLVK
FT                   RAVLADVSAPALYGRLLDSSVVPAGVRADLEKFEWDTPVVKVNYALDRKIPWRSRSLES
FT                   AGTVHLGADDNGLVRWMADLTTGVIPTDPFLLFGQMTTSDPSRSPEGTESAWAYTHLPR
FT                   GITDDESAELLAHRVDAMLESHAPGFAERVVGRNVQRPGDLEASNANLHGGAVNGGTAQ
FT                   LYQQLVFRPTPGSSGPYTSIDRLYLASSAAHPGGGVHGMCGYNAARAALADHGRWGLVR
FT                   RKVRGRILDLVVTPDGKRSPHHR"
FT   gene            128130..128819
FT                   /locus_tag="RHA1_ro00124"
FT   CDS_pept        128130..128819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00124"
FT                   /product="hydrolase"
FT                   /EC_number="3.-.-.-"
FT                   /note="GO_function: GO:0008967 - phosphoglycolate
FT                   phosphatase activity; GO_process: GO:0005975 - carbohydrate
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00124"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91960"
FT                   /db_xref="GOA:Q0SKH6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKH6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91960.1"
FT                   /translation="MSAKSPSTARAVLFDVDGTLVDSNYLHVRAWQRAFREVGHDVDAW
FT                   RVHRAIGLDSSLLLQSLLGDDADELGDRAKDLHTTYYLGARDSMRPLSGARELIRELHG
FT                   RGVQVVLATSAPEEELDVLREILSVDSYIAHTTSSEDVDQAKPDPGVVRAAMDRASTSP
FT                   DTAVMVGDAVWDGKAASRAGVTFVGLLSGGISRADLTEAGAAAVFEDAQDLLDNLESSP
FT                   LAKLLVS"
FT   gene            complement(129081..130403)
FT                   /locus_tag="RHA1_ro00125"
FT   CDS_pept        complement(129081..130403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00125"
FT                   /product="NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /note="GO_function: GO:0003954 - NADH dehydrogenase
FT                   activity; GO_function: GO:0015036 - disulfide
FT                   oxidoreductase activity; GO_process: GO:0006118 - electron
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00125"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91961"
FT                   /db_xref="GOA:Q0SKH5"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKH5"
FT                   /protein_id="ABG91961.1"
FT                   /translation="MTNESAGEPTRIVVVGSGFAGFECARALTRRLRGTDTRITLISAH
FT                   DYMLYTPLLPEVAGGILDARFVTVPLAEALPNVELVKGNVDSVDFEARTVHVTDCEHGV
FT                   EDVAWDRVVLTPGSVTRLFDIPGLAEHARGLKTPAEALYFRDQLLTQIELAERDTDPSV
FT                   ADARRTVVVVGASYAGTELTAQLRALADEAAARRNLDPAKIRFLLLDAADTVMPEVGEK
FT                   LGGKVLDVLRSRGIDVRLETTLTELGPEHVTLDDGTVIPTRTVAWVTGVTASPLIDTLG
FT                   LPTEKGRLTVRPDLSVDGHPDVFAGGDAAAVPDPRNSGSITPPTAQHAVRQGQTLARNV
FT                   AASLGVGDPKPYGHRDMGLVVDLGPGFAVANPLGIQLSGFLAKVVTRAYHLYAMPNTAN
FT                   RWAVALAYLTDLLFPRPLVSIGLVTDSESRFAAGEGVGAQH"
FT   gene            130535..130804
FT                   /locus_tag="RHA1_ro00126"
FT   CDS_pept        130535..130804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00126"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00126"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91962"
FT                   /db_xref="InterPro:IPR025329"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKH4"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91962.1"
FT                   /translation="MSAVSKAMYKPLALAASVAGGIAASALFGQVWKRVAGEAEAPDPK
FT                   DLSRSTREVLIAAAVQGTVFGLVKAAVDRAGAQGYRKLAHDDPR"
FT   gene            130844..131491
FT                   /gene="phoU1"
FT                   /locus_tag="RHA1_ro00127"
FT   CDS_pept        130844..131491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU1"
FT                   /locus_tag="RHA1_ro00127"
FT                   /product="phosphate transport system protein PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00127"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91963"
FT                   /db_xref="GOA:Q0SKH3"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKH3"
FT                   /protein_id="ABG91963.1"
FT                   /translation="MRTRFAENLDSLSGDLASMCRLSVTAMSEASDALLQADLELAEHV
FT                   IDVSGELDDAAAHWEKRAFALLALQAPVAHDLRFMVGGLHISADLHRMGGLAVHIAKIA
FT                   RRRHPDHVVPDEVLGVFTEMGAVAVAQAKETEQVLQHRDPERARGLLTADEAMDDLHRS
FT                   LFTITQAEDWPHGVQSAVDITLLGRFYERFCDHTVEIGRRVIFLETGSLPEQ"
FT   gene            complement(131505..132119)
FT                   /locus_tag="RHA1_ro00128"
FT   CDS_pept        complement(131505..132119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00128"
FT                   /product="probable methyltransferase"
FT                   /note="GO_function: GO:0008757 -
FT                   S-adenosylmethionine-dependent methyltransferase activity;
FT                   GO_process: GO:0009312 - oligosaccharide biosynthesis;
FT                   GO_process: GO:0009877 - nodulation"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00128"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91964"
FT                   /db_xref="GOA:Q0SKH2"
FT                   /db_xref="InterPro:IPR008715"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKH2"
FT                   /protein_id="ABG91964.1"
FT                   /translation="MSAMDPGYFETMYAESADPWGFDERWYERRKYALTLAALPRPHYR
FT                   RAFEPGCSIGVLTVHLARRCDRVVATDVVPRALESARDRLRREGVADRVELGRASLLDP
FT                   WPPGAFDLVVLSEVLYYLTPADLATTLGRAVDALEVGGTLVAVHWQHPVPEYPQTGRAV
FT                   HETVAATDGLHRAGSYQDADFHLDVYTRGPVPSVAAAEGLS"
FT   gene            complement(132116..132889)
FT                   /locus_tag="RHA1_ro00129"
FT   CDS_pept        complement(132116..132889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00129"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00129"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91965"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKH1"
FT                   /protein_id="ABG91965.1"
FT                   /translation="MDNGTRFREISVAARGTPEDEWQSWLESTRFLPVPLAECDRLVVV
FT                   APHPDDEVLGVGALMATAAAAGIPVVVVAVTDGAASHPDSPTLSPDALAVARIAESTQA
FT                   TALLGAGEPLRLGIPDGGVSAHEHELTTRLVDVLTATSGAGERVWVLATWRDDGHPDHE
FT                   ATGRAAAAACSITGHRLIEYPVWMWHWARPADPAVPWNRIRVLTPAAEILARKRGAVDE
FT                   FRTQILPLSEDPRDAAILPPWVLARLMRTTEWVLW"
FT   gene            complement(132892..133857)
FT                   /locus_tag="RHA1_ro00130"
FT   CDS_pept        complement(132892..133857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00130"
FT                   /product="probable acyl-CoA dehydrogenase"
FT                   /note="GO_function: GO:0003995 - acyl-CoA dehydrogenase
FT                   activity; GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00130"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91966"
FT                   /db_xref="GOA:Q0SKH0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKH0"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91966.1"
FT                   /translation="MSTDVTHDSSPTDAAVRAIIGSGDAELPLPGGGSTAARWARLTQW
FT                   CRHDLSVGRLLEAHADADAILAEVDGTRAGRNEFWGVWASEPPHPVLHASHDAAGWRLR
FT                   GTKAWCSGASMCTHALVTARVDEQPRLFAVDLREPGVTAGRGGWRNPGMAATDTESVTF
FT                   DGVPARPVGAPDEYLDRPGFWHGGIGVAACWFGGALAVAEPLRVRARSGRTDGHQLAHL
FT                   GAIDVAVSAARWALESAAGEVDANPLDRRSAQVRAFRVRALIERTASEVIDRVGRALGA
FT                   APLATDADHARNVADLLVYIRQSHAERDLAALGALVAGED"
FT   gene            complement(133854..134519)
FT                   /locus_tag="RHA1_ro00131"
FT   CDS_pept        complement(133854..134519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00131"
FT                   /product="probable glycosyltransferase"
FT                   /note="GO_function: GO:0016740 - transferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00131"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91967"
FT                   /db_xref="GOA:Q0SKG9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKG9"
FT                   /protein_id="ABG91967.1"
FT                   /translation="MRVEHITVVVPAHDEEALLPRCLEGLHTAARAVSVPVTTVVVLDG
FT                   CTDGSEAVVRRAGVDVVILGARNVGAARRAGFESVAPRPHEWFATTDADSRVPAHWLSS
FT                   HLQHARRGAQLVAGTVAVTDWSGWPDHVRSRYGSAYRSGSAHGHVHGASLGFSADLYRA
FT                   AGGFAALPAHEDVDLVQRMVERGANVVWSIDAPVETSARADARAPQGFATYLEGLQDR"
FT   gene            complement(134575..135066)
FT                   /locus_tag="RHA1_ro00132"
FT   CDS_pept        complement(134575..135066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00132"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0001760 -
FT                   aminocarboxymuconate-semialdehyde decarboxylase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00132"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91968"
FT                   /db_xref="GOA:Q0SKG8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKG8"
FT                   /protein_id="ABG91968.1"
FT                   /translation="MAPLVCGFDPTDRPRGRIEFVWNRTGRWAGVGEVMFRHDDLTSLT
FT                   VGEVPSPDHAAMDDVLDFCSEKEVPISIHHDSASMGLPGRHEYIGALERALERHRSTSV
FT                   VWCHAGVSRRVGPNGQLDLVRELLLRHPNLTVELSWVLLDRIVDGPDVAVGNAERSWFP
FT                   "
FT   gene            135332..135859
FT                   /gene="xdhC"
FT                   /locus_tag="RHA1_ro00133"
FT   CDS_pept        135332..135859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xdhC"
FT                   /locus_tag="RHA1_ro00133"
FT                   /product="xanthine dehydrogenase Fe-S binding subunit"
FT                   /note="GO_function: GO:0005489 - electron transporter
FT                   activity; GO_function: GO:0005506 - iron ion binding;
FT                   GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00133"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91969"
FT                   /db_xref="GOA:Q0SKG7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKG7"
FT                   /protein_id="ABG91969.1"
FT                   /translation="MNVADSPRYRKITLTVDGEERNLEVDTRTTLLDALRDHLGVTAPK
FT                   KGCDHGQCGSCTVLLDGRRSTSCLTFAVAHHGERVVTAHGLADGEVLHAVQQAFVEQDG
FT                   LQCGYCTPGQICSVIGMLDEFLALHPSAVTENLTAPPELTDDEIRERMNGNLCRCGAYP
FT                   NILAAIRQAAEA"
FT   gene            135856..136848
FT                   /gene="xdhB"
FT                   /locus_tag="RHA1_ro00134"
FT   CDS_pept        135856..136848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xdhB"
FT                   /locus_tag="RHA1_ro00134"
FT                   /product="xanthine dehydrogenase FAD-binding subunit"
FT                   /EC_number="1.17.1.4"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00134"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91970"
FT                   /db_xref="GOA:Q0SKG6"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKG6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91970.1"
FT                   /translation="MIPFDYERATDVDSAVATVTGDPRASFLAGGTNLVDHMKLGVARP
FT                   HLLVDVSRLPLGDVVELPDGGLRIGAAVRNSDLAAHDVVRARYPMLSRALLSGASGQLR
FT                   NLATTAGNLLQRTRCVYFQDVTTPCNKREPGTGCSAIGGYVRYHAILGASEHCVAVHPS
FT                   DMAVAMTALDGVVVVRGADGERRIPLSEFYRLPGDRPDRDTVLAHGDLVTAVELPPPPS
FT                   GNRSAYRKVRDRASFAFAVVSVAAELTIGDTSITSARVALGGVAHRPWRATLAEEVLVG
FT                   SPPTEATYTEAAAAELAAAQPLPGNEFKVALTRRVLASVLRSLAEEARR"
FT   gene            136845..138941
FT                   /gene="xdhA"
FT                   /locus_tag="RHA1_ro00135"
FT   CDS_pept        136845..138941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xdhA"
FT                   /locus_tag="RHA1_ro00135"
FT                   /product="xanthine dehydrogenase, molybdopterin binding
FT                   domain"
FT                   /EC_number="1.17.1.4"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00135"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91971"
FT                   /db_xref="GOA:Q0SKG5"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKG5"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91971.1"
FT                   /translation="MTLVDPKVIGTSAERLDAHDKVTGTALYAFEYPVDEPTYLHPILS
FT                   TIGRGRVTAMHTADAEALDGVLAVLTVFDAPRLADTSDGELAILQDAEVHFRGQFVGAV
FT                   VAESPEVARHGASLVRVDYDVESHDTDFRSGRGDLYTPEDVNAGFPTDTEDGDVDAALS
FT                   AAAVTVDQVYSTAMEHNNPMEPHAAIARWTPGGSGPVLTLHDSTQGVHSVRQTLAPLFG
FT                   LEVEQMRVIAPYVGGGFGSKGLPHAHDVLVVMAAQRVEGRPVKFALTRQQMFALSAYRT
FT                   PTVQHIRLGADADGRLTALSHEAVVQSAKIKEFAEQAAVPSRLMYSTPTRYTTHRLASL
FT                   DVPAPSWMRAPGETPGMFAAEVAMDELAEACGLDPIELRIRNEPEVDPSTGRPWSGRRL
FT                   TDCLREGARRFGWADRDATARARSDSQWQVGMGVASATYPANTSPGSVARIVYDSDGTY
FT                   TVQIGSVDIGTGAWTALTQIAADALGCPLDAIVLQIGDTNLPSATVAGGSTGTSSWGSA
FT                   IVAAARAFRDAHGTSPDPGAEARAGTPDNPDAEKFALHSFGAHFVEAHVHRDSCEIRVE
FT                   RMLGVFAIGRVINARTVRSQLLGGMTMGISMALHESSVNDPRFGHVVTQDLASYHVSTH
FT                   ADIRYLDAVCLDDVDEHANPMGSKGAGEIGIVGAAAAVANAVRHATGVRVRKAPIHLDD
FT                   LLPG"
FT   gene            complement(138952..139272)
FT                   /locus_tag="RHA1_ro00136"
FT   CDS_pept        complement(138952..139272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00136"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91972"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKG4"
FT                   /protein_id="ABG91972.1"
FT                   /translation="MTTQTTEEPEEAFGTDWLRLALRRCDLLAQMHSVSSDARWMISFA
FT                   IQWAPFGGASAAELLERFGVSRRRFMELVFEGLAPKSTDVQKIRAMKSHLRTSLAQAWG
FT                   VQ"
FT   gene            complement(139278..139739)
FT                   /locus_tag="RHA1_ro00137"
FT   CDS_pept        complement(139278..139739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00137"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91973"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKG3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91973.1"
FT                   /translation="MSCVDRGKPNGRRRGGAGIHGGDGMTTDGMTRWQGLAQKCELMIQ
FT                   RCLNCTTLLAPLMATCSACQGSNLERVPSCGVGSIVSSKVVHREVNETDRGLVPCTIAI
FT                   VELDEGPWVYTWIDGDVPAPSDCPVRVEFRPASTAEQLPVFAVRSAGQR"
FT   gene            complement(139944..142301)
FT                   /locus_tag="RHA1_ro00138"
FT   CDS_pept        complement(139944..142301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00138"
FT                   /product="possible protein kinase/ transcriptional
FT                   regulator, LuxR family protein"
FT                   /note="bifunctional; GO_component: GO:0005622 -
FT                   intracellular; GO_function: GO:0003700 - transcription
FT                   factor activity; GO_function: GO:0004383 - guanylate
FT                   cyclase activity; GO_function: GO:0004674 - protein
FT                   serine/threonine kinase activity; GO_function: GO:0004713 -
FT                   protein-tyrosine kinase activity; GO_function: GO:0005524 -
FT                   ATP binding; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent; GO_process: GO:0006468 -
FT                   protein amino acid phosphorylation; GO_process: GO:0007242
FT                   - intracellular signaling cascade; GO_process: GO:0042829 -
FT                   defense response to pathogen"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00138"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91974"
FT                   /db_xref="GOA:Q0SKG2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKG2"
FT                   /protein_id="ABG91974.1"
FT                   /translation="MRRGLRVESDGAMPAAVKGTVGNLPHELTSFVGRRREVTEARRLL
FT                   SVSRLVTLAGIGGVGKTRLALRVAADASRAFEDGVWLVELGELDDDTTLVDAVSAALRL
FT                   REQRSGNPEVLLTEYLATRQLLLVLDNCEHVVAAAAALSETLLRGCPELRILATSREPL
FT                   AIGGEAVLRVPPLTVPEPERSSLQGLPQYEAVTLFVERAATAVPEFELTEDNHVAVARI
FT                   CRQLDGLPLAIELAAVRLRVMSAEQILQRLTDRYRLLTVGSRGAPSRQQTLRLCVDWSH
FT                   ELCTEEERELWARLSVFAGGFELDAVEGICAGDLPVENVLDVVASLIDKSILIREESGP
FT                   AVRYHLLETVRDYGREKLQETGEYQSLRRRHRDWYEQLVVQCEAEWIGPRQAMWISRLD
FT                   AETLNVRAALHFCLTEPGEAETGLRIAAALYPYWRARGLLREGRRWLGQLLGRHPGGAS
FT                   RERIEALYVDSVLAGMHGDREAAKALVDEGVLLAERHGDTLMRALVVHAAGCCAMFAGD
FT                   LPRARVCFEEALAEFRDKGNLLQLTWGLLGVALVSGMQGDGAVAKMCGSEIFALTEAHG
FT                   ESVYRGWSLWAAGMAAWQRGHLALADDYVKQGLRLSHLVDDRISACGALEVLAWVAVGS
FT                   GRAQQAAELMGAAEAVAQTVGNPSTVYPNLLVHHAECEQQARAVIGDRAFDDAFDHGMR
FT                   TSFDDAVAHALDEQPPETVSASNGATHLTRREWQVAELVADGLTNKAIAARLVISQRTA
FT                   QGHVEHILAKLGFNSRTQIAAWIVEHAQDPHP"
FT   gene            complement(142377..143063)
FT                   /locus_tag="RHA1_ro00139"
FT   CDS_pept        complement(142377..143063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00139"
FT                   /product="probable short-chain dehydrogenase/reductase"
FT                   /note="GO_function: GO:0016616 - oxidoreductase activity,
FT                   acting on the CH-OH group of donors, NAD or NADP as
FT                   acceptor; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00139"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91975"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKG1"
FT                   /protein_id="ABG91975.1"
FT                   /translation="MHPSTRTAVVTGSDSPMGRAVALALADDGFHIGLAYAADRDSAEA
FT                   TAADVRSRSVNAAVQRMDLADLPDSAAAVDEFASELGGIGVLVSCPGSTAVECIQRAVR
FT                   YMIASGGGGRIVNVIPSSSGLGGLTGLLAAELARYSITVNSVVVPAVEPDFASPGPDDR
FT                   EVAAVASYLTAPAAMFVTGAAYVVDGTRIAMIPHSLTEAGMRRPARRANRIRSYTGRWA
FT                   PTRWTR"
FT   gene            complement(143183..144403)
FT                   /locus_tag="RHA1_ro00140"
FT   CDS_pept        complement(143183..144403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00140"
FT                   /product="possible lipase"
FT                   /note="GO_function: GO:0016787 - hydrolase activity;
FT                   GO_process: GO:0016042 - lipid catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00140"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91976"
FT                   /db_xref="GOA:Q0SKG0"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKG0"
FT                   /protein_id="ABG91976.1"
FT                   /translation="MKRSRISSLTAGALCAAFVACATVANVGVAAAVPIYPASDPDPFY
FT                   LQPQGLADTAVGEPLAVRPMPPLLAFPDTDVWQVKYRTTNSEDHPISSVTTVLVPRTRP
FT                   VNGPLLSYQHIINALGPRCAPSRTLYSNDPDLQIKEAPALNLALQRGWTVALPDHLGPN
FT                   SAYGAARLGGTITLDGIRAVQRVPELAVAESPVALAGYSGGGMASAWAAALAPTYAPEL
FT                   NIVGVAEGGVPMNIGKMANGLGMQPHPAFGLAMAAALGLEREYPDRLPISEQLNDRGLA
FT                   MRDEMVNACTNGILAAGAGRSATEVARTTDLMSSPQAWEVLNENSVELYPGVPTAPIFE
FT                   WHSPTDVLIPIDSIEATVARYCAAGAKVQSDLFPSPDHLTTAVLGLPTALDYLDARFRG
FT                   DPAPSNC"
FT   gene            complement(144521..171307)
FT                   /locus_tag="RHA1_ro00141"
FT   CDS_pept        complement(144521..171307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00141"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /EC_number="5.1.1.3"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00141"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91977"
FT                   /db_xref="GOA:Q0SKF9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF9"
FT                   /protein_id="ABG91977.1"
FT                   /translation="MTSVNSPQPNNGAEDVTVPEGAFPLSSVQRSMWFAQQLSPTVPKF
FT                   IAQYIELRGEIDLDLLSDAAVRAGQEFQSPFLRLLDVDGEPYQAVDFSIDPSIGFLDFR
FT                   GESDPMGAAQVWIDEDYATPLRLTRDRLVEMTVLQVGEQHYLWYTRIHHVALDGYSGMT
FT                   MVNRIAALYTAAVEGTEPEPNRALDLRDLYELDQKYRASSRFENDRLYWAERIVGIEHG
FT                   STLATHDAPAAAKSRLESAKISDTALGFLGESDQRVGATSAAVLLAGFACYLSRMTGKR
FT                   DVLINLPVSARTTAPLQRSGGMLVNVAPLRITVRPEDTVAELVQRTQLELMGALRHQRC
FT                   SLEDIRRDAGLAGTAEGLAGPMVNVMLFHQAFTLGTVTGEYHIVTSGPVDDLLVNIYQS
FT                   GDGQTLLDFRGNPNRYGSEELRAHHRRFVELVEEFVTAEPQTRTADIHAESARLGARFL
FT                   EREAQLAFWKRELAGLPEVAALPLDRPRPAERAGAGEVVGFAVDAEVQRRAALLAEEAG
FT                   TGIFTALHAALAVLLGRLGDTDDVVIGTPIVGREAADSDDPEAGAFFNKTVLRSQVDTA
FT                   SSFVDHLSRVRDADRAAFTHAALPFDDLVAALGAESDPSHTPLFQVMLEFTDGGHPHDS
FT                   SGNVTVSPIQREHRALGLDLVFSLTESESGGINGRLRFATDVWDRASAEALAARFVRIL
FT                   QTVTAEPTAPIGDVDLLEQVEYAELAPVRDEPSVEPRTLPTLLARAVEAGGDGDALVYQ
FT                   GRTLTYPELDAQSDRLARMLIGHGVGPGSVVALAIARSIESVLATWAVAKSGAAFVPVD
FT                   PNYPADRIEHMLTDSGAVVGLTVAAHRSSLPETTPWLVMDDASFGRDLAQHAAGTVADA
FT                   DRLRPLRTADPAYLIYTSGSTGTPKGVVVTHAGLANFAEDERQRFAVTAGSRTLHFSSP
FT                   SFDASILELLLAVGAGATMVVAPSTVYGGTELADLLSRERVTHAFVTPAALASVDPTGL
FT                   DHIRCVVTGGESCPPALVAQWAPGRVMFNAYGPTEATVVASVAGPLTVGEPVTIGRPSR
FT                   GCGLLVLDSRLHPVPRGVPGELYITGDGVARGYHNRSIPTAERFVADPHGAPGERMYRT
FT                   GDLARWNAAGQLEYLGRTDFQVKIRGFRIELGEIDAVVRSHPSVAFATTVGRTAPSGDT
FT                   VLVTYVLPEDGTDIVVGDILEHAAAALPAHMVPARVMVLREVPLTPAGKLDRKALPEPQ
FT                   FEATSTVYRAPVTPTEMQIAEVFAALLGVERIGVDDSFFDLGGDSLVATRVVSRVNAAL
FT                   STEIGVLDLFEAPSVALLSARVDALGPRTSARPVLAPRAGSGPVQVSLAQQRMWFINQL
FT                   DTASPAYNIPVGIRLRGTLDVEALRTAVSDVLTRHESLRTVFPNTPNGPIQVVLPVAEV
FT                   SPHLDAVEVAENELESRLIADAATGFDVTVEPPIRAELYRTATDDHVLVFVVHHIAADG
FT                   LSMTPLTRDVMVAYHARAAGDTPQWAPLEVQYADFAVWQRELLGSPDDPTSLLARQLAF
FT                   WARTLDGAPEVMDLPTDRPRPARQSMIGATADFSIPARIHAALLEIAGANDASLFMVVH
FT                   AALAVLLSRSSGSSDVSIGSPVSGRGERQLDDVVGMFVNTVVLRTTVDPDRSFPEILSH
FT                   TRSVDLAAFSNTDLPYERLVDELKPTRSEAHSPLFQVMLVLQGFANTRLELPGLDVEVE
FT                   ALETGAAKFDLQVILTEHTEESGAPGAIDVQFSYASELFDPPTMTALAERFVTLLETIT
FT                   AGSDAKVGDIDLIGADETHRMLEQWIDTDVAVPDSATLVSLFEAQVARTPDAVAVVFAE
FT                   EELLYAEFDARANRLARELLARGVGPESRVAVALRRSLELMIAIYAVEKTGAAYVPLDP
FT                   DHPASRIAYVIESAEPACVLTSSRDRCEGVDSAAGAAVIEIDTLNLSRRPSTPITAAER
FT                   GGPIHPDSTAYVIYTSGSTGRPKGVAVSHRAIVNRLLWMQDTYRMDHTDVVLQKTPVTF
FT                   DVSVWELFWPLEVGARLVLAAPDGHRDPTYLSHIIADHQVTTMHFVPSMLAVFTAGAEP
FT                   ELCGSLRQVFCSGEALPPATADAFREFGSAALHNLYGPTEAAVDVTYWECTEGDRASVP
FT                   IGAPVWNTQVYVLDSRLHPVPVGVHGELYLAGIQLARGYVGRSDLTSDRFVANPFGAPG
FT                   QRMYRTGDVVRWRADGNIEYIGRRDFQVKLRGQRIELGEVEAAVLAHPSVAQAVVTVHR
FT                   SEATGESLVGYVIPVAGADIDTAVVRDAAAEALPAYMVPTRIIVLDRFPLGATGKLDRG
FT                   ALPEPEFLSPSAEFVTPRNPIEEILASIFADLLDAPRIGVYDSFFDLGGNSLVATRLVA
FT                   RVNAALGSRIGVREIFDAPTVATLATRIESEAVQGAERPPLVAGARPDRLPVSLAQKRM
FT                   WFINQFDLDSPAYNIALAVRLTGDLDEDAMQDAVADVMDRHESLRTRFPMVEGEPVQVI
FT                   LPTEDVVPDLSPIATTEAELPEHISRLAGAGFDVTVSVPVRAALFRTDPGEHVLVIVVH
FT                   HISADGFSMAPLARDVMTAYAARTGGQAPDWTPLPVQYADFALWQHRVLGNADDPDSLL
FT                   AAQLDYWTHTLAGLPELLALPTDHPRPTQQSMRGGIHSFSIDPQVHSRLITTAREHNSS
FT                   VFMAVHAALAVLLARLGDTDDVSVGTPIAGRGDAALDDMVGMFVNTLVLRTPVEPAGTF
FT                   TDLLSTVRDTDLNAFHHADLPFERLVDAISPERATSHSPLFQVVLEFRNNERPRLELPG
FT                   LTVTGLDLATDISNFDLQLTLTEEFGASGEPAGISAAFTYASSLFDASTIAGFADYLQR
FT                   IFDAVTSEPGMAVGDIDLMVASERAALTPVMDGPDAEPRTLPELLAAAASVDPKAAALS
FT                   YEGREVTYRDLDERSNRLARLLIGRGIGPESVVALALARSPESVLSLWAVAKTGAAFVP
FT                   VDPNYPTDRIVHMLSDSGAALALTVAEFRPTLPDCTSYVVVDAPGFDDEVSAHSAAVVT
FT                   DADRTHPLALENPAYLIYTSGSTGTPKGVVVTHRGLANFATDERVRFGVTPRSRTLHFS
FT                   SPSFDASILELLLAVGSGATMVIAPASVIGGTELADVLREGRVTHAFITPAAMASVDPA
FT                   GLDQLECVATGGDVCPPELVAQWVTGGRRMFNAYGPTEATVVSSVTGPMIPGEGVTIGR
FT                   PPMGTGEMVLDSRLHPVPNGVTGELYVSGSGLARGYKDRAGTTAERFVANPYGGLGARM
FT                   YRTGDLARWNGAGQLEYLGRSDFQVKIRGFRIELGEIETALTRYPGVARSVVSAHRGST
FT                   GANRLVGYLVPTAGAELDPEAVLEFVGGFLAPYMVPSALIVLDELPLTPAGKLDRRALP
FT                   EPDFGARVSTGRAPVSEMEEVLAGLFAEVLGLESAGVEDSFFALGGDSIMSIQLVARAK
FT                   AAGVVLTPRDVFEAKTVAGLAAVASWVGAADVVVLDELPGGGVGDMPTTPITKWLLERG
FT                   GEFNRMSQSALLTAPPNLRELEPLSATFQAVLDRHDMLRAQLIVSAEDSHLAVRPVGEV
FT                   DAQDLIRRVPVSTAPGTRAFAATVIAELDAALDRLDPAAGVMVQVVWFDAGESGGRLLV
FT                   VAHHLVVDGVSWRILVPDLATAWAQISAGQEPVLEQVGTSMRRWAHGLVDEAASRAGEL
FT                   DLWQRILDCEDPLVGSRPLDPDIDVNATVGRVTVQLPAEVSEAVLTALPEAIHGSVNDG
FT                   LLTALAMAVTQWRRTRGHTLHGRSVDGTLVSLEGHGREDQVVPGADLGRTVGWFTAMFP
FT                   VRLDLSGIDLDDAFDGGKAAGSAIKAIKEQLLAIPDHGMGYGMLRYLNADTAPLLAARS
FT                   LPQISFNYLGRFAADLSEAATRAGWTPTGEVDMDRAQDLDTPVTSAIDVNAVTTEVEDR
FT                   PQLRATWAYAAGVLTVAEVRELAELWVRALTALTTYAARPDAGGVTPSDLELVSLDQDA
FT                   IDRIESRFPALSDIWSLSPLQSGLLFHALLADQTIDSYTVQVTLELRGAVPSRMRVAGQ
FT                   ALLDRHANLRASFVYDEGGTPVQAIHGSAELPWTEIDLSGLDAESREAEIVRLLDADRR
FT                   RGFDMATPPLLRFMLIQIGGDEQRLIITNHHILLDGWSMPLLIRDLLTLYATEGDATAL
FT                   PRVHPYRDYLAWMSHRSTEDSLGVWQRALAGVEEPTLLAPADASVQSDTQSSELLVELD
FT                   VDRTDQLSVLAREHGLTLSTLIRTAWGIVLGGLVGRSDVVFGGTVSGRPPQIAGIESMV
FT                   GLFINTLPVRVVLDPRETLGELLERIQGEQAALLDHHYVGLTDIQSVAGPGAGFDTLTV
FT                   FESYPVDREGLTDQTDIAGMHVLDVHDSANAAHYPLALIASAHENLQLKLEYVEELFDR
FT                   ADVERIGDRIVRALIALAEHPGMKLAQLRLLTDVEEAELVPARGLPGRSVRTLPQMFAE
FT                   TAAAAGDATALVFGDRRMSYRELDERSNQLARLLIDRGVGPEDIVALGISRSIESVLAV
FT                   WSITKTGAAFVPVDPTYPRERVEHMVTDSGCTFGLRLEADHGRLPDTVRWLTLDDTETA
FT                   TAIRAMSTDTVTDDDRVAPLRFAHPAYVIYTSGSTGKPKGVVVSHRGLDNFAEEQRTRY
FT                   ATDSTSRALHFSSPSFDASVLEYLLSFAVGATMVIVPPSVYGGEELAELIRTEGVTHGF
FT                   VTPAALASVDPEGLEVFQNVVAGGEAVPPELVTRWAPGRTMYNGYGPTETTIMSNLSDH
FT                   LQVGETVTIGAPVRGVSEVILDSRLQPVSVGVAGELYISGEGLARGYHARAGLTSERFV
FT                   ANPYGEPGDRMYRTGDLARWRSDHTVEYLGRTDFQVKIRGFRIELGDIDSALAAHPSVA
FT                   FAVTLGRPGPAGDTVLVSYVLPEAESALEPPELKEWTANLLPAHMVPSSIMILDEIPLT
FT                   PVGKLDRAALPEPQFLPTSDDFRPPSTVLEHTIADVITTVLGIERVGIDDNFFDIGGNS
FT                   LIATRVAARLTAELDTDIGVRTLFEAPTIHQLARLIESTAFAPAQDGAHVRIPLGPMPR
FT                   PAHVPVSLAQKRMWFLNQFDTSSAAYNIPLAVRLTGHLDVESLRAAVTDVFVRHESLRT
FT                   VFPSHDGEPTQVVLSPGQWTPNLEIVEVSEDELREHIAGLATAGFDVTADVPMRSALFA
FT                   LAPDDHVLVIVVHHICADGFSLTPLARDVMTAYAARIAGSAPQWNPLSVQYADYTLWQL
FT                   QLLGDESDAESLISQQLRYWTDQLADLPELLQLPTDRARPVQQSFRGAQVDFTIPADVH
FT                   RALAALARKHNSTMFMAVHAALSVLLSALSSTEDIAVGTPIAGRGDAALDDMVGMFVNT
FT                   LVLRSAVDPAAGFGALMDQVRSTDLAAFHHSDLPFERLVDVLAPERSTAHSPLFQALLE
FT                   FRNNETPRLELPELTAAAVDFDLEVAKFDLQLSVEEGFDADGVASGIAASFIFATDLFD
FT                   AGTVRTFADRFLRILGAVTSDPLAPVGDIVITDAAERSAMATEWNTAGFDAGTDTLADR
FT                   FAQSVARFPDATAVTSEDVALTYAELDARSNRLARLLISQGVGPETLVAVALPRTCDLI
FT                   IALLAVIKTGGGYLPVDITYPADRLAFVFEDAAPNCVITTTGDVSALPDSETPAILLDD
FT                   PETTADLAQQSPATITDADRVTPLDSSSVAYVIYTSGSTGRPKGVVVSHRNVLTLFANT
FT                   QPLYGFDENDVWTMFHSYAFDFSVWELWGPLLYGGRLVVVDYYTARSPEMFHELLRNEQ
FT                   VTVLNQTPTAFYQLAETDRIVSEIDVNAAALALRYVIFGGEALDLGQLGRWYSRHDDSA
FT                   PTLVNMYGITETTVHVSYLALDREFAESASASVIGRGIAGLHVHVLDRRLHPVPPGTIG
FT                   EMYVSGDQVTRGYLGRAGLSSSRFVADPLRPGARMYRTGDLARWNTDGQLEYLGRSDFQ
FT                   VKIRGFRIELGEIESALLRYRGIAQAVVLTRDDGHGGHRLIGYVVPESGATVEVSSALE
FT                   FVGTQLTSYMVPATLVVLDALPLTSNGKLDRRALPEPDFGARVSAGRAPATEMETVLAG
FT                   LFAEVLGLESVGVDDSFFALGGDSIMSIQLVARAKAAGVVLTPRDVFEAKTVAALAEAA
FT                   SWAGAADVVVLDELPGGGIGEMPVTPITAWLLERGGDFRRYTQTALLSLPAAADETLLK
FT                   RTIAAVVDHHDMLRARLLGAEPQWRIEVQAVGVVDVDDVLHRVEVASVVGSGFAEVATR
FT                   ELDAAAGRLDPEAGVMLQMVWFDAGDQGGRLLVVAHHLVVDGVSWRILVPDLATAWAQV
FT                   SAGQEPTLEPVGTSMRRWSHGLVEATRERAGEIELWRRVLEADDPLIGSRPLDAAIDVA
FT                   GTVEKVTVEVPADVTDALLTRVPEAFHGGVNDGLLTALALALAQWRRTHGDFTRESLVS
FT                   LEGHGREDQVLPGADLGRTVGWFTAMFPVRLDLSGIDLDDAFAGGKATGSAVKAIKEQL
FT                   LAIPDHGIGYGMLRYLDPESADQLRALAKPQVTFNYLGRLGGATSTDIHGHAWVPVTDT
FT                   KLDDIPASDIPVASALDINAVTGTGADGNRLRATWAFPTGVLTPSEVRALADLWVQALT
FT                   ALTTHVARPDAGGVTPSDLDLVTLDQDAIDRLEARFPALSDIWSLSPLQSGLLFHAQFS
FT                   DASVDPYLVQLALKLRGNIDPDRIRRAGQALLDRHPNLRAAFVHDSAGASAQIIQQHVE
FT                   LPWSEFDLSALDPDETTREYDRIVARDRSVKFDMANAPLLRLALVRLTEEDYRLILTNH
FT                   HILLDGWSTPLVIRDLLTLYALDADGSLLPRVHSYRDYLSWMKRHDTTDSLDAWRTALD
FT                   GVEEPTLLAPLERGEAHSAVAEETAFTLSEEQTTRLRDLSRERGLTLNTVVQTAWGIVL
FT                   GGLVGRSDVVFGGTVSGRPPQIAGIESMVGLFINTLPVRVTLDPWESLGELLERVQSEQ
FT                   AALLDHHYVGLTDIQSAVGGGGAFDTLTVFESYPVDEAGLTEQTDIAGMFVTGIDGKDS
FT                   AHYPLAVVASGDARLNFKFEYLPEVFEESAVDEIADRLQRVLDALADRPEIPLAHMQLL
FT                   TEAELAEFAPVRGRPGFSVRTLPQIFEDAAALDPNRTALTFEGRNVSYRELNERSNQLA
FT                   RVLISRGAGPETFVALGIPRSIESVLAVWAVAKTGAAFVPVDPNYPMDRIEHMLTDSGA
FT                   TIGLTMAAYEKALPDSVPWLQLDSPKFEKACQSKPALPVADSDRRSPISLDNAAYIVYT
FT                   SGSTGKPKGVVVTHEGLDNFAEDQRQRFAAAQTSRTLHFSTPSFDGSVFEYLQAFGVGA
FT                   TMVIAPPTVYGGAELAELIRSEHVTHAFVTTAALSTVDPTGLDEFQHVVFGGEACPPEL
FT                   VTRWAPGRQLSNAYGPTETTVMANISDPMTVGDPITLGGPIRGVGELVLDSRLQPVPVG
FT                   VPGELYITGAGLARGYHRRPELSSQRFVANPFGEAGERMYRTGDIVRWRADHTVEYVGR
FT                   SDFQVKIRGFRIELGEIDNEIATFPGVSFAATLGVPGPSGDTVLVTYLLPNTAGGVDPA
FT                   ELTAHLSTRLPAHMVPTSVMFLDEIPLTPVGKLDRSALPAPEFHVTTTEFQPPTNDLER
FT                   KIVDIFADVLGIERIGIDDNFFDLGGNSLVATRVTARLRDALDTDIGVRALFEAPDVRS
FT                   LAARVADSVSGGARPALAPVERPDRIPLSLAQKRMWFLNQFDTSSPAYNIPLAVRLTGT
FT                   LDEDALRLAMADVLERHETLRTVFPTVDNEPTQRILPAADAQPGVDTVSVAAEDLPRHI
FT                   MDLVSRGFDVSTDVPVRAALFRIAPDHHVLTIVVHHISADGFSLAPLARDVMVAYTSRL
FT                   GGDGPQWDPLHVQYADYTLWQHAGLGSENDPESMINQQLRFWSETLAGVPDVIQLPTDR
FT                   PRPIQQTFEGDRVEFAIDADLHQRLTALARANNATMFMAVHAALAVLLSRLGSTDDVVI
FT                   GTPVAGRGEAALDDMVGMFVNTLVLRNRIDPASTFTELVQRIRETDLAAFQHSDLPFER
FT                   LVEELNPTRSTSYSPLFQVALEFQNNENPTLELPDLRVENVDLETKVVKEDLEVILAEQ
FT                   FDQDGAPAGVAGGLDFAVSLFDRGTARSIADRFVRILAAVTADPDRPIGTLPLLDEAEI
FT                   EEMVPARGKPDVRPEVWPDLLTAAAALDPDSVALSFEDRQVTYRELDEWSNRLARVLCA
FT                   QGVGPETFVAIGMPRSIEEVVSIWSVAKSGAAFVPVDPTYPRDRIDYMLTDCRASVGLT
FT                   VAGRRDNLPDTVPWLVLDDESFAEQVAAVSSSPVTDADRTRPLHLAHPAYLIYTSGSTG
FT                   KPKGVIVTHRGMANLTAEEHERFQVTHESRVSHLASPSFDASIFELMMAFGASARVVIV
FT                   PPTVFGGTELADLFRRNAVTHAFITPTALSSIEDVGLESLRVLAVAGEACPPELVEIWG
FT                   KHRNMHNGYGPTETTIQASVSAPMRPGGVVNIGAPALGFGSLVLDERLQPVPVGVPGEL
FT                   YITGPGLARGYHNRSALTSERFVACPFGEPGRRMYRTGDVVRWRGDHTIEYIGRTDFQV
FT                   KVRGFRIELGEIDAVLARHPAVAFAATIGHTGPSGDTLLASYVRAAEGHDLEPAELRTH
FT                   AADRLPAHMVPSAVVVLDQIPMTPVGKLDRKALPAPEFGTTGAAFRAPTTATERIIVEA
FT                   FAEVLGVDRVGTADSFFDLGGNSIVATRVITVLQERLGRQIPLQSMFLDPTPAGLALRV
FT                   DTENAAGSPVDEALGVVIPLRPTGDKPPLFCIHPGIGLSWGYAGLLQHLSQDRPAFGLQ
FT                   LPIISGGPSFESIEQLAHQYVLEMRKVQAHGPYHLLGWSLGGVIAHAMAVELRREGEAV
FT                   DTLAVMDSYVTGGTDQGPESLTVPELLHGLGLDLESVSGEELTYERAVELLDDAFGQKT
FT                   GLTPQHLERISAGFTNSSRIMNNFRPQVFDGDLLFFTAAGSASTDQHSPEEWRSSVTGG
FT                   IREVKIECEHNQMIEPEVLAVVGPVLEDYLSAH"
FT   gene            complement(171523..171855)
FT                   /locus_tag="RHA1_ro00142"
FT   CDS_pept        complement(171523..171855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00142"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00142"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91978"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF8"
FT                   /protein_id="ABG91978.1"
FT                   /translation="MTGASRRPDSCVWCGREVAETGMGRRRRYCRQSCRQRAYEQRNQV
FT                   KGTSIPADAVVLTSEEASAMVDRVFQVRCAAEDVATAVAEGAAAHEVESLCADLVQLAR
FT                   EAERFR"
FT   gene            171854..172366
FT                   /locus_tag="RHA1_ro00143"
FT   CDS_pept        171854..172366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00143"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0005489 - electron transporter
FT                   activity; GO_function: GO:0016491 - oxidoreductase
FT                   activity; GO_function: GO:0046872 - metal ion binding;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00143"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91979"
FT                   /db_xref="GOA:Q0SKF7"
FT                   /db_xref="InterPro:IPR025182"
FT                   /db_xref="InterPro:IPR038638"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF7"
FT                   /protein_id="ABG91979.1"
FT                   /translation="MVNHLTARRLDARPVRCRGCICAACGNQSGGRGVVDECERLVLVQ
FT                   AYSRGDDRGEDTTMADRVLRGSRLGAVSYETDRDHDLAPRRMAKYRCDNGEVFDIPFAD
FT                   DAEIPGTWLCRNGLEGTLVEGTAPEAKKVKPPRTHWDMLLERRSKEELEELLKERLDLL
FT                   KAKRRGA"
FT   gene            complement(172901..204019)
FT                   /locus_tag="RHA1_ro00144"
FT   CDS_pept        complement(172901..204019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00144"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /EC_number="5.1.1.13"
FT                   /EC_number="6.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00144"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91980"
FT                   /db_xref="GOA:Q0SKF6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91980.1"
FT                   /translation="MSFRGWPVGVVPTAVVGKRTNKVVDAVPSGDVTAVDRIPDGAFPL
FT                   STAQRGMWFAQQLDPEVPVTIAQCVELVGVLDVALLSESLITAGRELGSAFLRLVEVDG
FT                   VPYQLVDPTLDASVRFVDLQREPDPRAAAKEWMRQEYTTPLDVCRDRLVTSAVLCTGPD
FT                   RHYWYSRVHHVALDGMGSMTLIDRTTQLYTAAVQGRTAAPSKAAALTDVARVDDDYRIS
FT                   PRYRADQEYWSERVSTIGETHSLVERSAPARARSRTAGGQIPGTLVDHLEAATDRHDSS
FT                   TAFEVIAAFAAYLSRMTGREEVAVSLPVTARTTALLRRSGGMVSNVVPLHLHVRPDMTN
FT                   ADLVAAVRLEVTAALRHQRYPHIDIRRDAATEHQGFYGPLINVMLFHDEITLGSIVGRL
FT                   ELLSTGPITDLAVNVYHGVAGTSLNLDFEANPDLYSEGTLRAHHTRFTRFLGAFLTSDT
FT                   DEPRRVGDLDILDDDESRTLVPASGRAGFAPVTLPDLLGGAVRSNRDGDALVAPGHGIS
FT                   SADTLSYRALDEASNRLARLLIDLQVGPEVMVALALPRSRESVSSVWAVAKAGAAFVPV
FT                   DPSLPADRIAFMLEDCGAPIGITTAALRDGLPECTHWIVLDDDEFRATAAAYPPDAVTD
FT                   TDRTRALSVDHPAYVIYTSGSTGRPKGVAVTHRGVVNLAADERDRLVVSSGSRVLHFAS
FT                   PSFDASVFELVMAVCAGATLVVAPTTIYGGTELAELMAEQRVTHAFCTPAALASLDHRG
FT                   LDHLRTVVVAGDVCPPELVARWAPGRIMVNAYGPSETTIMSSATGPMVPGQPVTVGSPT
FT                   VGVDLVVLDHRLRPVPAGVRGELYVLGSSLARGYVRRAGLTAERFVASPFGTGGRMYRT
FT                   GDVVRWVTAPDGPPVLEFLGRSDFQVKIRGFRIELGEIDAALTAHPVVEFAYTVGYDDG
FT                   SGSSRLVSYVLPVPATDVETRVLSEFVGERLPGYMVPSSIMMLDSLPLTPAGKLDRNAL
FT                   PAPVFAARSADIVRPRTVTEEILLGIFRDVLGLPELSVDTSFFELGGNSLMATQVVSRV
FT                   NTALGVRIGVRDLFQSPSVSQLAVPAANTGPQADSRPVLEARERPDHVPLSVAQQRMWF
FT                   LNQFDTASPAYNLPISLRLTGALDREALRAALGDVQERHEALRTVFPDTPDGPHQLVVP
FT                   VVSVLAETDPIDVDAKSLTAAVTALGGAGFDLTTDTPLRAGLFREAPDRHVLVLVVHHV
FT                   AADGWSMTPLAADVMVAYAARVAGHAPTWAPLPVQYADYTLWQRELLGSEDDPDSVSAR
FT                   QIAHWQSALAGVPQLLELPADRPRPAEMSHRGGRVEFTITADVHGRLVDLAQSTGTTLF
FT                   MVTHAALVVLFHRLGAGTDIVIGTPVAGRGEEALDDLVGMFVNTLVLRATAEPGDTFEE
FT                   VLDRVRDADLAAFSHADVPFERLVEVLSPDRSAARHPLFQVMLSFQNTAPTSVELPGLE
FT                   VAAAEIDVHVAKFDLQLTVTERFVGAGMPGGLAAGFDYATDLFDESTVASMAERFANLL
FT                   RSVAASSATVVGDLSLLHAAERDRLLGTWNDTAHRVPAMCLPELFDAQVARTPDAVAVV
FT                   FGDVTLSYSQLDCRANSVARYLIDRGVGPESRVGLAMRRSPDLLVGMYAIVKAGGAYVP
FT                   VDPDHPTDRIGYVLDSAQPVCVLTTSADRGALPAGQSFVEIDRIALDSYSGGPVTDSDR
FT                   LAPLRPDNPAYVIYTSGSTGRPKGVSVPHRGIVNQLLWMQSEYALTERDVLLQKTATTF
FT                   DVSLWGYFWPLHTGATMVLATPDGHRDPEYLARVIDEHGVTVTDFVPSMLDAFVASVPI
FT                   TSCSTLRHVFVIGEALPPETVTRFRALSDAGLHNLYGPTEAAVSVTYWDTATTVAGTVP
FT                   IGVPEWNTQVYVLDSRLHPVPPGVAGELYLAGEQLARGYLGRVDLTSDRFVANPFTPGL
FT                   RMYRTGDLVRWTSAGALEYIGRTDFQVKFRGQRIELGEIEFVLRAQPSVTSAAVLVHSD
FT                   PGTGDRLVAYVVPEPGHDLDTTRLRECAAASLPAYMIPAALMVVDEFPLNTSGKLDRQA
FT                   LPAPEFGGSGTEYVAPRTSVEANLAEIFAEVLGLDRIGLRDNFFDVGGNSLVATRVTSR
FT                   IRAELGAPLALRDLFDAPTVGALAERIEGTVQTTPRAPLVAATRAGRIPLSPAQRRMWF
FT                   VNQFDTASAAYNMPFALRLSGILDCDGLRSAIRDVLERHESLRTLYPDSTDGPHQVIVG
FT                   ADEVPLDLDVQPITEAELPTRLVELATEGFDVTSAVPLRTALLRLSVDEYVLAVVVHHI
FT                   SADGSSMAPLARDILLAYTARTAGRAPSWPPLDVQYADYSYWQAEFLGDETDGRSQATE
FT                   QIEFWSAALDGIPDLLELPADRPRPAMPTNSGATVPFSVDAATAKAVADLAARSAATPF
FT                   MVWHAALSVLLSRLSNAVDVTVGTPVAGRAEPSLQDLVGMFVNTLTLRARVSGDLSFAD
FT                   LLAQVREFDLAAFAHADLPFERLVEVLEPARSTARHPLFQVGLSYENFEPGVLELPGLT
FT                   VSAVEMNPEIAKFDLNVTLTEIRDERGTVSGLTGAFTYAVDLFDRDTVESFADRFARIV
FT                   TAALADPGTAVGDLPVLDQRELVRVLREWNATDVEVSGRPYLARYDEQAARTPDAVAVV
FT                   YRDVSVTYREFNSRVNRLARKLIAEGAGTETTVAVAARRSIEFLIALHAVLRSGAAYVP
FT                   LDVDLPAERVAHVIEAAHPVLVLTAVRGEFESDSGVRVLPIDGLELDRFDDAPVTNRDR
FT                   LRPLAADNLAYVIFTSGSTGRPKGVAVSHAGLGSHFEFLMSLCALDETDRVVVKTPQSF
FT                   DASLWELLWPLAVGARVVIAEPDGHKDPDYLAELIDTEQITAIHFVPSMLAVFTDVIAP
FT                   SRFSSLRTVFVGGEALSVNVARRFAAVSDAAVLNAYGPAEVAAASTTSWVDTSNSAIVT
FT                   VGTPVWNTRAYVLDQRLHPSPAGVTGELYLAGTQVSRGYAGRPDLTAERFVANPFDAPG
FT                   TRMYRTGDRLRWTGRGELEYLGRNDFQVKLRGLRIELGEIEAVLESADSVAQAVVTVYS
FT                   GAASEQLVAYLVARAGTRVDIEALTAYAASRLPEYMVPDGFVTLDAFPLNASGKLDRVA
FT                   LPAPAVGDVAVDRVEPRTPMEESLAALFREALGVDDLGVNDSFFALGGDSIVSIQLVSR
FT                   AKAAGIVFTPRDVFERKSIAALAEVVTVASADRLALAELAGGGVGNVELTPVVRSLLDR
FT                   SGSVGRYSQSVLLTLPTGIERSDIVATVQAVLDRHDALRSRLVRDGADVRHSVLPTGAV
FT                   DADRLVTTVSVNPDLGDAAFDALIDRELSAAADRFDFETPVLTQFVWLDRGATRPGRLL
FT                   VVAHHLVVDGVSWRIIVPDLVAAGGAVAAGHAPNLPEVGTSLRRWSHGLSEAARQPSTV
FT                   AQFDYWRSVVDAADPLLGGRALDPVRDRTSTTQELHVELSTEITATLLARVPEAFGCSV
FT                   GDSLLAGFAVALTEWRRARGVPAASAYITLEGHGREESVVPGADLSRTVGWFTSVYPVR
FT                   LALEGVDTQDALVGGASAGAAIKAVKEQLLAVPDRGVGYGLLRYLNPATATVLAGFDPP
FT                   QVVFNYLGKTGMGDLSPEMREIGWVPDLESSRVFSGETDQDMSASAAIEINAGVTDTDA
FT                   GPRLGASVRFAGELLAADDVRELVDLWQQALVSQIEHVVAGSGGGLTPSDIGTVALTQS
FT                   QIDLWERAYPTLEDVWALSPLQAGFHFHSLLAAEHSVDVYHSQLRMTLLGDVSADRMRA
FT                   AAAALLDRYSNLRVVFVQDGDVTAQIPLRGVEVPLTVVDLSGRESDSGERELESLVAEN
FT                   RTAPFDLSEAPLLRLLLVRTGADRHELAMTNHHILLDGWSIPLIVQDLLVLYATAGDQS
FT                   ALPAVRPYREYLDWLTRRDPSASRAAWAHALEGFDEPTLLAPAHTGGSATADPEEVPVH
FT                   FSAADTAELLAFARQHGVTPNTVIQTAWALLLRRLTGRDDVVFGATVSGRPPHIPGIES
FT                   MVGLFINTVPVRVRIDADESVAELLVRVQGQQADLLDHHYLGLTEIQAEAGVGALFDTL
FT                   TVFESYPMDQAALQAQTDIAGMRVDSVQVHSVTHYPLSLMAQVDDTLRLGVAYLPDTFE
FT                   RDEARLIAARLDSVIRALIAEPSAAVAQVTGFIPGEYARVMHDWNATGHHVPESTLLTL
FT                   FEAQAARTPDAVAVDFDGDVLTYAALDARANQLARHLIALGVAPETRVAVVMRRSLELV
FT                   VGIYAVLKAGGAYVPVDPDHPAERTSYVLASAQPVCVLTTSADRPDLPNRIPVSALDTL
FT                   DLSGVSAVPLTDAERIEPLRPAHPAYVIYTSGSTGKPKGVAVPHAAIVNQLLWMQSEYA
FT                   LTDRDVWLQKTATTFDVSLWGYFWPLQVGATMVLATPDGHREPAYLTRVIDERAVTVTD
FT                   FVPSMLDVFVAAAPEGTCRSLRLVFVIGEALPPATVLRFRELSAAGLHNLYGPTEAAVS
FT                   VTYWKTGDADTTNVPIGVPEWNTQAYVLDSRLHPVPVGVPGELYLGGAQLARGYLGRVD
FT                   LTSDRFVANPFGRTGERMYRTGDLVRWTSSGALVYIGRTDFQVKFRGQRIELGEIETVL
FT                   RSHPAVTGAVVSVYSDTTVGDHLVAYVVGTPGELDVAELRRQASESLPSYMVPSAITVL
FT                   DEFPLNTSGKLDRKELPAPEFHGSSTEYIAPRNEAERTVAAVFADVLGSSRVGAHDNFF
FT                   DLGGNSLSVTRVAARLGELSGTGLSVRDVFTAPTVAELARRLAEPTAAGGARPVLSGMQ
FT                   RPARIPLSPAQQRMWFINQFDPSSPAYNLPFAVRMSGALDVAALSQALDDVVGRHESLR
FT                   TVFPDTDDGPAQVVVSAADLSMPLEVVDVPEGELDSRMIAFSSHGFDVSEDLPVRATLF
FT                   RTGPGEHVLAITLHHIAADGWSFGPLGADVMVAYAARAESRSPEWIPLAVQYADYSVWH
FT                   RAVLGSEDEPESLARRQLEYWTRTLDGLPDELKLPFDRPRRTEQSYVGGSVGFTITPEI
FT                   HSGIERLAREHGATVFMVAHAAFALLLARLSASDDIAVGAPIAGRGERALDNLVGMFVN
FT                   TLVLRTRIESTETFAELLTRVRDGDIGAFGHADLPFERLVDVLDPVRTSAHHPVIQTAL
FT                   SMQPTAIDDIELPGLRVRVEDIDARVAKFDLQLTLGEDIDPAGVPSGIRAEFTYAADLF
FT                   DDVTVRRYAGQLVRILETVIADPTTVVGDVNLLDDAERARLAPVRGPASRPSRLLPEVL
FT                   AESAADPSATALVFGDRSMTYGELDRRSNLWARELIEAGAGPETFVAVALARSIESVLA
FT                   VWAVAKTGAAFVPVDPNYPAERIAHMLGDSGSALGLTTIEFRAGLPDSTQWLVMDDPDH
FT                   TALVTSHSSAAVTAADRLGRMHADQLAYLIYTSGSTGLPKGVAVTHSGLANLLTELADE
FT                   YELTADARTLHFASPSFDASVFEYLMAFCRGATMVVVPHSVYGGTELAELLGAQGVTHA
FT                   FFTPAALASVDHTGLDELAVIVVGGEAWGADLAERWVPGRALFNGYGPTESSMMVTQSG
FT                   PLMLGERMTIGAPVRGVEAFVLDARLHPVSPGVPGELYISGPALARGYHQRLGLTAERF
FT                   VANPHGAPGRRMYRTGDLVRWVESRTGTYVIEYVGRSDFQVKIRGFRVELGEIDSVFRA
FT                   HSAVGFAATIAHDTESGVTALVTYVCAASGNDVDVDDLTAFVGGVLPAHMVPGSIMVLD
FT                   SIPLTPAGKLDRRALPEPVFVSHTRFTAPDTADEIAVAAAFADVLGESRIGVDDNFFAL
FT                   GGNSLSATQVVSRVGSAFGTRVSVRTLFDNPTVRQLVSAVATSGPDASSGRPALTRREH
FT                   PGRIPLSLAQQRIWFLNQYDPSSSAYNIPLALRMSGRIDVPALRAALGDVLERHESLRT
FT                   VYPGSADGAHQEILPAAAAEFDLTPIRTAPDQLMLRIAEYAVAGFDVTREIPFRIHLFR
FT                   ENRSEHVLLLVAHHIAADGWSFGPLAADVMAAYASRVEGLAPSWEPLPVQYADYSVWQR
FT                   ELLGAEDDPDSLSATQIERWRAALDGAPEALDLPTDHPRPAVASHRGERVDFEIDADTH
FT                   RGLVERAQKGGTTLFMVVHAAFATLLHRLSGSTDIVIGTPVAGRGDEGLDPLVGMFVNT
FT                   LALRTRIDPGESIDALLEQVRDVDLTAFQDTEVPFDRLVEILRPTRSSDRHPLFQVMFA
FT                   FQNLRPVTMELPQLVVEAVDFDPHIAKFDLDLALAEIVDDAGHHHGISGAFTFASELFE
FT                   RATVAGFADRFLRILEAVASADDIAVGDIAILGAAEQGSLAPVWGGPLLANATLPELLV
FT                   ATAERYPDSTAVVFDGVSIDYRELDRRSTQLARALIGMGVGPETYVALALPRSVESVLC
FT                   VWAAAKTGAAYVPIDPAHPADRIAHILRDSGVVVGVTCAEFAEHLPGVTDWLVLDDPAV
FT                   LRELSSASTAPVGDADRTSALHVDHPAYLIYTSGSTGLPKGVVVSHRGLANLAGSYTTA
FT                   VRATEESRVAHLASPTFDLSVLELLLAHTSGAALVVCPPGVYGGVELHEVLQSERVTHM
FT                   TITNAALASVEPEGLDDLRSIVVGGDACPPETVARWADRLELVNGYGPTEVTVGATFSS
FT                   VLGQGRDITIGGPLPGVAAVVLDSRLRPVPVGVVGELYLLGPALARGYHERAALTAHRF
FT                   VASPFEAAGARMYRTGDIVRWRAVHSGVTGSMTDGTFPGHAIEYLGRSDHQVKVRGLRI
FT                   ELGEIDAALNAHPDVEFAATLGYESPAETRLASHVLVGAGADRDPAALLAFLRQALPGY
FT                   MVPSALVFLDTIPLTPNGKLDRDALPAPDFGAAAKEIVYREPRNPLEQSIADAFAEVLG
FT                   GTDIGLDTDFFDAGGNSLSATRVTARVGALLDIRVTVRDLFEAPTVLALAESLAPRMSE
FT                   AGDGASAGPALAPQPRPDRIPLSLAQQRMWFLNQFETSSPAYNLPAAVRLTGPLDTAAL
FT                   AAAIDDLITRHESLRTVFPDSRGGPHQVILEPGQFTPDTAPVRVSESGLRADLEQFLLT
FT                   GFDVSQAVPLRVKVYSLGDTEHVLAFVVHHIAADGVSMEPLIRDVMIAYSSRAAGHAPS
FT                   WAPLPVQYADYALWQREVLGVESDPGSLAAAQLEYWTRTLAGVPDQLYLPGDRGRPAVP
FT                   SHRGAATRFTLDADTHRALAELARAHGASIFMVAHAALSVLLGRLSTSSDITVGTAIAG
FT                   RGRVELDDIIGMFVNTLVLRTTLDPGASFVSLLEQARDVDLEAFAHADLPFERLVEVLS
FT                   PVRSTSHHPLFQVALGVQAVSADRLELDGLSLEPLTLDASTAKFDLHFTLTERLDDASE
FT                   AAGIDAELVYATDIFDESTAAEYAIRLRRIFEAVVADPQRPIGDIPVLGDEEYAALTPV
FT                   RGADARPVQMLPEILADAVAAAPDGPAVVFEGESLTYRDLDERSNQLARLLVDRGVGPE
FT                   TRVALALPRSLESVVAVWAVAKTGAAFVPVDPGYPADRVLHMVQDSGAMVGITVSAKQD
FT                   VLPDSIRWMLLDDPALAVRCTHESRLPLTNRDRMRPILSDQVAYVIYTSGSTGRPKGVA
FT                   VTHRGLMNLVTDERELLGVTSGSRTLHFASPSFDASVFEMLMALGAGATMVIAPPTIYG
FT                   GSELAELLAAEHVTHAFSTPAALASVDHHGLDDLAVVVVAGDVCPPELVARWAPGRRMV
FT                   NAYGPSEATIMSSITEPLRAGEPVTIGGPSRGVRALVLDGRLRPVPVGVPGELYVGGPS
FT                   LARGYLGRPGLTAERFVADPYGEPGDLMYRTGDLVRWRENRVLDFVGRTDHQVKIRGFR
FT                   IELGEIDAALTAHPQIEYATTIGYEHPNGETSLVAYVLPFTGEDVDRVEVANFVGRTLP
FT                   AYMVPASVTLLDALPLTPAGKLDRAALPEPIFVAAATTFEAPRNPMEVIVAGIFADILA
FT                   LPEIGIHDSFFDLGGNSLLATQVVSRINAALDVHVGVREVFESPTVAALAARITETTTH
FT                   GVRRPALTAKPRPEHIPLSLAQQRMWFINQFDTASPAYNLPVALRLSGEVDLRAMQIAI
FT                   ADLVGRHEALRTVYPDSVDGPHQVIVPAGDAVPDLTPVAAHPDDVLDRVLALVTTGFDV
FT                   TADVPLRARMYRVGADDYVLVMVAHHISGDGWSLAPLARDVMLAYTARAEGHVPRWTPL
FT                   PVQYADYSLWQRELLGDETDPESVAAAQIAYWTRTLEGLPDRPSLPTDRPRPAVASHLG
FT                   AHVPFTIDAGTHRALLALARGRNTSLFMVMHTALAVLLARLSNESDIAVGAPIAGRGEE
FT                   SLDELVGMFVNTLVLRTRVALASSFADSLADVRSADLNAFAHSDIPFERLVDVLNPARS
FT                   RAHHPLFQVAFSFQNLATTTLELPGLHVEGLDVPNTISNFDLHLTLSEKHDADGSPDVI
FT                   EAQFTYATDLFDESTVRAFAERFTRVLASVVEDPDVAVGAIDLLDGPERQSIVADFNDT
FT                   GVDLPPTTLAELFSAQAARTPEKAAVFFEGTELTYAEFDRRVDVLAHRLIDRGVGPESV
FT                   VGLAMNRSIELLVGMYAVLRAGGAYLPIDLTHPADRLAYVLATARPVCILTTSSDGFAA
FT                   ESVPVIEIDTLDHTGSPREPVTDARRLAPLRPENTAYLIFTSGSTGRPKGVAVTHAAIA
FT                   NQLRWKQHEYSLDTTDAVVQKTPVTFDLSVWELFWPLTTGARLVIARPDGHRDPAYLAD
FT                   LMRQQRVTTAHFVPSLLEAFLATPDAGEQPALRRVLCIGEALPVDTAARFRRRFGTVAL
FT                   HNLYGPTEAAVSVTAWTHTADDVDTVPIGGPEWNTQVFVLDARLNPVPVGVAGELYLAG
FT                   EQLARGYVARADLTAERFVANPFGASGSRLYRTGDVVRWHVRDSRGVLEYLERSDFQVK
FT                   VRGFRIELGEIESALVSSAGVGQAVVVAHQHPHTGTTLIGYVVPEDGATVDFAAVLAEV
FT                   GAAVPSYMVPAALVVLAQLPLTSNGKLDRRALPAPDFASATDEYRAPATPTEEAVAAVF
FT                   ADVLGVDQVGTAANFFDLGGNSLVATRVVARLSERLGCRVEIRTLFEAPTVAALAALLD
FT                   SIDATAPARPALTPAVRPERIPLSSAQHRMWFLNRFDPNSAVHNIPAAVRLSGALDVDA
FT                   LQHAVADVVRRHESLRTVYPDSADGPHQVILPIDRVGGEMSVVATDEAALPALIAGLVT
FT                   TGFDVTTEVPVRVRIFRMSATEHVLALVVHHISGDGWSMAPMVRDVMTAYAARSADTTP
FT                   DWAPLPVQYADYALWQRALLGDETDPESVSARQLAFWTHTLAGAPDQLDLPTDRPRPAV
FT                   ASYRGGTVDFTVPADLHGTLLGAARDANASLFMLVHAALAVLLSRLSGTGDIAIGTPVA
FT                   GRGERELDDLIGMFVNTLVLRQQVDGGRTFAELVADVRETDLAAFSHADVPFERLVEVV
FT                   NPSRSTGRHPLFQVMLTFQNLDQATLRLGDLSVSGVDFDVDIAKFDLQLTLMEQFDSAG
FT                   SPDGIAARLTYASDLFDEPSMHVFGQRFQQVLRAATDSPDTAVGDIDVLGSGERKQIAG
FT                   TNATSHEVPAGTLASLFDTRVAADPVRVAVIFDRDELTYADFDARVNRLARRLIEQGVG
FT                   PESVVAVAMRRSIDLLVAIYAVVKAGGAYLPVDPDHPAERTAHVLDTAQPACVLVSGAG
FT                   LAGGGSVPVIDVASEDVSGFDSSPVTDADRLWPLSPANTAYVIFTSGSTGRPKGVAVTH
FT                   GAIVNRLLWMQHEYTLTSADVVLQKTPVTFDVSVWELFWPLQVGASLVIAAPDGHRDPR
FT                   YLTGLIQERHVTTTHFVPSMLSVFTAEPAVAVCDSLRLVFCSGEALTPEQVSRFRAVCG
FT                   ADLHNLYGPTEAAVDVTYWETGAADTVTVPIGRPVWNTQVHVLDSRLHPVPNGVAGELY
FT                   LAGDQLARGYLNRPDLSADRFVANPHVAGGRMYRTGDLVRRRADGVLEYVGRTDFQVKL
FT                   RGQRIELGEIEAALEAHPDVSQAVVVVHRDDRGEEALVAYLVGPRAADWSDVRAHLSAR
FT                   VPSYMIPAQVVHLDTLPLSANGKLDRTALPAPAARSAADEYQAPRTAAERAVATVFADV
FT                   LGIDRVGVTDSFFDLGGNSLIATRVASALGSELGIDFPLQWMFSDPTPQSLGQRIQKWT
FT                   NDGVDGAGASLDVLLPIRTRGTAEPLFCVHPFIGLAWSYAGLGRELTQDRPIYGLQSPA
FT                   LTEDEPHLETITDFAARYVREIRSIQPHGPYHLVGWSLGGVIAHEMGVQLQDAGEEVRL
FT                   LGLLDSYVGIDRSVENSATTADLLGGVGLDLPDDSVLDELAPDGQFDAERAAALLRVVG
FT                   GPLAALTATELERIYGNALRAPALIDAHRPRVFDGELVFFTAALDDGFHVDPVTCWGQF
FT                   VRGSIDEHPVDATHWTMTTPDALAAIAPHLERSHRRPRHAAPDTGRDSDPDDSANRPHS
FT                   VR"
FT   gene            complement(204228..204956)
FT                   /locus_tag="RHA1_ro00145"
FT   CDS_pept        complement(204228..204956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00145"
FT                   /product="dolichyl-phosphate beta-D-mannosyltransferase"
FT                   /EC_number="2.4.1.83"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0016410 - N-acyltransferase activity;
FT                   GO_function: GO:0016810 - hydrolase activity, acting on
FT                   carbon-nitrogen (but not peptide) bonds; GO_process:
FT                   GO:0006807 - nitrogen compound metabolism; GO_process:
FT                   GO:0042158 - lipoprotein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00145"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91981"
FT                   /db_xref="GOA:Q0SKF5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF5"
FT                   /protein_id="ABG91981.1"
FT                   /translation="MIIPTYNERENLGLIVGRLHAALPRTHVLVVDDGSPDGTGDVADA
FT                   LASSDDASRIHVMHRTEKNGLGAAYIAGFHWGLDRDYTVLVEMDADGSHAPEQLHRLLD
FT                   QVDAGADLVLGSRYVPGGTVVNWPKHREWLSRGGNIYSRLALGVKIKDITGGYRAYRRE
FT                   VLEKLDLAAVESHGYCFQVDLAWRAIQEGFDVREVPITFTEREIGESKMSGGIVREALL
FT                   KVTQWGLRNRIAKLKGAAAR"
FT   gene            complement(204937..206640)
FT                   /locus_tag="RHA1_ro00146"
FT   CDS_pept        complement(204937..206640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00146"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_component: GO:0019866 - organelle inner membrane;
FT                   GO_function: GO:0016410 - N-acyltransferase activity;
FT                   GO_function: GO:0016810 - hydrolase activity, acting on
FT                   carbon-nitrogen (but not peptide) bonds; GO_process:
FT                   GO:0006807 - nitrogen compound metabolism; GO_process:
FT                   GO:0042158 - lipoprotein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00146"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91982"
FT                   /db_xref="GOA:Q0SKF4"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF4"
FT                   /protein_id="ABG91982.1"
FT                   /translation="MSGSTTPRWTIGKLGVLVRSVLSVAAGFLVFAGFPPRPLWFLAPI
FT                   GIALLTLILTGAGGAAPRLRAGFGYGYLAGLGFLVPLLPWIGVFVGALPWLALAAVESL
FT                   YIGLFGVLAVLVSRLRWAPLWIAACWSLTEWLRASVPFGGFPWGRLAFGQSEGWFLPLA
FT                   SIGGAPLLSFAVALTGAGLASVAVTVRARASGATNWTRPLAGGLVAALAATVVSLALWP
FT                   TPPGMDSGDRTITVAAIQGSVPKLGLDFNDQRKRVLDNHVNRTLELADDVASGAAPQPD
FT                   LVVWPENASDIDPLRNADAAADISRASEAIGAPILVGAVLVNSDRTTTNSVIVWDGDAG
FT                   PQEQHDKKIIQPFGEYLPYRGFFRHFSAYADRAGNFVPGDGDGVVHADGIAVGVATCYE
FT                   VAFDRAFEQSVRSGAELLAVPTNNATFGDTEMTYQQLAMSQVRAVEHGRAVVVAATSGV
FT                   SAIISPDGSTAAETSLFVPAALVSQVPLRTGTTLASRLGPIPEVLLCVGAVAAVAFAVV
FT                   QRRRTVRTLIQRSTEKAPAVAGREDPHGIGDRFRAERGTERTDSGDHSDV"
FT   gene            complement(206630..208234)
FT                   /locus_tag="RHA1_ro00147"
FT   CDS_pept        complement(206630..208234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00147"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0016787 - hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00147"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91983"
FT                   /db_xref="GOA:Q0SKF3"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF3"
FT                   /protein_id="ABG91983.1"
FT                   /translation="MPVTTQLLVGGRIYSSFAPDATSMAVTGGVVSWVGDDRAARALHP
FT                   GADVVDLGGAFVTPAFVDTHVHLTALGLNIVGLDLVGVGSLRECLDRLASFARTHGDAV
FT                   IWGHGWDESAWPEGAGPTTAQLDEAAPGRTVYLSRIDVHSAVCSTALRQSVPDLSDTAG
FT                   FSPEGPLTFEAHHAARTVARSLLTAEQRSAARTAALDAIASRGIVAVHECGGPDIAGLD
FT                   DFRELLATPHGVEVRGYWGEAVTDADEARKLLNATGAHALGGDLFIDGSLGSHTAWLSE
FT                   PYADLDGGTGKSYLGVDEIAAHVRACTIAGIQAGFHVIGDAAVRAAVDAFAVVAADLGG
FT                   PAVAKAGHRLEHVEMMTGDDAARLAQWGVIASVQPAFDALWGGTDGLYAQRLGTERALT
FT                   LNPFAAAASAGVSLALSSDAPVTPVDPWAMLRAAVHHRTPGSGISPRAAFSAATRGAWR
FT                   AGGVRDGLAGTLDPGAPASYAVWDAGELVVSAPKDSVQRWSTDPRSRVPALPRLEDDAP
FT                   TPVLLRSVHRGSVVHER"
FT   gene            complement(208247..208753)
FT                   /locus_tag="RHA1_ro00148"
FT   CDS_pept        complement(208247..208753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00148"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0016020 - membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00148"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91984"
FT                   /db_xref="GOA:Q0SKF2"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF2"
FT                   /protein_id="ABG91984.1"
FT                   /translation="MYAALFLLYVVVEIAALVLVGHAIGVLWTVLLLLGGTLIGLLLMR
FT                   SQWRRVMDGLRRAASGDGSPGAAVADGALVALGSALMFVPGLVTSVLGLLFLVPPTRWA
FT                   LRPVVVLLAGRRAATVAAGAEAFARAPRRGRGEVIEGEVVDEVFEGEVIDEEPRTPTRD
FT                   PHVLP"
FT   gene            208958..209575
FT                   /locus_tag="RHA1_ro00149"
FT   CDS_pept        208958..209575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00149"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00149"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91985"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF1"
FT                   /protein_id="ABG91985.1"
FT                   /translation="MTRSTVFRRAAIVLASAAAFGMLSTGPASAAPVADFAKGAAELQA
FT                   LATEVSPAATAAVDALLGASVFIPKDVLEVGLTTPQDFMYPSPTLGCGVADKPATVTLA
FT                   SAQGGPNLFPQISPNQLRFQAVPAYVAIPQSSDLSVAWINLTTFQGGIVKLDDKLPLIN
FT                   TPLLSKVVDTGKGTVLATMFGTVGYADSVTCTVVPTVGTFTV"
FT   gene            complement(209603..210262)
FT                   /locus_tag="RHA1_ro00150"
FT   CDS_pept        complement(209603..210262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00150"
FT                   /product="response regulator, two-component system"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0000156 - two-component response regulator
FT                   activity; GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0000160 - two-component signal
FT                   transduction system (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00150"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91986"
FT                   /db_xref="GOA:Q0SKF0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKF0"
FT                   /protein_id="ABG91986.1"
FT                   /translation="MPITVLLVDDQELMRMGLNMVLDAQDDITVVGEASDGAAAVAAVR
FT                   TLEPDVVLMDVRMPVVDGVSATAQILESGVASRVLVMTTFDLDEHAMGALRAGASGFLL
FT                   KDTPSEDLVSAIRSVAAGDAVVSPKVTRRLLAKFLDDGPGPLRDPEVLDVLTEREREVL
FT                   QLVATGLSNTEIAGQLFLSESTIKSHVGRILTKLNVRDRVQAVVLAYETGLVRPGS"
FT   gene            210439..210867
FT                   /locus_tag="RHA1_ro00151"
FT   CDS_pept        210439..210867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00151"
FT                   /product="probable IMP dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00151"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91987"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKE9"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91987.1"
FT                   /translation="MRIADVLRNKGPAVVTVDPEMPVSTLIGELARHNVGALVVTENDA
FT                   VVGIVTERDVVRRIHERGPDILNARVVDIMTTSVFTCLPTDTVDSLAETMTERRIRHLP
FT                   VIVDGQLVGIVSIGDVVKSRIGELQTERDQLESYIDHG"
FT   gene            complement(210849..211175)
FT                   /locus_tag="RHA1_ro00152"
FT   CDS_pept        complement(210849..211175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00152"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91988"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKE8"
FT                   /protein_id="ABG91988.1"
FT                   /translation="MTCVLLAEFAHRGRPSADLHLLHQILLGERILREQACDGVLVLGV
FT                   DDEQRTVAIGEGAGRAHHLAADEFGEPPTMLRPVIVAEGRRLGAVRVFHDEQGHEVLVQ
FT                   PWSM"
FT   gene            211285..211956
FT                   /locus_tag="RHA1_ro00153"
FT   CDS_pept        211285..211956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00153"
FT                   /product="possible transcriptional regulator"
FT                   /note="GO_function: GO:0004871 - signal transducer
FT                   activity; GO_process: GO:0007165 - signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00153"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91989"
FT                   /db_xref="GOA:Q0SKE7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKE7"
FT                   /protein_id="ABG91989.1"
FT                   /translation="MPGFPLAPADSLGHDAFTSLVVSLPRPVCVYDDRRQLVLTNPALA
FT                   DLVGYRSDEFDRVDLAGLMHPSDAPRWFGLVRGVLDTGTSDAGYARVRHRNGNWLWAHG
FT                   FASTFTSADTRFVVLVWQDRTDEVWNNPRLLDKADVASADVVRSRAIIEQAKGALMLVY
FT                   SISADAAFDLLTWRSQETNTKIRVIADQLVLAFGDEIHTPASFRDRFDALLLTTHERHR
FT                   R"
FT   gene            212195..213754
FT                   /locus_tag="RHA1_ro00154"
FT   CDS_pept        212195..213754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00154"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91990"
FT                   /db_xref="GOA:Q0SKE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKE6"
FT                   /protein_id="ABG91990.1"
FT                   /translation="MSTGLLNEPLERSAPPPVPRPFRAPMILAASGAVVAAVLFWIVSG
FT                   SLTDDAYISLSAARNLAVHGEWAIVHGLTANTSTSPLNVLVLGALTFLTRLWGPGDPLL
FT                   ALGMLNVAVTALLGWVLARMCRRLGLGSGWAVLAGALVVFNPFVLSAVGLEVLLIPAAV
FT                   AVMVWFAVEGRTAWFGAAAGMATLVRLDLLVFVVVIAALSPVIRTQLRRALAGFAAIAG
FT                   PWYLFSWVVLGSALPDTFLIKQGQASDVGGYNYLTGPIMYFESNPWRTVAAFGPAALAL
FT                   VLILVALASYARPWKRPVPVPVPLLALGLSGALYYVAYVVLDTVPYHWYYVAPATTLAM
FT                   FAVLAAGIHWSAARDTPDRAVAGSLAGLLAVLGVGAVYYDVESGLPWDAPPIFGNWASA
FT                   QDYERVGRAVGTLVGEAPVRSPGEIGTLAYFCECVIVDEFSDRGLVVEDRLVPRLAEAT
FT                   EPARTLLRANYVFFDYRLAPVNPAFDLRYEEGRGPGGPMSWDVFSAARGAGHFILVPLT
FT                   AG"
FT   gene            complement(213835..214500)
FT                   /locus_tag="RHA1_ro00155"
FT   CDS_pept        complement(213835..214500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00155"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91991"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKE5"
FT                   /protein_id="ABG91991.1"
FT                   /translation="MSNQYRCRSLIFARRQPAQMHGAFAVVEHSDRLAQRVPGIVELRA
FT                   IGDLSRESIEPTCRQPKSNPWVPTDVPHPAGDEIRARHRQRGWQKRDEVGTVTALDHPH
FT                   TLSSLFARLASSRRQYCKSRRRAHEEAGQHQGTEDCPVPRPPHQAPVLGRLLRRRSADL
FT                   PVPLVIIRRGRSILVSCHSHRPVPAFPASNMATVHRSTRRHFTCQATKNRAPCRSSGS"
FT   gene            complement(214594..215322)
FT                   /locus_tag="RHA1_ro00156"
FT   CDS_pept        complement(214594..215322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00156"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_function: GO:0016566 - specific
FT                   transcriptional repressor activity; GO_process: GO:0006355
FT                   - regulation of transcription, DNA-dependent; GO_process:
FT                   GO:0016481 - negative regulation of transcription"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00156"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91992"
FT                   /db_xref="GOA:Q0SKE4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKE4"
FT                   /protein_id="ABG91992.1"
FT                   /translation="MAKQVVSDSSRKRRRPTKQGAVLSEQLIMETALRLLRHHGSAGLS
FT                   VRRLGAALGADPSTLYRYFRGIDDLTLAIADELIGRSFHGWEPTGDWWRDLHSLGIRSH
FT                   AAYLDHPQAAVLSASRVSGRTSEKAAVDTILGVLREAGFPDGAAVRLYRAFVDQMLAFA
FT                   ALDGAELALPDDVRESDRQLWRSSYAQLPAETHPHIAATAGLLVDLSDRSAYPDALELL
FT                   LDGARALLHRLDAKRESATS"
FT   gene            215391..217022
FT                   /locus_tag="RHA1_ro00157"
FT   CDS_pept        215391..217022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00157"
FT                   /product="amino acid transporter, APC family protein"
FT                   /note="tc: 2.A.3; GO_component: GO:0016021 - integral to
FT                   membrane; GO_function: GO:0005279 - amino acid-polyamine
FT                   transporter activity; GO_process: GO:0006865 - amino acid
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00157"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91993"
FT                   /db_xref="GOA:Q0SKE3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKE3"
FT                   /protein_id="ABG91993.1"
FT                   /translation="MSQAGSEAPGRGHETPDRRVASRPSPPSSESDAHMAVVNNGAADA
FT                   PRATALRKSLGVMDGVAIAASSTAATTSIGVGLGVIAAVVGLQMPVVLLLAFVPILGIA
FT                   SGYARLNRVEPNCGNSYVWVGRSLSPWLGFLTGWMAIVAVVVFMAYTTAIAGSAILQLA
FT                   GMAGLHSIGGLALDPDSTLQSTMLGLTILGAVTFTAVRGVAVAARLQKYLLVFEYVVLI
FT                   GFCTYGLFAGSQPFSLSWFNPFAIPSFAVLAEGMVIAVFFYWGFEAAFSVSEEVRDPRD
FT                   ASRAGVITVFLVLGLFLLGAVAFQRVLTPTELADNGTVGLAFLGEALARQPLAALPVVA
FT                   LMFSVIASLQATVIPSARGLFAMGRDRTLGPVWTRIHSRYGTPAAGTVLLGGISAVVAL
FT                   LATVIPKLSDLLGAGISSIGLVVALWYGLTALAAAVRFRGLLRERPWEGLRAVVFPALS
FT                   ALVLLALGGYLGWIFYTSADHLEFSATNGWFQLLFPVLILISGLVVAAHAKWVRRSPYF
FT                   VTGRGTDADDVNLLGAPADVPVTTRS"
FT   gene            217083..218738
FT                   /locus_tag="RHA1_ro00158"
FT   CDS_pept        217083..218738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00158"
FT                   /product="probable metal-dependant glycoprotease"
FT                   /note="GO_function: GO:0016787 - hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00158"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91994"
FT                   /db_xref="GOA:Q0SKE2"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKE2"
FT                   /protein_id="ABG91994.1"
FT                   /translation="MSAEPADLVFTGGSIATLDPARSRATTVAVTGGRISAVGHDEVRE
FT                   LIGSRTEVVDLTGRLLLPGFQDAHIHPVVAGLEYARCNLTGTSDAAGTLAAIRSYADAH
FT                   PELPWIVGGGWSMEAFDGGTPTAQLLDTVVRDRPVFLPNRDHHGAWANTRALDLAGITR
FT                   DTPDPVGGRIERDADGLPTGMLQESAMELVGCHTPQHTPDDRLKALLHAQQHLHSLGIT
FT                   AWQDALLGDTSGISDVSDAYLSAAGDGSLTARVAGALWWDRDRGAEQIPDLLRRRSLLR
FT                   VGRMRADTVKIMLDGVAESRTAAMISPYLDGCGCATAHSGTSFVDPDELRGYVTELDAL
FT                   GFQVHFHALGDRAVRDALDAVDAARTANGFRDTRPHLAHLQVVDPDDIPRFRALGVTAN
FT                   MQPLWAAHEPQMDELTIPFLGDERSRRQYPFGSLLRSGATLAAGSDWPVSSADPIHGIH
FT                   VAVNRVLPGRDGQGRPVFLPEQRIDLTAALTAYTAGSAYVNHLDDTGSIEVGKLADLVV
FT                   LDRDPFTGTADEIGGSRAVLTYVGGNRVYSAPDA"
FT   gene            218855..219259
FT                   /locus_tag="RHA1_ro00159"
FT   CDS_pept        218855..219259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00159"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91995"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKE1"
FT                   /protein_id="ABG91995.1"
FT                   /translation="MGDNRPFGFDPDDLDRVIREAGEELQGVKDRIVRFLDQADSQIPW
FT                   TGVFADFARSPRGAAKPETAGETGDGVWAIYTLDDEGVARVEQVYATELDALRAHKHNT
FT                   DPHRSVRFLPYGVTVSVLDQPEEAAPPETE"
FT   gene            complement(219270..220439)
FT                   /locus_tag="RHA1_ro00160"
FT   CDS_pept        complement(219270..220439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00160"
FT                   /product="receptor-like histidine kinase of 2 component
FT                   system"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_component: GO:0019866 - organelle inner membrane;
FT                   GO_function: GO:0000155 - two-component sensor activity;
FT                   GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0046983 - protein dimerization activity; GO_process:
FT                   GO:0000160 - two-component signal transduction system
FT                   (phosphorelay); GO_process: GO:0006468 - protein amino acid
FT                   phosphorylation; GO_process: GO:0007600 - sensory
FT                   perception"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00160"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91996"
FT                   /db_xref="GOA:Q0SKE0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKE0"
FT                   /protein_id="ABG91996.1"
FT                   /translation="MHMRRFSLWLRGKPTVADSMLAAILFTLEVFVFTASGDRSPWVQL
FT                   VMGFLLCLPIVWRRKYPLAAAGAVLVMSITITFISYSIGDLDAEHPGLLALAVALYTLV
FT                   AYVDRSTAAVYAVGLVVDSALSIWLLEQELVAAGLFSVLVFALSWITAEFLGARRAYDE
FT                   EVAARLVVADYDRDRRAEDAVAAERTRIARELHDVVAHAVSVMIVQADGASYALKTNPD
FT                   IAKQALTNIASTGREALAELRRTVSLLRTEPATDDMPQHGTAGLARVVDMMRSAGLPVE
FT                   LELTGELDDISPAVSLGVHRLVQESLTNVLRHAGERPRAKVRVRRRETDVLVEITDNGN
FT                   SSGQFSLGSGNGLLGMRERVAVLHGTLEAGRQTDGSWRVTAELPLELED"
FT   gene            220480..221247
FT                   /locus_tag="RHA1_ro00161"
FT   CDS_pept        220480..221247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00161"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00161"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91997"
FT                   /db_xref="GOA:Q0SKD9"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD9"
FT                   /protein_id="ABG91997.1"
FT                   /translation="MNVGDWALLLTAATAAGWVDAVVGGGGLILIPALFLVAPQLTPQA
FT                   ALATNKLTAFTGTSAAVVTFARRIPMNWRLLVPAGLLAAVASALGAATVSRIDKDVFIP
FT                   LIMAVLVGVAVFVTIRPQLGTTLAKDPPTRRKVVAVVLLSAGLLGFYDGLFGPGTGTFL
FT                   IISFATFLGTEFVRSAAMAKVINLGSNLGALVFFAATGHVLWALGLGMAVCNVIGAVIG
FT                   SRMALSKGAGFVRITLLIVVIAMVIRLGWQQFG"
FT   gene            221270..222790
FT                   /locus_tag="RHA1_ro00162"
FT   CDS_pept        221270..222790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00162"
FT                   /product="probable modulator of DNA gyrase protein, TldD"
FT                   /note="GO_component: GO:0042597 - periplasmic space;
FT                   GO_function: GO:0016491 - oxidoreductase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00162"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91998"
FT                   /db_xref="GOA:Q0SKD8"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD8"
FT                   /protein_id="ABG91998.1"
FT                   /translation="MTAPRQVDPEFLALPLRSLADAALAAARAAGASHADLRVHRLTSQ
FT                   SLRLRDGEVQSAVDTSELGFAVRVVVDGTWGFASHAELTPATAAATAEQAVAVARALRR
FT                   LNREHVELAAEPVHTDVRWVSDYDVDPFEVPASDKISLLGEYSRRLLASDGVDHVTAGC
FT                   LHVKEQTFYADLAGSSIVQQRVRLHPQLEATTVDQSAGVFETMRTLAPPVGRGWEYVAG
FT                   DGVWNWTDELARIPDLLAEKVKAPTVVPGPTDLVIDPTNLWLTIHESIGHATEYDRAIG
FT                   YEAAYAGTSFATPDKLGTLRYGTPIMHVTADRTERHGLATIGYDDEGVETQSWDLVADG
FT                   ILVGYQLDRAFAPRLGLERSNGCSYADSPHHVPIQRMANVSLQPDPDADRSTDDLISDV
FT                   EDGIYVVGDKSWSIDMQRYNFQFTGQRFYRIRGGKLDGQLRDVAYQATTTDFWGSMDAV
FT                   GGRSTWQLGGAFNCGKAQPGQVAAVSHGCPSALFRGVNVLNTRTEGGR"
FT   gene            222787..224148
FT                   /locus_tag="RHA1_ro00163"
FT   CDS_pept        222787..224148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00163"
FT                   /product="possible modulator of DNA gyrase protein, TldD"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00163"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91999"
FT                   /db_xref="GOA:Q0SKD7"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD7"
FT                   /protein_id="ABG91999.1"
FT                   /translation="MIAPQQLVEQVLARATVDETIVIVTDASEASLRWAGNSMTTNGVS
FT                   TSRSWTVISIVRAGEDAKVGIVTSASVDAADIDGVVRSAEIAARAATPASDAMPLLTGT
FT                   EADERWDDSAERTEIGAFEQLAQDLSMGFDGSDQLYGFAHHQLHTTWLGTSTGIRRRFA
FT                   QPTGSVEINGKRGDASAWVGTSTKDFTDVASVKLLQDLSTRLDWARNRVELPAGRYETI
FT                   LPPSAVADLMIYLMWTMEGRAAEEGHSALSAPGGTRIGEKLSALPLTLYSDPAALGLEY
FT                   TPFVVTGSSSESVSVFDNGMDAGRVDWIRDGTVNALAYPRAAAKEFGADVTAPGDNLIL
FT                   DAGGSVSLEQMVAETERGLLLTTLWYIREVDPATLLLTGLTRDGVYLVENGKVTGAVNN
FT                   FRFNESPLDLLRRVTQAGATERTLPREWKDWFTRTAMPALRVPDFHMSSVSKAL"
FT   gene            224367..224573
FT                   /locus_tag="RHA1_ro00164"
FT   CDS_pept        224367..224573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00164"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92000"
FT                   /db_xref="GOA:Q0SKD6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92000.1"
FT                   /translation="MHSDTTTRDLLHGHTKVTRRFALADVALTTFVCLVCATGIGIITG
FT                   SVLAAATGGLIVVLATALMVAAV"
FT   gene            224570..224917
FT                   /locus_tag="RHA1_ro00165"
FT   CDS_pept        224570..224917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00165"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92001"
FT                   /db_xref="GOA:Q0SKD5"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD5"
FT                   /protein_id="ABG92001.1"
FT                   /translation="MTAPRHQRSTTIQEITVSNDVLETAPPAHSIPHRHPDGREVLATA
FT                   KGILIATRGYGDAEAFEELLDVSRHHHVSVMRAAKSLVELATRRQPCPSVTTPAPSYAL
FT                   EFKEWTTLLAR"
FT   gene            complement(224886..225014)
FT                   /locus_tag="RHA1_ro00166"
FT   CDS_pept        complement(224886..225014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00166"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00166"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92002"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD4"
FT                   /protein_id="ABG92002.1"
FT                   /translation="MSRLWLRRFDRGPLEWLTHRGYQRLTRADRDGVTAPAASSIP"
FT   gene            complement(225020..225544)
FT                   /locus_tag="RHA1_ro00167"
FT   CDS_pept        complement(225020..225544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00167"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00167"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92003"
FT                   /db_xref="GOA:Q0SKD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92003.1"
FT                   /translation="MTSQLSSSHRYAALDVMRGAAILGTLATNIWIFTNVEGLVGYVNG
FT                   TGRATGGWAPVQAILQQFAQGKFLGLLTIMFGIGLVIQQRSAQRRGARWPGGYPWRAGL
FT                   LMLDGAPGANPARPVGRSREWAALRSVAMCCRTSCARSSATAGDSASRSGWAAPPSCRR
FT                   RSHCSVRSRQP"
FT   gene            225624..226208
FT                   /locus_tag="RHA1_ro00168"
FT   CDS_pept        225624..226208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00168"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00168"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92004"
FT                   /db_xref="GOA:Q0SKD2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD2"
FT                   /protein_id="ABG92004.1"
FT                   /translation="MPKLIDHDRRQQEIAEAVWRVIQREGIGAVSVRDVAAEAGISSGS
FT                   LRHVFASKTELLAYSMRLVATRVRERAQAHASITDPWQRALAVLDEVLPLDDRRRCEME
FT                   VNLALVAESPAHPLLKDIALDAQRQLRGACAAILTGLAQWGLIAPDIDVDAEAMRLHAL
FT                   VDGAAMHVLLGDTDTPDTARRMIAEHLRTLL"
FT   gene            complement(226267..226533)
FT                   /locus_tag="RHA1_ro00169"
FT   CDS_pept        complement(226267..226533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00169"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92005"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD1"
FT                   /protein_id="ABG92005.1"
FT                   /translation="MNHHIALRRRVDRSMRSRRVNIPRRDAHAVVIAGLLASRVLADYF
FT                   GTVTIHEKDHLADNAVHSIRKRGDLIASRTFDDGVVWLRYRPA"
FT   gene            complement(226675..227076)
FT                   /locus_tag="RHA1_ro00170"
FT   CDS_pept        complement(226675..227076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00170"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92006"
FT                   /db_xref="GOA:Q0SKD0"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019965"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKD0"
FT                   /protein_id="ABG92006.1"
FT                   /translation="MGPVTTEFDRVSSAKYVLLTTFRKDGTPVATPLWAAADGDRLLMW
FT                   TVTDSYKVKRIRRNPEVTVAACDARGKPKGPEVPARAVILDAADTDHTRDVIARKYGIL
FT                   GWLTMKGSLLRRGKTGTIGLAVTADDRRG"
FT   gene            complement(227109..230918)
FT                   /locus_tag="RHA1_ro00171"
FT   CDS_pept        complement(227109..230918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00171"
FT                   /product="cobaltochelatase"
FT                   /EC_number="6.6.1.2"
FT                   /note="GO_process: GO:0009058 - biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00171"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92007"
FT                   /db_xref="GOA:Q0SKC9"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011953"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKC9"
FT                   /protein_id="ABG92007.1"
FT                   /translation="MVPGYVRPRVASPALATAGEEAGENPARSRHCELAETGGRARPSP
FT                   AVLRPTVPHRTTATGRDTPRKAPHVILLLSTSDTDLLSARASGADYRWANPARLLVEED
FT                   LPGLLDGADLVVVRILGGRRAWEEGLDAVLASGLPVVVLGGEHAPDAELMECSTVTAGV
FT                   SAEAHNYLAEGGADNLAQLHHFLSDTVLLTGHGFEAPVHLPSWGVAPFAPAVNPERPTI
FT                   AVLYYRAQHLAGNTRYIEALCDAVDAAGGTPLPIFCASLRTAEPQLLNTLRRADAMVVT
FT                   VLAAGGTKPAGVSAGGDDEAWDVAALAALDVPILQGLCLTSSRESWESNDDGLSPLDVA
FT                   TQVAVPEFDGRLITVPFSFKEIDADGLSTYVPDAERASRVAGIAVRHARLRHIPASDRR
FT                   IALMLSAYPTKHARIGNAVGLDTPASAIRLLTEMRAAGYDLGPVDGPDSVPGLAAQDGD
FT                   ALIHALIAAGGQDPDWLTAEQLEGNPIRISAARYREWFSALPAELREGVEDHWGPAPGE
FT                   LYVDRSQDPAGEIVIAAMQFGNLVLMVQPPRGFGEKPVAIYHDPDLPPSHHYLAAYRWI
FT                   AADAAAGGFGADAVVHLGKHGNLEWLPGKTLGMSASCGTDAALGDLPLIYPFLVNDPGE
FT                   GTQAKRRAHATLVDHLIPPMARAESYGDISRLEQLLDEHSNISALDPSKLPAIRQQIWT
FT                   LMRAAKMDHDLGLEERPDEDVFDDMLLHVDGWLCEIKDVQIRDGLHILGAAPRDDAEVE
FT                   LVLAMLRARQMWGGEQNVPGLREALGLSEDGDESRTRVDDIEQQAHALVQGMHDADWEP
FT                   DAADTLTDDATVAKILRFAATEVVPRLRETDNEIAQVLHALDGGFIAAGPSGSPLRGLI
FT                   NVLPTGRNFYSVDPKAVPSRLAWETGQAMAESLLDRYKSDHGEWPRSVGLSVWGTSAMR
FT                   TSGDDIAEVFALLGVRPVWDEASRRVVNLEVIDLEELGRPRIDVTVRISGFFRDAFPHV
FT                   LALLDDAVRLVAALDEPAESNFVRAHAQADLAEHGDERRATTRIFGSKPGTYGAGLLQL
FT                   IDSKSWRGDADLADVYTTWGGFAYGRGLDGAPAADDMRTAYRRITVAAKNTDTREHDIA
FT                   DADDYFQYHGGMVATVRALTGKSPEAYIGDSTRPESVRTRTLSEETSRVFRARVVNPRW
FT                   LEAMRRHGYKGAFEMAATVDYLFGYDATTNVVADWMYEKLAESYVLDDQNRKFMEQSNP
FT                   WALHGIAERLLEAAERDMWEHPEQQTLDGLRQVYLETEGELEGD"
FT   gene            230917..232050
FT                   /locus_tag="RHA1_ro00172"
FT   CDS_pept        230917..232050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00172"
FT                   /product="probable ferredoxin--nitrite reductase"
FT                   /EC_number="1.7.7.1"
FT                   /note="GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00172"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92008"
FT                   /db_xref="GOA:Q0SKC8"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR012798"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKC8"
FT                   /protein_id="ABG92008.1"
FT                   /translation="MVDSRSRPDACPGALQVHQAADGALARVRLPGGVLTSTQLQTLAE
FT                   SARDLGNGEIELTSRGNAQLRAVRDPQEFARRLADAGLLPSETHERVRNILVSPLTGRI
FT                   GGLADLRDLVDELDRTLCADSALADLPGRTLFTLDDGRGDVSALGGDFGVHAVSETEVA
FT                   LVLAGRDSGARITTTESVKVLLDAARVFLELRDQHWRLSEIADGVERTLSALTLAPTAD
FT                   PVYGFDEHRPPIGWLDQPDGNVTLGGGLAFGILDARLAEFLAAVEKPVIVTPWKSVLLC
FT                   DLDEWSAEQVVRVLAPMGLIFDENSPWLNVSACTGQPGCEKALADVRSDARDAVARGEL
FT                   PVEGRQHWSGCERCCGRPKGEVADVVATETGYRVEEP"
FT   gene            232075..232701
FT                   /locus_tag="RHA1_ro00173"
FT   CDS_pept        232075..232701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00173"
FT                   /product="precorrin-8X methylmutase"
FT                   /EC_number="5.4.1.2"
FT                   /note="GO_function: GO:0016993 - precorrin-8X methylmutase
FT                   activity; GO_process: GO:0009236 - cobalamin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00173"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92009"
FT                   /db_xref="GOA:Q0SKC7"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKC7"
FT                   /protein_id="ABG92009.1"
FT                   /translation="MIEYIRDGAEIYRQSFATIRSEADLSAFPEDVSQAVVRMIHASGQ
FT                   VDLVDDVAFTPGVVKAARAALAGGAPILCDAQMVAAGVTRKRLPADNEVLCTLRDPRVP
FT                   VLAEQIGNTRSAAALELWGSKLEGAVVAIGNAPTALFYLLDMIESGAPRPAAIVGGPVG
FT                   FIGAAESKEALIEHPSGLDYLVVRGRRGGSAITAAALNAIASEVE"
FT   gene            232698..234200
FT                   /locus_tag="RHA1_ro00174"
FT   CDS_pept        232698..234200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00174"
FT                   /product="probable bifunctional protein, CobI-CobJ fusion
FT                   protein: S-adenosyl-L-methionine-precorrin-2 methyl
FT                   transferase + precorrin-3 methylase"
FT                   /EC_number="2.1.1.130"
FT                   /note="GO_function: GO:0030788 - precorrin-2
FT                   C20-methyltransferase activity; GO_process: GO:0009236 -
FT                   cobalamin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00174"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92010"
FT                   /db_xref="GOA:Q0SKC6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKC6"
FT                   /protein_id="ABG92010.1"
FT                   /translation="MSSEERVTGKLWGVGIGPGDPELVTVKAARVIAEADVVAFHSARH
FT                   GKSISRAVAAPYLREGQIEEHLVYPVTTETVDHPGGYQGAMDEFYEEASQRLAAHLDAG
FT                   RSVALLAAGDPLFYSSYMHMHKRLVPRFEAEVVPGVTSISAASAALAMPLVEGEEILTV
FT                   LPGTMPPGELTRRLRETDAAAILKLGRTYPAVRQALKDSGRIDETWYVERASTTRQKID
FT                   AADDVSDSDVPYFSIAIVPSPSNARRDDAAPQGELVVVGLGPGDQAWTTPEVQHELSLA
FT                   TDLVGYGPYIDRVPERPGQRRHSSDNRVEAERAAMALDLAKNGSRVAVVSSGDPGVFAM
FT                   AAAVLEVAAEEQWRGVPVRVLPGMTAANAVASRVGAPLGHDYAVLSLSDRLKPWDVVAQ
FT                   RISAVASADMAFAVYNPASKSRTWQVAAMRDLVLEHRSPDTPVIIGRDVAGAQESVRVV
FT                   RLADLDPAEIDMRCLLIVGSSMTTVVENEHGTRVFTPRRYPG"
FT   gene            complement(234206..235117)
FT                   /locus_tag="RHA1_ro00175"
FT   CDS_pept        complement(234206..235117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00175"
FT                   /product="beta lactamase"
FT                   /note="GO_component: GO:0005618 - cell wall; GO_process:
FT                   GO:0000902 - cellular morphogenesis; GO_process: GO:0009252
FT                   - peptidoglycan biosynthesis; GO_process: GO:0046677 -
FT                   response to antibiotic"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00175"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92011"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKC5"
FT                   /protein_id="ABG92011.1"
FT                   /translation="MTPSAAKRIRDVFADAGCTGWLHARRVGTPTGGDAGDIAVGADDL
FT                   VVLASVYKLPLLVALCRAFESGELSPTASVRVNPADCTPGPTGVSTFRDPVVLSWRDLA
FT                   LSMMTVSDNAAADLVLGQVGLASVERTLSELGMTSTRIIGGTADAHRSLVIDAHAHTTA
FT                   EAFAALADNDEAWTVSAYDPSYASATTPREMTSLLDAIWTGRAVPGPQGEFVRHVMSAQ
FT                   IWQHRIRSGFPYSEVDVAGKTGTIGAIRNEVAVVTFPGETPVAVAVFTRAARTDPVLPV
FT                   VDAAIGHAARIAVTELRSGRVD"
FT   gene            complement(235114..236058)
FT                   /locus_tag="RHA1_ro00176"
FT   CDS_pept        complement(235114..236058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00176"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00176"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92012"
FT                   /db_xref="GOA:Q0SKC4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKC4"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92012.1"
FT                   /translation="MPGKRWRREMGAAGTDSMVAMDLLRHLSFFVAVAEEGHFGNAASR
FT                   LGMTQPPLSQGVRRLEQRLGAELVHRSARGIGLTDAGRQLLPRARLLVADAARFEDEAH
FT                   RIAGGRDAVVRWGVPHSVADGVVVRCVRALRDADETRPTRVVTTTASTTELVDAVRTGS
FT                   LDVAVVEHPALLTGLDSGPVLKLRRWVVVPDDHPAAVAKKAQVRMLRGLALATGPRSDN
FT                   PPAHDLFVDLWRARGLDPDIVVAPGPREIFTHVAAGGHFGVTATAPTVMPGVAWVDLLR
FT                   EDLALRVRIVWRSGTDVAPSAAALDRVLLRAGR"
FT   gene            236155..237108
FT                   /locus_tag="RHA1_ro00177"
FT   CDS_pept        236155..237108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00177"
FT                   /product="beta-lactamase, penicillin binding protein"
FT                   /EC_number="3.5.2.6"
FT                   /note="GO_component: GO:0005618 - cell wall; GO_function:
FT                   GO:0008800 - beta-lactamase activity; GO_process:
FT                   GO:0000902 - cellular morphogenesis; GO_process: GO:0009252
FT                   - peptidoglycan biosynthesis; GO_process: GO:0030655 -
FT                   beta-lactam antibiotic catabolism; GO_process: GO:0046677 -
FT                   response to antibiotic"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00177"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92013"
FT                   /db_xref="GOA:Q0SKC3"
FT                   /db_xref="InterPro:IPR000871"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023650"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKC3"
FT                   /protein_id="ABG92013.1"
FT                   /translation="MSTHRNHPKPRRTGRRGAVALALALPLLLGACTATAEQAQPTTSV
FT                   AAIPDRRSLDATIDALEAQYSTRIGVTAVNPATGEVYSHRGDERFAMCSTFKAYASAAV
FT                   LRKTEDGSTSLDKTVVIEPGDLVENSPVTAAAVGAPMTLGQIAEAALTQSDNTAGNYLL
FT                   REIGGPQAITALARDVGDGGTRLDRWETELNTAFRDDPRDTTTPNGLAQGFRALLLGDA
FT                   LDTASRDQLLEWMRASKTSDKRMRAGLPTGWTAADKTGGGGFGTANDAGVAWSPDGAPL
FT                   VLAILTDSLTNQQDAQGNNQAIADTTAAVIEGLTAP"
FT   gene            complement(237273..237593)
FT                   /locus_tag="RHA1_ro00178"
FT   CDS_pept        complement(237273..237593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00178"
FT                   /product="possible serine recombinase"
FT                   /note="GO_function: GO:0000150 - recombinase activity;
FT                   GO_function: GO:0000287 - magnesium ion binding;
FT                   GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0008897 - phosphopantetheinyltransferase activity;
FT                   GO_process: GO:0006310 - DNA recombination; GO_process:
FT                   GO:0006633 - fatty acid biosynthesis; GO_process:
FT                   GO:0045449 - regulation of transcription"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00178"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92014"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKC2"
FT                   /protein_id="ABG92014.1"
FT                   /translation="MNAATDRQWAVRDAVLRWLLAKTTEGYRSPILDADAIGETVGWAP
FT                   APLNRDEVADASNYLYREGYVTGVPVMGIGIPRPMLTVAGRRVAKTERPLRRAMRGHDV
FT                   VS"
FT   gene            238301..238441
FT                   /locus_tag="RHA1_ro00179"
FT   CDS_pept        238301..238441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00179"
FT                   /product="possible hydroxyquinol 1,2-dioxygenase"
FT                   /note="GO_function: GO:0008199 - ferric iron binding;
FT                   GO_function: GO:0018576 - catechol 1,2-dioxygenase
FT                   activity; GO_function: GO:0018581 - hydroxyquinol
FT                   1,2-dioxygenase activity; GO_process: GO:0009712 - catechol
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00179"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92015"
FT                   /db_xref="GOA:Q0SKC1"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKC1"
FT                   /protein_id="ABG92015.1"
FT                   /translation="MFGVKDSLIKNFVEQPPGTPIPDGRRIGDRTWSRCGLDIVRAPEQ
FT                   I"
FT   gene            238588..239337
FT                   /locus_tag="RHA1_ro00180"
FT   CDS_pept        238588..239337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00180"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_function: GO:0016564 - transcriptional repressor
FT                   activity; GO_process: GO:0006808 - regulation of nitrogen
FT                   utilization; GO_process: GO:0009225 - nucleotide-sugar
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00180"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92016"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKC0"
FT                   /protein_id="ABG92016.1"
FT                   /translation="MKIVIFGTGLIGSQVASKLTETGHDVAALGRGDGIDTTTGKGVAE
FT                   AVEDADVVVDLTNSPSWEDDDVLAFFRESTNHLLAAEEAAGVRHHVVLSIVGADRLPDS
FT                   GYMRAKVAQEDLVKSGPIPYSIVRSTQFFEFIAGIADAGTVGDTVHATPAHLQPIASHD
FT                   VVTRVAEVAVGAPLDGTIEIAGPEPLGIDALVRRLFAATGDQRTVTTDPDTGYFGAKLD
FT                   DAAITPTPGANAWIAPTTLDEWLREHA"
FT   gene            239397..239858
FT                   /locus_tag="RHA1_ro00181"
FT   CDS_pept        239397..239858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00181"
FT                   /product="possible transcriptional regulator"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0005554 - molecular function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00181"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92017"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKB9"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92017.1"
FT                   /translation="MKLSGGVEWALHCCVVLSQAESPVPTARLAELHGVSKTYLAKHLQ
FT                   SLARAGLVHPTEGRDGGYVLTRAPEAITVLDVVQAVDGTEPAFRCTEIRRQGVLAAPPE
FT                   QCRSACGIAKVMAGAEQAWRASLSSVTIADLGATIDLTVLKHILATSTT"
FT   gene            complement(240176..240478)
FT                   /locus_tag="RHA1_ro00182"
FT   CDS_pept        complement(240176..240478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00182"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92018"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKB8"
FT                   /protein_id="ABG92018.1"
FT                   /translation="MINARRTIAAVAFAALPVLSAFGAASVAHAEPIGPNGPTGGPCPI
FT                   VNTDSQGNETVTYGKPGDRNGALVCGADGEWTVGKAGGFKGGPGQIQTQPGLSRG"
FT   gene            complement(240649..241089)
FT                   /locus_tag="RHA1_ro00183"
FT   CDS_pept        complement(240649..241089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00183"
FT                   /product="probable redox-sensitive transcriptional
FT                   activator SoxR"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_function: GO:0005506 - iron ion binding; GO_process:
FT                   GO:0006118 - electron transport; GO_process: GO:0006355 -
FT                   regulation of transcription, DNA-dependent; GO_process:
FT                   GO:0006979 - response to oxidative stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00183"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92019"
FT                   /db_xref="GOA:Q0SKB7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010211"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKB7"
FT                   /protein_id="ABG92019.1"
FT                   /translation="MSLDPKDLLSVGEVSRRTGVAVSALHYYEQLGLIASTRTSGNQRR
FT                   YERHMLRRISLIVVAKRLGIPLADVGAVFETLPADRMPSIRDWQRVSKLWRVQLEDQRK
FT                   RIERLEHELTGCIGCGCLSMKACYLLNPEDQLAVEGSGPNRL"
FT   gene            241083..242567
FT                   /locus_tag="RHA1_ro00184"
FT   CDS_pept        241083..242567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00184"
FT                   /product="possible multidrug efflux transport protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_component: GO:0019866 - organelle inner membrane;
FT                   GO_function: GO:0015520 - tetracycline:hydrogen antiporter
FT                   activity; GO_process: GO:0015904 - tetracycline transport;
FT                   GO_process: GO:0046677 - response to antibiotic"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00184"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92020"
FT                   /db_xref="GOA:Q0SKB6"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKB6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92020.1"
FT                   /translation="MTSHPPLDLESTRDFSVVCMTSTAPSPASWSELLGPRCRSTSAVL
FT                   AGGVGLHAVNIFLTTSLLPTAIGELGRESLYAWSATVFMVASVISSMTVSRLLAHRGAL
FT                   GAYLFALVPFFVGTMICAVSPSMEVLLVGRAVQGVGGGLLAGLGYAVLREALPEHLWAR
FT                   ATALVSAMWGVGTLAGPAIGGLFAQLGQWRLAFVALAVVTAAIAVIAPRALPRTERVRG
FT                   GEPVPATSLVLLTLATIAISVASIVGNRTHMLALIAVGAAFIVLFLAWERRSPRRVLPQ
FT                   STYTRASSLKWIYLTIAVLASGTVSEAFTPLFGQRLAGLVPFAAGFLGAMMSVGWSATM
FT                   IFSSDISRQRAQTAAKIAGPAVLAAGLLLTAALWRDAAGPVTVILWAGTLAIAGAGIGL
FT                   AFPHLMVAAMRSTDDEQEGAKAAAGLNTVELIAMAVGSAVAGVLVNLGAPSTLASARLL
FT                   FLGLGVIAAVGVFTAYRATRQAEREDAGRPYVRDAK"
FT   gene            complement(242546..243382)
FT                   /locus_tag="RHA1_ro00185"
FT   CDS_pept        complement(242546..243382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00185"
FT                   /product="citrate lyase"
FT                   /EC_number="4.1.3.6"
FT                   /note="GO_component: GO:0009346 - citrate lyase complex;
FT                   GO_function: GO:0000287 - magnesium ion binding;
FT                   GO_function: GO:0008815 - citrate (pro-3S)-lyase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00185"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92021"
FT                   /db_xref="GOA:Q0SKB5"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKB5"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92021.1"
FT                   /translation="MSVETAQRSEVGVAMARSWLLVPAVGSEVLAAAAASGADSLVIDL
FT                   EDGLPFAAKDEGRARTAEWLARNAGWVRINDATTPHWQRDLDAIRGLPGVRGLMLSKTE
FT                   SPEQVRDTAEGIPGIPVVALVESAAAIVAADDIARTAPVSRLAFGIGDYCRDTGAGRTP
FT                   MALAYARSRLVNASRAARIGAPIDGPTLSLDAEAVRDDTRLAREMGMTGKLTLATEQVP
FT                   VINTALAPDSNDISWAETTIARLGADGSRVTHGGHPPQLARAHDILRRAAHFASRT"
FT   gene            complement(243513..243800)
FT                   /locus_tag="RHA1_ro00186"
FT   CDS_pept        complement(243513..243800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00186"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92022"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKB4"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92022.1"
FT                   /translation="MQKKSARRTAALVGILSAPLVLGATVGAGTASAEPWHIGPVYRAE
FT                   TSGEGAEYFCGKAAALEQTSGAVIVPCTFDEPTNVWYRVVFNPASWGFDF"
FT   gene            complement(243868..244497)
FT                   /locus_tag="RHA1_ro00187"
FT   CDS_pept        complement(243868..244497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00187"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0005576 - extracellular region;
FT                   GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0004222 - metalloendopeptidase activity; GO_process:
FT                   GO:0006508 - proteolysis; GO_process: GO:0016998 - cell
FT                   wall catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00187"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92023"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKB3"
FT                   /protein_id="ABG92023.1"
FT                   /translation="MTTRNMEKYTLGWIALIGAVVTVLLGLGAGTAGGAPHDWEEVAEC
FT                   ESGGDWTTDTGNGFYGGLQFTPETWKANGGTGVASEASQAEQIRVAENVLKTQGPGAWP
FT                   VCGQYLKKGGTAPVEVPHTTPAPAPAIETPDPVETPDLVETPDVVETPDVVETPDVVEA
FT                   PATVDDSAAVKAAVKAAAQEALNSARELAEQNGSGQVFEERASAPR"
FT   gene            complement(244980..245843)
FT                   /locus_tag="RHA1_ro00188"
FT   CDS_pept        complement(244980..245843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00188"
FT                   /product="probable transcriptional regulator, LuxR family
FT                   protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0000156 - two-component response regulator
FT                   activity; GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0000160 - two-component signal
FT                   transduction system (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00188"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92024"
FT                   /db_xref="GOA:Q0SKB2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKB2"
FT                   /protein_id="ABG92024.1"
FT                   /translation="MRVPVNDTLRPSDTDAIRAELRDLRRQTDFPVLFGGTVEGGHLTL
FT                   SGFVGTRSTILRDLVIDAECGVGGRAIAEQRPIGIQDYSNSESITHEYDVQVGAEGIET
FT                   LLAVPVVVRGRTRGTLYGGLRANRPLGDRVTDRVMRGAARLARELDIRDEVDRRLAMLA
FT                   ASSGVDRGVPRDVRVSEAITESYLALRDIADRLGDDGLGAEVQAVEQKLRRLTAPGDPS
FT                   TVTLSRRESDVLAHVALGCRNAEIADRLSLSVETVKSYMRNLMGKLEVRSRQEAVVEAR
FT                   RQGLLP"
FT   gene            245955..247559
FT                   /locus_tag="RHA1_ro00189"
FT   CDS_pept        245955..247559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00189"
FT                   /product="acyl CoA synthetase, AMP-binding protein"
FT                   /note="GO_function: GO:0016208 - AMP binding; GO_function:
FT                   GO:0016874 - ligase activity; GO_process: GO:0006869 -
FT                   lipid transport; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00189"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92025"
FT                   /db_xref="GOA:Q0SKB1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKB1"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92025.1"
FT                   /translation="MSGPTLSTANHTPLSPLRFLERSASVFPDRIAVVHGDRRYSYREF
FT                   GDEVERLARVLRSRIEPGDRVAFLCPNTPEMLFAHFAVPLAGGVLIALNSRLAGRELEY
FT                   ILEHSGTSLLFVDSELVGSVATAREAVPSLREVIEIPDSTIARPMVPEGIVTGMYADFL
FT                   AAADDVDGTPLHWGVDDEQQVIAINYTSGTTGKPKGVMYTHRGAYLNSLGETFHNGFAG
FT                   STKYLWTLPMFHCNGWCTPWAVTQAAGTHICLRAVRADAIWDAIDTLGVTHLCGAPAVC
FT                   STIAEAPQAHPVDALRITTAGAPPSPTVIAQLEAIGVTVVHVYGLTEVYGPYTICEYQD
FT                   SWSDRTAEERASLLSRQGVGMVQAENARVVDAQMNDVPADGETMGEIVLRGNNVMLGYY
FT                   RDPEATAEAFAGGWFHTGDLGVMHADGYIQLKDRAKDIVISGGENISTVEVEQAMMTHP
FT                   AVLDVAVVGVPHPKWGERPKAFVIVKKGATVTAEELVEHTRGRIAKFKVPDEIVFPLEL
FT                   PRTPTGKVLKFELRNSN"
FT   gene            247642..248373
FT                   /locus_tag="RHA1_ro00190"
FT   CDS_pept        247642..248373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00190"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92026"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKB0"
FT                   /protein_id="ABG92026.1"
FT                   /translation="MGEPGVDAFAIFHAANQWVTPMVALDYDVEPGMQHRLLRKLAGRG
FT                   WRDPSPVIDGVDGVTSPVLSLRSLDGRTLLIEDDTDVLFEGVVVPPHGWIDDVRALGAV
FT                   GVIAGAGITSMPDWERQLPRLARESELLGSVATVTLTNAFGREDVNAFAYEVISALRPM
FT                   LPADALHDAGFALEDDRPHRAVIEVVASAARHQVVVPARIFDLVHRRATDRTSFGWRES
FT                   RILRRLLRKVRTDERASNAEV"
FT   gene            248615..250018
FT                   /locus_tag="RHA1_ro00191"
FT   CDS_pept        248615..250018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00191"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003824 - catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00191"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92027"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKA9"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92027.1"
FT                   /translation="MSRSVAGGASEDAERRAYARVRAGHVNAVHAALEDHLGRLDWPRD
FT                   QIERYRTDRLRALLAHARERSPFHARRLRDLDPSSASLTDLATLPMMTKRDAQDEWDAI
FT                   VTVRDLDRERAERILAEQQWFSYTSGDEQIFSSGGSSGVRGVYVWDWQFYVSAACLAWR
FT                   VQAREERRASSVRSPARLAVLAAGVPPHASTPLFDVPTAPGMETVVIPAGAPFDEIVAA
FT                   VAAARPTHLVGYATVIGRLARATVAGDLKISPARVSTNSEPLLEEDRQAIRDAWSVPIH
FT                   NLWGSTEIGVQAVGCGYGEGLHVCEDEVVLERVDDSGAPVAADAPAARTLATGLANRTF
FT                   PFIRYDLGDQVTLLPGGCACGSAFARVADIGGRRDDDFRYGTTIVPASTFRYVLGADPR
FT                   ISEYQVRQTADGAEIFAVGDPDVAALTPAVTAALRRQGVADPQVRIEVVDHLQRHLASG
FT                   KLQRFIALR"
FT   gene            250135..250452
FT                   /locus_tag="RHA1_ro00192"
FT   CDS_pept        250135..250452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00192"
FT                   /product="possible chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00192"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92028"
FT                   /db_xref="GOA:Q0SKA8"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR010958"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKA8"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92028.1"
FT                   /translation="MTDTDFGAVTENAAGALPAATDLSRVHAEIARLDAEILDAVNRRL
FT                   ALAQFAARTRVESGAPMVALGGETDVIRRYQDELGPRGSLLALELLRLARPPFSSTYRT
FT                   R"
FT   gene            250511..251125
FT                   /locus_tag="RHA1_ro00193"
FT   CDS_pept        250511..251125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00193"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0005554 - molecular function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00193"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92029"
FT                   /db_xref="GOA:Q0SKA7"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKA7"
FT                   /protein_id="ABG92029.1"
FT                   /translation="MTLGTVRLSSAIRDGTHFSWCRTCSRATVRRVAPVEMGAGTANLD
FT                   ERVPRNRGTGSVRHEELRAHFRYPEDLFTVQREMIAKYHVDDPREFFTTNAFWSVPSDP
FT                   IVDDNPHQPPFDVLVGDRGTAQPSFRPAGAIVGHNREFLSSYISAHSDPENYGKISVLQ
FT                   LPTDTLTQGPQQVQNSVISHSMSEESPPRTVRRRMRPRLSS"
FT   gene            complement(251271..251750)
FT                   /locus_tag="RHA1_ro00194"
FT   CDS_pept        complement(251271..251750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00194"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00194"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92030"
FT                   /db_xref="GOA:Q0SKA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKA6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92030.1"
FT                   /translation="MNPGPRGRLCRRCFSCGYRLPILLPRHVDLVRVADCTHGGHTAAV
FT                   GAWPSWWGAVIQLVCGAALFLGLGTRITAFIASGSTAYAYFWSHQPDGVLPIQDNGELS
FT                   AIFCWALFLMIFLGAGALALDRLIARGGRTAQSGDGDDGTAGEQGPTTELREVNA"
FT   gene            251801..252727
FT                   /locus_tag="RHA1_ro00195"
FT   CDS_pept        251801..252727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00195"
FT                   /product="5,10-methylenetetrahydromethanopterin reductase"
FT                   /EC_number="1.5.99.11"
FT                   /note="GO_function: GO:0004497 - monooxygenase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00195"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92031"
FT                   /db_xref="GOA:Q0SKA5"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019923"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKA5"
FT                   /protein_id="ABG92031.1"
FT                   /translation="MRDFRFSFNIFGFESRDALLDRCRLGESAGYDTVFAADHLGAPAP
FT                   FPLLVAAADVTCLRVGTLVLNAPFWNAALLAREIATTDVLTDGRLEIGLGAGHMKWEFD
FT                   AAGIEWKALGGRVEQLSEMVDGLRTFFTADLDELPEGRALPRPLQRRGFGGSGPPLIVG
FT                   GTGDRVLRIAAAHADIVGVAGAFQIPGRPPGTFRLATANETAERIRFVRTHAGARAEDI
FT                   EWHLLVQLVVETDDRRAAANEIADRLGGTMTVDDVLDTPYVLVGTVDEMAAQLRRHRER
FT                   YGFSYITVHEPYLELFAPVIRQLREQS"
FT   gene            complement(252739..253125)
FT                   /locus_tag="RHA1_ro00196"
FT   CDS_pept        complement(252739..253125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00196"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00196"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKA4"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92032.1"
FT                   /translation="MNLIKKSAASVLVAATVTLGAGTAHADPVVPNTGTPALAIPGRHE
FT                   VDKQKALENMLNELGVGWANGGAAGTAIGALMGLGVGCISMFPGSLAGCIIGTPIGAIT
FT                   GAIVGIGQGNPRAQQAIQEYINTP"
FT   gene            complement(253283..254422)
FT                   /locus_tag="RHA1_ro00197"
FT   CDS_pept        complement(253283..254422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00197"
FT                   /product="probable sigma factor, includes region 2"
FT                   /note="GO_component: GO:0005634 - nucleus; GO_function:
FT                   GO:0003700 - transcription factor activity; GO_function:
FT                   GO:0003899 - DNA-directed RNA polymerase activity;
FT                   GO_function: GO:0008565 - protein transporter activity;
FT                   GO_function: GO:0016853 - isomerase activity; GO_function:
FT                   GO:0016987 - sigma factor activity; GO_process: GO:0006352
FT                   - transcription initiation; GO_process: GO:0006355 -
FT                   regulation of transcription, DNA-dependent; GO_process:
FT                   GO:0006457 - protein folding; GO_process: GO:0006606 -
FT                   protein import into nucleus; GO_process: GO:0006986 -
FT                   response to unfolded protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00197"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92033"
FT                   /db_xref="GOA:Q0SKA3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014305"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKA3"
FT                   /protein_id="ABG92033.1"
FT                   /translation="MLAPRRRAVDRCSRTGVGPTTGGRAESFLVTDMSARTPDAAAADA
FT                   EAADLARARDGDDAAFTRLVGPLRRELHAHCYRMLGSSHDADDALQDALLRAWRGFARF
FT                   EGRSTLRSWLYTVATRTCLDAVESRGRRALPVDLGPSSDRAVIGDVPLTDVAWLGPYAD
FT                   AGLTAGSAGPAARYEQREAVELAFVAALQHLPGNQRAALLLFEVLGFSAAEIADTMNTS
FT                   TASVNSALQRARTIVAEKIPPVTQAHTVREIDDARLRAIVAGYSTALERGDADALVALL
FT                   TEDVTWSMPPMAHWYRGLDAVTDFAVRVPLTGCGSWRHLPVGANGQPAVAFYLWDEDAG
FT                   THLRWSITVLTLRGTKIADLTSFLGPEHFDPFGLPESLP"
FT   gene            complement(254430..254927)
FT                   /locus_tag="RHA1_ro00198"
FT   CDS_pept        complement(254430..254927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00198"
FT                   /product="possible gluconolactanase"
FT                   /note="GO_function: GO:0005488 - binding; GO_process:
FT                   GO:0006350 - transcription"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00198"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92034"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKA2"
FT                   /protein_id="ABG92034.1"
FT                   /translation="MWLWSSCSKQKGSWRNCCTISPRGFVRVVRDDLLWPNGIGISPDG
FT                   TRVYVAEFAASRVRVLGPQGASAFAHAPRGECDGLPVDVEGCVWVALGSSGGIARFSAD
FT                   GVLDELIDLAGRFVSSLAFSGTAIYITTPGALLRHDVDVQGLPVAEARVPVARLQVTGR
FT                   VG"
FT   gene            complement(254932..256215)
FT                   /locus_tag="RHA1_ro00199"
FT   CDS_pept        complement(254932..256215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00199"
FT                   /product="probable serine-type D-Ala-D-Ala
FT                   carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="GO_component: GO:0005618 - cell wall; GO_function:
FT                   GO:0004180 - carboxypeptidase activity; GO_process:
FT                   GO:0000902 - cellular morphogenesis; GO_process: GO:0009252
FT                   - peptidoglycan biosynthesis; GO_process: GO:0046677 -
FT                   response to antibiotic"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00199"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92035"
FT                   /db_xref="GOA:Q0SKA1"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKA1"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92035.1"
FT                   /translation="MLAVGVAVVIAGCSTTSEPTTSQTSNGALPATTTAAASTGSALKP
FT                   IDPAAFQAAVNAAAQELLVPGAVVQLRTPQGNFGAVVGTTELGVQTPPDEHTHFRIASN
FT                   TKTMTAALIVLLAQDGKLEFGDPVSAYVSDVPNGENITVAELLTMRSGLYNYTNSPELA
FT                   ATLDTDPAKVWTPQEVLEIAFRHPPEFPPGTSYEYSNTNYALLGLIAEKVGGRPLTEQF
FT                   RDRLFGPLGLQHTLLPAAADAATIPDRYSHGYMYGESSFAMVDEEYPADMQAAARAGTL
FT                   QPLDYTNQNSSYATAAGGAISTADDMTAWIRALVSGNVLNSEYQQQWLHSLQPEDPSTP
FT                   DGQQYGYGISYQRFGPNASMYYHGGELPGFNSFIGYDPDNDVTLVIWTNLTLSPEGKTT
FT                   ANALLPTVLDEIYAGLSLAPTPAPTTTR"
FT   gene            256240..256926
FT                   /locus_tag="RHA1_ro00200"
FT   CDS_pept        256240..256926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00200"
FT                   /product="possible oxalate decarboxylase"
FT                   /note="GO_component: GO:0016023 - cytoplasmic
FT                   membrane-bound vesicle; GO_function: GO:0008830 -
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase activity; GO_function:
FT                   GO:0045735 - nutrient reservoir activity; GO_function:
FT                   GO:0046564 - oxalate decarboxylase activity; GO_process:
FT                   GO:0009103 - lipopolysaccharide biosynthesis; GO_process:
FT                   GO:0045045 - secretory pathway"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00200"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92036"
FT                   /db_xref="GOA:Q0SKA0"
FT                   /db_xref="InterPro:IPR006045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKA0"
FT                   /protein_id="ABG92036.1"
FT                   /translation="MTTPSGRPARHVLRRGIPHRRHTASAAEFDTAYERVSAGQISLCI
FT                   VTPIPTRSFDFTGTILLGTLYVRTASHHRHGRQFHEHATQQPQHLAHRWRDRRAIRPRL
FT                   DHPDNSGHVPDPERHVDQTRADQSRCHAHPHWHANANELTYCVSGTSLVSVLDTGSTFS
FT                   TFTIGAGEMFHIDSGSLHHIENVGADVAEFIIAFRSERPEDFGLGAAFGTSPTVTSSPS
FT                   RNRIRP"
FT   gene            256923..257291
FT                   /locus_tag="RHA1_ro00201"
FT   CDS_pept        256923..257291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00201"
FT                   /product="possible oxalate decarboxylase"
FT                   /note="GO_function: GO:0008830 - dTDP-4-dehydrorhamnose
FT                   3,5-epimerase activity; GO_function: GO:0045735 - nutrient
FT                   reservoir activity; GO_function: GO:0046564 - oxalate
FT                   decarboxylase activity; GO_function: GO:0050162 - oxalate
FT                   oxidase activity; GO_process: GO:0009103 -
FT                   lipopolysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00201"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92037"
FT                   /db_xref="GOA:Q0SK99"
FT                   /db_xref="InterPro:IPR006045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK99"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92037.1"
FT                   /translation="MSLAVGSAHLARVQFWPALKDLSMYSLRIREDGMREPHWHPITAE
FT                   MGYVRRGSARMTFMDPDGSLDTWHLEEGDVSFIPRAYPHHIEVVGSEDIPLPNFPFTSS
FT                   DPLRVTRTNPLDERGVGE"
FT   gene            257753..257905
FT                   /locus_tag="RHA1_ro00202"
FT   CDS_pept        257753..257905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00202"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92038"
FT                   /db_xref="GOA:Q0SK98"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK98"
FT                   /protein_id="ABG92038.1"
FT                   /translation="MAAIKALVSGLSGKAKVALVLILTLEVLLAPVLVVLLLALVVAAV
FT                   RATAQ"
FT   gene            258190..258903
FT                   /locus_tag="RHA1_ro00203"
FT   CDS_pept        258190..258903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00203"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00203"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK97"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92039.1"
FT                   /translation="MKTKGQVALAVGAGYMLGRTHRMKMALMLAAAGATGRFPGGPRDL
FT                   LERGTKMLASSPEFAKISDSVREELINAAKAAAVTAASQRINSLNNRLLSSGGEAVGDV
FT                   GDTVDDTVSGVGNSVGKLSRVGKLGRKRRGRSQDDEYDESEVDEEQDEQPDEQYAEEDD
FT                   EYEEPEEEEAAEEEPAPRKRPAARRRTSSSGSSRPAGRSRTAKSDLDDEEAPTRGRKTR
FT                   AKATTDSAPVRRARR"
FT   gene            258909..260090
FT                   /locus_tag="RHA1_ro00204"
FT   CDS_pept        258909..260090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00204"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0016218 - polyketide synthase
FT                   activity; GO_process: GO:0017000 - antibiotic biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00204"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92040"
FT                   /db_xref="GOA:Q0SK96"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK96"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92040.1"
FT                   /translation="MTSAAKKLREAAPGDGDGSSSVLQEAMQRLVGTVAEKALSSVSDK
FT                   VANTSGRLTEYAENGGEGGLLAALTGSEKSDDDESPDESDTGGGWWEGAKQTVKDKASD
FT                   LKDAVTGGGGGGSGKGKKLKLTNIVETIDVGVPVQLAYNQWTQFADFPSFMKKVERVEQ
FT                   EADEKLEWKAQIFLSHRTWEATILEQVPDERIVWRSKGAKGFIDGAVTFHEVTPDLTRI
FT                   VLILEYHPKGLFEKTGNLWRAQGRRARLELKHFARHVMTQSILHPDDVEGWRGEIRDGQ
FT                   VVEPEEDEAETEDEQDESQPDEGEEDETEEPAETDEYEDEEPEAEEDEADEADEGEGED
FT                   EEEEEEEAPPPPRRRGRPRKTAAAAVDQAPKQRGRPRKATATKTSSSRQGARR"
FT   gene            260087..260500
FT                   /locus_tag="RHA1_ro00205"
FT   CDS_pept        260087..260500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00205"
FT                   /product="gas vesicle synthesis protein"
FT                   /note="GO_component: GO:0012506 - vesicle membrane;
FT                   GO_function: GO:0005198 - structural molecule activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00205"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92041"
FT                   /db_xref="GOA:Q0SK95"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="InterPro:IPR018493"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK95"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92041.1"
FT                   /translation="MTSIQPAGGGGGGVSGGPSSSSLADVIDTILDKGLVIDAYVRVSL
FT                   VGIELLTIDARVVVASVDTYLRFAEAVNRLEIGSGEPKGLTDLVGDVTEGGAKSKTKGA
FT                   LESAGEKLGDILGGGKEEPERERVSRKSTRGDK"
FT   gene            260500..261288
FT                   /locus_tag="RHA1_ro00206"
FT   CDS_pept        260500..261288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00206"
FT                   /product="probable gas vesicle synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00206"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92042"
FT                   /db_xref="GOA:Q0SK94"
FT                   /db_xref="InterPro:IPR009430"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK94"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92042.1"
FT                   /translation="MSTSNENTDSAEEPRTSGVYVYGIVPADVQAEEDAVGVCDGPVSI
FT                   VKHGDIAALVSEISVDRPLGKPEDLRTHAHVLDGTSRVAPVLPLRFGAVMTDEGAVEEE
FT                   LLAAHADEFAAALKELEGRAQYVVKGRYVEQAILEEIIEENEQASKLLGAIRDQPEETT
FT                   RDARMALGEIVSNAIEAKRDEDTQKVVEALESLSDSVNVREPTHEEEAAQVAALVEVAR
FT                   QEELEKAVGELAEQWDGRVDMRLLGPLAAYDFVVTQKPEG"
FT   gene            261292..261546
FT                   /locus_tag="RHA1_ro00207"
FT   CDS_pept        261292..261546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00207"
FT                   /product="possible gas vesicle synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00207"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92043"
FT                   /db_xref="InterPro:IPR007804"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK93"
FT                   /protein_id="ABG92043.1"
FT                   /translation="MGLLSFIATLPLAPVRGVISLAELIQRQVEEEAHNPASARRALEE
FT                   LEDARAAGEISAEEEEQAQQAILDRMTGTARPPSGTEKE"
FT   gene            261553..261843
FT                   /locus_tag="RHA1_ro00208"
FT   CDS_pept        261553..261843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00208"
FT                   /product="probable gas vesicle synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00208"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92044"
FT                   /db_xref="GOA:Q0SK92"
FT                   /db_xref="InterPro:IPR008634"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK92"
FT                   /protein_id="ABG92044.1"
FT                   /translation="MAEEQPPPLPAPEIAEIATHDIAQLTGKKPLGATSVMPTDDGWTV
FT                   EVEVVEDRRIPSSTDMLAMYEVVLDLDGELLSYRRTRRYIRGVGDSGSASS"
FT   gene            261840..262247
FT                   /locus_tag="RHA1_ro00209"
FT   CDS_pept        261840..262247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00209"
FT                   /product="gas vesicle synthesis protein"
FT                   /note="GO_component: GO:0012506 - vesicle membrane;
FT                   GO_function: GO:0005198 - structural molecule activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00209"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92045"
FT                   /db_xref="GOA:Q0SK91"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="InterPro:IPR018493"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK91"
FT                   /protein_id="ABG92045.1"
FT                   /translation="MTITGGGASNLPQSSGGGMGGGHQSTNLGEILERVLDKGLVIAGD
FT                   IQVNLLDIELLTIKVRLVIASLETAKEVGIDWWEHDPWLTGKNSDVELENRKLRERIAE
FT                   LESDRSVRPAVQAADTVEVEGKRRKPRNDRG"
FT   gene            262234..263013
FT                   /locus_tag="RHA1_ro00210"
FT   CDS_pept        262234..263013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00210"
FT                   /product="probable gas vesicle synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00210"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92046"
FT                   /db_xref="GOA:Q0SK90"
FT                   /db_xref="InterPro:IPR009430"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK90"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92046.1"
FT                   /translation="MTADEGVWLYSITTDRIGDAQLAGVTGVAGEPVRAVSSAGLVAVV
FT                   GTVSLSEFGQEPLQRNLEDLDWLAATARAHDAVVAAVLRCGPTVPLRLATLYLDDDRVR
FT                   LLLDERQDEFGATLRRVTGRSEWGVKAYGDAKALAQNVKEDPAATGAAGKGTAYLLRRR
FT                   AELSAQQDVERRAAGHADEIHSALLGHAVDGVRRQVTDPVLTGKRAWMIFNGTYLVDDE
FT                   RVDDFAALVSALDTARPGITLDLTGPWPPYSFAGIDG"
FT   gene            263018..263227
FT                   /locus_tag="RHA1_ro00211"
FT   CDS_pept        263018..263227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00211"
FT                   /product="probable gas vesicle protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00211"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92047"
FT                   /db_xref="GOA:Q0SK89"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK89"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92047.1"
FT                   /translation="MSEMVPADDTRRIALVDLLDRVLGGGVVITGEITLSLADVDMVRI
FT                   SLRTLIASVSALVPDPVGPEPTDD"
FT   gene            263220..263552
FT                   /locus_tag="RHA1_ro00212"
FT   CDS_pept        263220..263552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00212"
FT                   /product="gas vesicle protein, GvpK"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00212"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92048"
FT                   /db_xref="GOA:Q0SK88"
FT                   /db_xref="InterPro:IPR007805"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK88"
FT                   /protein_id="ABG92048.1"
FT                   /translation="MTEPEPVDSDAPTDIGRRVLPQRIDADPESVEKGLVTLVLTIVEL
FT                   LRQLMERQAIRRVEHGDLTDEQIERIGTTLMLLEERMAELREHFDLTPEDLNIDLGPLG
FT                   PLLSNE"
FT   gene            complement(263574..263762)
FT                   /locus_tag="RHA1_ro00213"
FT   CDS_pept        complement(263574..263762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00213"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00213"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92049"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK87"
FT                   /protein_id="ABG92049.1"
FT                   /translation="MGKKIRHKVETAEGAAKKAVGRATGNAHLEAEGSKEQAKGNAKQM
FT                   GDKVKDAGKKIKNALKH"
FT   gene            complement(263866..264924)
FT                   /locus_tag="RHA1_ro00214"
FT   CDS_pept        complement(263866..264924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00214"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /note="GO_function: GO:0016740 - transferase activity;
FT                   GO_function: GO:0016853 - isomerase activity; GO_process:
FT                   GO:0008616 - queuosine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00214"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92050"
FT                   /db_xref="GOA:Q0SK86"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK86"
FT                   /protein_id="ABG92050.1"
FT                   /translation="MTRARIPSAAEFRFVLPQRLEASGPPESRGLLRDSVRMLVSDRGR
FT                   VEHSRFHDLPRFLRPGDVVVVNASSTLAAAVDGTVDAVGPVVVHFSTDLADGDWAVEVR
FT                   APGPVSGALDTIAAGTRIILPRGVVATLVKPWPLGSTRLWRASIDGVADVAAELLATSG
FT                   RPITYAYVHERWPLSSYQTIFGRTGGSAEMASAARPFTHSMVTDLATSGVVVAPILLHT
FT                   GVSSPERGEPPIPERFEVPEQTARLVNDRRAAGGRVIAVGTTVTRALETAATSGGMAVA
FT                   GAGWTDLVLSAGRPTLVVDGLITGWHAPGASHLMLLESVVGEKAVRRAYDEALARGYLW
FT                   HEFGDSALLLRR"
FT   gene            complement(264921..265667)
FT                   /locus_tag="RHA1_ro00215"
FT   CDS_pept        complement(264921..265667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00215"
FT                   /product="possible short chain dehydrogenase"
FT                   /note="GO_function: GO:0004022 - alcohol dehydrogenase
FT                   activity; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00215"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92051"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK85"
FT                   /protein_id="ABG92051.1"
FT                   /translation="MVADVTGDKESAMNGTRTALITGGSAGLGRVSAVALAERGWEVIV
FT                   TGRRVEPLDRVAARAHSITALPGDVTDPGHRESIAVEIAARGRLDLLLNNASALGPSPM
FT                   PALARYPEDALAQVFATDVLAPLALIAALLEHVRDAGGTVINISSDAAVAAYAGWGGYG
FT                   AAKAALDHATAVLAVEEPGLAVYAFDPGDMRTEMHQAAFPGEDISDRPDPETVVPALLH
FT                   LLDSSPPSGRYRAADFVVAANTGVSS"
FT   gene            265816..266136
FT                   /locus_tag="RHA1_ro00216"
FT   CDS_pept        265816..266136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00216"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92052"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK84"
FT                   /protein_id="ABG92052.1"
FT                   /translation="MNTFAVRSALAAAAALAVFATPGVAAAAPNLHGDPTTPGTQVQVE
FT                   SDPGDSNSYTCGAVGVAGAGVGSNSSGGAGQVNGAYFGPGPVQGGCVGSDGSVYFPTGN
FT                   AE"
FT   gene            complement(266165..266845)
FT                   /locus_tag="RHA1_ro00217"
FT   CDS_pept        complement(266165..266845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00217"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_component:
FT                   GO:0016021 - integral to membrane; GO_function: GO:0008119
FT                   - thiopurine S-methyltransferase activity; GO_process:
FT                   GO:0008152 - metabolism; GO_process: GO:0046690 - response
FT                   to tellurium ion"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00217"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92053"
FT                   /db_xref="GOA:Q0SK83"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK83"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92053.1"
FT                   /translation="MSERSGPLADPFSGRQPTSHERMTGRPWDASYHEGPAPWDVGRPQ
FT                   PAVVRVASEGGFAGAVLDAGCGTGENALHVASLGLQVLGVDVAETALAIARDKADDRRI
FT                   EVEFALADAFQLDGMGRRFDTVLDCGLFHTFDAAERPRYVASVASVTEHGGTVYVLCFS
FT                   DAGPDTGPHPVSREELRAAFDPGDGWKVAAIEPDRIETRFHDNGAPAWFATIERIHPVG
FT                   GPAR"
FT   gene            266981..268015
FT                   /locus_tag="RHA1_ro00218"
FT   CDS_pept        266981..268015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00218"
FT                   /product="probable oxidoreductase"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00218"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92054"
FT                   /db_xref="GOA:Q0SK82"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK82"
FT                   /protein_id="ABG92054.1"
FT                   /translation="MSTNIGIVGYGLGGRYFHAPFVDAAEGITLGGIVTRSDSRVAQAA
FT                   ADFPGVPVFSSLGELIDSGVDAVTITTPPQTRRELVLEALGRGVHVVADKPFAPDLETA
FT                   RELVAAADDAGVLLSVYHNRRYDADIRTLKSVLPRLGDIWRVESHFDLDGADTLESGPA
FT                   GGLLRDIGAHVVDQMLWLFGPAERVDAHLDYVDRPEGRTDAGFVVNIAHRSGVYSSVSS
FT                   SKVNHLEGRRLRAFGSVGSYVADGTDVQAQALFAGVRPIDDPTGWGYERRERWGVLHTA
FT                   DGAEPVPSQRGAYQDYYTEFAAAVAGTGTQPVPARTALGTIAVLGAAREAAESGSTVVV
FT                   QSLD"
FT   gene            complement(268089..268397)
FT                   /locus_tag="RHA1_ro00219"
FT   CDS_pept        complement(268089..268397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00219"
FT                   /product="possible hydrolase"
FT                   /note="GO_function: GO:0004601 - peroxidase activity;
FT                   GO_function: GO:0016787 - hydrolase activity; GO_process:
FT                   GO:0006725 - aromatic compound metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00219"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92055"
FT                   /db_xref="GOA:Q0SK81"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK81"
FT                   /protein_id="ABG92055.1"
FT                   /translation="MRLVRLLAAMGRVDRTLSPPELALLNDHAKIDWRPTIRSSDLPVL
FT                   FVAGSDSEFWPSAHAAAAAALAPKGASTVVPRAGHATNMERPHSFNKAVAEFLDSAS"
FT   gene            268396..268773
FT                   /locus_tag="RHA1_ro00220"
FT   CDS_pept        268396..268773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00220"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92056"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK80"
FT                   /protein_id="ABG92056.1"
FT                   /translation="MPRLQIGVPWPVGGILSAKDVSTCRTLQVEPLDEGVHESGACLHR
FT                   RSVRRGRSRPVTRQIHSDDAVAGLDQRRDLIPPRRGGGCEARRQHHARRGSAVTVHGVV
FT                   DSSTAGFDGQHCFSYPPTVRG"
FT   gene            268975..269316
FT                   /locus_tag="RHA1_ro00221"
FT   CDS_pept        268975..269316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00221"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92057"
FT                   /db_xref="GOA:Q0SK79"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK79"
FT                   /protein_id="ABG92057.1"
FT                   /translation="MHISLPHSQASRAANPSGAVNRRPRITLRNRFATAAVAAAIAVIP
FT                   LGAATTIATAAEHPVATVAAPTIPGDRGDHGDGPRHDRQRDQRQERRDQSMTLDELLIG
FT                   WNSSQIYQM"
FT   gene            complement(269378..269848)
FT                   /locus_tag="RHA1_ro00222"
FT   CDS_pept        complement(269378..269848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00222"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK78"
FT                   /protein_id="ABG92058.1"
FT                   /translation="MDDIIDFVEGLGDVLTLRPAPGDGSPEISWGDTFFYYSPDRIVPD
FT                   RTQPFATIVTKNYPGDESSGLDRAGAFRVNIHAGKEAFIEATGHAPREQGVADVDAGAR
FT                   DTVIAHPVYGSLAWLAVIDPGSRTGEVTRALLCRAHALARSRYERRAESTPR"
FT   gene            269918..270688
FT                   /locus_tag="RHA1_ro00223"
FT   CDS_pept        269918..270688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00223"
FT                   /product="possible transcriptional regulator, MerR family
FT                   protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00223"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92059"
FT                   /db_xref="GOA:Q0SK77"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK77"
FT                   /protein_id="ABG92059.1"
FT                   /translation="MTSLQSRHLRTVDVARRAGCSVQHVRNLERDGVLPPATRTATGYR
FT                   IYTDVHVQSALAYRELAIGVGPVEATRIVRSVHTCPAATTVALLDAAHARLHTERTELA
FT                   LAKQAAEAISTEPVDDVQASDWMSVSELAAALGIRPSTLRHWDAEGLVVPDRDTPTGAR
FT                   RYSPSQVRDARVVHQLRKAGYRIAPLHAVMTQLGHTPGSGDIGAALAARDQATTARSRA
FT                   LLDATSALTVLLALREGGVSARATTPPPENRNPR"
FT   gene            complement(270639..271430)
FT                   /locus_tag="RHA1_ro00224"
FT   CDS_pept        complement(270639..271430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00224"
FT                   /product="probable SAM-dependent methyltransferase"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0008757 - S-adenosylmethionine-dependent
FT                   methyltransferase activity; GO_process: GO:0046690 -
FT                   response to tellurium ion"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00224"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92060"
FT                   /db_xref="GOA:Q0SK76"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK76"
FT                   /protein_id="ABG92060.1"
FT                   /translation="MARSSSEDRPRRPWHPADRDSRRRNTVGLRVGAEVVSHTVAVARR
FT                   AGRIEEESVMSARTPEERIPSQWEEITAADPGHSMWYVERFRAMEAQGKDIVGEARLVD
FT                   AMLGRGGRVLDAGCGLGRLGGYLHDAGHVVVGVDVDPVLISVAEEDHPGPTWLVGDLAE
FT                   LDLPARGVTADFEVIVCAGNVMTFLAPSTREAVLTEFAAHLAPTGRVVVGFGADRGYEF
FT                   SQFLADAQAGGLTADLLFSTWDLRPFSEDSDFLVAVLSRAH"
FT   gene            271429..271851
FT                   /locus_tag="RHA1_ro00225"
FT   CDS_pept        271429..271851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00225"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00225"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92061"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK75"
FT                   /protein_id="ABG92061.1"
FT                   /translation="MPESVPDRVQITDRLHVVADLLDTKDWPGFAATLTEDVVAYGRTG
FT                   PVDVVARVRSHLDVCGATQHLLGNIRVDVDGDAARTRSYFRAFHVGLGERAGATYECLG
FT                   EYRDEWRRGPSAWLLAGRVIDVRAEIGDRGVIAPLS"
FT   gene            complement(271866..272957)
FT                   /locus_tag="RHA1_ro00226"
FT   CDS_pept        complement(271866..272957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00226"
FT                   /product="ABC sugar transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="tc: 3.A.1.2; GO_component: GO:0042597 - periplasmic
FT                   space; GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006935 - chemotaxis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00226"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92062"
FT                   /db_xref="GOA:Q0SK74"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK74"
FT                   /protein_id="ABG92062.1"
FT                   /translation="MKRRVRAFSVAAAVAAVVLGACAAPAPQGDDAQEKVFFFLPNTTT
FT                   TRFVERDEPLFTDFLELFAPEATVTVRNAEGDPARQQSQVESAIAEGASVLVLISTDAR
FT                   FSGGALTAAAEADVPVVLYDHDAVGGPADVQVIFDPLEVGRRQGSRAADLIAAMPGDGV
FT                   KIARVGGNLGEYGTRQFLLGQDEFLQPLADSGKIRVVCETAIDDWDPAEGQAFAEECLA
FT                   RENNDIALFVTMNDDLGGGIVAALAGRGLAGRIPVTGGQDANLAALQLIAQETLDNTIF
FT                   KNLSDQAKVAAQLTTSILHGDGIPEEIVNGTIDNQYMAVPTVFLPVQNITKDNLDVVVN
FT                   SGFYTWQQICAPDPASAVCGDHS"
FT   gene            273108..274472
FT                   /locus_tag="RHA1_ro00227"
FT   CDS_pept        273108..274472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00227"
FT                   /product="possible membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00227"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92063"
FT                   /db_xref="GOA:Q0SK73"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK73"
FT                   /protein_id="ABG92063.1"
FT                   /translation="MFHQDRGAVSSGDRDTSTADEHLLNESLLVEPEVRRRPWREFLAS
FT                   TPGRLSLLAVVLVAVALTAGLVTSAVVAARQQRMETLRAHTEPLADAAQNLFSSLSIAD
FT                   AAATSSFIAGAIEPLAVRDRYNQALGDASNALVTASYGVTSGDVESLRLLTEMSRHVAV
FT                   YTDLVATARSNDSAGNPVGVAYLGTASALMQDTILPLAEHLYNDQARAVADTQSHTARL
FT                   PATAIVVASAGVVVLAVAHAYVAHRSRRRVNPGLACATVLLAALVVWIVIAGLLSTSAS
FT                   ERARIDGAEPLAAVTKARILAQQARADETLGLLRPGFDPAGSDYARHTDALSAILNSDA
FT                   SRNTVIAPTIADASAAFDGWRSAHRDLQQKLADGDYQGAADVAVGPGATASTAQFRALD
FT                   ESLEDAITALRTEELDAMRESYRTMAALAVGGIVLAVSAALAVVAGIEPRVSEYH"
FT   gene            274472..275461
FT                   /locus_tag="RHA1_ro00228"
FT   CDS_pept        274472..275461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00228"
FT                   /product="ABC amino acid transporter, periplasmic substrate
FT                   binding protein"
FT                   /note="tc: 3.A.1.3; GO_component: GO:0016020 - membrane;
FT                   GO_component: GO:0030288 - periplasmic space (sensu
FT                   Proteobacteria); GO_function: GO:0000287 - magnesium ion
FT                   binding; GO_function: GO:0004970 - ionotropic glutamate
FT                   receptor activity; GO_function: GO:0005234 -
FT                   glutamate-gated ion channel activity; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00228"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92064"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK72"
FT                   /protein_id="ABG92064.1"
FT                   /translation="MVRTHPERRPRSTRLLGCLAFGAVLIAGCGAPDAPAPRFSGDFTE
FT                   FPLSAGAQLIAPSDTPPPDTETPACAAPASLRPGTPSFGGTLGDIRARGTVVVAVDQNT
FT                   NLFSFRDPTTGTLTGFGVDLAREVARDLLGDPTKVEFRPLGTDDGAEMLADRDADMVVR
FT                   PVALPCQGLQDLTFSTVYLEASRRLVVRDGSGISGPADLARRRVCTHHDPASMSALSRI
FT                   APKATILAVPDWDDCLMAIQQRQADAVAGAAFLAGLVAQDPNLEIVGPETDSAQYAIGL
FT                   APGNDDLVRFVNGTLERLRTDGTWAALYERWLSSLGPAPGPPAPEYRD"
FT   gene            complement(275519..275923)
FT                   /locus_tag="RHA1_ro00229"
FT   CDS_pept        complement(275519..275923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00229"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92065"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK71"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92065.1"
FT                   /translation="MELVERAVSAEIDAAARAVITAAAAEASRHADEIIGTGPLPGTAE
FT                   WDAEQGTDIPNQRTLAWHLLSLRIQLAAGLDGIETVLGLRFQGATWATIGKAAGMTRQS
FT                   AHERWGSRTTALLDPMGTGLPKTVADDDPS"
FT   gene            complement(276099..276863)
FT                   /locus_tag="RHA1_ro00230"
FT   CDS_pept        complement(276099..276863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00230"
FT                   /product="haloacid dehalogenase"
FT                   /EC_number="3.8.1.2"
FT                   /note="GO_function: GO:0018784 - (S)-2-haloacid
FT                   dehalogenase activity; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00230"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92066"
FT                   /db_xref="GOA:Q0SK70"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="PDB:3UMG"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK70"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92066.1"
FT                   /translation="MAGVPFRSPSTGRNVRAVLFDTFGTVVDWRTGIATAVADYAARHQ
FT                   LEVDAVAFADRWRARYQPSMDAILSGAREFVTLDILHRENLDFVLRESGIDPTNHDSGE
FT                   LDELARAWHVLTPWPDSVPGLTAIKAEYIIGPLSNGNTSLLLDMAKNAGIPWDVIIGSD
FT                   INRKYKPDPQAYLRTAQVLGLHPGEVMLAAAHNGDLEAAHATGLATAFILRPVEHGPHQ
FT                   TDDLAPTGSWDISATDITDLAAQLRAGSTGFR"
FT   gene            complement(276965..277291)
FT                   /locus_tag="RHA1_ro00231"
FT   CDS_pept        complement(276965..277291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00231"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92067"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK69"
FT                   /protein_id="ABG92067.1"
FT                   /translation="MVVVEGYSNMRGHAMSSSAPTAARSRRAENWSAAMASNPTDVSNF
FT                   LVSESPSPTLVVESEASCTACPHSADSHDELGIRFCAVTSARSLERKCICAGDQVSGQH
FT                   YSRY"
FT   gene            277548..304163
FT                   /locus_tag="RHA1_ro00232"
FT   CDS_pept        277548..304163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00232"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /EC_number="5.1.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00232"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92068"
FT                   /db_xref="GOA:Q0SK68"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK68"
FT                   /protein_id="ABG92068.1"
FT                   /translation="MDTRNRSDATVRSRPDAFPLTPVQRGIWLAQRLAPDVPRCIAQYV
FT                   EVRGALDLAALDDASVTAGREFQSAFLRVFEIDGQPFQIVDPTIELSTGYVDLGDEPDP
FT                   VAAAHAWMTRDYTAPLDPTRDRLATSTVLQIGDDCYLWYSRIHHVALDGYGAMTLVNRI
FT                   AALYTARVEARTPQPAGAADLRTLHRLDEEYRSSRHYESDRAYWRDRLAGLRSNSSLSP
FT                   TVAPAVADSILEKTLLSTAATERLDRSGERLGTPPATGVIAAFATYLARMTGQDDVVVD
FT                   LPVSGRTTTLLQRSGGMLVGLAPLPVATAPDDTVASLTRRVHHEILGALRHQRFTLEDI
FT                   RRETDAAESLCGPMVNVMLFHRRIQFGPLTGDFHVVTSGPVEDLLVNVYRTTAAGRTVI
FT                   EFRGNPHRYSRDELARHHRSFVGLLEEFLAADPGDPVAEVHTESAHEGDRIHRRTAHLD
FT                   YWRTMLTDLAHDTPLPRDHTRRAGTVDGRREHVEAHVTADLHHRIETLGRDCPFATYTV
FT                   THAAVAALLARLGGVRDVVLGTPAGSGGWPLVLRMRVDGTESFTELVERARTTELGAFT
FT                   HADVSFDEIAAALAIPAASAGRHPFQVGFDLQTSDHPHEPDSRSDEGADLWIHIVEHPG
FT                   RAGLDLRLTFARELFEPSTIRGFADRLVRVLDQVTAHPDIPIADLDLLSSAEWRRLVPA
FT                   RGDPGVPPRTLPEILANAAHRDPDAIAVVDAAGDGTGITYRQLDAESTQLARVLLSRGA
FT                   GPETVVALALPRSADLVRAVWAVAKSGAAFLPVDPGYPEARIAHMLTDSGANLGVTVSR
FT                   HRGDLPGDVEWIELHDRNADDTTSVRTSTPVGDADRPRPLRWDHPAYLIYTSGSTGVPK
FT                   GVVVTHRGIANLIAAQIKGLDVPPTGRVAQFASPSFDASLFELLAAVGSGARVVIVPPE
FT                   VVGGTELERVLTDYQVTHAVLTPTTLATLEPRGAPTLSHLTVAGEVCPPEVVSTWAPGP
FT                   RVVNAYGPTEATIMSTISAPLVPDEPVSLGAPACGFEVVVLDDRLHPVPPGTVGELYLA
FT                   GPGLARGYRNRAGLDAVRFVAAPFGSPGTRMYRTGDLVRWRVRHGEDPSAALDLAYVGR
FT                   SDFQVKVRGFRIELGEIEAVLRADPSVGFAVATAATDPNTGDAAVIAYVHPAEGRRVDV
FT                   GEMHRRLARTLPAHMLPAAVVPLDVIPRTPSGKLDRAALPAPTFAPRSGAGHRPRTPTE
FT                   ETVASVFETVLGVTGVGVDDDYVDLGGGSLAATRVVARLNSALETSLDVRDLFEHPTVA
FT                   ALADIVESRRGDGSERPPLRRFPRPARIPLSPAQERMWFVNQYDPHSPAYDIPLVVRLT
FT                   GHLDVGALEAAIADVVERHESLRTVYPTSDDGPHQVILPAERALPRVETVRVDGPTGLD
FT                   AHVAGAAAAPFDVTVDAPLRASLFTIGDTDHVLALVIHHIAADGASAGPLARDLSAAYR
FT                   ARVEGRAPAWEPPAVQYVDYALWQHALLGRPTDPDSLASRQLDYWSESLRGSPPLLALP
FT                   TDRPRPQRRSLHGGRVDFHLPPELHAGMRALSRTCTSTLFMTCHAALAVVLARLAGTYD
FT                   VSIGTPVAGRGEPALDDVVGMFVNTLVLRTRIDPEAGFADTVRTVRDVDLGAFAHADYP
FT                   FEKLVDSLEPERTDSRSPLFQVLLEFQNVLPAGHEARELDLPGLHVAAVGYDPKICKFD
FT                   LQVWLSERRDDGGAPQGIDGRIVYATDLFDEETVRGLADRLVRVLNIVTTEPDTVVGNI
FT                   DLLTDRERDVALRSWTAPDEPGPATTLPAEFARTAARQPDAVAVSFAGDTLSYGELADR
FT                   VNRIARLLHDHGAEPERLVAVAIPHSMDYVAVTLGVLAAGGACLPLDPGWASPTQTSRT
FT                   IPDIAIFVTISAVEEHLPHGHVPTLVLDAPGTVADLARRSGHPLTAVDVGAGPSPDTAA
FT                   YVLLTRGSTALPKPVSVTHRAVLSALARPAVPAGEVWAMVPTFAPGVTVLTPWSAFLHG
FT                   GRLEVVDDATASAPSALADLLHRRGVNMVAQTPAAYEHLSRARESAPAADELRSVLLTG
FT                   DPVDAAVVAAPEVVAVYASVEAVWFAAATDRAPEAGADRMEYRPARGRRFAVLDDRLAP
FT                   VPPGVVGELYIGGPTLARGYHRRAAATSTHFVASPLGPPGERMLRTGDAACLTPTGGLN
FT                   ILWRRDFQSELRGYRIPLGDIDTVLTAHPQVANAVTVDHTPRAGKPALVTYVVPAPGST
FT                   TTISEVRAHAAMILPPPWVPGAVVVLDRLPVTETGDVDLDALPVPEELRHAPVYHAPAT
FT                   PTEKTVSRVIAQVLGIGGVGVDDNFFELGGTSLDAAKVVARIDSAFGTRIGIRSLFEAP
FT                   TVRGLATVLDASEVHPDRPALGPRAHTEPAPVSFAQQRMWFVNQFDVTSAVYNVPMVVR
FT                   LTGLLDVPALHAALIDVLVRHEPLRTLYPLTDTGPVQVVVPAESVPVDLAPIPVADAAR
FT                   VSGLVDEVVAEGFDVTVRPPVRVRLWQLDDHAHVLAVVVHHIVADGSSLAPLARDLSTA
FT                   YTARRVGRAPVWEPLPVRFSDFAVWQREVLGSVTNPASPVARQLDFWRTALADLPERLE
FT                   LPLDRPRPATASYRAAAVPFVMPERTHRRLIDFARAHDTTTFVVIHAALAVLLSRLAST
FT                   TDVVVGSPTAGRGEQTLDPLVGMFVGTLVLRTTVDPASPFGAVVAAVRDADLAAFAHAD
FT                   IPFETLVDELHPPRSAALHPLFQVMLSFQNIEPPCLGLPGLEAHVTDLEPRVSPFDLNV
FT                   VVREQPAEDGSLTGISGQIVYATDLFDAGTIRAFSSRLLRVITAALTNPETVVGDVDIL
FT                   DDAERGLVLDRWNATAHDLPATTIVDLFEAQVAATPDAPAVRGEDRILTYAELDTWSTR
FT                   LAHSFLARGIGTESIVALVIPRSVEMLAAMYAVVKSGAAVLALDPSHPTDRIESLIQSA
FT                   SAALVVTTGDADVPVPTGLPVARFDDIDHEARDTAPVTDVDRGASLHPDNLAYVVYTSG
FT                   STGAPKGVAVSHAAIANQLAWSQAQLPIHEHDRTVQKAPIAFDVAIWECFAALCSGSVL
FT                   VLLPPDRQFDLDYLSGLLDDMQITVVEFVPSLLDVFVNDHRHSFPGSLRRVLTGGEAIS
FT                   ARTASSVLAQGVRLGNMYGPAEAAVTATYHDVAAARAATTVPIGSPVWNTQVYVVDGRL
FT                   HPVVPGVTGEMYLGGAQLARGYLGRPGITAGRFVANPFGAPGSRMYRTGDLARWNPDGQ
FT                   LDYHGRTDFQVQLHGYRVEPGEVESALLRHPGIAQAVVVPRADRNGAHHLVGYVVPVPG
FT                   IDVAEEELLDHTRSLLPSHMVPSAVISLSTLPLTPHGKVDRNALPIVDFTTRAAEFRSA
FT                   GTAVEESLVTLVRDVLGLESVGVDDSFFALGGDSIMAIQLVARAKTAGLALTPRDVFEY
FT                   KTIARLARAISTRPEPRAVLSELPGGGIGSFPLPPAARWLLERGGDLDTFCQSVLLTAP
FT                   PDLNTDTLTATVQTVLDHHDMLRARLRRGTTDEDTVLEVVAAHQAPRVESLIRRVALDD
FT                   PADLKGRAEVESRAAATRLDPENGIMLQLVWLDPHTQPGHLLLTIHHLAIDGVSWRILI
FT                   PDLATAHHAHTTGTTPTLPPVTTSARRYAHALTDTTTHHTHELPHWRTILTTPDPPLGT
FT                   RPLDPTHDTEHTTTHTTTELPPHTTHTLLTTLPTTYHCGIDDALLTALALAVTTWRHRH
FT                   HTPTHTLLVTIEGHGRTNTHIPGADLTHTLGWFTTIHPALLDLTDIDLHDALTGGPATG
FT                   HALTTIKEQLHNTPDHGTGYGPLRYLNPHTATQLRNLPQPQITLNYLGRFDYPPSRPEA
FT                   GWMPVTDVDLSRRPDSDLAAAAVLTIDAATVVTEGAARLTATWSYAAGVLAATDVDDIT
FT                   ELWTEALTALADHISRPGAGRLTPSDLDLVHLDQPALDALHHHYPTLTDVWPLTPLQAG
FT                   LLFHAELGGPAADAYVVQLVLDISGPLDADRLRDAGAALLGRHPNLGAAFTHTADGTPV
FT                   QVVTTTALAWAHHDVTTAHRPAAELGDIVTADRAAPFDPAEPPLLRFTLVTTGPDDHHL
FT                   VLTNHHLVLDGWSTPLLLHELLQLYESHADPDALAPVRPYRDFLEWLGTRDVSASVAAW
FT                   GRALEGVEDATRLAPGLEPHRDPGPCAERVVALTAAETDALRTVARTHDLTLHTIIDTA
FT                   WALVLATHTGTTDITFGTTVSGRPPHIPGIETMIGLFINTIPVRITLHPTDTLTTLLTR
FT                   THTTHTQLLDHHHLPLTHIPNPHATTFDTITVHENYPHHTTTPPTDLTITTTSATDATH
FT                   YPLALAATTDTTLHLRGIFQLSAFDADSVDAILGQLARVLVAMGSDASLPIARLNLLDA
FT                   AEQRAVVPALGEAADEPRTLGAILGDAAERSPDAVAVDDGARRLTYAELEARALLLADR
FT                   LVESGVGPESVVAIAIPRSLESVLAVWAVAGTGAAFVPVDPTYPQIRIQHMVADSGVLV
FT                   GLTTSSRRDALPDTVTWIDIEGTGAGRLPHAGVSEACPAPTIRPDNAAYLIYTSGSTGV
FT                   PKGVVVGHRGVNSLATTLRECTGVTAASRVAHFASPSFDASVLEYLLTWSAGATAVIVP
FT                   TTIYGGDELRRHLADSRVTHAFLTPTTLTALDPDGLDDLECVVTGGEKCTPEVIRRWSP
FT                   HCRLINAYGPTESTVAADISDDPAADGANVIGGPIRGVTEVVLDARMQPVPIRARGELY
FT                   IAGDAIARGYHGKPALTATRFVADPFGPPGGRMYRSGDVVRWNTGREGSAVLEYLGRTD
FT                   SQVKVRGYRIEPGEIDAVLSGHPAVTFSATLPSTGGPDTTDQDATLISYVTTAGAAGPR
FT                   ELRDYLAGRLPAQLVPSAVIEIDVVPRTPSGKLDRDALRALRSTPLPAQVSAANPLEQT
FT                   VAETLAAALDLSSLGVDDDFFAAGGDSLTATRAVARVNTTLHTDLAVRSLFEAPTPRAL
FT                   ARLLLDDTQSEPRPPLTAAAQEPEYAPLSPAQQRIWFLNQYDTTTPTYNIPLTLHLTGH
FT                   LDTTALHHALTDLIHRHQPLHTTYPLHHGHPTQHIHPHPTTPPLTPTPTTETQLPHHIN
FT                   TDTTQPFDLTTDTPLHTHLYQLDNTHHTLTLVLHHIAADGHSLTPLTHDLTTAYTAHTH
FT                   HQPPHPTPLPLTYTDYTHWQHQLLGTPQHPTPTTHTQTTYWTTTLTNLPDTLPLPTDRP
FT                   RPTHRTHHGESIRFEIPADVHHRLRALARSTGATTFMTLHAAFAALLARLCDTDDVVIG
FT                   TPVAGRPDPRLDQLVGMFVGTLVLRTPVDSAGSFREVLTRTRDADLGAFMHADLPFEML
FT                   VDILAPERSTTHTPLFQVLIDYGTEVPLHLELPDLTVTVAEDTPPLAKFDLQLTLREHA
FT                   DAANPGLSAAFTYATDIFDRTTVEGVAARFLRLLDSVTADPGRPVGDVDLLDATERTAL
FT                   TTGSSTPSPPAEPVEAILADRFTRSVRRFADESALTDTGETLTYAALGARVYRLARHLV
FT                   ELGAAPDTVVAVALPPSIDLVVALLAAQQAGAGYLALDVGHPADRLDATMSDAAPVCLV
FT                   STTDHAARLRRNLPTVLADDADTRAHLLDLSPDPITDPERRAALTPDAVAYVVYTSGST
FT                   GRPKGVVVTHRNLTTLFDNTRTAFDFAETDVWTLFHSAAFDFSVWELWGALLHGGRLVI
FT                   VDTVTARAPDEFLSLLRRERVTVLCQTPTAFAQLATAERNQPTDLALRYVVFGGEALEH
FT                   GHLVDWLDRHDHTRPQLVNMYGITETTVHVTRHPLGDPRPAARSVIGRAIPGLRVYVLD
FT                   RRLHPVPTGVTGEMYVAGNQVTRGYLHRSGLTVTRYVADPAGRGGRMYRTGDLARWNAQ
FT                   GQLEFLGRSDAQVQLHGYRIEPGEVEATLVRHPDVAQAAVSVRPDDRGTERLIGYVVPV
FT                   RDGEQTRAVDIDRVLGFARTILAPHMVPATLVVLDRLPLTPNGKLDRRQLPAPDFAERV
FT                   STGRAPVTASELALAEIFAEVLGVPSVSADESFFALGGDSIMAIQLVSRAHEDGVFVTP
FT                   RDIFEHQTVAALAEVAATVKQDVLAELPGGGVGTAPLVPIARWLLERGGDLDTFCQSVL
FT                   LTAPPDLNTDTLTATVQTVLDHHDMLRARLRRGKTDQDTVLEIPPAGTIAAAPLITHVA
FT                   VETHSDNDLAATARAQLDAATHRLDPENGIMLQLVWLDPHTQPGHLLLTIHHLAIDGVS
FT                   WRILIPDLATAHHAHTTGTTPTLPPVTTSARRYAHALTDTTTHHTHELPHWRTILTTPD
FT                   PPLGTRPLDPTHDTEHTTTHTTTELPPHTTHTLLTTLPTTYHCGIDDALLTALALAVTT
FT                   WRHRHHTPTHTLLVTIEGHGRTNTHIPGADLTHTLGWFTTIHPALLDLTDIDLHDALTG
FT                   GPATGHALTTIKEQLHNTPDHGTGYGPLRYLNPHTATQLRNLPQPQITLNYLGRFDYPP
FT                   HGLSNGAGWEPITSIEFDTTILGNVPVAAILDVNAYVYESGGAPILRTTWVYPPGVLPA
FT                   ADVTELTELWTEALTALADHISRPGAGRLTPSDLDLVHLDQPALDALHHHYPTLTDVWP
FT                   LTPLQAGLLFHHELTSQDLDTYVVQLVLDIDGPLDPDRLRDAADALLGRHPNLRAAFGH
FT                   TPDGTPIQIITPAILPWNHHDLSDERDGTVAHDIVTADRTTAFDLTAPPLLRLTLITHG
FT                   PTHHQVALTHHHILLDGWSTPLLLHELLQLYEHHTDPGAVPRPLPYRRYLEWLTQQSLE
FT                   ESRAAWADVLDGLEGPTILVPSARGRVPSTFPEEYRVSLSREHTDALRTVARTHDLTLH
FT                   TIIDTAWALVLATHTGTTDITFGTTVSGRPPHIPGIETMIGLFINTIPVRITLHPTDTL
FT                   TTLLTRTHTTHTQLLDHHHLPLTHIPNPHATTFDTITVHENYPHHTTTPPTDLTITTTS
FT                   ATDATHYPLALAATTDTTLHLKFEFLPEFLSRKDTEAIAAHMCRALDVIATAPDTTVAS
FT                   VRLLGDDEFRALAPVRGGPAPATRTLATIVTDAAALDPDAVALEDSGRAVSYRDLDEAS
FT                   NRLARLLITRGAGPERYVALAIPRSADSVLAVWAITKTGAAFVPIDPGYPAARITDMIA
FT                   DSGVALGVTLTPQRERLPATVPWLVLDEPGTVTMVEQQPSGAVGDADRRRPLRPDHPAY
FT                   MIYTSGSTGVPKGVVVPHRGLATLAAAQAAGLGPGRHSRVLHFSSPSFDGSVFDYLLAF
FT                   GCGATLVISPPTIVGGTELSRFVAAERVTHAFVPTAALASADPDDLDGYDGFGEILAAG
FT                   EACPPGLVTRWSRGRALRNGYGPTETTVMSNISAPLAPGSDVTIGGPIAGAEEVVLDAR
FT                   LQPVPDGVPGELYIAGPGLARGYHRRPGLTAGRFVAAPYGPAGERMYRTGDIVRWIADT
FT                   SGGRVVEYLGRADFQVKVRGFRIEPAEVDAVLGAHPDVEYAATLTRTGPAGDPILVSYV
FT                   VGSAELAPALLSAYLTERLPAHMVPSAIVPIDRIPLTPVGKLDRAELPDPRFDSPADPA
FT                   HRPTSPVEETIANAFAAVLGLEHVGVDDNFFEAGGNSLTATRVVARVNSTLHTHIDVRT
FT                   LFEDRTPRVLSTHLDHDSNDAPLPVPTPGPQPEFVPLSPAQQRIWFLNQYDTTTPTYNI
FT                   PLTLHLTGHLDTTALHHALTDLIHRHQPLHTTYPLHHGHPTQHIHPHPTTPPLTPTPTT
FT                   ETQLPHHINTDTTQPFDLTTDTPLHTHLYQLDNTHHTLTLVLHHIAADGHSLTPLTHDL
FT                   TTAYTAHTHHQPPHPTPLPLTYTDYTHWQHQLLGTPQHPTPTTHTQTTYWTTTLTNLPD
FT                   TLPLPTDRPRPTHRTHHGDRVVFHIGRDLHRSLSALARQNNSTLFMAIHAVFAVLLARL
FT                   SGSSDIVIGTPVAGRPDPRLDPLVGMFVNTLVLRTPVDGSRSFTEVLDRTRDVDLGAFL
FT                   HADLPFERVVEAVDPARSTSRSPLFQVSLEFESVQRPEITLPDLTVTVAEYTPPVVKVD
FT                   LELVVAETFDESGDPNGIAAGFTYATDIFDAATVQGFADRLTRLLAAVVADPDHPVGDL
FT                   TLGDEDEDTSVSGPPGLPARVWPDLLTEAVERHADRLAVSDAGRALTYRQLGEDSAQFA
FT                   RLLIARGAVPEGVVALALPRSIAWVRAVWAVARSGAASVPVDPTYPLTRIAHMLADAGA
FT                   ALGLTVAGYRAQLPDTVEWLVLDDPDFETQTRHFPSTPVTDVDRTAPLRTDNPAYLIYT
FT                   SGSTGAPKGVVVSHRGLANLFEQERHHLHVTPDARVSHLASPSFDASLFELTMAFCAGA
FT                   QVVLVPPPTYGGSALADILAVERITHAFITPTALATLEPTGLDSLRVLVVAGEPCPTDL
FT                   ARRWAPGRRMLDAYGPTETTIWSHVSEPLAPAEPVTIGRPVRGFTAAVLDARLHPVPPG
FT                   TPGELYLAGPGLARGYHDRPATTATHFVACPFAAPGWRMYRTGDLVRTRPDLTLEHLGR
FT                   TDFQIKVRGFRVEPGEVDSILAARADIGFAATVGRTGPDGEPILVTYVHGATGVDVDAS
FT                   AVRTALSAQLPPYLVPAAVVVLDEVPLTPAGKLDRSALPEPEFGPRPDRFRAPSTAVER
FT                   AVVEAIAEVVDIGEDRPIGVEDDFFALGGTSLSAVRVAADLQRRLGRPVPLPALFLDPT
FT                   PAGLAARLATEVPATTDEALRVLVPLRRGDRLAPLFCVHAGMGLAWAYTGMVRHLSPDR
FT                   PVWGLQLPSLGGGPEYDSIEDLAHRYLDEVRAVQPAGPYHLLGWSLGGLIAHAMATELQ
FT                   DRGEEVASLVLLDSYAGEPIAEPDPLDVGDLLRGLGVDVGPGANSRPLRYSDASDRLRE
FT                   AYGPAAAMTADQLRRIAEGYDRSTRLAARFAPRVFRGDALLLIAEDGPHDGWGDSITGT
FT                   VQEEHVDCGHNDMMQPKPARAIGMLVENYLSGRGR"
FT   gene            complement(304139..306706)
FT                   /locus_tag="RHA1_ro00233"
FT   CDS_pept        complement(304139..306706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00233"
FT                   /product="probable non-ribosomal peptide synthetase"
FT                   /note="GO_function: GO:0005554 - molecular function
FT                   unknown; GO_function: GO:0016742 - hydroxymethyl-, formyl-
FT                   and related transferase activity; GO_function: GO:0016788 -
FT                   hydrolase activity, acting on ester bonds; GO_function:
FT                   GO:0016874 - ligase activity; GO_function: GO:0031177 -
FT                   phosphopantetheine binding; GO_function: GO:0048037 -
FT                   cofactor binding; GO_process: GO:0009058 - biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00233"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92069"
FT                   /db_xref="GOA:Q0SK67"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK67"
FT                   /protein_id="ABG92069.1"
FT                   /translation="MQYLDQVADLVVVADRRDLDTASLTLVCDVLVGVRDADTVTANPV
FT                   GRHRHGRALGGWSAEVLRSSHPLVAAREDMTATVAAAAAVVTGRRDDLSVVTVPVWRVD
FT                   RTRPPRMLGGFENWVDLAFHTSLDRTLAELAEEVKCSRQQEVSWESVKIGEMRSTATGV
FT                   LGTVTRDTGREYLPCQTAPFPLTLVPVADTGGHATLEVYADPVSVDADTAARFGQWVAR
FT                   VVNGLRDPSPRRRRVFGAAVAPVGAGVRAPVSGGRIEDLVVRQAHERPDAVAVTHGRRT
FT                   LTYRALEEQSAWMARGLHDRGVGPGDRVGICVDRSVDLVVTMLAVLRSGAAFVPMDVRH
FT                   PPDRLAYTARDAGVRLVVTELQGEARWAGVPAVTPAELPGSVSGPGEVDWAVGGDGAPA
FT                   YVVYTSGSTGRPKGVVIPHRAVPALMSATATEFAPTPGDTWSMFHSPAFDFSVWEIWGS
FT                   LSTGGRLVIVPYWISRSPVEFHTLLADERVSVLSQTPSAFVLLAAADRDLEPLSALRLV
FT                   VFGGETLDPRVVLPWLDRYPESRCRLVNMFGTTETTVHVTAHTVTRRDALTGSRTVGKP
FT                   LPGWEMAVADEFGDPLPNGLTGEIYVGGAGVALGYLDRAGLTACRFVAAPGGSRWYRTG
FT                   DRGRICDDGTLEHLGRLDTQVQIRGFRVELDEVRSVLLDDPVVTAAAVVPSGRPEDPAG
FT                   IALDAYVVPGGSAAAGGTETVAAIRERAARFLPEHMVPRSITLVDALPLTINGKIDVAR
FT                   LPAPAPRSLPHNVVEPQDGGPLTDAGTAHMLTDIWESVLGVPVSLDDNLFELGGNSLCA
FT                   IKADSMMRRLGLPALPMRELYRHPSIRGICGTLARLYLPRPDR"
FT   gene            complement(307041..307871)
FT                   /locus_tag="RHA1_ro00234"
FT   CDS_pept        complement(307041..307871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00234"
FT                   /product="short chain dehydrogenase"
FT                   /EC_number="1.1.1.243"
FT                   /note="GO_function: GO:0004022 - alcohol dehydrogenase
FT                   activity; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00234"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92070"
FT                   /db_xref="GOA:Q0SK66"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK66"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92070.1"
FT                   /translation="MSADLAGKTAFVTGAARGIGRACAVEFAAAGADLMLVDITRNLPG
FT                   VPYPLGSQSQLDYTAELCREHGATVLTQAVDVRELAEITAAVQVAHERFGRLDVLLNNA
FT                   GIAAPSGKAAHDIAESEWRLMIDVDLSGAWRTIATAGRIMVTQRSGSIINIASTAGLVG
FT                   YRHFAGYVAAKHGLVGLTKAVALDYAPSGVRVNALCPGSVRDSSEYEGRMLAEIARSLG
FT                   VGVDEHESVFVQAQPTNKLVEPGEVAAAARWLASDDARGVTGSVVTVDGGFTAR"
FT   gene            complement(307868..308578)
FT                   /locus_tag="RHA1_ro00235"
FT   CDS_pept        complement(307868..308578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00235"
FT                   /product="thioesterase"
FT                   /note="GO_function: GO:0016788 - hydrolase activity, acting
FT                   on ester bonds; GO_process: GO:0009058 - biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00235"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92071"
FT                   /db_xref="GOA:Q0SK65"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK65"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92071.1"
FT                   /translation="MSPATLVCLPYAGVGASFFRDWQSCAPRGLDILPVQLPGREERFG
FT                   EDLLTSVDAAVHDIAPRVLPVLRESSGVAVFGHSLGAVLAYELAHRLTADGDVALTRLF
FT                   VSGSPGPATVREVRASSLADEEFLDRVGELAGYSHPALANPELRELLLPVVRADVEMHE
FT                   NYRPPPRPPLDVPITALRGRGDHLVGAAQLAEWAATTTAGTSVIEVDGGHMYLTEHPHA
FT                   LVRLLAAQLAEDAR"
FT   gene            308758..309312
FT                   /locus_tag="RHA1_ro00236"
FT   CDS_pept        308758..309312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00236"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92072"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK64"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92072.1"
FT                   /translation="MHGTHTDSDMCWVSRPTELDVVGKLVHCLLHHPADCRHTWLRVDP
FT                   QQRNCRRAQRRGRSHGPRSDCEAAELIRVHVVPPTIECMGVAAAARALGRLQYRIARIP
FT                   FHLVDDTVMPAFFDDAAPARLAYEWVLIECDEAAAILFDDDFAATHAQMLRQRSAAVRY
FT                   AIARRQRQALRDTDVVVLERP"
FT   gene            309577..310521
FT                   /locus_tag="RHA1_ro00237"
FT   CDS_pept        309577..310521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00237"
FT                   /product="possible DNA ligase (ATP), C-terminal"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0003910 - DNA ligase (ATP) activity; GO_function:
FT                   GO:0005524 - ATP binding; GO_process: GO:0006260 - DNA
FT                   replication; GO_process: GO:0006281 - DNA repair;
FT                   GO_process: GO:0006310 - DNA recombination"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00237"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92073"
FT                   /db_xref="GOA:Q0SK63"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK63"
FT                   /protein_id="ABG92073.1"
FT                   /translation="MLATLGSPPGGDDWAVEMKFDGVRAVATITPAAVHLFSRDNADIT
FT                   AAYPEIAAGLSEINPGRGVIVDGEIVAPAAGSGRPRFDLLRQRTPIQDPPPALQRAVPV
FT                   AFCIFDLLVHRGAPILQWPYLERRQLLADLNLDLEGEALRVPPHWVDVAGEDMLRLADE
FT                   HGLEGIVAKRMTSPYRPGRRSPDWVKTPLRNSAEVIVGGWEATSRGGLRSLIVGAHADQ
FT                   VGLIFVGHVGSGFTESHRRRTLMLLRPLERPSSPFDDHVPDELAAHARWVEPILVGTVE
FT                   YREFTLDRRLRHPSWKGFRAGIDPRWVTVEELP"
FT   gene            310530..311678
FT                   /locus_tag="RHA1_ro00238"
FT   CDS_pept        310530..311678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00238"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92074"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK62"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92074.1"
FT                   /translation="MSRHDGFCASAGPAGLRGAALHRQELRRSGAASAKPGMELCCSSS
FT                   AFEIEAVTGLFHCYVLGGTSLRVGNRSARRPSRNRTLPPRTGGSDNREREFSTFRRRVG
FT                   SRSGPRCAGRSCSPTRADRRTYHGPIGNAPRHLPFRRAALSFMRWQIGRGVLAPLSAMP
FT                   PGSPWWRAVNERLMRDGCEAVARSGGMGGTPSSHTVDLWMLFVADPTARTWYRAHNASI
FT                   ASAYLDHRDLACTESHPERFFLNVVLLRVLYAHALVSAPRLALGRLAPAGPLLGDPRLS
FT                   MTGIFLSLSRVLPDRYPLGDDVAAYVAAEHNIGEMLDYGMIGPRLQQLYEWSADELDEP
FT                   GLLDCICDGSPTYAWSYSDREVWHPASPAATIRAVRRILPAN"
FT   gene            311681..312100
FT                   /locus_tag="RHA1_ro00239"
FT   CDS_pept        311681..312100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00239"
FT                   /product="isopentenyl-diphosphate delta-isomerase"
FT                   /EC_number="5.3.3.2"
FT                   /note="GO_function: GO:0000287 - magnesium ion binding;
FT                   GO_function: GO:0004452 - isopentenyl-diphosphate
FT                   delta-isomerase activity; GO_function: GO:0030145 -
FT                   manganese ion binding; GO_process: GO:0008299 - isoprenoid
FT                   biosynthesis; GO_process: GO:0015979 - photosynthesis;
FT                   GO_process: GO:0015995 - chlorophyll biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00239"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92075"
FT                   /db_xref="GOA:Q0SK61"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK61"
FT                   /protein_id="ABG92075.1"
FT                   /translation="MSPSAELLDEAGPQVGTVAEASVHTSATPLHLAFSAYVIDPEGQG
FT                   LVGRRARWKSTWPGVWTNSCSGHPCPGENLPEAVARRVDEVLGIIPADITLILPDFRCR
FT                   TRDPHKYVGRQYRTSLCSSGGYTVDDSPSTVVPAN"
FT   gene            complement(312022..313134)
FT                   /locus_tag="RHA1_ro00240"
FT   CDS_pept        complement(312022..313134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00240"
FT                   /product="probable aryl-alcohol dehydrogenase (NADP+)"
FT                   /EC_number="1.1.1.91"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006813 - potassium ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00240"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92076"
FT                   /db_xref="GOA:Q0SK60"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK60"
FT                   /protein_id="ABG92076.1"
FT                   /translation="MHIPIPQEQIMRLDQYVTLGRSGLRVSPFALGAMTFGEDAGGAGC
FT                   SVEESEKILATYLDLGGNFIDTANFYTNGHSEKILGDFFAAHRGRRERVVLASKFFANL
FT                   FPGDPNGGGAGRAAIIAQLHETLRRLRTDYVDVYWLHNWDRHTPIEETLRTLDDLVRAG
FT                   KIRYIGISNNPAWVTAQAQTTALLRGWTPLIALQVEYSLLARTVEGELAPLALDQGMAL
FT                   VPWSPLKNGFLSGKYRRGTEVTDSARTAFVGGPTDAEFVVIDAAAAIADDLATTSAAVA
FT                   LAWLRARSGTVVPILGARRVEHLTDNVAGLEVTLGPEHLRILDEVSAPTLNYPAPMHGE
FT                   QRAMLQFAGTTVDGESSTVYPPLLQSDVRY"
FT   gene            313256..314179
FT                   /locus_tag="RHA1_ro00241"
FT   CDS_pept        313256..314179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00241"
FT                   /product="transcriptional regulator, AraC family protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_function: GO:0016563 - transcriptional activator
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00241"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92077"
FT                   /db_xref="GOA:Q0SK59"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK59"
FT                   /protein_id="ABG92077.1"
FT                   /translation="MRNSPDLLDEIRAGITVHARPDLQTPIDGLLLSKVTAESAAPEYS
FT                   LTEPLLVIMTQGGKRLLLGDRLYEYRAGQCLVVTASVPVTGHYIDISEGAPSLAMGLVL
FT                   RPAAIAALVLQAPTERWSRGAAGVPAIETGDADVHLLDAAARMLRLLDHPADAPVLAPL
FT                   IEQEILWRLLTGPHGSTIRQIGMADSDLAHVSRAIHWIRDNYSEPMRIDDLARLSSMSA
FT                   SAFHRHFRAVTAMSPLQYQKRIRLQHARSMLVAHPGDVAGVGHHVGYDSPSQFNREYRR
FT                   LFGASPGKDAHGLRGNTALSDTGPLP"
FT   gene            314326..315222
FT                   /locus_tag="RHA1_ro00242"
FT   CDS_pept        314326..315222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00242"
FT                   /product="possible 3-oxoacyl-[acyl-carrier-protein]
FT                   reductase"
FT                   /note="GO_function: GO:0004022 - alcohol dehydrogenase
FT                   activity; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00242"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92078"
FT                   /db_xref="GOA:Q0SK58"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK58"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92078.1"
FT                   /translation="MADQYAQQDPTTQYPAPDREHQPELSHPGLTSDMVTAPDHGEKSY
FT                   RGSGRLDGRRALITGADSGIGRAVAIAFAREGADVVVSCLDEEEADARETVRLVEEAGR
FT                   RGVVATGDITSEDHCQYLVDLTVRELGGLDILVNNAAFQMVQTGGIADITTEQFDRVLR
FT                   TNLYALFWLCKKSVAVMEPGSTIVNTSSIQGTNPSPGLLDYATTKAGIIDFTKGLAADV
FT                   AKRGIRVNAVAPGPIWTPLIPATMPADGYRQFGDDVPLGRPGQPAELAPAYVFLASNES
FT                   SYVTGEVLGVTGGTPFT"
FT   gene            complement(315253..315996)
FT                   /locus_tag="RHA1_ro00243"
FT   CDS_pept        complement(315253..315996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00243"
FT                   /product="probable ATP-dependent Clp protease ATP-binding
FT                   subunit"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0004518 - nuclease activity; GO_function: GO:0005515 -
FT                   protein binding; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0008233 - peptidase activity; GO_function:
FT                   GO:0017111 - nucleoside-triphosphatase activity;
FT                   GO_process: GO:0006289 - nucleotide-excision repair;
FT                   GO_process: GO:0006457 - protein folding; GO_process:
FT                   GO:0006986 - response to unfolded protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00243"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92079"
FT                   /db_xref="GOA:Q0SK57"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK57"
FT                   /protein_id="ABG92079.1"
FT                   /translation="MENSDRTTPPIRLDELIDAIKKVHAEAPLEQLTDAVLAAEHLGEL
FT                   ADHLIGHFVDQARRSGASWTEIGKSMGVTKQAAQKRFVPKDPGQASDLDPNQGFSRFTP
FT                   RARQVVVVAQNEARAAHNAEILPQHLVLGLLADPEGLGARAIAAQGVKLDSVRHAATAT
FT                   LPPAAEEVPALVPFDAQSRKALELTFREALRLGHNYIGTEHILLALLEVEDGVGVLTGL
FT                   GVDKAAAEENIAANLDAIVAAREKE"
FT   gene            316127..316489
FT                   /locus_tag="RHA1_ro00244"
FT   CDS_pept        316127..316489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00244"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00244"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92080"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK56"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92080.1"
FT                   /translation="MHIEKDLVAASATPLVLGILAEGESYGYAILKRVNDLSGGRIQWT
FT                   DGMLYPLLHRLERLGYVSASWGASDSGRRRKHYTITAAGREMLAERRAQWDVVADALSQ
FT                   VWRSVQLPPASAQGWS"
FT   gene            316489..317835
FT                   /locus_tag="RHA1_ro00245"
FT   CDS_pept        316489..317835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00245"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00245"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92081"
FT                   /db_xref="GOA:Q0SK55"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK55"
FT                   /protein_id="ABG92081.1"
FT                   /translation="MDTDKELESQIGQWRGYVERRHAISAADTDEMEDHLRDQISDLSS
FT                   AGLRTDEAFLVAVKRMGNVDDISREFAREHSDRLWKQLVLMPAASDGDGTRATRELFVV
FT                   LGLAVGAALSVKAGVATLGEQDLARNLSLFVLPFLAGYFAWKRQVTPRLAAVLLVPFAL
FT                   AAVLLNVFPFASNGSTEVIAAIHAPIALWFAVGLAYVGGQWRSDRRRMDFIRFTGEWVV
FT                   YLTLLALGGGVLIGLTIGAFDALGLSVEWFIEDWVLPFGAAGAVIVAAWLVEAKQNVVE
FT                   NIAPVLTRVFTPLTTLMLLVLLTAFATTGSVVDVDRNLLILMDLILVVVLGLLLYAISA
FT                   RDPYLPPDLFDRLQLVLVVSALAVDLLMLFAMLTRIAEFGFTPNKVAALGMNLVLLVNL
FT                   TWSAHLILGFLRGHRGFSSTERWQTGYLPVFGMWAALMVGVLPPVFDFV"
FT   gene            317859..318542
FT                   /locus_tag="RHA1_ro00246"
FT   CDS_pept        317859..318542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00246"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00246"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92082"
FT                   /db_xref="GOA:Q0SK54"
FT                   /db_xref="InterPro:IPR011737"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK54"
FT                   /protein_id="ABG92082.1"
FT                   /translation="MFSSDREFTAYGPSYWAMIALFVVGAAVLVRLGRRQTESQARRLG
FT                   RVLAVLTAAIYGATLVHFSIPPTIGGSVPLRLTDLATVAAACALWSRAQWAYALTYYWG
FT                   LVLSTQALISPVLTGPDFPHYQFLAFWAIHLLVVWAAIYLTWGRGMRPRWRSYRFTVLV
FT                   TVVWAAVTFTFNRVAGTNYGFLNRKPATATLLDVLGPWPVYLLTATTLILVVWALMTWP
FT                   WERTR"
FT   gene            318672..319661
FT                   /locus_tag="RHA1_ro00247"
FT   CDS_pept        318672..319661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00247"
FT                   /product="rod shaping protein, MreB"
FT                   /note="GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0051082 - unfolded protein binding; GO_process:
FT                   GO:0000902 - cellular morphogenesis; GO_process: GO:0006457
FT                   - protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00247"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92083"
FT                   /db_xref="GOA:Q0SK53"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK53"
FT                   /protein_id="ABG92083.1"
FT                   /translation="MGGLGIDLGTANTVVGTPDDGIVLNEPSFMLVRTKDPHRALAIGT
FT                   EARSLVGRTPIGITPVRPMRDGVIVDLESARAFVTAVIKRVSSARRYGLRPKAVISVPA
FT                   GATPLERRALLEVGHEAGLRKVGLVPEPVAGALGCGINPMEPRAHLVVDIGGGTSEVTA
FT                   ICFGGILSHRSCRVAGDELTNALYQYLRAEHKIVVGELTAERAKLGEPDSAEGQSLVVE
FT                   GRDAVTGRARLVTLETEEIVEALRPTTTGIVQTLTECLDDLPAQAIGDVMSEGLLVIGG
FT                   GALLRGLSQLLEESFGFPVKTAERPLTCVAEGATACLVHPEVVAAYSA"
FT   gene            complement(319662..322505)
FT                   /locus_tag="RHA1_ro00248"
FT   CDS_pept        complement(319662..322505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00248"
FT                   /product="cell division protein"
FT                   /note="GO_function: GO:0003674 - molecular_function;
FT                   GO_process: GO:0009273 - cell wall biosynthesis (sensu
FT                   Bacteria)"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00248"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92084"
FT                   /db_xref="GOA:Q0SK52"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK52"
FT                   /protein_id="ABG92084.1"
FT                   /translation="MHDDKHDDKHESDPWIVGAAIVLVVLGLLNLLSTGKTADAVRHTL
FT                   FAVAGLGIMYVVSRLRMSDLRAFGWAVFTVATVLLAVVPFAGVATKGAQRWLDFGVFTV
FT                   QPSELAKLALVLVPASMLAGGFTLARFVATLAIVGVPIALVALQPDLSTAVVLVATAGF
FT                   MLILARVPLLPLVPLFVLGLASLPLAVLFLRPYQLERVHVFLSSNADPAGAGWAELQAN
FT                   IAIGSGGLWGLARDPMYAVRAEYLPESEHDLAFASLVYGWGLIAGLAVVVATSVIVWRA
FT                   ALSARTARTREAALVAAGIGALFGIHALVSIGQSLSLLPHTGMPIPLFSYGGTAAIVGF
FT                   VAIGLVLAVRRDGVARPLWTPDPRRRRRPRGMSAGTLTMTAALVAMSVFAWQLQHDRGA
FT                   EFRAMSDQQMMRCIRLPAERGLILDRNGVPLAVNVAEYAVAVVARMFDEHDDDARNRLA
FT                   AVLARSPDEVADLIDAGGEGESQVEVGRVAPDQARRIVDARLPGVLVVPTGRRQYPYGA
FT                   VLASVLGHVGVADADDMERWPHLALGSRVGKAGLEKQYDALLRGSDGKQCMYVDPSGHP
FT                   VAAGERVDPVRGHDLRLHLDIEVQNLATDALVEAMRTSKGDLGAAVVMDARNGAVLALA
FT                   SVPGADNNVYGPPADLVALAAQSQTPGPSPLLNNATQTAVPPGSTFKIVVAAANTRYPV
FT                   LSPDAVIDTGAAYTYGGHTFRNWQPMGPHNLLQAIQWSDNVYFYKLGELLGPERMADVA
FT                   GQLGVGRRSGIDLPGEAEGFLGTPENVGSIGATWYPGSTLLMGIGQGTVSATPIQVARW
FT                   TSGIATGAMVTPQLAAAYGSELTPIPTAEPQRLPFADLLGPVRAGMRASASAGTAGQLA
FT                   DLPVPAGAKTGTAEDPSAPGEGLNAWFSAVAPFDAPQIQVSVLIRGGGFGSATAGPVVK
FT                   KLLEHYFPRPPAPAPTR"
FT   gene            complement(322526..323758)
FT                   /locus_tag="RHA1_ro00249"
FT   CDS_pept        complement(322526..323758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00249"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00249"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92085"
FT                   /db_xref="GOA:Q0SK51"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK51"
FT                   /protein_id="ABG92085.1"
FT                   /translation="MIEAVTGLLARRTEPADARSDPPEHIDHDARVRGVAVGRLLAVAA
FT                   LTPEQAALLVADALHELELARGEGPYPFRLRNVTVSDAGHLTIECAGSASRRDMNEAVV
FT                   ELLRSIATNCRGSALADRLHESLAETTDLDALVHRVRQAIAPDVDPAEERRKRCQLAGL
FT                   VAATTGRPRPDTEVVGERTDVRDWPYVAAGSTLAPSGWFPPVRNPWHRKRRRPSRRQGA
FT                   LGLIAILILVAAAWMAPRVWSELRRGWDAVLNPVNPSEQNQIRPVSPPPPEPQADQPPS
FT                   ATIDVGRPPPPVDIGAPGSAGPITLVTVTRANGECLPGQACAIRVDIRLDPAAAVGAVT
FT                   WRVNVYDRCSGEVRPTSDVTLPVQPGSQQVYGIVRTDLPPGAALAVAAVTSAPATAASE
FT                   PLLVPAENARC"
FT   gene            complement(323973..325544)
FT                   /locus_tag="RHA1_ro00250"
FT   CDS_pept        complement(323973..325544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00250"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92086"
FT                   /db_xref="GOA:Q0SK50"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK50"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92086.1"
FT                   /translation="MGCAGPRPASTAKGMTSTNWTRWLPLAAVAVFVVVLAASGMVPVW
FT                   PGLLHLVALPPLDQFADLRLLLVRTASWPQFLVLLSVVSAVRVMLMAWLLGGLDARRLR
FT                   FAAMFYAAAFGPVLLATLGDATAYAALYSRAFWPAVALVGLLVVILGPVPWQGGVTVRG
FT                   AMARGWRRGLRIEVMVPYCAAVLGLGVLADRAPALTVLLLPVSAAATGLTVWAMDREPV
FT                   TRPVAALAAVLVVVTAASVIFVRTRGYDDPEPAPRQAGSLFLMSGINSRSGQGSIPRAD
FT                   VHRLGYECDQVYYFSYAGPGDGQPQRDSTCPIRSGAPYESADTQRPVEEQVALFAEQTA
FT                   NLQRPLTVAAHSHAAWIAWDAVATGRARVDVLVLVGVFPETPLGFPPPDGDRRGRVFGD
FT                   LLRWAAPVTDVVFFHFDPDTPAARQLLGTAGSAQAILGEPLPGEVRVLSITSAADLPLM
FT                   PHGWRLDVERNGCPVRAAHSSLPTSAAFEDEVIRFLDHRDPPPCPMWRDWGAVVMHAFG
FT                   SPPSGS"
FT   gene            325703..326185
FT                   /locus_tag="RHA1_ro00251"
FT   CDS_pept        325703..326185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00251"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92087"
FT                   /db_xref="GOA:Q0SK49"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR015207"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK49"
FT                   /protein_id="ABG92087.1"
FT                   /translation="MERAEAGSRGTLMTFDQFADIFRDVASLGVVREDFHRFDDVVTAK
FT                   LYDLLLVAQESAAAQHRHIVEPTDLPITRGLQENIGLFRELGPGLRVDPIVERLADYPP
FT                   LDGILATETRSGLADITGGLSVALARTFRVVYPELRTVRARTTHWSVISTLVDLYL"
FT   gene            326374..326796
FT                   /locus_tag="RHA1_ro00252"
FT   CDS_pept        326374..326796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00252"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92088"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK48"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92088.1"
FT                   /translation="MNSTKTRIAAAAATGAALGLGMFMAQSATAAAAPAQSTFPQVVSP
FT                   ESGLSPYKVEVRDRIGCANAWPMVACDAPDEDVPPQVTLVEPGTTLVEPGGTTLYGPAA
FT                   ATVDSQQGATIHQVYYPLEPDDGVISHSLDPDMPWM"
FT   gene            327004..328536
FT                   /locus_tag="RHA1_ro00253"
FT   CDS_pept        327004..328536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00253"
FT                   /product="amino acid permease, APC superfamily protein"
FT                   /note="tc: 2.A.3; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0015171 - amino acid transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00253"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92089"
FT                   /db_xref="GOA:Q0SK47"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK47"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92089.1"
FT                   /translation="MTGLYRDSLPRKFPIEREAAQMTAEDVVGAQIADQECQDCGYKPE
FT                   LKRTLGSFQVFAVSFAFISVAVGIFGTYDDVLRDAGPVGIWLWVIVALGQTLVALVIAQ
FT                   FAARIPLSGSSYQWASRLANPKIGWLFGWLTFCYLALGVVTVDNAMASSALMPLFGMQP
FT                   DENTARVITLVVVLVQAVLVVFSTRLVGLITSGAVGLELVIVVVLAIGLFAAVAISGEG
FT                   SVGNLTSRGITEGAPNYFAVGGGLMAAMIMGLATLVGFDSAANMAEEAKDPFRSVPRAI
FT                   VGSVVAAAVLGLVFLIALTIAIKDIPRVSASDTPVAAILRDQLGPVMERTLLVAIAFAF
FT                   FGAGMVTLATCSRMVFAMSRDARFPAYRLMRRVNPRTQTPIPATIMIVVVGVVLMAVLP
FT                   GGALLELLTVGTVISAVLYGAIILLYLAVRRRLDRKEGAFDLGRFELPVAIGALLWSAV
FT                   VLFVIVSPSSALTSILIAVGLLLAGGLYFAYLLIFKREVLDTEPGDADVFSH"
FT   gene            328544..329956
FT                   /locus_tag="RHA1_ro00254"
FT   CDS_pept        328544..329956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00254"
FT                   /product="possible FAD-dependent oxygenase"
FT                   /note="GO_function: GO:0003998 - acylphosphatase activity;
FT                   GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00254"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92090"
FT                   /db_xref="GOA:Q0SK46"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK46"
FT                   /protein_id="ABG92090.1"
FT                   /translation="MKPLTATTVLTGDVVRAGDSRYEAARVGWNRLYSRYPEAIVFCCD
FT                   TQDVVNAVRWARTEGIALRARSGRHSLEGWSSIDGGLVVDVSRMKSIVIDEAARTATVG
FT                   TGLTQQETVAALGQRGFVVPTGSEGGVGLGGVILGGGFGLLTRSMGLACDNLLAAEVVV
FT                   ADGARSAKVVEATEHSNSDLLWACRGGGGGNFGIATSYTLRLHELSNVTFLVARWTGHD
FT                   DLGALLRVWQRDAPVADERLTSALEVDTTAVELSALLFGGARRELEDQLRSLLAIGNPD
FT                   VTVTEGPWQTVYGDVDRGPNDVALWKFYSQFVTRPFPDEAIDLIVHYMANTPSPPSNFF
FT                   CSSFGGAVRHAPPGGSAFPHRDALFYCEPGAAWNDPALNSTALGWAADFWRALRPYGDG
FT                   AYVNVPNAAASDWEREYYGSHRERLREVKATYDPENVFSFEQSVPLSPVDPSRVLGWGD
FT                   GGQPESQGQGRP"
FT   gene            329970..330311
FT                   /locus_tag="RHA1_ro00255"
FT   CDS_pept        329970..330311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00255"
FT                   /product="possible nuclease"
FT                   /note="GO_function: GO:0003674 - molecular_function"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00255"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92091"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK45"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92091.1"
FT                   /translation="MESVEHDLTAEQWSALTEAWGGCAYCGTTDKPLQRDCVQALSRGG
FT                   RYTLDNIAPACGSCNASKCNDEVTGWLRRKRLDERAFLLRHIEIKTALALRFPTPPDTE
FT                   LEAPESTAP"
FT   gene            complement(330324..330953)
FT                   /locus_tag="RHA1_ro00256"
FT   CDS_pept        complement(330324..330953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00256"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="GO_function: GO:0000287 - magnesium ion binding;
FT                   GO_function: GO:0004845 - uracil phosphoribosyltransferase
FT                   activity; GO_process: GO:0006223 - uracil salvage;
FT                   GO_process: GO:0009116 - nucleoside metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00256"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92092"
FT                   /db_xref="GOA:Q0SK44"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SK44"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92092.1"
FT                   /translation="MGTVHVIEHPLVQHKLTMMRRKDASTNSFRRLANEISALMTYEVL
FT                   RDIPMQEIDVETPLEFTTGKVIDGKKLVFVSILRAGTGILDGMLTIVPGARVGHIGLYR
FT                   DPKTLGAVEYYFKMPGDLQERDVVVIDPMLATGNSAVAAVERLKECGPKSIKFVCLLTC
FT                   PEGVAALHKAHPDVPIYTAAVDRQLDEHGYILPGIGDAGDRLFGTK"
FT   gene            complement(330973..332238)
FT                   /locus_tag="RHA1_ro00257"
FT   CDS_pept        complement(330973..332238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00257"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00257"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92093"
FT                   /db_xref="InterPro:IPR012469"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK43"
FT                   /protein_id="ABG92093.1"
FT                   /translation="MSVTGVGPVLDTGRAEGAAAALRTTSAVRERARQLLSRAREGDSL
FT                   WFGVDDDALEAAAAEVADVTRARYPDLKIPYHSRWRHFEAGGVDRKAELDARLTALDAP
FT                   GRARAMIDLAVVSVLLDAGAGPDWHYHEVHGGQRFARSEGLGVASWHAFLSGLFSSDAA
FT                   HPLQVDAAGLCGLDTDRLAEVFQAGPSNPLVGLEGRVLLLRRLGEALAAQPEVFGTHGR
FT                   PGGLFDLLVAPQGAATATVAAHDILSQLLTSLSGIWPTGNAIDAEPLGDVWRHDAVAGP
FT                   GLTRGWMPFHKLSQWLSYSLLEPFQWAGVRVVGLDELTGLPEYRNGGLLLDTGVLRLHD
FT                   PAWAAQNWTAGDELVVEWRALTVALLDELAPLVRARLGVDPGEMPLACVLEGGTWAAGR
FT                   ALAQRSRGGLPPLNIVSDGTVF"
FT   gene            complement(332235..333506)
FT                   /locus_tag="RHA1_ro00258"
FT   CDS_pept        complement(332235..333506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00258"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="GO_function: GO:0003935 - GTP cyclohydrolase II
FT                   activity; GO_process: GO:0009231 - riboflavin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00258"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92094"
FT                   /db_xref="GOA:Q0SK42"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR022163"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK42"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92094.1"
FT                   /translation="MSAESVAATPEPTGGHIRLTSHSGGVGALPIHWGAPTPSERGPVV
FT                   GTTTNRAHRNVIGTHSGSYSIYRALAVASGALSRHHKADLTDTAPTNIIGPYPQWSEPG
FT                   KIVSLDPWGATVAEVFAAELAAGHDIRPSIAVTKAHVILPEIMEAIQKGRLHPDGRFLL
FT                   PSGAALVTKAAIEPVWHLPGVAERFHCSETDLRRVLFEETGGMYPELVTRSDLEVFLPP
FT                   IGGQTVYIFGDARDLADPGVELTARVHDECNGSDVFGSDICTCRPYLTHAIEECIQGAQ
FT                   RGGVGLVAYSRKEGRALGEVTKFLVYNARKRQVGGDTADQYFARTECVAGVQDMRFQEM
FT                   MPDVLHWLGVRKIHRLVSMSNMKYDAITGSGIEVGERVDLPADLIPADARVEIDAKMAA
FT                   GYFTPGAVPDADELAKVKGRELDG"
FT   gene            333624..335081
FT                   /locus_tag="RHA1_ro00259"
FT   CDS_pept        333624..335081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00259"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00259"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92095"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK41"
FT                   /protein_id="ABG92095.1"
FT                   /translation="MWRRRRRANADEVHGDRAWDSVAEVTKNRARAVDLRTQIEADDVF
FT                   ARGYALRATVPSSAHESAAVGAGRPDVLDFVEASNRGRLANLIPLRIGRMIASPFAFFR
FT                   GAAGLMAADLADSPVTGLTAQLCGDAHAANFGLYGTPDGHIVMDINDFDETLPGPWEWD
FT                   LKRLAASLVLAGREGGVSENGCIEAAEDAVKSYRRTIRDLAELPFLQSWNALPDKSVLE
FT                   RAKADALLDDFDKAAQKARRNTSEKVAAKWTAHLEDHETGIRRRRFIDDPPVLTHVDRA
FT                   TADAVTDGLELYVDSLRESRRNLIARFAVSDVAFRIVGTGSVGLRSYIALLHGNRDEVL
FT                   VLQLKQARPSALSAYLPVDEPKHEGKRIVHGARLVQAESDILLGWTTIDGLPFIVRQFR
FT                   NLKGDIDPTGLEQDHLDDYGRLAGALLARAHTRSLDPRVLAGYFANDTELDEVIGRYAV
FT                   SYADQTEADHATLVAAVKSGRIAAEPA"
FT   gene            complement(335334..335801)
FT                   /locus_tag="RHA1_ro00260"
FT   CDS_pept        complement(335334..335801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00260"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92096"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK40"
FT                   /protein_id="ABG92096.1"
FT                   /translation="MRRRGCRVVVFTDERLVRMNRRRWSLRRAVLVVGLAATPLVWCPG
FT                   AATAAPVSAPFQIPRVWASGTFGYCFPACIDVPVAVTGDAPGVVTFHDPALMETVVLWV
FT                   GWTNLSNGTSGVASVTKDKPGVAHTGTGVVTASAMGNLVEYVGARGIFYVP"
FT   gene            complement(336038..336454)
FT                   /locus_tag="RHA1_ro00261"
FT   CDS_pept        complement(336038..336454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00261"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92097"
FT                   /db_xref="GOA:Q0SK39"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK39"
FT                   /protein_id="ABG92097.1"
FT                   /translation="MESLALASTVFEHFAPTTTRRRPPRTERVDGRARDLVPARAPSIH
FT                   LRVVVTWVSIFPLVTLGMTVMTLSGPITSTWPTWLRALSLTGVVVPTAVYLVVPRVLDL
FT                   SVRWMTWRCRRSAGAESCESLQAARAMRSHSHQY"
FT   gene            336560..337249
FT                   /locus_tag="RHA1_ro00262"
FT   CDS_pept        336560..337249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00262"
FT                   /product="probable transcriptional regulator, TetR family
FT                   protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00262"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92098"
FT                   /db_xref="GOA:Q0SK38"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041467"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK38"
FT                   /protein_id="ABG92098.1"
FT                   /translation="MAWDTERTKRLLIEAGVAEFSSFGLAGARVDRIAAKAGVNKERIY
FT                   QYFGKKEAFFSAVLEHELATTLAAVELSGHGVVAIADYAGRRFDYQREHPTFTRLLFWE
FT                   GLELEAPVAEASRQKHAQAIVASAREAVPELSESDAQELLITVITLVDGWVALQTADRL
FT                   FSPPLPRGRDRDSRRRDFIVMTVEAATRAALTRSQSARTQPTAGSPRMGDAGSALRSSR
FT                   ADRAGKV"
FT   gene            337391..338350
FT                   /gene="chaA"
FT                   /locus_tag="RHA1_ro00263"
FT   CDS_pept        337391..338350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chaA"
FT                   /locus_tag="RHA1_ro00263"
FT                   /product="sodium calcium/ proton antiporter, CacA family
FT                   protein"
FT                   /note="bifunctional; tc: 2.A.19.1.1; GO_component:
FT                   GO:0016021 - integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00263"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92099"
FT                   /db_xref="GOA:Q0SK37"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK37"
FT                   /protein_id="ABG92099.1"
FT                   /translation="MLAAVHHAEVVAHKVGEPFGSLILAVAVTVIEVGLIVTLMISGGP
FT                   ATASLARDTVFAAVMLTVNGIMGLSLFVGARRYGVALFNAEGTGAALATVASLATLSLV
FT                   LPTFTTSRPGPEFSSAQLIFAAVASLVLYGMFVLTQTGPHRHFFLPVIPDEPVAVEDRN
FT                   AAPPSGRVAGMSLALLVLALCAVVGLAKVESPTIEDAVEDAGLPQSIVGVVIALLVLLP
FT                   ETLAAVRAAQRNRIQISLNLALGSAMASIGLTIPAIAVASIWLDGPLLLGLGPTQVVLL
FT                   AITVVVGMLTVVPGRATRLQGGVHLVLLAAYVFLSVNP"
FT   gene            338405..338959
FT                   /locus_tag="RHA1_ro00264"
FT   CDS_pept        338405..338959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00264"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92100"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK36"
FT                   /protein_id="ABG92100.1"
FT                   /translation="MRSGKFPRMETASWVGAAAAVLFGATTAAAWRKAALADQARREAE
FT                   VALDVALEQVTALTRIAEAAQRAFPQPEHVEFEVQRIRGPVDRFRLRNVGTGIATDVRF
FT                   VVDPVEEQNRRIPTPQWLQEEPVTLLPKEWADFAASALSPVSGSWRIVFPAFVTVICDE
FT                   AGAPQRVDLPTVVVAEDGVIG"
FT   gene            complement(338994..339521)
FT                   /locus_tag="RHA1_ro00265"
FT   CDS_pept        complement(338994..339521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00265"
FT                   /product="possible transcriptional regulator, PadR family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00265"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92101"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK35"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92101.1"
FT                   /translation="MAERPLNATAASLLGFLHEGSKTGWDLVVTAQERIGKFWSITTSQ
FT                   VYRELAAMERGGLIEAGERGARERKPYTLTEDGRRAFAEWIERDPAPENIRYPMLLTVA
FT                   FGAHLPPERLAAMLDSHRAAHESQLAEYERDAAVHGSNRFALATLDFGIVYERAVLEWF
FT                   DRVGNRLGQESR"
FT   gene            339520..340107
FT                   /locus_tag="RHA1_ro00266"
FT   CDS_pept        339520..340107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00266"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00266"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92102"
FT                   /db_xref="GOA:Q0SK34"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK34"
FT                   /protein_id="ABG92102.1"
FT                   /translation="MARSFAQSGVDIPLWHIDHSGSDIPQWNVIAEEGPMQYADNIRIS
FT                   DSEREQVVGELGRHLTEGRLTIGEFDQRVAQVYQSTTQQQAHQVLRDLPSAPQAVALAP
FT                   PRAPTAHPSRRRIPGHQRIEWLAWLAAGGINIAIWGIVSLATGVMIYPWPIWVIGPWGL
FT                   VLLGRTALGREGGCSRITDALHDDRTKVAVSR"
FT   gene            340513..340839
FT                   /locus_tag="RHA1_ro00267"
FT   CDS_pept        340513..340839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00267"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00267"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92103"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK33"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92103.1"
FT                   /translation="MNAEPITCGDYVTATFARDFVAEGFDHDAVERIYSGLFDEWSHAL
FT                   AQSGLFTNRTVAAALHSWQDDPHSLLDALLANADEMTLKRYDLVWEALERSHVGSAEPL
FT                   AEYA"
FT   gene            341134..341385
FT                   /locus_tag="RHA1_ro00268"
FT   CDS_pept        341134..341385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00268"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92104"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK32"
FT                   /protein_id="ABG92104.1"
FT                   /translation="MNVQAMQVSTAPEGLGRYRDAVDALHAFDNPGHRTDPRTALLFDS
FT                   LTDDLIEAAQTAGAGDTVSQRDIVAVIDTAISRPRPSL"
FT   gene            complement(341424..341837)
FT                   /locus_tag="RHA1_ro00269"
FT   CDS_pept        complement(341424..341837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00269"
FT                   /product="possible redox protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00269"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92105"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK31"
FT                   /protein_id="ABG92105.1"
FT                   /translation="MSSGVAEVSGHTVSGVPGRFILDARENHLVSDSRFGPAEAIQAGE
FT                   LLLAAIVSCAMANIQSNAEADDIRVEHIEVHASHRRGTADPTRYDFTEVRIEIHGVDQP
FT                   TADSLAARFESSCPIYNTIRRGSGIELTVTAHS"
FT   gene            complement(341834..343198)
FT                   /locus_tag="RHA1_ro00270"
FT   CDS_pept        complement(341834..343198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00270"
FT                   /product="probable dibenzothiophene desulfurziation enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00270"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92106"
FT                   /db_xref="GOA:Q0SK30"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK30"
FT                   /protein_id="ABG92106.1"
FT                   /translation="MSPSRMHLAAFVTAGPGRPGGWRYPGSVPGWLSAGYYQNIARTLE
FT                   DARFDLVFFADILSVPDRFGGSPDSQLRNGALGSMRLDPLHVLSSMGAVTSHLGLAATV
FT                   STTYAQPFTVARSFATLDHLTEGRAAWNVVTSFQESEARNFNRDEQFPRDQRYERADEF
FT                   LEVAGKLWDSWEDDALVLDTEQPLFADPDRVHPIRHKGDWFTVQGPLNVPRPPQGYPVV
FT                   IQAGASAKGKDFAARWSDVIFCSHASLESAQDFYKEIKERAAAHGRDPESVKILPSIAP
FT                   VVGATTAIAQQTFEELFDLVPPLGGLSTLAYHLDVDLSTFPLDERLPDVEVPGVEGHYQ
FT                   EVREMTEREGLTLRELGKRYGGRVEGGFIGTATEVADGLGEWFGQGACDGFMVQAPYQP
FT                   GGFEDFTRHVVPELQKRGLFRKEYEGSNLRENLGLPRVQSGEWANRVRRGAEAAL"
FT   gene            complement(343211..344296)
FT                   /locus_tag="RHA1_ro00271"
FT   CDS_pept        complement(343211..344296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00271"
FT                   /product="ABC transporter, subtrate-binding component"
FT                   /note="tc: 3.A.1.17; GO_component: GO:0016020 - membrane;
FT                   GO_component: GO:0030288 - periplasmic space (sensu
FT                   Proteobacteria); GO_function: GO:0005215 - transporter
FT                   activity; GO_process: GO:0006790 - sulfur metabolism;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00271"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92107"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK29"
FT                   /protein_id="ABG92107.1"
FT                   /translation="MSPRVTSQLRALDRRGFLRASGAGVLGLSALSLTGCGASASGAAG
FT                   GPLTEVRYALIGDGKAEPGTILRNNLGGFDLAKDLGVPVQWPSGFPASLPVMEAVKSGS
FT                   VDFSFATATAVIYAIGGGVPIVPLVAYPLPANEVDILVPQGSDITSGADLRGRKVADHR
FT                   GTTGTYSLVKYLESVGLTLEDIEYVNLPAADAEAAFAEGKVDAWISWQPTIELAKRKHN
FT                   AVALPDVKTYDYAFFVASEDFAFNHPDAAATLVRNVRDAQRWIDGNPEVAVSAFAELGG
FT                   FGNSDLEEQVYLDLVKARRLSYSGAGEFTAVDAAAINGTQDLADNFHDLGVYPDRVDVT
FT                   TWLQDSRFDSIKSVIAQALAK"
FT   gene            complement(344350..345087)
FT                   /locus_tag="RHA1_ro00272"
FT   CDS_pept        complement(344350..345087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00272"
FT                   /product="ABC transporter, ATP-binding component"
FT                   /note="tc: 3.A.1.17; GO_component: GO:0019866 - organelle
FT                   inner membrane; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0015171 - amino acid transporter activity;
FT                   GO_function: GO:0016887 - ATPase activity; GO_process:
FT                   GO:0006811 - ion transport; GO_process: GO:0006865 - amino
FT                   acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00272"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92108"
FT                   /db_xref="GOA:Q0SK28"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SK28"
FT                   /protein_id="ABG92108.1"
FT                   /translation="MPATNLVGLDLVGIGHRYRDTTVLHDIDLTVEPGEFVSFLGPSGV
FT                   GKSTLLRIIAGLEQPTHGVVESTGGTSGGTMSRMMFQEDRLLPWRNVLDNVQLGTRHQR
FT                   ERALELLYDVGLAGREKDWPSELSGGQRQRVALARALLHQPDVLLLDEPFGALDAITRV
FT                   AMQQLLERVLAEQPRTVLLVTHDVEEALVLSDRVLLLTDQGITRDLRIPHARPRHRGDA
FT                   QLAAWKEELLDGLLQADNALSSL"
FT   gene            complement(345087..345950)
FT                   /locus_tag="RHA1_ro00273"
FT   CDS_pept        complement(345087..345950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00273"
FT                   /product="ABC transporter, permease component"
FT                   /note="tc: 3.A.1.17; GO_component: GO:0016021 - integral to
FT                   membrane; GO_component: GO:0019866 - organelle inner
FT                   membrane; GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00273"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92109"
FT                   /db_xref="GOA:Q0SK27"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK27"
FT                   /protein_id="ABG92109.1"
FT                   /translation="MTETQLAAPRPTRAEPTGEDRRRPQRAVTRRRLQPSVLLPWVVPV
FT                   LVILGWQWASSAGAISPSVLPPPSKVLATAEQLWTAGELQRHLTVSLRRILIGFTLGAS
FT                   IGLVLGFVVGLSRIAEGLVDRTLQMLRALPHLALVPLLIAAFGIGELPKVVLVTLGVIF
FT                   PVYLNTVAGIRTVDPKLVQLGESYGLGRGARIRDIIVPGAMPMILTGIRYALGVAWLTL
FT                   VIAETIATSEGIGFLAQNGRDMLRNDRIVLAILLYAVAGLLADQITRLIEARVLRWNPH
FT                   YQGGNR"
FT   gene            346176..346799
FT                   /locus_tag="RHA1_ro00274"
FT   CDS_pept        346176..346799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00274"
FT                   /product="transcriptional regulator, GntR family protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00274"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92110"
FT                   /db_xref="GOA:Q0SK26"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK26"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92110.1"
FT                   /translation="MERESSAYKQLRERITGGADRPGTMLIPATIGAELGLSRTPVREA
FT                   LQRLEYEGLVVQAPRGYRVRERTPEEVLEICEARIALESAIAYSAATRHTELDLARLSR
FT                   LFEQAIESPDPATSLALHNEWHTALRSAAHNQTIAQLMDRLDAQLRVYDAEEAQASSNL
FT                   QQIETEHREILTAVQSGDAEKARILMIAHQARTRDLRIAAMARR"
FT   gene            346902..347624
FT                   /locus_tag="RHA1_ro00275"
FT   CDS_pept        346902..347624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00275"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00275"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92111"
FT                   /db_xref="GOA:Q0SK25"
FT                   /db_xref="InterPro:IPR021454"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK25"
FT                   /protein_id="ABG92111.1"
FT                   /translation="MTNDRGEDPKSRPSPGMRRRLPWLLLAAVVVVVGAVAVVAYVLTS
FT                   GADDGREARDFSPSADNPDPSLGIEGIVTVDYPPADHVQALQRVAYDQSPPFGGAHDQY
FT                   WATCTGIVYPEAIRSENAVHSLEHGAVWVTYDPDRLDDDDIAALAANVEGEPYTLMSPY
FT                   PGLDSAVSLQSWGHQLKLDDVTDPRISDFLTALRQNPNTYPEPGATCSTVRGGFDPADP
FT                   PPFDPSAPGPDAVPVDGK"
FT   gene            complement(347916..348893)
FT                   /locus_tag="RHA1_ro00276"
FT   CDS_pept        complement(347916..348893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00276"
FT                   /product="purine nucleosidase"
FT                   /EC_number="3.2.2.1"
FT                   /note="GO_function: GO:0016798 - hydrolase activity, acting
FT                   on glycosyl bonds"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00276"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92112"
FT                   /db_xref="GOA:Q0SK24"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK24"
FT                   /protein_id="ABG92112.1"
FT                   /translation="MTDRYVLVDTDAGVDDALALLTIAQHAGAEIVGVGTVFGNCTERQ
FT                   AARNALTVLSVAGMRDVPVCVGQSRPGPPPATSSPHGLDGLGDRGYRPPPGVGPAPESA
FT                   VDQLLRVAQDRPGAVDLLCLGPLANIAAAVTRDPRILTRFRSVTIMGGMGPVSRREVEA
FT                   AEQPQFLEKGDTNTNHDPVAARVVAAAPGQITWVGMSVTGRLRLAWADLVARSAVGKTA
FT                   TFVRDITEDYHRYCTGTYRSEDPIYTAHDSVAAAVMLDPTVMLSATDAQPRVYHDEDGR
FT                   AAVWGVSPVRGPAHRFVTDLDYRSIGARITATLDADPPGSDPTG"
FT   gene            complement(348985..349350)
FT                   /locus_tag="RHA1_ro00277"
FT   CDS_pept        complement(348985..349350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00277"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00277"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92113"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK23"
FT                   /protein_id="ABG92113.1"
FT                   /translation="MSNKAVVSLTTGLEDAEKVTVAFLVAVGAAEQQRETLMFLTKEAV
FT                   RLALDGTIQGVACEGCPPLPDLAARFATAGGIYMVCPICFEAKHLDKDALVSNAELAGT
FT                   VPMWKWIGDEGAVTFSY"
FT   gene            349515..350399
FT                   /locus_tag="RHA1_ro00278"
FT   CDS_pept        349515..350399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00278"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00278"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92114"
FT                   /db_xref="InterPro:IPR008585"
FT                   /db_xref="InterPro:IPR038128"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK22"
FT                   /protein_id="ABG92114.1"
FT                   /translation="MPLRLAVRHDRSTRASAAERIGIHPRMLTRMGAEPRQQARVSHGG
FT                   TTALFTLLPDTDVDEIDTIRITAGGCRRLGAAPGQTVTLDRRCTASAMTEEEAEMGGEF
FT                   IERLEDDGRHHRLVVLAPHGGAIETRTDQQAEQVVASLGSRDSTLWVCKGWRPVGNAYR
FT                   AWHISSTDLSVHSFPLLRSLSARRFRWALSFHGYRGNDVLIGGRAPARLKSDVRNAIAK
FT                   ALDGSGICVRVAERGERHSGESASNLVNRLTIDAAGGIQIEQSRAARTLHGPAIAAAVS
FT                   EVYDTWIAADNLR"
FT   gene            complement(350404..351666)
FT                   /locus_tag="RHA1_ro00279"
FT   CDS_pept        complement(350404..351666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00279"
FT                   /product="protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="GO_function: GO:0004674 - protein serine/threonine
FT                   kinase activity; GO_function: GO:0004713 - protein-tyrosine
FT                   kinase activity; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0016853 - isomerase activity; GO_process:
FT                   GO:0006468 - protein amino acid phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00279"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92115"
FT                   /db_xref="GOA:Q0SK21"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK21"
FT                   /protein_id="ABG92115.1"
FT                   /translation="MQVGALFGRYRLDRSLTVDVSGEVWAAFDTVMFRQVVVRVLPPDA
FT                   TEDDEYCDRFEREAGIAAQIRNPHIVPIHDFGQVGNRLFLATPVTQGTNLRTILQSTGP
FT                   MEVSRAVGVVEQLASALEAVRVAGLVEQEVSSANVVVQDGGLVQLTDVGLPTILGAASG
FT                   VYGLTCVLYECLTGEVFPTSAIPTPPVGMAAVIARGTAADPARRYRSVGELAAAARVAA
FT                   PPQQPAVEPAPATPPIDRNRRLIVAGLALAAIVAVAIVGGVIIGSGTSSPHVAVPTPSS
FT                   SAARPASPSSSPSAMANPTAAEQEPPVQAPPPTETPVAEAPIQEEAIPTPAPQSPPVVP
FT                   APAPPPGASAPQVLPCYPGYEHTPPPDGPCLPPGSPPANAPAPVPAPAPAPAPAPQVLP
FT                   CYPGYQHTPPPDGPCWAPAGP"
FT   gene            complement(351722..351988)
FT                   /locus_tag="RHA1_ro00280"
FT   CDS_pept        complement(351722..351988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00280"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92116"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK20"
FT                   /protein_id="ABG92116.1"
FT                   /translation="MLDPPDHVVQIPRCDVVGIPRLTDVCGPFGNPPTTDPVIEHGIEG
FT                   IAECSTHQVSPESGRSRTGTSLGAFCAYEHTTGLQREPMAPTA"
FT   gene            complement(352088..353200)
FT                   /locus_tag="RHA1_ro00281"
FT   CDS_pept        complement(352088..353200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00281"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92117"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK19"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92117.1"
FT                   /translation="MSDTIRMFLAGDVMTGRGVDQILPFPGDPELRERCVRDARGYVAL
FT                   AEKRNGPIPGPVGFGWPWGEALPILDAAEPEARVVNLETTVTTCARFASKGINYRMHPS
FT                   NLGVLTAARIDVCVLANNHLLDFGADGLVETLDVLARNGVRTVGAGRTVAQAWCPVVVE
FT                   TGRGRRLLIWAAALPSSGVSSHGAARRGRPGVAYLPEPTPAEADNVLDRTRLIRRNTDV
FT                   VAVSLHWGSNWGYDVPDAHVEFAHRLVDGGVDVVFGHSSHHPRPVEIYRGHPILYGCGD
FT                   LINDYEGIGGHERFRDDLRLLYLVTLDARTHELLELRMVPMRSRQMQLHRASRRDTEWL
FT                   RRVLDGISRDFGTRIDVGDDVLVARANHAN"
FT   gene            complement(353287..353679)
FT                   /locus_tag="RHA1_ro00282"
FT   CDS_pept        complement(353287..353679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00282"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92118"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK18"
FT                   /protein_id="ABG92118.1"
FT                   /translation="MKVTAKATRCGGWWVVEVPGVEAALTQARRLDQVSAMVADAVHLV
FT                   EDVPAEDVEVVLDYEIGDSAALMEARAAQLQVESAAHAQECAARASRAAVAHLRRSGLS
FT                   VRDIGVILELSPQRVSQLDRADARTR"
FT   gene            complement(353828..356866)
FT                   /locus_tag="RHA1_ro00283"
FT   CDS_pept        complement(353828..356866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00283"
FT                   /product="protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_function: GO:0004674 - protein serine/threonine kinase
FT                   activity; GO_function: GO:0004713 - protein-tyrosine kinase
FT                   activity; GO_function: GO:0005524 - ATP binding;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent; GO_process: GO:0006468 - protein amino acid
FT                   phosphorylation; GO_process: GO:0042829 - defense response
FT                   to pathogen"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00283"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92119"
FT                   /db_xref="GOA:Q0SK17"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK17"
FT                   /protein_id="ABG92119.1"
FT                   /translation="MADFDPDATQAAAVRAVGHGIVAELDAAGFAGAEEVGRGGFGVVY
FT                   RCLQRSLGRIVAIKVLTSDLDPENRERFLREGYAMGGLSGHPNIVNILQVGVTDAGRPY
FT                   IVMHYHPRDSLAVQIRREGPLPWPEAISIGVKLAGALETAHRTGTLHRDIKPANILLTA
FT                   YGEPQLTDFGIAHIAGGYETATGGFTGSLAFTAPEVLNGESPTARSDVYGLGATIFSLI
FT                   AGRAAFERKTGEELVAQFVRISSQPVPDLRAQGIPDGVCAVIERAMATNPAARPGSAEE
FT                   FGHELQAAQRHIGLRSDAMALAPLEAAQTTEEHPSDSGADGYRRIRYEGSDSGQRPWGE
FT                   PTQQLQPDSHPSGPPFWPPNGPPPWPPTGESGSIGESRTGRRAVLTVLALVVALVLAGG
FT                   GYLVLRETTGPGTARPTVQDAGASPAVDPTAAWRPVEDARVARQQTATTVADGTIWVFG
FT                   GLDENGVSAQQEGYDPAIDTWKAGPDLPVPLNHAMAVTYNDEPVLIGGWKAEGQNLTAV
FT                   DSDRVMAMRDGRWVDLPPLNAPRAAGAAAVVGDKIVVAGGQANGQLVATTEVFDGTKWT
FT                   TVAPVPTPREHLAGVSDGTYFYAIGGRDLASDQNTAAVERFDPAAGTWTTLPAMPTPRG
FT                   GLGAAFIDGRIVAVGGEEPTRVLSTVEAYDVVAGTWSQLPALRTPRHGMAVGAVGNTVY
FT                   AVGGGIKPTHAESTAVSEALQLAPRKTQWAPAWRPLEDAPIARQQTATAVADGTIWVLG
FT                   GLDNAGSTPKVEGNDPAIDTWKAGPDLPVPLNHAMAVEYGGELVVLGGWVPEGPNLTGI
FT                   TSDRVLALRNGKWMDLAPMNEPRAAGAAAVVGDKIVVAGGQADGALVATTEVFDGTKWT
FT                   TVSDIPTPREHLAGVSDGTYFYAIGGRDLASDQNTAAVERFDPAAATWTTLPAMPTPRG
FT                   GLGAAFIDGRIVAVGGEQPTKVLSTVEAYDVDSGTWSSLPPMPTGAHGMSVATVGHTAY
FT                   AIGGALRPTHAESTATAQALDFW"
FT   gene            complement(357214..357504)
FT                   /locus_tag="RHA1_ro00284"
FT   CDS_pept        complement(357214..357504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00284"
FT                   /product="probable conserved signalling protein"
FT                   /note="GO_function: GO:0000155 - two-component sensor
FT                   activity; GO_function: GO:0005554 - molecular function
FT                   unknown; GO_process: GO:0000160 - two-component signal
FT                   transduction system (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00284"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92120"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK16"
FT                   /protein_id="ABG92120.1"
FT                   /translation="MRPGDTVARLGGDEFVVVCEDVAGAPEAGAIAARITGSLADLNRA
FT                   ESLDWPISASIGVALSDPECTREELVRRADSATYRAKAAGPGGYALYDGTF"
FT   gene            357816..358304
FT                   /locus_tag="RHA1_ro00285"
FT   CDS_pept        357816..358304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00285"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92121"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK15"
FT                   /protein_id="ABG92121.1"
FT                   /translation="MGMRRVRWPAFAPPAASGTAVHGPTILASKTHITLDLLGIIAFSS
FT                   GIHVRLALTATGRAAERAHHETRTLSDPTDPDTQWSYLSVLLQLGSVAGEADPYLPRSG
FT                   SPLKWGGVPAYRTEPNYWLGTCTRPHDIMISAGWPEIGLGPTCVTALLEPSPSAVTSD"
FT   gene            358391..358597
FT                   /locus_tag="RHA1_ro00286"
FT   CDS_pept        358391..358597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00286"
FT                   /product="molybdenum-pterin binding protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_function: GO:0015098 - molybdate ion
FT                   transporter activity; GO_function: GO:0030151 - molybdenum
FT                   ion binding; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent; GO_process: GO:0015689 -
FT                   molybdate ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00286"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92122"
FT                   /db_xref="GOA:Q0SK14"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK14"
FT                   /protein_id="ABG92122.1"
FT                   /translation="MSTRNQLAGTITGVTLGSVMATVKVKLDGGEQIVTASITKEAVEE
FT                   LGLKAGVGATVLVKSTEVMLGVE"
FT   gene            complement(358630..359907)
FT                   /locus_tag="RHA1_ro00287"
FT   CDS_pept        complement(358630..359907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00287"
FT                   /product="probable signal transduction histidine kinase in
FT                   2 component regulatory system"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0000155 - two-component sensor activity;
FT                   GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0046983 - protein dimerization activity; GO_process:
FT                   GO:0000160 - two-component signal transduction system
FT                   (phosphorelay); GO_process: GO:0006468 - protein amino acid
FT                   phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00287"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92123"
FT                   /db_xref="GOA:Q0SK13"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK13"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92123.1"
FT                   /translation="MAESSVLPADLGGSPDLERIILEHAYRGAYLQLALRGVLVLFIAL
FT                   TLAFVPPMNDAGVCVAVLICYALWSGGLALWTRRGGPGPVNAMWLALFGDLAVLGCLTL
FT                   LTGIAAQQSWTADILSNGLFVIPLLASTQLRPGVCASVVVPTVLIFLAASWATMASNEE
FT                   PWSSILLSTMALAVLGAGAVMLSRIQRSRVLTIGHLVRDRTALLAELMGLEQRERRALS
FT                   EQLHDGALQFVLAAKMDLDDLTGSADPEAVGRITHALTESATLLRATVSELHPTVLDRV
FT                   GLARALGDLTRSAQARGGFEVQLLTSEWVDDLRTSADDVLFSAARELLSNVVKHAQAGT
FT                   VRVELARWGEHAVLDVTDDGCGISREAIDRSLSRGHIGLTSHELRVVAAGGSFSVHPGP
FT                   RSGTVAHIEMPFEIVTAPDSLTTSAH"
FT   gene            complement(359989..361254)
FT                   /locus_tag="RHA1_ro00288"
FT   CDS_pept        complement(359989..361254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00288"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00288"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92124"
FT                   /db_xref="GOA:Q0SK12"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK12"
FT                   /protein_id="ABG92124.1"
FT                   /translation="MVPNPDPCEDRSRVPRTVRTRGRHPVSLRAQSATALVTAALAVAV
FT                   VASVDWQLCRGVFSPTELALFVIVGVVFVSAGLVAKWHRPQDNLGWLLVFAGLLWLVKG
FT                   FRLSTVPALFTAGAALTNMYIPVLIQLVFSFPWGRLRHRWERWFVGGSYAYYAVAVVSE
FT                   LAFLDTHRVSPAHPPSLNLLLVRDDPRVFAALQVIFGAVGIALGVVLIGVVVARWRSGS
FT                   PAYRAAVAPLWIAALLGTAATAWTPLVSVWVHSPQHAWTLLLRYPSTALIPLAVLAGMW
FT                   RYRVARAAVRNLMIEIGTAPLGDGFIEALRAALRDPDLALWSFSRARDGYVDAQGRPQV
FT                   LPPRNDPREATALIRDGVLVGALVYDRAVADLPRLLAAVRAATTLALDNQRLHGELEAQ
FT                   FAEVRRARELTAECQGSYTRRC"
FT   gene            361424..362338
FT                   /locus_tag="RHA1_ro00289"
FT   CDS_pept        361424..362338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00289"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00289"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92125"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK11"
FT                   /protein_id="ABG92125.1"
FT                   /translation="MTRIRLRPAVALASIAGVSSLFLAACTQDASSTEGTESAAPSASS
FT                   EAPPTEAPVNGVDAKEYASSDAEADSYGFVTPSGKWLCAIIPTKNLAGCVSHPTAGPLG
FT                   VPGTPQIASPDGGPLAEANLIAVEAGKEPSFQNWNQAVFPGNANVLPYDTTLAIDGFSC
FT                   NVQFSGVSCREDATDKGFTISTSGYAFEFTPLPVSLPSASPPQIAPTPAPLPQQARGSN
FT                   QCGPVVYPETGKPATVVIVKGTLRCDEAHTMLTKYFAAPDKSEPVYSFDGWECRLAGDP
FT                   ESAEIGYTINCSDDNGNTVVAQP"
FT   gene            362405..362722
FT                   /locus_tag="RHA1_ro00290"
FT   CDS_pept        362405..362722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00290"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92126"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK10"
FT                   /protein_id="ABG92126.1"
FT                   /translation="MHPPNDQAGTWEGSWLAAMTVIKSAQRVFTPENRPPSELIPLVEP
FT                   LSRLGDALRATPPDPEESRRRAADLVADRDLIEWACQPDQPSEIREFGATLAFLSMKLT
FT                   T"
FT   gene            complement(362762..363676)
FT                   /locus_tag="RHA1_ro00291"
FT   CDS_pept        complement(362762..363676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00291"
FT                   /product="probable exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="GO_function: GO:0004519 - endonuclease activity;
FT                   GO_function: GO:0008853 - exodeoxyribonuclease III
FT                   activity; GO_process: GO:0006281 - DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00291"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92127"
FT                   /db_xref="GOA:Q0SK09"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK09"
FT                   /protein_id="ABG92127.1"
FT                   /translation="MRIATFNVNGIRAAQRRGFEDWLGDRGPDVVALQEVRARAEAIPP
FT                   GVFGHYHLTYDEGDVAGRNGVAVLTRGAPVAVRTWSGTALMRAPGEMHTDRVELDPEPL
FT                   ARGLGEFANQGRYVEVDLAEAPITVASMYLPKGGLPAHLQKPGRMREAPDGGARYDRKM
FT                   RFLSAFARQLTRSRRTARARGRELLLMGDLNIAHTRSDVRNWRRSNQAEGFLPEEREWF
FT                   DSILSPRTLVDVVRRQHPGVDGPYSWWSWLGQSFVNDIGWRIDYHLATPDLARAAVTAG
FT                   TDRDPVADRRMSDHAPVVVDYDF"
FT   gene            363832..365406
FT                   /locus_tag="RHA1_ro00292"
FT   CDS_pept        363832..365406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00292"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00292"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92128"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK08"
FT                   /protein_id="ABG92128.1"
FT                   /translation="MRIARMRPGSAQRGVVTAALAVSVVLGVATSPMPAIASAETFFFD
FT                   DVGSTAVPRANCGPGSLPETGMQGDVPAEDRNNGRSTQGYRCNMSLVGGLQDRGGGLLS
FT                   VTYDHCSYTSTFFPGNLLNPTTPGVQVLDVSNPAQPALSTTLNEPAMLGGTWESLKVNK
FT                   ARKLLAATAVPIAAGTGYFSVYDISDCAHPRLLNRGAGTDVTMPLPFISHEGGFSPDGN
FT                   TYWVSGPAPGFLTAIDIRNPAEPRIIWQGLHGLGGHGFGITPDGNRMYLSNLGGITVLD
FT                   ISAVQRGDPYPTVPQIATYLWTDGFFNQHSIPVTYGDKPYIFTVDETGGGGIKVFDVAD
FT                   PAHAEIVQKIKLEIQLPANTAANLRSSQGGSVFSYDPHYCVVDRPADPTALACSWESSG
FT                   IRVFDVRDLSRISEIAYYNPPAQTGKNVQLTNSPHALSSLIGVSLFNFVPLARAVFEGK
FT                   TDPRVAFGPRAGMVAFGDLSADWCFSPPEFHGNQIWTSCSDNGFIALQLDDAVYQPPVN
FT                   QVSTYGQ"
FT   gene            365396..366049
FT                   /locus_tag="RHA1_ro00293"
FT   CDS_pept        365396..366049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00293"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0000155 - two-component sensor
FT                   activity; GO_process: GO:0000160 - two-component signal
FT                   transduction system (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00293"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92129"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK07"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92129.1"
FT                   /translation="MGSDTTPSSFRRPLVLLLCAVLVGAAGVAAGMWLQSERATNPGGV
FT                   QLSSADIGFAQDMSVHHEQAVLIAQTLPRDVDPQIRVIADQIVVSQTSEIAAMRGWLNL
FT                   FDEPFTTPHPMQWIQGSDHAMGDQGGAPMPGAASISEITRLAGLRGSDAETLFLQLMIR
FT                   HHQGGVDMAEAATDVVASEPIRRIARGMIRDQSNEIAVMTAILDTRNARPLPHP"
FT   gene            366327..367085
FT                   /locus_tag="RHA1_ro00294"
FT   CDS_pept        366327..367085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00294"
FT                   /product="probable 3-oxoacyl-[acyl-carrier-protein]
FT                   reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="GO_function: GO:0016616 - oxidoreductase activity,
FT                   acting on the CH-OH group of donors, NAD or NADP as
FT                   acceptor; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00294"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92130"
FT                   /db_xref="GOA:Q0SK06"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK06"
FT                   /protein_id="ABG92130.1"
FT                   /translation="MTTETTPVSIQREPELAGQTVVVIGGSAGIGLETARRARAEGAEV
FT                   ILTGRNSDRLAQAATEVGTRRTAAFDANDTASLARFFHDLPTPIDHVLVTAGGPRYAPL
FT                   LEMDSDEVREQLSGHVVLGLEVARNAASKMRPGGTLILMGGTGGRRIGHGLGIASAATA
FT                   ALPPFTAALALELAPVRVNLIAAGFVDTPLSASLLGDRLDERRNELRTTLPIGRVVGPA
FT                   DVAALAVHIMSNTALTGATYDIDGGQQFVS"
FT   gene            367161..367793
FT                   /locus_tag="RHA1_ro00295"
FT   CDS_pept        367161..367793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00295"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0016829 - lyase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00295"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92131"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK05"
FT                   /protein_id="ABG92131.1"
FT                   /translation="MSTNEVQTNDSTRTHVAPVDMKLEVVVIPVTDVDRATEFYTRLGW
FT                   RQDVTPPGSGVVQFTPPGADASIHFGADLTTAAPGSAKGYLIVSDIEAARDQLVAADIE
FT                   VTLFHLGPDGPGDGLDPDRRSYFSLASFSDPDGNAWVLQEVTTRLPGRIDTAVTSFGSA
FT                   RDLAAALRRAAAAHGGHEERTGEEDPNWPDWYAEYMAAEQSGAELPT"
FT   gene            368207..368617
FT                   /locus_tag="RHA1_ro00296"
FT   CDS_pept        368207..368617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00296"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00296"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92132"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK04"
FT                   /protein_id="ABG92132.1"
FT                   /translation="MEQGPQRTVGRRCPAPTTGSSPTDGPDFGGTYAPPWRAEYAAEAT
FT                   QRGKETATRISGRSILQIYFFDTDSSAESGIAAYNGPNPLPEPAAHSVVEVHLTPNYER
FT                   GTQWFVGLGTDYPQFQVTALTEPARIAVDIHD"
FT   gene            368769..369269
FT                   /locus_tag="RHA1_ro00297"
FT   CDS_pept        368769..369269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00297"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003676 - nucleic acid binding;
FT                   GO_function: GO:0003824 - catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00297"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92133"
FT                   /db_xref="InterPro:IPR005114"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK03"
FT                   /protein_id="ABG92133.1"
FT                   /translation="MRDNRPAASALQLYRAFQHQHPRTPVPADYVTECGFRLGRWQDRQ
FT                   RIARMLGTLPPQRIEQLDAIGFLWSDDDVPLPAVSRTDAKRRRMLTAIAAYREEHGNAL
FT                   VPANYVTADGEQVGQWLYRAVKKWRADALPDKERRTLSVLGVSPGPRPRGPRTSAHLVG
FT                   QVM"
FT   gene            369410..370369
FT                   /locus_tag="RHA1_ro00298"
FT   CDS_pept        369410..370369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00298"
FT                   /product="transcriptional regulator, AraC family protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00298"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92134"
FT                   /db_xref="GOA:Q0SK02"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK02"
FT                   /protein_id="ABG92134.1"
FT                   /translation="MDVPHRVGVLVFDGVKMLDVAGPSEVFTEANRLGATYELVLCSVG
FT                   AVDVTASTGMRISVDVDAANTGRLSTALVMGGDLFPSTPVSPELAGAATTLAGNADRMA
FT                   SICTGAFILAAAGLLDGRRATTHWQHADTLARGYPRITVEPDAIFVEDGTIFSSAGVTA
FT                   GVDLALAFVERDHGTELARAVAQSLVVFLQRPGGQSQFSPSLRGPRPRTGQLREVVDAV
FT                   AADPTGDHSITRLAARANVSPRHLTRLFQDELGTTPAKYVELIRFDTAKAMLDAGHTVT
FT                   STAQHSGFGSPETLRRSFIQHLGVSPRAYRQQFHSTRR"
FT   gene            370504..371142
FT                   /locus_tag="RHA1_ro00299"
FT   CDS_pept        370504..371142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00299"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0016787 - hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00299"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92135"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK01"
FT                   /protein_id="ABG92135.1"
FT                   /translation="MTDTVAGIEIPDTVVVNEATELVREAANPLIYHHSRRVFLFGSLR
FT                   ARHQKLAFDPELLYVGAMFHDLGLTAKYRRADQRFEIDGADEARTFLRSHGIGEDDADT
FT                   VWTSIALHTTPEIPLHMAPEIALLTRGVELDVLGIGYDAITDEERAAVVASHPRPDFKN
FT                   EILAAFTDGLEDRPDTTFGNVKADVLAHFVPGFVRGDFVDVILNSAWSE"
FT   gene            complement(371159..372382)
FT                   /locus_tag="RHA1_ro00300"
FT   CDS_pept        complement(371159..372382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00300"
FT                   /product="MmgE/PrpD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00300"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92136"
FT                   /db_xref="GOA:Q0SK00"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK00"
FT                   /experiment="2DGE; MS"
FT                   /protein_id="ABG92136.1"
FT                   /translation="MAIAPHESTDAIAHELAGWAVGIEPGAGDLDLARRALVDTIAVTL
FT                   AALDDPAAAWTDGLPAALRWAAVGHVLDFDDLHIPSTTHISVVCVPATLSAGGGGREYL
FT                   AAAGVMARLGTALGWNHYTQGWHTTATVGAISAAVAAGLSFGLDSEGIATAMAHAVPAA
FT                   GGVRQAFGTAGKSIQVGFAAQAGVRAAGLAAAGATADPRAVGEWFRLVGGRMSPHVEGP
FT                   IIPDGLGLKLHPCCYALQRPIAAVRSLGSLSVDDIARIRVHTPNSAVLPLIHNFPSSGL
FT                   EGKFSLNYGIAAALLDGFPDIGSFTDPAVQRPEVRSILDRVSLVAEPVGEGVLDGDCTV
FT                   VVELRDGSQLEAVVDLPVGHPRRPASVADFEAKVRGCVGDERAAEILNLDWVSAAALLQ
FT                   RHLPGGGN"
FT   gene            372571..374121
FT                   /locus_tag="RHA1_ro00301"
FT   CDS_pept        372571..374121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00301"
FT                   /product="metabolite transporter, MFS superfamily protein"
FT                   /note="tc: 2.A.1.6; GO_component: GO:0016021 - integral to
FT                   membrane; GO_component: GO:0019866 - organelle inner
FT                   membrane; GO_function: GO:0015293 - symporter activity;
FT                   GO_process: GO:0006810 - transport; GO_process: GO:0046677
FT                   - response to antibiotic"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00301"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92137"
FT                   /db_xref="GOA:Q0SJZ9"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJZ9"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92137.1"
FT                   /translation="MTECDPKHDTHFPTHCADMQHTRYRLHCLRPCDGLAPIADFPDAM
FT                   VESRVRGQAPPTNGTPSGHRQPLPSTITSNAFTERRFAMKIETSDKAAISNPRRQLIAG
FT                   TVGHSVEFFDFLAYSYLAVYFASSFFPSSESGLVPLLSAFGVFAVGFLARPLAGLFIGL
FT                   FADRYGRRRALSLTISLMAGGSLLVAICPTYSQIGVAAPIILTVARILQGLSAGGEYTT
FT                   AGAFIVESAPAGRRGFYSSFMFVASGIGKLTCLAFITLFVALIGEDAMRDYGWRIPFAV
FT                   GALAAIVAWYIRRGTQETLETTASDEGAAPVSRNPLNALQRYPRQSLIVFAIATGMGVG
FT                   QYFWATYLTTYFQIQNGASATTAMTVGIITLILYTLAQPVAGLISDRYGRKPCMYAFGV
FT                   GTVIVTPFLLSITSSNFSVLICIQLVGLLLLSLCTSITSAVMVENFPPHVRVSGLGFPY
FT                   SLSVAIFGGTVPLVATSLANAGYSQYFPWYIVATAIITLLGAIAVPETFRSDISGEDS"
FT   gene            complement(374193..374933)
FT                   /locus_tag="RHA1_ro00302"
FT   CDS_pept        complement(374193..374933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00302"
FT                   /product="transcriptional regulator, GntR family protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00302"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92138"
FT                   /db_xref="GOA:Q0SJZ8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJZ8"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92138.1"
FT                   /translation="MGGRDNEQTPAHRRLSHALREQIAAGHFHGGRQLPTELELAEQYG
FT                   LSRQTVRRAFYDLVADGLVYRVPGRGTFVSELGSRHLRRLGPIEELTNLPTGTTTEIVA
FT                   PLRRRADIEAASRLRLDNDFVSTIAYVRRYAGIVFAMTTVHLPDLHAQHLCGGAATEPG
FT                   AIGAHTIIGLLEPHLASPVVELVQSITVAPASEETAHHLDCPVGHPLLRADRVYLDSDS
FT                   RAVELAVGYYLPEHYTYRNTIGRS"
FT   gene            375304..376494
FT                   /locus_tag="RHA1_ro00303"
FT   CDS_pept        375304..376494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00303"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="GO_function: GO:0003995 - acyl-CoA dehydrogenase
FT                   activity; GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00303"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92139"
FT                   /db_xref="GOA:Q0SJZ7"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJZ7"
FT                   /experiment="2DGE; MS"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92139.1"
FT                   /translation="MTAVVDDVGSSGAGYLTDERLAIQAMAREFAAKEVLPVANELDPV
FT                   KGEIPMELRQKMAELGFFGVLIPEEYGGLGLGVFEYALIVEELARAWMSVSSLITRGQQ
FT                   FTAGFTEEQRREYLPRMATGDFLSAFALSEPDAGSDVAALSTRARREADGWRISGQKMW
FT                   CTFADGADYLQVFARTSPIDRDHRSRGISCFIMPKPRGELPPGVTGTPVRKIGYHGWKT
FT                   WELSFDNAYAAGDSMVGPEGEGFKVAMGDLETARIHTAARAIGVARGALEDSVAYARQR
FT                   VQFGRPIGENQAIRFKIAHMATEVEAARSLMYRVCTEVDAGRRNTVEASMVKYLATEMA
FT                   ERVTSEALQIHGGAGYTTDFAVERYWRDAKLTKIFEGTSEIQLKIISDSILGRQTR"
FT   gene            376491..377030
FT                   /locus_tag="RHA1_ro00304"
FT   CDS_pept        376491..377030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00304"
FT                   /product="possible acyl-CoA transferase, N-terminal"
FT                   /note="GO_function: GO:0005554 - molecular function
FT                   unknown; GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_function: GO:0016740 - transferase activity; GO_process:
FT                   GO:0000004 - biological process unknown; GO_process:
FT                   GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00304"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92140"
FT                   /db_xref="GOA:Q0SJZ6"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJZ6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92140.1"
FT                   /translation="MTSPVAGPLNDVVVIDLTTMLAGPFATMVLGDLGADVIKIEPPHG
FT                   DFIREQGPFAPDDELRAFGGYFQSVNRNKRSVVLDLTTEEGRASLLELVAHADVVVENF
FT                   RHGVMDRLGLSYERLQEKNPHLVYAAIRGFGDERTGSSPMRDWPAYDITVQAVSGLMEI
FT                   TGEPDRPPDQDRSRSR"
FT   gene            377035..377703
FT                   /locus_tag="RHA1_ro00305"
FT   CDS_pept        377035..377703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00305"
FT                   /product="possible CoA-transferase, C-terminal"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_function: GO:0016740 - transferase activity; GO_process:
FT                   GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00305"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92141"
FT                   /db_xref="GOA:Q0SJZ5"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJZ5"
FT                   /protein_id="ABG92141.1"
FT                   /translation="MPALFAVIGLLSAVHRARRDGVGGFVDVSMYDAMLAMCERAVYQH
FT                   SYTGDVPTRQGNSHPLLCPFDVVPAADGWVSIAAPGNKHWQQLCAVIGRPELATDERTR
FT                   DNVSRLVNRDFTMSAVTAWTTTRTKDQIVETLGGKVPVAPVNTVEDIYADPHVRARNML
FT                   VEVDHPGVPHPVTIANSPIKFADAPSTHVRRAPLLGEHTDEVLAQFDNATAALQLEETR
FT                   "
FT   gene            377711..378688
FT                   /locus_tag="RHA1_ro00306"
FT   CDS_pept        377711..378688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00306"
FT                   /product="citrate (pro-3S)-lyase beta subunit"
FT                   /EC_number="4.1.3.6"
FT                   /note="GO_component: GO:0009346 - citrate lyase complex;
FT                   GO_function: GO:0000287 - magnesium ion binding;
FT                   GO_function: GO:0008815 - citrate (pro-3S)-lyase activity;
FT                   GO_process: GO:0006113 - fermentation"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00306"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92142"
FT                   /db_xref="GOA:Q0SJZ4"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJZ4"
FT                   /protein_id="ABG92142.1"
FT                   /translation="MSRTQRPRRSCLAVPGSNPKMIEKAKGLDSDQVFLDLEDACAPLA
FT                   KPGARKTIVSALNEGGWGSKIRVVRVNDLTTHWTYRDVVEVVEGAGENLDCIMLPKVQS
FT                   AAQIAWLDFTLTQIEKTMGFEVGRIGIEAQIEDAAGLINVDEIAAASPRTETIIFGPGD
FT                   FMASINMKSLVIGEQPPGYGVGDAFHYPLMRILMAARANGLQAIDGPYVQVRNVDGFRR
FT                   VAGQAAALGYDGKWVLHPAQIDAANDTFSPAQADYDHAENILAAYEWFTSDQGGRKGAV
FT                   MLGDEMIDEASRKMALVIAGQGRAAGMERLDVWKPEIETVESGV"
FT   gene            378692..379222
FT                   /locus_tag="RHA1_ro00307"
FT   CDS_pept        378692..379222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00307"
FT                   /product="probable MaoC protein"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00307"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92143"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJZ3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92143.1"
FT                   /translation="MTTTEKEQNMQFGRYFEDFEVGAIYRHWPGKTVTEYDDHLFCLLT
FT                   MNHHPLHINSHFAQETTEFGRNVVVGNYVYSLLLGMSVQDVSGKAIANLEIESLRHVKP
FT                   TFHGDTIYGETEVLEVTPSKSKDDRGVVYVETRGYKQDGQIVCIFRRKVLVPKRSYGDA
FT                   RGGEQPARPLPHV"
FT   gene            379501..380937
FT                   /locus_tag="RHA1_ro00308"
FT   CDS_pept        379501..380937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00308"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /note="GO_function: GO:0004029 - aldehyde dehydrogenase
FT                   (NAD) activity; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00308"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92144"
FT                   /db_xref="GOA:Q0SJZ2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJZ2"
FT                   /protein_id="ABG92144.1"
FT                   /translation="MRERYETFVGGHDERSKSGQYFSTRDPATGDVIAEVALGGAEDIE
FT                   AAVAVAQSAFRSWRDTPAATRGRILLEVARTLREHADELARIETLDTGQTLSQSNVDIE
FT                   TAARYFEYYGGAADKVHGETIPLGPDYLSYTRNEPFGVIGVVTPWNAPINQAARAIAPA
FT                   LAMGNVVVLKPAEDTPLSALEMSRLAVEAGLPAGVLNVVPGFGADAGAALTGHDKVRKI
FT                   VFTGSVETGRAIMRAAAQRLIPLTLELGGKSPNIVFDDADLDAAATGAWTAFTTKAGQV
FT                   CSAGSRLLVHSSVHDELVGRLVQHAKTTVIAPGIEDPDIGSLATRGQFDKVRSYLELGP
FT                   SEGARVATGGHVADTGRLGRGLFIEPTIFVDVDNTMRVAREEIFGPVLTVLRFDSDEEA
FT                   VEIANDSDYGLVAGVWTRDHGRAHRVAGAIEAGQVFINQYFAGGVETPFGGYKLSGFGR
FT                   EKGFEALKHYCQLKTITARL"
FT   gene            380960..381280
FT                   /locus_tag="RHA1_ro00309"
FT   CDS_pept        380960..381280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00309"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92145"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJZ1"
FT                   /protein_id="ABG92145.1"
FT                   /translation="MTKYADETINGIDRSTHKRRSSWGVDGSAQCTKPEEARVVHNADR
FT                   HRFELRVRGEPVGILGYFDLRHLTEPLRIQGNIGPSPRTSFYSHTRVVERSENRAFAAL
FT                   FV"
FT   gene            381867..382238
FT                   /locus_tag="RHA1_ro00310"
FT   CDS_pept        381867..382238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00310"
FT                   /product="possible transposase"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_function: GO:0004803 - transposase activity;
FT                   GO_process: GO:0006313 - DNA transposition; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent;
FT                   GO_process: GO:0006412 - protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00310"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92146"
FT                   /db_xref="GOA:Q0SJZ0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJZ0"
FT                   /protein_id="ABG92146.1"
FT                   /translation="MKVPEEEMSLMAMKAYSAEFKADAVALYLSDPSHTFEGIGNDLGV
FT                   SRETLRNWVRAERKRTGTSTAELRADGAARPASRAGEVSSESVLEEENKQLKAQIRKLE
FT                   TEREILRKAAKYFAGETNW"
FT   gene            382235..383128
FT                   /locus_tag="RHA1_ro00311"
FT   CDS_pept        382235..383128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00311"
FT                   /product="probable transposase"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0004803 - transposase activity; GO_process: GO:0006313 -
FT                   DNA transposition"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00311"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92147"
FT                   /db_xref="GOA:Q0RVL3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVL3"
FT                   /protein_id="ABG92147.1"
FT                   /translation="MSRFQFVDDHCDTVPVKWLCQILEVSRSGFYRWRTSGPARAARAR
FT                   ADEELAERIRAIHADFDGTYGAPRITAELREAGIEVNHKRVERVMREHGIVGVHLRKPV
FT                   RTTVPDPDAAAVPDLIRRDFTASAPNTRYVGDITYLPVGDGEFLYLATVLDLGSRRLAG
FT                   WSIADHMRTELVTDAMRAAAACRGAAGLEGSIFHSDNGAQYASAEFADLCRELGVTRSR
FT                   GAVGTSADNAAAESLNATLKRETLQGRKRWNSAGEARAAIFRWITRYNTRRRHSTLGQI
FT                   CPIEFEQRSATLATAA"
FT   gene            complement(383198..383722)
FT                   /locus_tag="RHA1_ro00312"
FT   CDS_pept        complement(383198..383722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00312"
FT                   /product="possible enoyl-CoA hydratase, C-terminal"
FT                   /note="GO_function: GO:0004300 - enoyl-CoA hydratase
FT                   activity; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00312"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92148"
FT                   /db_xref="GOA:Q0SJY8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJY8"
FT                   /protein_id="ABG92148.1"
FT                   /translation="MHRDDAGDTSRSSTGHCLGAGCGTRAGCQLVAACDLAVASSTARF
FT                   GTPGVKIGLFCSTPMVALSRAIGRKRVLRMLLTGEMIDAVTAETWGLINLVAEPQTLTE
FT                   VTRSLAETVAGASALTLATGKEAFYRQIELSEDEAYRQMQETMAVNATTYDAQEGITAF
FT                   LAKRPPVWQHR"
FT   gene            complement(384050..384379)
FT                   /locus_tag="RHA1_ro00313"
FT   CDS_pept        complement(384050..384379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00313"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0003824 - catalytic activity; GO_process: GO:0006725 -
FT                   aromatic compound metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00313"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92149"
FT                   /db_xref="GOA:Q0SJY7"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJY7"
FT                   /protein_id="ABG92149.1"
FT                   /translation="MTVMTHNHRTAPLGDRASSMGQALAAFNASVFTGPGEIPRKYREL
FT                   MAVAVALTTQCEGCIKVHTNDAVACGASDEELAEATYIAASLRAGGAVVYGLKSLASAE
FT                   RIRNS"
FT   gene            384397..384828
FT                   /locus_tag="RHA1_ro00314"
FT   CDS_pept        384397..384828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00314"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0004803 - transposase activity; GO_process: GO:0006313 -
FT                   DNA transposition"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00314"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92150"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJY6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92150.1"
FT                   /translation="MARRAFRDNGRQRHLRVDIGRVRLNRILRRCLLPPNSGLAGDDYE
FT                   ATPLVSGVLEQALFTRRRTDFRFTLTGLVHHADAGSLYRSLAFTEALVESGITGSIGSV
FT                   ADALDNAMMESAIGLYMTEPIRWEWVWTGRAEAEREAAE"
FT   gene            384981..386462
FT                   /locus_tag="RHA1_ro00315"
FT   CDS_pept        384981..386462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00315"
FT                   /product="probable adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="GO_function: GO:0016829 - lyase activity;
FT                   GO_function: GO:0047472 - 3-carboxy-cis,cis-muconate
FT                   cycloisomerase activity; GO_process: GO:0006099 -
FT                   tricarboxylic acid cycle"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00315"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92151"
FT                   /db_xref="GOA:Q0SJY5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJY5"
FT                   /protein_id="ABG92151.1"
FT                   /translation="MLDYQHTACRLAEQHANRQSCGADLLRTNRHEGGTMGVGLDDDLL
FT                   RDFFGNAEQRAIFDGPQRLQGWLDVERALAQTQAELGIIPAEAAQRISAHCQSDLFDIN
FT                   KLRQHVNATQHPIVPMVNALEKLVGTEFGQFVHYGATSQDIMDSGQALQLRQSLQGIER
FT                   DVAAATKAAASLALKHRNTTQVGRTHGQHAVPISFGLKAATWVDELQRLQTRIAESRDR
FT                   ILTVQIFGAAGSMAGYGDRAFEVKAGVASRLGLTEPVAPWHATRDRIAELGSLMALLAG
FT                   VSERIAAEVIRLQSTEFGELVEPLQPGHIGSSTMPQKRNPHLSEGIVAKARIAQSLSAG
FT                   LLRNGAHQHERDMGAWAVEWLTVPELMVGSGAMAADLNHLLEGLQVNAECMRRNVGITG
FT                   GQVNAESLMMILDSSIGRDHAHHLLVELTRSADLQNLNFSEVATADERVASHLSQDQIM
FT                   KALDPAQYLGFAPEVADRVSRALTAEAEDRPSISS"
FT   gene            386573..387655
FT                   /locus_tag="RHA1_ro00316"
FT   CDS_pept        386573..387655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00316"
FT                   /product="possible monoxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00316"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92152"
FT                   /db_xref="GOA:Q0SJY4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019921"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJY4"
FT                   /protein_id="ABG92152.1"
FT                   /translation="MPYSVQRGHERGKPTGGRDYLVAHTTQYAVETRPNASAGLTNRKE
FT                   QELKLGLRIPQRDKVNLRLDVTEVAQTAENNGFESLWVYERSLYPLTPEEPYPYSDPPG
FT                   GDWPSYYRQTADPLSVLAAAAMVTSHVRLGTSVLIAAQHIPFQLAKTIATIDQISEGRF
FT                   VAGFGAGWSKDEIRAAGADPKFRGRYLDETLDVLAAAWGPDPVSYQGRRTIVNNAIVAP
FT                   KPASRVPVLIGGGGTPRTIERIASRADGWLSIPFGSKGFQEIESTWNKIRERAVELGRS
FT                   AEHLEHIVCANITLTSELAGAERTPFVGTLDQIVEDVVAASKVGVDELIIDLNLQDPWF
FT                   TESRKMLDTALEIFHRVNKR"
FT   gene            complement(387882..388415)
FT                   /locus_tag="RHA1_ro00317"
FT   CDS_pept        complement(387882..388415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00317"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92153"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJY3"
FT                   /protein_id="ABG92153.1"
FT                   /translation="MRQRAAAKASRRSRAVMKSERGFVVPKTLPDRTAASLPQSVEATP
FT                   GQPVRRGAVTIEKPHSRGCINHAPYRLCRRDRRILRSRPDREPGNRFGRCHGLVDGYLD
FT                   RVASGHLRGDHAMIPATIQPEVSSSRKASVTMMIATPIKYGITSPFGSRVCVLCLFPHG
FT                   TFCGVLGLVVGSNR"
FT   gene            complement(388549..389286)
FT                   /locus_tag="RHA1_ro00318"
FT   CDS_pept        complement(388549..389286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00318"
FT                   /product="transcriptional regulator"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00318"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92154"
FT                   /db_xref="GOA:Q0SJY2"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJY2"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92154.1"
FT                   /translation="MQGIERGLRVLEAVAESQPVGVGELSRTLQLPKSTVQRTLQALAS
FT                   AGWIRSDGSEYTRWKLTSRALAVGRRGWDKGDLRTVALEPMRELRDLTNETITLQVRDG
FT                   AERVVQIERMDSHQAVRTFIKVGSTWQLPHTSGGMAIMACLPDDEVDRILSSPIQQLTP
FT                   QTDTDPESIRKKIEEIRRVGYAVNVNQNRMGVCAVGAAVLGEGGCPVGGIGISMPETRF
FT                   DENRVPWWGKQVSDTAANVSSLL"
FT   gene            complement(389396..389866)
FT                   /locus_tag="RHA1_ro00319"
FT   CDS_pept        complement(389396..389866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00319"
FT                   /product="possible thioesterase"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0008610 - lipid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00319"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92155"
FT                   /db_xref="GOA:Q0SJY1"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039298"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJY1"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92155.1"
FT                   /translation="MEVEVEVGVSEVEWDEVHDGGFIGLIGPLLLRRGDGGAREYGLRC
FT                   EPKHRNLRGVVQGGLIMAFADRALGSTALAETGTQNMATVQLNVSFLGIVRVGDLLTSS
FT                   PRIVRRTASIVFADSDLRVNDSVVATATGVFKILADSSPPVGVGAAAEIRLR"
FT   gene            complement(390037..390921)
FT                   /locus_tag="RHA1_ro00320"
FT   CDS_pept        complement(390037..390921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00320"
FT                   /product="probable hydrolase"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_function: GO:0016740 - transferase activity;
FT                   GO_function: GO:0016787 - hydrolase activity; GO_process:
FT                   GO:0006725 - aromatic compound metabolism; GO_process:
FT                   GO:0044248 - cellular catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00320"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92156"
FT                   /db_xref="GOA:Q0SJY0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJY0"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92156.1"
FT                   /translation="MTTTKFDKAVGRYVHLTIDDVEYRVYYEESGSGIPLLLQHTAGCD
FT                   GRQYRHLLEDEEITSHFRVITWDLPYHGRSLPPLSVRWWEQEYNLTQDFFMKFVVALAE
FT                   ALDCEDAVYMGSSMGGNLAPDLALHYPGVFRAVIALEAALHSPGFYLDYWFHPEISNDS
FT                   KPAAMYALTSPTAPEVGRRETTWVYSQGSPPVFKGDLHYYSVEHDLRETAQNIDTSKTA
FT                   VYILNGEYDFATGPEEAAELGAQIEGAKVVPMAGLGHFPMSEDAAQFFRCIKPVLWEIR
FT                   DSAVPSKVLSATQ"
FT   gene            complement(390918..391325)
FT                   /locus_tag="RHA1_ro00321"
FT   CDS_pept        complement(390918..391325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00321"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92157"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJX9"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92157.1"
FT                   /translation="MPFVDTERFTEALNLDPEFKIAARFWNAIVRLEIGDETYVLVIRD
FT                   GRLDSMTPPEGNNLMTVARNYDIEISAPIEEWSKFFQRVPRPFYQDLFSAVTRHNFRYG
FT                   GDMKMFFAYYAALRRVFDFMRSYTNVAEEAK"
FT   gene            391744..392760
FT                   /gene="leuB1"
FT                   /locus_tag="RHA1_ro00322"
FT   CDS_pept        391744..392760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB1"
FT                   /locus_tag="RHA1_ro00322"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="GO_function: GO:0003862 - 3-isopropylmalate
FT                   dehydrogenase activity; GO_process: GO:0009098 - leucine
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00322"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92158"
FT                   /db_xref="GOA:Q0SJX8"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJX8"
FT                   /protein_id="ABG92158.1"
FT                   /translation="MKIAVIPGDGIGPEVIDQAVRTLHEVAPTIDTSYFDLGARNFRET
FT                   GRLLAPETLDEIRHHDAILLGAIGDPTVPAGTLERGILLEMRFALDHHINPRPTKTMPG
FT                   APRVLAGDVNVDLLVVREGTEGPYTGNGGALRVGTPHEVATEVSVNTRFGVDRLLREAF
FT                   ERATVRRQRLTIVHKPNVLAFAGSLWTRAADDLSALYPDVEVDHMLVDAAMLHLVTNPA
FT                   RFDVIATDNLFGDLITDLTSALGGGVGLAASANIDGSRRNPGMFEPVHGSAPDIAGRGV
FT                   ADPTAAILSVALMLHHLGRSPEANAIDQAVQDHVATRGPESCSTEEIGEQIRSRVGS"
FT   gene            complement(392765..393187)
FT                   /locus_tag="RHA1_ro00323"
FT   CDS_pept        complement(392765..393187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00323"
FT                   /product="possible transcriptional regulator, ArsR family
FT                   protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00323"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92159"
FT                   /db_xref="GOA:Q0SJX7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJX7"
FT                   /protein_id="ABG92159.1"
FT                   /translation="MVRQNSYCRYAGSMTDLAPTYRMSDSEEPSLPTPLPEPAASEIRL
FT                   ERVMGVLADPLRLTIVNRLLTSSEEYDHTCGWFGFDRPKSSLTHHFKALREAGVIRQRQ
FT                   HGLERRSRVRIEDLDERFPGLVELIANWQPADGEAV"
FT   gene            393253..394539
FT                   /locus_tag="RHA1_ro00324"
FT   CDS_pept        393253..394539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00324"
FT                   /product="transporter, MFS superfamily protein"
FT                   /note="tc: 2.A.1; GO_component: GO:0016020 - membrane;
FT                   GO_process: GO:0007582 - physiological process"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00324"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92160"
FT                   /db_xref="GOA:Q0SJX6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJX6"
FT                   /protein_id="ABG92160.1"
FT                   /translation="MAKSSAGPKELRWSLAAASTVTAVFVLSNAPTPLYTRWQAEWEFS
FT                   SGTLTIVFGAYMVGLIGTLLVAGKLADRYGRKIVLVPGLIAAVTAAGLFLSATNVVWLL
FT                   AARLLAGAAVGAAVTAGMSATIDLAPDHRRRTGSMIASAAMVFGAGLGPLLSGALSQLI
FT                   DTPQSWIFGIVLTITTLTLVVAIRLPLPHGFAEDGPVGPLWSWPSVPRPNRRELAWGAA
FT                   AFAPGITSTSFFLSLGPTVLATGIDAPSPLLAGAAACGMFLVATGIQFALAHLRTRTHL
FT                   ALSSTAAFVSMATLTASVTLSPTPALFVIAALLAGAAQGLGQLAALTLIGTRIPSNHRA
FT                   EANATLNIAGYIPAALLPVGTGYLIQFLPFGAAIVTFAAAVMAFSLAALITVRISTAEH
FT                   LRPRASDGHVIRGETDATAEEALLDGARP"
FT   gene            394684..395697
FT                   /gene="adh1"
FT                   /locus_tag="RHA1_ro00325"
FT   CDS_pept        394684..395697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adh1"
FT                   /locus_tag="RHA1_ro00325"
FT                   /product="alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="GO_function: GO:0003960 - NADPH:quinone reductase
FT                   activity; GO_function: GO:0004024 - alcohol dehydrogenase
FT                   activity, zinc-dependent; GO_function: GO:0005489 -
FT                   electron transporter activity; GO_function: GO:0008270 -
FT                   zinc ion binding; GO_function: GO:0020037 - heme binding;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00325"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92161"
FT                   /db_xref="GOA:Q0SJX5"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJX5"
FT                   /protein_id="ABG92161.1"
FT                   /translation="MPTHQAVHVQAPGEPLTLVDVETGSPPRDHVRIAVSACGVCGTDH
FT                   AFVNGAFPDMSWPLTPGHEIAGTIAELGEGVDNYAVGDRVAVGWFGGHCNQCIPCRQGS
FT                   FIHCEKLQVPSWQYPGGYAESVIVPANALARIPNELSFAEAAPMSCAGVTTYDALRKTR
FT                   AVPGDRVAILGIGGLGHLGVQFARAMGFETIAIARGADKGDDARQLGAHHYIDSTAGDV
FT                   SEALQALGGVSVVLGTAASSKAMGDVVGGLLPLGELTVVGVTPDPLPISPLQLITPGVD
FT                   VTGHPSGTARDVEETMHFAVLSGVRARIEEQPLARAAEAYAAMEEGRARYRMVLTM"
FT   gene            complement(395728..396201)
FT                   /locus_tag="RHA1_ro00326"
FT   CDS_pept        complement(395728..396201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00326"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00326"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92162"
FT                   /db_xref="GOA:Q0SJX4"
FT                   /db_xref="InterPro:IPR035197"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJX4"
FT                   /protein_id="ABG92162.1"
FT                   /translation="MSNSTSAQHEQAIVMSRNTQRTRPGPLQWLGYAVGRKLPDSMQDW
FT                   VRNDLVGDWAVPRHLLRSMVPFVPVFAAFFLFPGPLGLRASMVLLGVLLAVFYAVSYMA
FT                   QNRSRRLERHGLPPDLENPRKASRHDAEKAAYEKLHGPSGTRGIGRRSGNELR"
FT   gene            complement(396210..396686)
FT                   /locus_tag="RHA1_ro00327"
FT   CDS_pept        complement(396210..396686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00327"
FT                   /product="probable transcriptional regulator, MarR family
FT                   protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_function: GO:0004826 - phenylalanine-tRNA ligase
FT                   activity; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0016564 - transcriptional repressor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent; GO_process: GO:0006412 -
FT                   protein biosynthesis; GO_process: GO:0016481 - negative
FT                   regulation of transcription"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00327"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92163"
FT                   /db_xref="GOA:Q0SJX3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJX3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92163.1"
FT                   /translation="MTADIQQGKAGDDLLALDRQVCFALAIANRAVLAVYRPLLEPMGL
FT                   THPQYLVMLALWGKAPMAVKEIGTALQLDSPTLSPLLKRLEASGLITRTRSRADERQLD
FT                   VELTEAGAALRAEAEKIPPAVIEKLGVSLAELEELHDVLTRVNQAALRAGALDH"
FT   gene            complement(396760..397452)
FT                   /locus_tag="RHA1_ro00328"
FT   CDS_pept        complement(396760..397452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00328"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0004325 - ferrochelatase activity;
FT                   GO_process: GO:0006783 - heme biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00328"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92164"
FT                   /db_xref="InterPro:IPR010644"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJX2"
FT                   /protein_id="ABG92164.1"
FT                   /translation="MTRSRFTELNQRVRFMMFTVFQVVPGALPDVRDEVVDDAHTYLDR
FT                   VAESGVAIRGIYDVAGLRGDADFMMWTHADTVEELQAAYSGFRRCRLGRACTTVWSAVA
FT                   LHRPAEFNRSHIAAYVADEEPGQFVCVYPFNRSLEWYLLPDAERRRQLAEHGRAARAYP
FT                   DVRANTVSSFGLSDYEWILAFEAPDPSRIVDMMRDLRATDARRHVRLETPFFSGPRTGL
FT                   DALVARFP"
FT   gene            complement(397461..398288)
FT                   /locus_tag="RHA1_ro00329"
FT   CDS_pept        complement(397461..398288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00329"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /note="GO_function: GO:0004792 - thiosulfate
FT                   sulfurtransferase activity; GO_process: GO:0008272 -
FT                   sulfate transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00329"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92165"
FT                   /db_xref="GOA:Q0SJX1"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJX1"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92165.1"
FT                   /translation="MSRSNFLVDAEWVVEHGHDPDVVLVEVDEDTAQYETNHIDGAVRI
FT                   DWKRDLQDPVRRDVIDRRSFEKLLSERGIANGDTVILYGGNNNWFAAYAYWYFKLYGHR
FT                   DVRLLDGGRKKWELDGRPLSSEEVTRPATDYVASEPVSGIRAHRDEVIEQIGSKNIVDV
FT                   RSPDEFSGRILAPAHFPQEQPQVPGHVPTAVNVPWSKAAADDGTFLGEDELRALYGDAG
FT                   LDETKDIIVYCRIGERSAHSWFVLHELLGYPDVRNYDGSWVEYGSLVGAPVER"
FT   gene            398394..400076
FT                   /gene="nirA"
FT                   /locus_tag="RHA1_ro00330"
FT   CDS_pept        398394..400076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirA"
FT                   /locus_tag="RHA1_ro00330"
FT                   /product="ferredoxin--nitrite reductase"
FT                   /EC_number="1.7.7.1"
FT                   /note="GO_function: GO:0004783 - sulfite reductase (NADPH)
FT                   activity; GO_function: GO:0008942 - nitrite reductase
FT                   [NAD(P)H] activity; GO_function: GO:0048307 -
FT                   ferredoxin-nitrite reductase activity; GO_process:
FT                   GO:0006118 - electron transport; GO_process: GO:0042128 -
FT                   nitrate assimilation"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00330"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92166"
FT                   /db_xref="GOA:Q0SJX0"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJX0"
FT                   /protein_id="ABG92166.1"
FT                   /translation="MTTPKTRSVQAKAPRTEGQWAQGDREPLNVNEQVKQDDDGLNVRK
FT                   RIEEVYCRTGVAGIDPTDRRSRFRWWGLYTQRAPGIEGGRTATLPPEELEDEHFMLRIR
FT                   IDGGALTTEQLRVVGEVSRLFARDTADLTDRQNIQLHWIRVEDLPEIWRRLEGVGLTTA
FT                   ESAGDTPRVVLGSPMAGIAVDEVLDATPALHEITRRLIANPDYSNLPRKFKTAISGLQD
FT                   VVHEINDVAFIGVDHPDHGPGLDVWVGGGLSTNPRIGERLGAWVPLEDVPDVWIGIVSL
FT                   FRDYGYRRLRAKARLKFLVSDWGVEKFRDVLEKEYLGRAMLDGPAPEPLDEPRDHVGIQ
FT                   RQKNGLNAVGIAPVVGRVGGTVLTDLARAAEASGSRRVRITPMQKLVILDVEDDSIDSL
FT                   QADLEKLGFPARPSPWRRSTMACTGIEFCKFGIVETKARAATLIADVEKRLADVQDQLE
FT                   HPITVHLNGCPNSCARIQVADIGLKGMIVTDVDSNQVEGFQVHLGGGLGLDTSFGRKLR
FT                   GHKLPATEVPDYVERIVRRYVAGREGSEKFATWVQRATEADLA"
FT   gene            complement(400312..400638)
FT                   /locus_tag="RHA1_ro00331"
FT   CDS_pept        complement(400312..400638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00331"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92167"
FT                   /db_xref="GOA:Q0SJW9"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJW9"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92167.1"
FT                   /translation="MIEDSIEPLTPTPGPTRLIPRRRPDGRELLGTAKGILIAGRGCSD
FT                   AQAFDELLDVARRHHLTVLGAARSLVDLAAGPSPRRRSPEAARFEEWEQLVNQLPPRRH
FT                   AQAS"
FT   gene            complement(400814..401299)
FT                   /locus_tag="RHA1_ro00332"
FT   CDS_pept        complement(400814..401299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00332"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00332"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92168"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJW8"
FT                   /protein_id="ABG92168.1"
FT                   /translation="MASDGGELTVRSGNVMATTGERTDGPDSTAVRVALWRAMHVQVDA
FT                   PPHVLVDEIGPQLAVRGRPARPPNLEAEPADRAGLRCSRLAAAGAGRLRGERVLVGAAG
FT                   CSGLRFSPPQEMLSLAREAGFADAQHVAGTSLAERYFADRSDGPRPPSGEDLLVATT"
FT   gene            401293..401811
FT                   /locus_tag="RHA1_ro00333"
FT   CDS_pept        401293..401811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00333"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00333"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92169"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJW7"
FT                   /protein_id="ABG92169.1"
FT                   /translation="MPRPSQRPPLPAYIPRMNPSVTRAAGLFTATAAAFLAFATPAQAD
FT                   SPTPVYFRVVNFNCSIAPDETVGCDLPQPLPMDFPILGEFGLPWLGPVRHVVIDLPWLP
FT                   AHPTYPPGTPFTLPGGNPDISEVATSQSMYQKTITHGGTTCLAGFMGDVTCTAKGHSFV
FT                   VTVYGIHAH"
FT   gene            complement(401833..404001)
FT                   /locus_tag="RHA1_ro00334"
FT   CDS_pept        complement(401833..404001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00334"
FT                   /product="excinuclease ABC subunit A"
FT                   /note="GO_component: GO:0009380 - excinuclease ABC complex;
FT                   GO_component: GO:0019866 - organelle inner membrane;
FT                   GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0005524 - ATP binding; GO_function: GO:0009381 -
FT                   excinuclease ABC activity; GO_function: GO:0015087 - cobalt
FT                   ion transporter activity; GO_function: GO:0015171 - amino
FT                   acid transporter activity; GO_function: GO:0016887 - ATPase
FT                   activity; GO_process: GO:0006284 - base-excision repair;
FT                   GO_process: GO:0006289 - nucleotide-excision repair;
FT                   GO_process: GO:0006310 - DNA recombination; GO_process:
FT                   GO:0006824 - cobalt ion transport; GO_process: GO:0006865 -
FT                   amino acid transport; GO_process: GO:0009432 - SOS
FT                   response"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00334"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92170"
FT                   /db_xref="GOA:Q0SJW6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJW6"
FT                   /protein_id="ABG92170.1"
FT                   /translation="MLRMLFSRVGTYPPGAPVLDSNAFSPNTPEGGCPACHGLGRTHDV
FT                   DIDALVPDPSRSIRGGAVAAWPGAWLGKNYRDILDTLGIDVDRPWSELPEDEREWILTT
FT                   EEQPTVTVSPVRDPGKMVRDYQGTFSSARTYVLHTFATTKSATQRAKVARYLVSRPCSA
FT                   CNGKRLRPEALAVRFAGLDIADATELSLADLASVLDAVVASRGSDASDATERASVALVD
FT                   NLRGRLAGLTELGLGYLSLARSTTTLSPGELQRLRLATQLQSGLFGVLYVLDEPSAGLH
FT                   PADTEALVTAVRRLRAAGNSVFVIEHNLDVVRAADWIVDVGPGAGEHGGRVLYSGKVDG
FT                   LAHIPESVTRRYLFGTPESCPEPGPPSRWIELAGITMHNLRDLTVRIPLGVLTAVTGVS
FT                   GSGKSTLVSRVLTDVVAQHLGLDSELGTDTGGDEADGSTVVLAEERENDTEPTVVAAHG
FT                   LGQINRLVRVDQTPIGRTPRSNLATYTGLFDVIRKLFAAHPVARERGYSPGRFSFNVSG
FT                   GRCEECEGAGSITIGMLFLPEASAPCPACAGARYNAETLEVLVDGRTIADVLAMTVDDA
FT                   RAFLSHVPAAAKSLDMLVEVGLGYLRLGQSATTLSGGEAQRVKLASELQRIRSGHTLYV
FT                   LDEPTTGLHPADVDRLMTVLRRLVAAGNTVVLVEHDMPVIASADWMIDLGPGGGDNGGR
FT                   IIASGPPTVVAETAGSATAAYLARHLAV"
FT   gene            404011..404334
FT                   /locus_tag="RHA1_ro00335"
FT   CDS_pept        404011..404334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00335"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00335"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92171"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJW5"
FT                   /protein_id="ABG92171.1"
FT                   /translation="MSEGADRRSGGGMTAGLLQGNRRWKPGDVPHPGRSDLIHQPACVR
FT                   GDGLEEPPLRFGVDGAEGQRRLPRSRDPGERDDAVPGNEHIDVGEVVFSGVEHCDSVEF
FT                   LGM"
FT   gene            complement(404499..405035)
FT                   /locus_tag="RHA1_ro00336"
FT   CDS_pept        complement(404499..405035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00336"
FT                   /product="possible dehydrogenase E1 component beta subunit,
FT                   C-terminal"
FT                   /note="GO_function: GO:0003863 - 3-methyl-2-oxobutanoate
FT                   dehydrogenase (2-methylpropanoyl-transferring) activity;
FT                   GO_process: GO:0006096 - glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00336"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92172"
FT                   /db_xref="GOA:Q0SJW4"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJW4"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92172.1"
FT                   /translation="MGPEEPEGGVCLEPIALYHTRDLYEDGDEQWLAPYPDPAKRAGNH
FT                   VPIGSARTYGDGADLTIVTFGNGVRMSLRVARRLERANIAARVVDMRWLAPLPVHDILR
FT                   EANATGRVLVVDETRKSGGVSEGVVTALIDDGFTGPLARVTSDDSFIPLGDAALEVLLS
FT                   EETIEAAAIKLAQVG"
FT   gene            complement(405108..405524)
FT                   /locus_tag="RHA1_ro00337"
FT   CDS_pept        complement(405108..405524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00337"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003863 - 3-methyl-2-oxobutanoate
FT                   dehydrogenase (2-methylpropanoyl-transferring) activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00337"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92173"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJW3"
FT                   /protein_id="ABG92173.1"
FT                   /translation="MAEQIDDYFTTTVAAMATTTRPGLIDHDRPVEAGSSLSVQQTLDL
FT                   FDSQLGSRHLDLVARRLRAKGEGFYTIGSSGHEGNAVVAGALRPTDPALLHYRSGAFGF
FT                   PGPFASGVVRLRRQRHRDQHQDAEGVDRRELRQP"
FT   gene            complement(405581..406747)
FT                   /locus_tag="RHA1_ro00338"
FT   CDS_pept        complement(405581..406747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00338"
FT                   /product="probable sarcosine oxidase beta subunit"
FT                   /note="GO_component: GO:0009331 - glycerol-3-phosphate
FT                   dehydrogenase complex; GO_function: GO:0004368 -
FT                   glycerol-3-phosphate dehydrogenase activity; GO_process:
FT                   GO:0006072 - glycerol-3-phosphate metabolism; GO_process:
FT                   GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00338"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92174"
FT                   /db_xref="GOA:Q0SJW2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJW2"
FT                   /protein_id="ABG92174.1"
FT                   /translation="MSKELPEQASVVVIGGGVIGASIAFHLAESGVSDVVLLEKDELAC
FT                   GSTCKAAGGVRASFSNEANIAIGLRGLDVYSRFAQEYHQEIDFSRDGYLYLLSDQANVD
FT                   IFTESVALQNRHGVPSRMVTPEAAQKISPLISTDGLLAASWSPQDGKATPESVVMGYAA
FT                   AARRHGARIVRHCAVTDIESTGGTITAVVTEHGRIKTDTVVCAAGAWSAGIGTMLGVNI
FT                   PVVPVRRQIAFTEPLSELPESSPSLTIDFPSNFYFHPEGKGLLLGWSDPNEREGFNLRF
FT                   ELEDWLMGLGAIAETRVPAVLDYGISTGWAGLYEVTPDRNQIIDRSTEVEGLLIATGYS
FT                   GHGFLMGPATGEIVRDLYHGKEPGYDISSFALDRFAQFGIGAGETNIV"
FT   gene            complement(406905..408053)
FT                   /gene="gdhA1"
FT                   /locus_tag="RHA1_ro00339"
FT   CDS_pept        complement(406905..408053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdhA1"
FT                   /locus_tag="RHA1_ro00339"
FT                   /product="glutamate dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.4.1.3"
FT                   /note="GO_function: GO:0004352 - glutamate dehydrogenase
FT                   activity; GO_function: GO:0004353 - glutamate dehydrogenase
FT                   [NAD(P)+] activity; GO_process: GO:0006520 - amino acid
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00339"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92175"
FT                   /db_xref="GOA:Q0SJW1"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJW1"
FT                   /protein_id="ABG92175.1"
FT                   /translation="MFELIDEWGPEKVVCVSDARTGMRGVLVIDNTARGMGKGGTRMST
FT                   TVSVGEVARLARNMTWKWAGVDLFYGGAKAGIWADPTASSKEAVLRAFVRALRNEVPEE
FT                   YVFGLDVGLTEKDAAIMLDEVGGRGGAVGTPHALGGLPYDQLGVTGHGVAESADAAAQA
FT                   LGLSTGSLSVSIQGFGAVGAASAKRLAELGATIVAVSTSQGGIHNPDGLDVATLLDLRD
FT                   QYGDGLVDQYSDAKPLAAGEELSVTADILIPAALQDVIDADLARTLPAKIVVEGANLPS
FT                   SPEAQSVLFDRGVTVVPDFIANAGGVVAAAVAMDARYSGIRPEPAAVFDNISNKLRAST
FT                   IDTLDASKAQGRTTHEVARATAQERVREAMVLRGRSPQNAAF"
FT   gene            complement(408089..409645)
FT                   /locus_tag="RHA1_ro00340"
FT   CDS_pept        complement(408089..409645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00340"
FT                   /product="aldehyde dehydrogenase (NAD+)"
FT                   /EC_number="1.2.1.3"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00340"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92176"
FT                   /db_xref="GOA:Q0SJW0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJW0"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92176.1"
FT                   /translation="MSTAVAETIALPTTDELRTLARTSLQRCGVDPAVLDTAGVENTIT
FT                   TRSPVTGESLFDYPAADATDVEAAIDAAHEAFLQWRTVPGPVRGFLIKRLGELLTEHKE
FT                   DVANLISIEVGKIRSEALGEVQEMIDICDFAVGLSRQLDGRTMPSERPGHRLMETWHPL
FT                   GVVGVVSAFNFPAAVWSWNLALAIVCGDSVIWKPAQLTTLTAAACSALFDRAAKESGAP
FT                   ANLNVLVSASAADTQALIDSPKVPLISATGSERMGEQIAPRVAARFGRAILELGGNNAA
FT                   IVTPSADLDIATRGIVFAAAGTAGQRCTSMRRIIVHQDIADELIDRISQVYGRLPIGDP
FT                   FADGTLVGPLIDGKSHANMTAALDKAVAQGGEILVGGKRRPSSESSYYVEPAIVRMPAQ
FT                   SEIVKDETFAPILYVLTYDTFEEAIALHNDVPQGLSSSIFTTDQREAERFIAADGSDCG
FT                   IVNVNIGTSGAEIGGAFGGEKTTGGGRESGSDAWRAYMRRATNTINYSRELPLAQGVNF
FT                   G"
FT   gene            complement(409646..411094)
FT                   /locus_tag="RHA1_ro00341"
FT   CDS_pept        complement(409646..411094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00341"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92177"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJV9"
FT                   /protein_id="ABG92177.1"
FT                   /translation="MPITQQWELRAEFARRLSHMYGKEVPAYTTLLEVSQAVNDTVLSN
FT                   LGAGAERLGSIARVTAERHGAIRVGTPQEMAQVARVFAAMGMYPVGFYDLREAAASSVP
FT                   VVSTAFRPTDPDELARNPFRVFTSMLVPSDRRFFSADLQQRLESFLAKRRLFTAELLVL
FT                   ADRATEYRGLNSGDAEMFLTLATAAFKLSTEAVDRAWYRELEQVSSVAADIGGVASTHI
FT                   NHLTPRVLDIDGLYARMERRRIDMIDTIQGPPRWAGPDLLLRQTSFRALAEPRVFREAD
FT                   GTVEKGSLRVRFGEVEARGIAATVRGREVYDRLTVEIEQAVREAAATAPVPAEARNEIA
FT                   AELWNQQVPATEQGLALHDLAYFTYRVDNDKQRNGTMPERSLQDLIDQGWVRPEPIVYE
FT                   DFLPKSAAGIFQSNLTSDGHKDTTQSTTDIDAAWMEGVLGRTLHNPYTLYDGIRRASLD
FT                   HVANQLGIRGPIEEPAPIATQGVK"
FT   gene            411265..412194
FT                   /locus_tag="RHA1_ro00342"
FT   CDS_pept        411265..412194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00342"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent; GO_process: GO:0009086 -
FT                   methionine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00342"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92178"
FT                   /db_xref="GOA:Q0SJV8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJV8"
FT                   /protein_id="ABG92178.1"
FT                   /translation="MNMSLAHLVALRELARRGTMVAVAEELGYTAGAVSQQIAALEKAV
FT                   GSRLVTRVGRNVVLTDSGTVLAEHAVKILSAEQTALDALRAVHDDVAAPLLLGTFGSTA
FT                   AALLPPVVAAAQRKYPHLALSSRELDVDEAATAVQRGQVDVAFGLDYPNSPMPRTPDIE
FT                   MITLRSERFGLAVSSGAYGIRTEGTIDLREAAEWNWILPPAETQFGRAVRIACRQEGFE
FT                   PIVRHEIVDTAVSLALAGKGLGAAPVTDMMIRLNSSVPIIRVDLEQEIGRRIVLIRLAG
FT                   SETRPTVRAITDIVRAAVDPASTAGEKI"
FT   gene            complement(412216..413346)
FT                   /locus_tag="RHA1_ro00343"
FT   CDS_pept        complement(412216..413346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00343"
FT                   /product="possible transcriptional regulator"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent;
FT                   GO_process: GO:0007600 - sensory perception"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00343"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92179"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJV7"
FT                   /protein_id="ABG92179.1"
FT                   /translation="MNLDEVVTEVAERLSASVVLVDRAFSLIAYSTQSPDVDKDRVQSI
FT                   LTRSCPPEARAWYESFGIADTTRPVITPENPDIEASSRICLPARYAGAAYGYLFVLPDE
FT                   NSAVSDGDLAAAMSLAGQAGAQLAHTARGRDDMAVAVVDLLEGDRKAFARAITRIEESG
FT                   LLPDGGALTVLAVDGFLPAPGARALLAPIGSLTAVMLPAGGGAVDPVRSVAESGAGAGA
FT                   LVGVGGSHQGLRSARRSWQQAKLGVRVARHDESMGPIAYWEELGIYRLSSCGPTSVVAD
FT                   AVLTPSVRALLDHRNVDLLVTAQTYLDQAGDTGATAGVLGIHRQTLYYRLAKIEEITGL
FT                   DLSVGAQRLELHVGLTLGRFIFEHLGTEEGGNGEQT"
FT   gene            413484..415067
FT                   /locus_tag="RHA1_ro00344"
FT   CDS_pept        413484..415067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00344"
FT                   /product="amino acid/polyamine transporter"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0005279 - amino acid-polyamine transporter
FT                   activity; GO_function: GO:0015185 - L-gamma-aminobutyric
FT                   acid transporter activity; GO_process: GO:0015812 -
FT                   gamma-aminobutyric acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00344"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92180"
FT                   /db_xref="GOA:Q0SJV6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJV6"
FT                   /protein_id="ABG92180.1"
FT                   /translation="MITHERKFAISPGPGPHFRPRPVTVSRRPITPATTGAQLALSISC
FT                   PTRPLERLMSTLEQPPETLQKSLKQRHLTMIAIGGVIGAGLFVGSSALLHTSGPAAFVS
FT                   YAITGVVIVLVMRMLGEMATTNPSTGSFAGYARKAFGGWAGFTTGWLYWFFWVVAVGAE
FT                   AVIGGKLLQRWIDLPSWVMAVVLLLAMVATNLRSVRNFGEFEYWFAGIKVAAILLFLGL
FT                   GAAYVFGLWPSHSADFSNLTDHGGFTPNGWTVILSGVVVAVFSMVGPEIATIAAAESAE
FT                   PEKAVAKATNSVIARIGFFYIGSVLLLAIIVPWTDVKVGQSPFVDALTHMGIPGGPDIM
FT                   NAVVLVAVLSCLNSGLYTSSRMLFTLAHKGDAPQSIARLDKHGVPRNSLLLATLVGFAC
FT                   IGLDYLSPDTVFAFLLNASGATILMVYLMIAMSQIKLRGLMTREEVAQLRLKMWLFPYL
FT                   SILAAGGILAVLVSMFYVESSRSQLSLSVGALIATLIAYRLRRRINPQNPLANNISAPA
FT                   PGPITKPASK"
FT   gene            complement(415142..417991)
FT                   /locus_tag="RHA1_ro00345"
FT   CDS_pept        complement(415142..417991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00345"
FT                   /product="possible oxidoreductase, N-termminal"
FT                   /note="GO_function: GO:0005489 - electron transporter
FT                   activity; GO_function: GO:0005506 - iron ion binding;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00345"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92181"
FT                   /db_xref="GOA:Q0SJV5"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJV5"
FT                   /protein_id="ABG92181.1"
FT                   /translation="MLRMISAESLAAELRSSGVSDVLSDGTTRAAYSSDASLYRVRPLV
FT                   VARPRHADEVAAALAVCRREGVPLTSRGGGTSVAGNAVGTGLILDFSRHMNRVLSIDRD
FT                   AQTATVEPGTIQTVLQQAVAPHGLRFGPDPSTFTRCTIGGMIGNNACGSRTLGYGRTSD
FT                   NVKGLHVLTGTGESLQLGSAGEVTASPALSALQQVTRAGLATIRTELGQFGRQVSGYAL
FT                   EHLLPENRFDVTRMLVGTEGTLAVATRATVRLVSEPAHRVLVVLGYADIASAGDATPLV
FT                   LKFDPTACEGIDSRIVEVVRERRGPDAVPPLPAGAAWLFVEVVGDDLDETIARAQQVGR
FT                   DCGAVDSLVVTDEGRTAQLWRIRADGAGLAGRSPAGLPAHAGWEDAAVPPAMLGNYLRD
FT                   FDALMDEFDVTGLPYGHFGDGCMHVRIDWPLDKPGGDGIFRDFLVAASTLVAGYGGSLS
FT                   GEHGDGRARSELLPLMYSPDAMKLFAAVKHVFDPDNILNPGVVVDPHPVDADLRIPAAP
FT                   LLRRNLALAYHHDDGDFTQAVHRCTGVGKCRADNTATGAVMCPSYHATREEKDSTRGRA
FT                   RVLQEMINGTDIDGGWRSPEVHDALDLCLSCKGCSSDCPTGVDMAAFKSEVLHQSYKGR
FT                   IRPASHYSLGWLPRWAKIASHAPGLVNAAMRVPGIGPLALSSAGVDERRTIPPFAKQTF
FT                   RSWFKATENDRVTTGDPVLLFVDSFTNYFTPEVGHATVQVLEAAGYRPQLTDKQQCCGL
FT                   TWISTGQLTAAKKILGRTVDALSGSAAAGIPIVGMEPSCTGVLRSDAAELLGRSAAEPV
FT                   ADATRTFAELLTDRGWEPPSLEGKSVVAQPHCHHHSVMGWSPDAQLLERAGAQVQRLGG
FT                   CCGLAGNFGVEKGHYEVSVAVAEQHLLPAVAGADADTTILADGYSCRTQLSDLTDRRGD
FT                   HLAQLLAAQLDADAARRRD"
FT   gene            417990..418772
FT                   /locus_tag="RHA1_ro00346"
FT   CDS_pept        417990..418772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00346"
FT                   /product="probable transcriptional regulator, GntR family
FT                   protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00346"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92182"
FT                   /db_xref="GOA:Q0SJV4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJV4"
FT                   /protein_id="ABG92182.1"
FT                   /translation="MLHAPSMLRTAPCCYSDRVADEALELEPLTPFAGRRMEQAIAAVR
FT                   AAIDDGRMKPGVKYSVYQLAEGLGISRTPVRDALLRLEEVGVIKFEARQGFRILLPQPK
FT                   EIAEIFAVRLALELPAVRKAAAVADPTLSDALQRQRRLMQDAAAGGDEHEFAHHDLGLH
FT                   DLILDAADNARARAIVKTLRETTRLLGANTADKTRTLTDIDDEHAPIIDAIIAGDPDGA
FT                   EAAMRVHLVNTGKLLVAQAVLSENSGLSVDEIWSAVIS"
FT   gene            complement(418781..420499)
FT                   /locus_tag="RHA1_ro00347"
FT   CDS_pept        complement(418781..420499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00347"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00347"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92183"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJV3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92183.1"
FT                   /translation="MPSGNRSPATAAAAPVTSAETITLRELLRALDTAVVELIDAPAGD
FT                   DVAVASVALVDSSDLTVETESQSPMQDLYLHVGVADADAVRWFDDVSGRARRHRPHAVM
FT                   SKTAHESSAVQAAAHRAGVALVAVHPKARWDHVFPLVQRMLDRSRRGRGAPADPDLLAT
FT                   DTDLFGLAQIVAQNAGGMVSIEDAQSKVLAYSASDEAADELRALSILGREGPRDYLRTL
FT                   QKWGVFDRLREGDEVIDVPAHEELATKRRLVVSIRQSTEDTSTAPRLLGSIWVQQGDAS
FT                   FNPDAVDVLRGASAIAARIITRSLNAPSTEGLLVQRLFGARGGGVDVPSVASALNLPMS
FT                   GAAAVVGFAPTGSESSTATGEFAGMGSMLRLHASSFSRHSVATVIGDRAYVLLPRYKSA
FT                   AGVTAWTRQLVDQFEAKRSIVLRAAIAVPVPDLAQVAAARVEVDRVLDGTAATFPEGRV
FT                   TTLAESRTAVLLGEILDLVGEHPELHDPRVDALYEYDRKHGSNLCESAETYLAEHGDVR
FT                   NAAAALSVHPNTLRYRIRRVEEIIGIGLQDAADRLLFALQLAVHRRATPEKPRQG"
FT   gene            420662..422317
FT                   /gene="rocA1"
FT                   /locus_tag="RHA1_ro00348"
FT   CDS_pept        420662..422317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocA1"
FT                   /locus_tag="RHA1_ro00348"
FT                   /product="1-pyrroline-5-carboxylate dehydrogenase"
FT                   /EC_number="1.2.1.88"
FT                   /note="GO_component: GO:0005759 - mitochondrial matrix;
FT                   GO_function: GO:0003842 - 1-pyrroline-5-carboxylate
FT                   dehydrogenase activity; GO_process: GO:0006561 - proline
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00348"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92184"
FT                   /db_xref="GOA:Q0SJV2"
FT                   /db_xref="InterPro:IPR005931"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJV2"
FT                   /protein_id="ABG92184.1"
FT                   /translation="MDAVTTTPQPINEPVGSFAPGSAERARLQAKLAELDSNPTEIHHV
FT                   IGGAHRRGNGPAIDVVQPHRHAAVLGTFTNAGAQDIQDAVAAATAAAPAWRALSFEDRA
FT                   AVFLRAADLLSGPWRETLAAATMLGQSKTAYQAEIDTPCELIDFWRFNVQFARQILADQ
FT                   PISSPGVWNKLEYRSLEGFVYAITPFNFTAIAGNLPTAPALMGNTVVWKPSQTQAVAAY
FT                   WTMKLLEAAGLPPGVINLVNGPGAEVSDIVLADPRLAGIHFTGSTATFQHLWRQVGDNI
FT                   SNYNSYPRLVGETGGKDFVLAHSSANPDTLTTALLRGAFDYQGQKCSAASRAFVPKSVW
FT                   AKMGNDFIEKASTLKYGDVTDFSNFGGAVIDQRAFDRNADAIARAKATPSLTIAAGGHV
FT                   DDSVGYFVDPTVLLGDDPTDEAFRTEYFGPILSVHVYDDSAAGSFDKVLDLVDKGSAYA
FT                   LTGSIIADDRTAIAQATDDLRFAAGNFYINDKPTGAVVGQQPFGGARASGTNDKAGSPQ
FT                   NLLRWASARTIKETFVPATDHHYPHQAADSSEDI"
FT   gene            422317..423282
FT                   /locus_tag="RHA1_ro00349"
FT   CDS_pept        422317..423282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00349"
FT                   /product="proline dehydrogenase"
FT                   /note="GO_function: GO:0004657 - proline dehydrogenase
FT                   activity; GO_process: GO:0006537 - glutamate biosynthesis;
FT                   GO_process: GO:0006562 - proline catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00349"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92185"
FT                   /db_xref="GOA:Q0SJV1"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJV1"
FT                   /protein_id="ABG92185.1"
FT                   /translation="MAAADLLRPALLAAARSPRMERTVSRIPVTKSLVDRFVAGETEDQ
FT                   AVAATTGILDSGRYISIDYLGEDTTDLGRASGTVSHYLTLLSSLAQRAPATDSGGRPRS
FT                   IEVSLKLSALGQFLPRDGHNVALENAHKICTAAEEAGVWVTVDAEDHTTTDSTLSIVGE
FT                   LREDFPTLGTVLQAYLKRTEADCRDLSGPGSRIRLCKGAYKEPASVAYQGKPAVDEAYL
FT                   RCLRILMNGEGYPMVASHDPAMVDAALTQAKATGRTTDEFEIQMLHGIRDTEQLRLVEQ
FT                   QQHVRVYLPYGEQWYGYFMRRLAERPANLAFFLRSLTSTK"
FT   gene            complement(423335..423700)
FT                   /locus_tag="RHA1_ro00350"
FT   CDS_pept        complement(423335..423700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00350"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92186"
FT                   /db_xref="GOA:Q0SJV0"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJV0"
FT                   /protein_id="ABG92186.1"
FT                   /translation="MGDLFQQGVTQQDYSVTSAVLAVGVFALLTLALAWANARFPRVRG
FT                   VTHGVPVIIVRGGIPDLQRLRTERISLDDLMADARQKGIRRFDEIELAVLETNGRVSFF
FT                   TRAGGAGEGAPEQPGIA"
FT   gene            complement(423735..423986)
FT                   /locus_tag="RHA1_ro00351"
FT   CDS_pept        complement(423735..423986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00351"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92187"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJU9"
FT                   /protein_id="ABG92187.1"
FT                   /translation="MQCSRAQLISTCSRPRDTPEPSAETSDASRTYMTIDPPPGDTLTL
FT                   GFDAYIQPSSQLGHSGSVSVSEKGVDVVTLEFTTWLVP"
FT   gene            424030..424338
FT                   /locus_tag="RHA1_ro00352"
FT   CDS_pept        424030..424338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00352"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00352"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92188"
FT                   /db_xref="GOA:Q0SJU8"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJU8"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92188.1"
FT                   /translation="MQQRRCFGWEEHEMARKDSQPQLKDQEMYEELREKGDSKEKAARI
FT                   SNAAASRGRENVGKSGGKSQSYEDWTVDELQKRAKELGLQGYSKLNKKELIDELRNH"
FT   gene            424395..424832
FT                   /locus_tag="RHA1_ro00353"
FT   CDS_pept        424395..424832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00353"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00353"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92189"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJU7"
FT                   /protein_id="ABG92189.1"
FT                   /translation="MQPEGQENNVLLDGINHIAWISKDSGRLGRFYADVFDADVGPTRS
FT                   HGDDGKETMTVIRIGPHTELNIFVIEGNTEPERQTPMWGRGRIDHFGLQAASHEAFATI
FT                   RQRLIDESASDGAVNDFGAVQSIFFRDPDGLEGEVLIAKPR"
FT   gene            424969..425556
FT                   /locus_tag="RHA1_ro00354"
FT   CDS_pept        424969..425556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00354"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00354"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92190"
FT                   /db_xref="GOA:Q0SJU6"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017520"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJU6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92190.1"
FT                   /translation="MFDLEPATDVMTALVESVRDDQLTAPTPCPELTVGDLLDHIDGLS
FT                   LAFTAAATKTPPAGGSQPPSADAARLGADWRTRIPQRLAALAGAWREEAAWHGMTQAGG
FT                   LDLPADVAGAVAVDEIVVHGWDLAVATGQNFDSTPELLGAAYEFAKSSADQNPHGTPGL
FT                   FGPPVTVPDSAPLLEQLLGLTGRDPRWVPAAT"
FT   gene            425932..426495
FT                   /gene="citA1"
FT                   /locus_tag="RHA1_ro00355"
FT   CDS_pept        425932..426495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citA1"
FT                   /locus_tag="RHA1_ro00355"
FT                   /product="citrate (Si)-synthase"
FT                   /EC_number="2.3.3.1"
FT                   /note="GO_function: GO:0004108 - citrate (Si)-synthase
FT                   activity; GO_function: GO:0008415 - acyltransferase
FT                   activity; GO_process: GO:0006099 - tricarboxylic acid
FT                   cycle"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00355"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92191"
FT                   /db_xref="GOA:Q0SJU5"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJU5"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92191.1"
FT                   /translation="MAPRTTTSPTCPGGSTAPDSSIIARVYPGPARVLPMIEDTEKSGD
FT                   ARALVKGILDRKEKLMGFGHRVYRAEDPRARVLRATAKRLNAPRYEAAAALEQAALAEL
FT                   RERRPERAIETNVEFWAAVILDFAEVPAHMMPAMFTCGRTAGWCAHILEQKRLGKLVRP
FT                   AAIYTGPAPRTPESVDGWDQIAST"
FT   gene            complement(426590..427636)
FT                   /locus_tag="RHA1_ro00356"
FT   CDS_pept        complement(426590..427636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00356"
FT                   /product="transcriptional regulator, AraC family protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00356"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92192"
FT                   /db_xref="GOA:Q0SJU4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJU4"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92192.1"
FT                   /translation="MTSLPPPDGDLVHGDGSDCRPANTPVLQPSLSRAGSTPQQRREVV
FT                   RTTTLGTWIDTIRDTFVALDIDPAEPTHFTGAVHTRHFAHLMAADVTATSQSFRRTARL
FT                   ADRHPLDLMQIGMVVAGEGQLIQDGRTCILGPGDFALYETSRPFTWNLHPDWHLRVFTW
FT                   PRASVSLTESQSQQLTARTVSSTSPVGQLLSPMLSRLLVADGEVSSGGAIGLAGGLADL
FT                   AITAAQEECQPDDPDAAMRELYANMVQYIGQHLDDPDLSPSGIAKAFFVSTRTVHRVFA
FT                   RFDATAAATIREHRLEACRQAMVSPRNIPRSLTDIAAQFGFIDLSVFSRAFTATYGISP
FT                   SRYREQHR"
FT   gene            428065..428304
FT                   /locus_tag="RHA1_ro00357"
FT   CDS_pept        428065..428304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00357"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92193"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJU3"
FT                   /protein_id="ABG92193.1"
FT                   /translation="MPVLLLDAVIALLRMLIRPHRWPADLRGGVNRIAAARAYRRSMAL
FT                   HAHMAGTHDERVYAEDFGATALPAVTTSSCAERR"
FT   gene            428423..429496
FT                   /locus_tag="RHA1_ro00358"
FT   CDS_pept        428423..429496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00358"
FT                   /product="phenylacetaldoxime dehydratase"
FT                   /note="GO_function: GO:0016829 - lyase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00358"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92194"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR025702"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJU2"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92194.1"
FT                   /translation="MESAIGDHLTCPRSLTRRVPDDYQPPFPMWVGRADERLQQVVMAY
FT                   LGVQFRGDEQRPAALAAMRDIVAGFDLDDGPLHHDLTHHADNQGYENLIVVGYWKDLAA
FT                   HTRWIQGSAVADWWASDERLSEGLGYFREIVAPRAEQFETLYAFQDHLPGVGAVMDGIS
FT                   GEINEHGYWGSMRERFPISQNDWMQPSGDLRVISGNPAAGGRVVVQGHDNIALIRSGQD
FT                   WKDAESEERALYLEEILPTLQQGMDFLRDNGESVGCYSNRFVRNIDLEGNYLDLSYNIG
FT                   HWGSLDKLERWAESHPTHLRIFTTFFRVAAGLSKLRLYHEVSVFDACDQLYEYINCHPQ
FT                   TGMMRDAQPVKHARSTT"
FT   gene            429496..431055
FT                   /gene="amdA"
FT                   /locus_tag="RHA1_ro00359"
FT   CDS_pept        429496..431055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amdA"
FT                   /locus_tag="RHA1_ro00359"
FT                   /product="amidase"
FT                   /EC_number="3.5.1.4"
FT                   /note="GO_function: GO:0004040 - amidase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00359"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92195"
FT                   /db_xref="GOA:Q0SJU1"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJU1"
FT                   /experiment="2DGE; MS"
FT                   /protein_id="ABG92195.1"
FT                   /translation="MTVIRPNDDAIGSAANRYGLHLDAATRQEFAGLVDGALGSYDVVD
FT                   DLYADESFSAPSRDHATPDASDNPLGAWYVTTSISTATGGPLTGRRVAIKDNVTVAGVP
FT                   MMNGSRSLEGFVPTRDATVVTRLLDAGATVAGKAVCEDLCFSGSSFTPATGPVRNPWDP
FT                   DREAGGSSGGSAALVAAGDVDFAIGGDQGGSIRIPAAFCGVVGHKPTFGLVPYTGAFPI
FT                   ERTIDHLGPITRTVEDAALLLSVIAGRDGHDPRQPDNLVVDDYVSTLDTGTDGLRVGVV
FT                   SQGFGHANSQPEVDDAVRAAAHRFTEAGGVVDEVSIPWHLHAFHVWNVIATDGGAYQML
FT                   DGNGYGLNADGLYDPELMAYFAQHRIQHADALSETVKLVALCGHHGVTALGGSSYGKAR
FT                   NLVPRARAAYDAALENYDVLVMPTLPYVASELPAQDVDRVTYVTKALGMIANTAPFDVT
FT                   GHPALSVPAGLVNGLPVGMMVIGKRFDDATVLRAGHAFEQIRGAFPTASGQPATSARLS
FT                   LA"
FT   gene            431128..431751
FT                   /gene="nthA"
FT                   /locus_tag="RHA1_ro00360"
FT   CDS_pept        431128..431751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nthA"
FT                   /locus_tag="RHA1_ro00360"
FT                   /product="nitrile hydratase alpha subunit"
FT                   /EC_number="4.2.1.84"
FT                   /note="GO_function: GO:0005506 - iron ion binding;
FT                   GO_function: GO:0018822 - nitrile hydratase activity;
FT                   GO_process: GO:0006807 - nitrogen compound metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00360"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92196"
FT                   /db_xref="GOA:Q0SJU0"
FT                   /db_xref="InterPro:IPR004232"
FT                   /db_xref="InterPro:IPR018141"
FT                   /db_xref="InterPro:IPR023900"
FT                   /db_xref="InterPro:IPR036648"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJU0"
FT                   /experiment="2DGE; MS"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92196.1"
FT                   /translation="MSATIEHTPDNAAPAQAPASDRAWALFRALDGKGLVPEGYTEGWK
FT                   KTFEEDFSPKRGAELVARAWTDPEFRDLLLTDGTAAVDQYGYLGPQGEYIVALEDTPTL
FT                   KNVIVCSLCSCTAWPILGLPPTWYKSFEYRARVVREPRKVLSEMGTDIPENVEIRVYDT
FT                   TAETRYIVLPQRPAGTEGWSREQLQQIVTKDCLIGVAVPQVSAN"
FT   gene            431777..432415
FT                   /gene="nthB"
FT                   /locus_tag="RHA1_ro00361"
FT   CDS_pept        431777..432415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nthB"
FT                   /locus_tag="RHA1_ro00361"
FT                   /product="nitrile hydratase beta subunit"
FT                   /EC_number="4.2.1.84"
FT                   /note="GO_function: GO:0018822 - nitrile hydratase
FT                   activity; GO_process: GO:0006807 - nitrogen compound
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00361"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92197"
FT                   /db_xref="GOA:Q0SJT9"
FT                   /db_xref="InterPro:IPR003168"
FT                   /db_xref="InterPro:IPR008990"
FT                   /db_xref="InterPro:IPR024690"
FT                   /db_xref="InterPro:IPR042262"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJT9"
FT                   /experiment="2DGE; MS"
FT                   /protein_id="ABG92197.1"
FT                   /translation="MDGVHDLAGVQGFGKVPHTVDADIGPTFHAEWEHLPYSLLFLGAA
FT                   DLGAFSVDEVRHVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTHDELEVLAGGPFP
FT                   LSRPAESEGRPARTDTITFEVGQRVRVRDEYVAGHIRMPAYCRGRVGTVTHRTGETWPF
FT                   PDAIGHGRADAGEEPTYHVEFAAEDLFGDDTDAGSVVVDLFEGYLEPAA"
FT   gene            432528..433754
FT                   /locus_tag="RHA1_ro00362"
FT   CDS_pept        432528..433754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00362"
FT                   /product="probable CobW protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00362"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92198"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJT8"
FT                   /protein_id="ABG92198.1"
FT                   /translation="MADTRLPVTVLSGFLGAGKTTLLNQVLRNREGRRVAVIVNDMSEI
FT                   NIDSAEVEREISLSRSQEKLVEMTNGCICCTLREDLLAEISALAADGRFDYLLIESSGI
FT                   SEPLPVAETFTFIDTDGHALADIARLDTMVTVVDAHSFLHDYQTGGRIEADAPDDERDI
FT                   SDLLVDQIEFADVILVSKADLVTSDHLTELTAVLRSLNPTARIQSTSHGQIPLDTILDT
FT                   GLFSLEKAAQAPGWLQELQGEHTPETEEYGISSVVYRERAPFHPGRLHQFLTSEWANGR
FT                   LLRAKGYYWNASRFTEIGSISQAGHLIRHGYVGRWWKFLPETYWPEDDYRRAGILDKWE
FT                   EPVGDCRQELVFIGQGIDPDTLRHRLDACLLTTAEIELGPDTWTAWPDPLGDGQTDQVI
FT                   STVARTNPV"
FT   gene            complement(433860..434387)
FT                   /locus_tag="RHA1_ro00363"
FT   CDS_pept        complement(433860..434387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00363"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92199"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJT7"
FT                   /protein_id="ABG92199.1"
FT                   /translation="MLIHVGTAWWGACCGPAEGVQYRREGIRVESVRPVYRATGGTRYT
FT                   CGTKGRRWTCSSTVIGPATRSMPCRIRSRRAAGRGVLSPPGPASGPGRCDGAAVDEPRA
FT                   GTSEERAVANPAAAAVSCTRVVASVLNSIVEQHEMLDSTAVSRVLGKAATSRNTASRDA
FT                   ALLETTASSPLR"
FT   gene            complement(434752..435252)
FT                   /locus_tag="RHA1_ro00364"
FT   CDS_pept        complement(434752..435252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00364"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92200"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJT6"
FT                   /protein_id="ABG92200.1"
FT                   /translation="MGHDRQCCTVETFLESDERRDRRSGQDGAWAAEPQQTLGWRPKNE
FT                   AAMFAAHRCASMGNRAIAETVIPAAPATTPSRARNDAASSSATADREVATAPQITAATP
FT                   KEEAESDHPERRHGQRPEGDRHGGQPRPALFPYPGVVEGGTHVVVGTGAVGDGGGHDPP
FT                   SHA"
FT   gene            complement(435339..436238)
FT                   /locus_tag="RHA1_ro00365"
FT   CDS_pept        complement(435339..436238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00365"
FT                   /product="possible hydrolase"
FT                   /note="GO_function: GO:0016787 - hydrolase activity;
FT                   GO_process: GO:0019439 - aromatic compound catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00365"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92201"
FT                   /db_xref="GOA:Q0SJT5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJT5"
FT                   /protein_id="ABG92201.1"
FT                   /translation="MDPVVTQSELRGAGVTLAADRWDPPSQETGGSGVDRKGVVLLLHG
FT                   GGQTRHSWRNTGRSLAADGWSAIAVDARGHGDSQWAPDGDYGIDALVADLTSVVAELGE
FT                   KPVLVGASMGGMTSLIGQGENPELARGLVLVDIAPKVETSGTAEIMAFMRSGLEGFASL
FT                   DEAAAAIAAYTPNRVRKPNPDGLRKNLRLRDGRWFWHWDPAFLRQGDEPTRQADSIVRY
FT                   ERARKAAAAVAVPTMLVRGKESKVVSEEGAKELLELIPSAKLIDVTGAGHMVAGDDNDV
FT                   FSGGLTGFLDEDIIAARY"
FT   gene            complement(436723..437565)
FT                   /locus_tag="RHA1_ro00366"
FT   CDS_pept        complement(436723..437565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00366"
FT                   /product="probable enoyl-CoA hydratase"
FT                   /note="GO_function: GO:0016853 - isomerase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00366"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92202"
FT                   /db_xref="GOA:Q0SJT4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJT4"
FT                   /protein_id="ABG92202.1"
FT                   /translation="MPETGTHDAIILERHGEIAVVRLNRPHQLNAFTNAMCYRLIEIFD
FT                   ETDADDEVRAVVITGTGRAFCAGADLAAGGDTFVLDDDPETGGAPADTGGQVSLRIYRS
FT                   LKPVIAAINGPAAGVGVTMTLPADIRIASETAKFGFVFTRRGLVPEACSTWFLPRAVGI
FT                   STAVEWTVGGKMVSAVEALERGLVRELVPADQVLERALDIARELVSGTSPVSAALTRQL
FT                   MWRMLGASDPEVAHRAESIGIYVRGTADDVREGVDAFLEKREPKFPNRVTDGLPNLFE"
FT   gene            complement(437600..439117)
FT                   /locus_tag="RHA1_ro00367"
FT   CDS_pept        complement(437600..439117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00367"
FT                   /product="long fatty acid CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /note="GO_function: GO:0008756 - o-succinylbenzoate-CoA
FT                   ligase activity; GO_process: GO:0009234 - menaquinone
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00367"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92203"
FT                   /db_xref="GOA:Q0SJT3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJT3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92203.1"
FT                   /translation="MAATVGSALHWWAKTKGEQDALTVAGETLTYRELQDWSSRIARKI
FT                   VDLEIQPGQRVGVLGPNSLTWPVIALGVLKAGGVLIPLNPRFKPAELRKVVDDAGAVLV
FT                   VMPNEFAQTVDAARELGRTFDTLSFDELAPLRAGEQDDFRIDLEPDEPTALLFTSGSTG
FT                   MSKGVICTNRTLLNIVFEASLTEEGFRPGSTSLLVLPLVFTPGLVWGLVMTTVLGGKLI
FT                   IEKEFDPGRAAQLLGEHHVQAIFGVPLIFEAISRSPEFADADLSSLRTAIVGGAAVAPA
FT                   LLQRWADKGVALRQIYGMTEAGGVATATLVAEAFDHPDTCGYGSIFTEVKVVRPDGTDA
FT                   APGEEGEILLRGPGVTPGYWNDAESTTAALQNNWLHSGDLGTLDDEGRVKFVDRLKDLI
FT                   ITGGINISPVEIERVISEIPGVEEVAVIAAADERFGETPAAIVTVKDGVDAAAIIEHCD
FT                   RLVADYKVPRYVVIRDEPLPRLPSGKLSKTAIRSEYRDVAERFDKVR"
FT   gene            complement(439310..440743)
FT                   /locus_tag="RHA1_ro00368"
FT   CDS_pept        complement(439310..440743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00368"
FT                   /product="probable multidrug resistance transporter, MFS
FT                   superfamily protein"
FT                   /note="tc: 2.A.1.3; GO_component: GO:0016021 - integral to
FT                   membrane; GO_function: GO:0003824 - catalytic activity;
FT                   GO_function: GO:0008199 - ferric iron binding; GO_function:
FT                   GO:0015520 - tetracycline:hydrogen antiporter activity;
FT                   GO_process: GO:0006725 - aromatic compound metabolism;
FT                   GO_process: GO:0015904 - tetracycline transport;
FT                   GO_process: GO:0046677 - response to antibiotic"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00368"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92204"
FT                   /db_xref="GOA:Q0SJT2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJT2"
FT                   /protein_id="ABG92204.1"
FT                   /translation="MTQAPDRAHLAAPESACRSALLVPALCFVVMITSMMQTAVVPLLP
FT                   VIAVQLDVGTDAVGWTVTANLLAAAVCTPLLGHLADRHGPRRVMLAVLGAVLIGSVLCV
FT                   AWNGLPALIAGRVLQGMSYALFPVGVAVVRGALGPHRVPMALGVMSGALSVGGGVGMIA
FT                   AGLMYTEGSDYRRVFWMLLILTTTAMVVGWRVIPRTPGSGPRGGFDFWGAIGLAIGLPG
FT                   LLLALTQGGTWGWLSVRTIGCTVTGALVLAGWYRHERRATAPLVAPALLTARLVAPAHV
FT                   AAFLVGVAMFVQFLAIATFVQISRGEAGYGFDASVLETSLVYLLPGQLAGTAAAAVSGL
FT                   VVRRFPAHTVLTAACAVGVCGFVMLIFAHDYTWQVITAVAVINVFVIVAYGALPSMLIG
FT                   SSPPGSTGAVNGINAIARTFGSSLASALVAVLLATITIPGTSTPTEQAYIVVFTVGGAA
FT                   ACAAGLVAVTARRVAKYKT"
FT   gene            complement(440768..441730)
FT                   /locus_tag="RHA1_ro00369"
FT   CDS_pept        complement(440768..441730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00369"
FT                   /product="probable phthalate dioxygenase reductase"
FT                   /EC_number="1.14.12.7"
FT                   /note="GO_function: GO:0004497 - monooxygenase activity;
FT                   GO_function: GO:0005489 - electron transporter activity;
FT                   GO_function: GO:0005506 - iron ion binding; GO_process:
FT                   GO:0006118 - electron transport; GO_process: GO:0006810 -
FT                   transport; GO_process: GO:0019439 - aromatic compound
FT                   catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00369"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92205"
FT                   /db_xref="GOA:Q0SJT1"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJT1"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92205.1"
FT                   /translation="MNGSTNTDQRKMRVIGKDVLAHGVMAVRLADPDGGAVPAWEPGAH
FT                   IDVIIDRSTVRQYSLCGDASDTTSLAIAVLREEDGRGGSRWVHDSLQVGDLIAIAGPRN
FT                   NFTLEPAQSYLFVAGGIGITPLLPMLRSAEAASADWRLLYGGRIRTSMAFAEELVARYP
FT                   GRIELRPQDEYGILDLSAALDAVPDGTAVYCCGPEPLLQAIENECLAHPNLSLYVERFA
FT                   AKERPANAVDRSFAVELRRAGRTITVDANESLLDAVLRSDVDAPFSCREGTCGTCETRV
FT                   LEGVPEHRDSILTEDEQAENDCMMICVSRSCTAKLVLDL"
FT   gene            441838..442629
FT                   /locus_tag="RHA1_ro00370"
FT   CDS_pept        441838..442629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00370"
FT                   /product="short chain dehydrogenase"
FT                   /EC_number="1.1.1.100"
FT                   /note="GO_function: GO:0004022 - alcohol dehydrogenase
FT                   activity; GO_function: GO:0004316 - 3-oxoacyl-[acyl-carrier
FT                   protein] reductase activity; GO_function: GO:0051287 - NAD
FT                   binding; GO_process: GO:0006633 - fatty acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00370"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92206"
FT                   /db_xref="GOA:Q0SJT0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJT0"
FT                   /protein_id="ABG92206.1"
FT                   /translation="MTQTSSPDQSESVLDLFRLDGSVAVVTGAGSGLGAGFARALAEAG
FT                   ADVVIAARRRENLEAVAVTVEATGRRCLVVPTDVTVPEQCDALAQAAVAEFGRLDILIN
FT                   NAGVTSSAPATRERPEDFRAVLDVNLMGSYWAAQACGRVMGPGSTIVNVASMLGLIKSA
FT                   LPQAAYAASKAGMIGLTRDLSNQWSKRKGIRVNAIAPGFVETDLISEMSSDTLDEFLRG
FT                   SSLGRTATQREIDGAVVFLASRASGYITGSTLAVDGGTSGH"
FT   gene            442657..443520
FT                   /locus_tag="RHA1_ro00371"
FT   CDS_pept        442657..443520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00371"
FT                   /product="probable hydrolase"
FT                   /note="GO_function: GO:0016787 - hydrolase activity;
FT                   GO_process: GO:0019439 - aromatic compound catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00371"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92207"
FT                   /db_xref="GOA:Q0SJS9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJS9"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92207.1"
FT                   /translation="MTYSTKVTTLRGDGVSLVADLWEPRREPKGTVLLLHGGGQTRHSW
FT                   QRTGIRLAQQSWRAYCIDARGHGDSQWSTDGDYSPDAHARDIRAVVADLGEPPVLVGAS
FT                   MGGMASLVASGDEPGIARALVLVDITPKAEPEGLAKITEFMHAGLSGFDSLEDALGAVI
FT                   DYNPHRSRAPRVEGLRKNLREHDGRWYWHWDPRMLTDKTNSADAAAAREIRARAAARAI
FT                   RVPTLLIRGAQSDVVSPEGARELLELIPGSRYIDVGGAGHMVGGDDNDVLSRGLVEFLD
FT                   EAVLTV"
FT   gene            443606..444277
FT                   /locus_tag="RHA1_ro00372"
FT   CDS_pept        443606..444277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00372"
FT                   /product="probable tetracycline repressor protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_function: GO:0016566 - specific
FT                   transcriptional repressor activity; GO_process: GO:0006355
FT                   - regulation of transcription, DNA-dependent; GO_process:
FT                   GO:0016481 - negative regulation of transcription"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00372"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92208"
FT                   /db_xref="GOA:Q0SJS8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR003012"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJS8"
FT                   /protein_id="ABG92208.1"
FT                   /translation="MARPSKPLISRAAAVAASIEIIDSEGLDAFSLPRLAKHIGVRAPS
FT                   LYHHFSDKSEILEAVARQIAGAGNLPRRKPGPDWPEFFVTLSMNLRRSILKHRNAAPIL
FT                   LQYLPRDLLIGTYEDTARFLEKSGVPAHLHVQILDGMERLTLGAVLTEAMRKPSTKSTI
FT                   FPNVDPESQPLLSKALAANEMTSRQLFEEMIRSFLHGVVRNESTAITDAAPSDNVRVSA
FT                   N"
FT   gene            complement(444380..445879)
FT                   /locus_tag="RHA1_ro00373"
FT   CDS_pept        complement(444380..445879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00373"
FT                   /product="probable betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00373"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92209"
FT                   /db_xref="GOA:Q0SJS7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJS7"
FT                   /protein_id="ABG92209.1"
FT                   /translation="MTTTETATGTTTPSIADRDQIFLGGRWVDSTGDEWVDVVDSFTEE
FT                   KVARVRTATVEDVTKAVAAARESFDRGEWASRTMADRADVLDAIADRLEQRVDELTPIG
FT                   VIEVGVPVSVSRPTQQMTGGLFRAVAAVAREFEVSEERSRADGGISRIVKEPTGVVAAI
FT                   IPWNGPIGTIAFKLAPALAAGCSVVLKTAPEAPISPSVFADIIAELVAEGRIPEGVVSV
FT                   LCADREVSESLVTNPDVDHVTFTGSTAAGRRIMSLAGERIARVSLELGGKSAAIILDDA
FT                   DINHVLQTLPMGGCMQSGQACIALTRVLVSRKRHDEVVEALKAAYGSLPMGNPWEPTNF
FT                   LGPLASKRQQDRVLGYIDIAKEDGAKVVLGGGRPEGLDTGFFVAATLIDDVQPDSRIAQ
FT                   EEVFGPVISVITYEDEEDAIAIANNSVYGLSGAVYTEDLDHGFEVARRIRTGTISVNTA
FT                   TMDFTLPFGGYKQSGVGREGGIEGLEEFFETKTVHLPAPAQ"
FT   gene            complement(445899..446723)
FT                   /locus_tag="RHA1_ro00374"
FT   CDS_pept        complement(445899..446723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00374"
FT                   /product="probable carveol dehydrogenase"
FT                   /EC_number="1.1.1.243"
FT                   /note="GO_function: GO:0004022 - alcohol dehydrogenase
FT                   activity; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00374"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92210"
FT                   /db_xref="GOA:Q0SJS6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR023985"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJS6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92210.1"
FT                   /translation="MGRLDGKVAFITGAARGQGRSHAVRLAEEGASIIAVDICDQIPTV
FT                   FYPMATSDDLAETERLVKEAGGAIVALVGDVRKLEDVQAAYDAGIAQFGKVDIVLPNAG
FT                   IMPVIGPGEQRQAWHDAIDTMLTGVWHVLDVTVPNLVERGEGGSIIITSSAAGLTSIGL
FT                   NTLPGQAGYSAAKHGVVGLMRLYAKQLAPHSIRVNTVHPTGVNTPMVANAEYGEFVNAH
FT                   PEVAADESYKNPMPVELIEAVDISNAIVYLASDEARYVTGVTFPVDAGYNIR"
FT   gene            complement(446903..447889)
FT                   /locus_tag="RHA1_ro00375"
FT   CDS_pept        complement(446903..447889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00375"
FT                   /product="possible acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00375"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92211"
FT                   /db_xref="GOA:Q0SJS5"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJS5"
FT                   /protein_id="ABG92211.1"
FT                   /translation="MISYQWCSELDSGDRDEVLALVAAAADYDDEAGFSSINPGDVTST
FT                   SRNGVRVYHLPITARRDLSARDDAPLVVVAYLHLQVDDGGLGTAQFVVHPDYRSRGIAT
FT                   MLVEEVGLDTTVNGGWEGTGAVALRCWAYGTHPASERLTRRFGVAPVSRLWTLFRHLSG
FT                   PFASPLDDVSVPGGITLAEARPLEDSMASKSIEEVLDAAALVPAQRERLADEIRLGAGT
FT                   VVVATDSSGASLGFVWFDSALSTHLELDAASVRALVLTEAARREGLGTTLLVVALGALR
FT                   DAGAQIALIRIDPDDAGAVRMCRLLSFEQEEEHSCYQVGEWAEVPSF"
FT   gene            448058..449227
FT                   /locus_tag="RHA1_ro00376"
FT   CDS_pept        448058..449227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00376"
FT                   /product="ring hydroxylating dioxygenase, large subunit of
FT                   terminal oxygenase"
FT                   /note="GO_function: GO:0005506 - iron ion binding;
FT                   GO_function: GO:0016702 - oxidoreductase activity, acting
FT                   on single donors with incorporation of molecular oxygen,
FT                   incorporation of two atoms of oxygen; GO_process:
FT                   GO:0006118 - electron transport; GO_process: GO:0019439 -
FT                   aromatic compound catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00376"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92212"
FT                   /db_xref="GOA:Q0SJS4"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJS4"
FT                   /protein_id="ABG92212.1"
FT                   /translation="MTEVGIPREERIRRALDHLRNDTTDEFEHVTWFEPVEFTDPDIAK
FT                   IERERVFGRVPSIIIHGSEIPRAGDFVTLQLPRNNVIIVRQRDGSVKTLVNQCRHRGAM
FT                   VEKEEKGRCRLFSCPYHRWSYDTDGSLRTITRDNTFGDADRSERNLVQLPTEERHGFVW
FT                   VVDDADATIDVADWLGPDMDSIMGSYGLDKMVTTRVQRFDEPINWKLMQDAFLDGYHIQ
FT                   YAHPNTAAKHIHTNVMAFEDFGNHCRFLNLRKTIDRWIEEDPGDRSLAEHITESHLVGP
FT                   NSTLLKQPDHFQLLTFRPHRSDPQRCHMEIRLVAPTLEESGLTEERWNRIWDKNVEILV
FT                   AVLHNEDFPILRGSQVAMDSASAGNMLLGRNEVANQVFRRAIQKLVNES"
FT   gene            complement(449324..450577)
FT                   /locus_tag="RHA1_ro00377"
FT   CDS_pept        complement(449324..450577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00377"
FT                   /product="cytochrome P450 CYP254"
FT                   /EC_number="1.14.-.-"
FT                   /note="GO_function: GO:0004497 - monooxygenase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00377"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92213"
FT                   /db_xref="GOA:Q0SJS3"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJS3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92213.1"
FT                   /translation="MAFEGCSALTTHDIATDLMVDFDVYDPALAAPVDVFQAKAAGLRA
FT                   RGPILYSPHYGGHWIVTRYDDIFRILRDAETFSSYPNNLVDAGQGKFIPVEIDPPEHTQ
FT                   YRQALQPLFGPARMKELEPKIREIINELIDGFASSGRCEFVAEFAHALPTRVFLTLMGW
FT                   PLDDAERFTEWTDIALQGIPGAGEEESARARAEAATNVFEYFGAFVDRVRSGQEDGESV
FT                   TAQIINTPILMDGVERYLTDEELRRMFFLLLIAGLHTVQGSLGWAMVHLANNPAQRNAL
FT                   IEDTSLVPDAVEEILRIEAAVSMGRRATRDVEIAGVKVEAGDQLLLLLCSANRDDTEFD
FT                   DPDAFVIDRGSNRHLSFGAGPHRCLGSHLARLELTLAMEEIHRRIPDYALVESDPPLMH
FT                   GTSVRGCVRLPLTFTPEL"
FT   gene            complement(450698..450925)
FT                   /locus_tag="RHA1_ro00378"
FT   CDS_pept        complement(450698..450925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00378"
FT                   /product="probable ferredoxin FdxD"
FT                   /note="GO_function: GO:0005489 - electron transporter
FT                   activity; GO_function: GO:0005506 - iron ion binding;
FT                   GO_process: GO:0006118 - electron transport; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00378"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92214"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJS2"
FT                   /protein_id="ABG92214.1"
FT                   /translation="MTDHDSKTEYGTRRLVVDRSVCAGHGLCYSRSPEVVDCDDSGYPV
FT                   ILQDALALDEHIAAAEEAVSVCPERALTLE"
FT   gene            complement(450931..451812)
FT                   /locus_tag="RHA1_ro00379"
FT   CDS_pept        complement(450931..451812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00379"
FT                   /product="short chain dehydrogenase/reductase"
FT                   /note="GO_function: GO:0004022 - alcohol dehydrogenase
FT                   activity; GO_process: GO:0019439 - aromatic compound
FT                   catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00379"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92215"
FT                   /db_xref="GOA:Q0SJS1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJS1"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92215.1"
FT                   /translation="MKLEGKVALITGAGSGLGREASQLFAAEGAKVAVVDIDPERAKGT
FT                   VELVEKQGGSAIAVTADVRVEQQVVEAVAATVAAFGKLDIAWANAGIISRGGVPSVAGG
FT                   EQVEFQDLTDADWQDVIGVNLSGVFYTAKAAVPALRANGGGVILATSSAASFVAYHSIA
FT                   AYSATKAGVNGMVRALSLDLGKYGIRVNAIAPTHGMSPNFLAPAGTPVVGQSYEEAAGP
FT                   WEPSVSPIPLKVNRPPSLKDNARAALFLVSDESAYISGVTLPTTDGGTLSRVAMMFPED
FT                   GNNPPPMVTGEE"
FT   gene            451881..452180
FT                   /locus_tag="RHA1_ro00380"
FT   CDS_pept        451881..452180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00380"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92216"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJS0"
FT                   /protein_id="ABG92216.1"
FT                   /translation="MAPSRSVSHIQRCQYAMNRISSREYSMPGCDSLKCSWVFTTRSSS
FT                   SLPVIAAPHGQLSLVFILTSVSLSAPLVRSDAHSTSATEKFGSASRNVVDVTSH"
FT   gene            complement(452241..453590)
FT                   /locus_tag="RHA1_ro00381"
FT   CDS_pept        complement(452241..453590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00381"
FT                   /product="aromatic acid transporter protein, MFS
FT                   superfamily protein"
FT                   /note="tc: 2.A.1.15; GO_component: GO:0016021 - integral to
FT                   membrane; GO_function: GO:0005351 - sugar porter activity;
FT                   GO_process: GO:0006810 - transport; GO_process: GO:0046677
FT                   - response to antibiotic"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00381"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92217"
FT                   /db_xref="GOA:Q0SJR9"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJR9"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92217.1"
FT                   /translation="MSQISVPGKERAVSGARSVVLTCLAITILDGVDLIMFGAVLPTLL
FT                   ELEQWGITTGSAGLIGSLSLFGMMAGAMLAGYITDRIGRRPVVLACIVSFSLFTGLCAI
FT                   APNLESFGLFRLLAGIGFGGALPTLIALTQEYVKVDRRQFYNGVIQTGFPIGGCVVAIA
FT                   AIFIIPAFGWKSMFAVGGLLGVVLFVIAYRKLPESIAFLASKGRHNEARELAQRYSIDA
FT                   GAESGMALEKSKSGSTGSPSGLRLLFAPGYRIATIMFPLITFFGLLVSYGMNTWIPQML
FT                   RSSGYDLGSALTFLLAFNIGSGFGMVVITGLADRLGSRPVISVSFVFGALAVSALTLQP
FT                   AQALVFGLVLLIGFCASSTTGVYGFVGVFYPAAARGTALGLAVGLGRLGGVCGPILTGM
FT                   IMSSALGADWAFYAFAFAGVAAAVLVSLVPRKNKAASETDVSVEKATEPA"
FT   gene            complement(453677..454867)
FT                   /locus_tag="RHA1_ro00382"
FT   CDS_pept        complement(453677..454867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00382"
FT                   /product="probable naphthalene 1,2-dioxygenase"
FT                   /EC_number="1.14.12.12"
FT                   /note="GO_function: GO:0005506 - iron ion binding;
FT                   GO_function: GO:0016702 - oxidoreductase activity, acting
FT                   on single donors with incorporation of molecular oxygen,
FT                   incorporation of two atoms of oxygen; GO_process:
FT                   GO:0006118 - electron transport; GO_process: GO:0019439 -
FT                   aromatic compound catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00382"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92218"
FT                   /db_xref="GOA:Q0SJR8"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJR8"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92218.1"
FT                   /translation="MVYTDLPYDEATKAGFARAMFDHLDNGTTDMAPEILEVDPRVYTD
FT                   PELAARERRELFGYVPIIAVHSTELSGNNDFATVQLPNNEVVLVRQADGRVRGFVNTCR
FT                   HRGAQLVPEEKGSKRIFSCRYHGWAYGSDGRLRSIADEHTFGTVDRSCMSLLEVPVEER
FT                   HGFVWVIDSAAGDREIDIAEWLGREFDESLAAMDMDKYHCHIAQNFDVDINWKVLMDAF
FT                   LDGYHITSTHAGTVAPYFYNNAQAWEPMGRHGRMVTARKSIDSVRDVAPDDAPIDRHIT
FT                   VAHFLMPNMSVLRQPDHLEVLNFVPTPGTAVGTRMQMRLLTREPVVTDEQKARWDKNWK
FT                   ILMAVLRDEDLVVNEGVQKSVANTDVGPLYFGRNEIANQHFHQWMGRAFADPRKWG"
FT   gene            complement(454913..456361)
FT                   /locus_tag="RHA1_ro00383"
FT   CDS_pept        complement(454913..456361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00383"
FT                   /product="probable betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="GO_function: GO:0008802 - betaine-aldehyde
FT                   dehydrogenase activity; GO_process: GO:0008152 -
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00383"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92219"
FT                   /db_xref="GOA:Q0SJR7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJR7"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92219.1"
FT                   /translation="MHQFNSTERIIVSLELYVDGKWIASTSTERIDVVNPTTEERIGSV
FT                   PAGAAEDVDMAVAAARRALGQWSQTAPHTRAEFVSHLADELERRQDDITDIVVAEVGTP
FT                   RRVARWAQVGLGIVDLREAVTAAKDFPWEEPLRNSLIVREPVGVIGCITPWNYPLHQIT
FT                   AKIGAALVAGCTVVVKASEVAPFTAHALAEAVEAVGIPAGVFNMVHGTGPIVGEAIAVH
FT                   PDIDMVSFTGSNSVGKRVLELAAGTVKRVSVELGGKSAAVLLDDLDVEEFAKAVPHTVR
FT                   ACYMNGGQSCNAQTRLLVPRSRLSEAETLAAQAVAAYAPGDPTGGNTKLGPMVTAAQRE
FT                   RVLGYIRAGVKEGAKLVAGSVDAPARTGFFVEPTVFSEVDPDSTIAQEEIFGPVLSIIA
FT                   YDTTEHAIEIANGTIFGIAGAVWSADAERAKSVARRLRATQIEVNGGKFNGAAPFGGFN
FT                   QSGHGREGGAFGLEEFVEIKSLQL"
FT   gene            complement(456425..457084)
FT                   /locus_tag="RHA1_ro00384"
FT   CDS_pept        complement(456425..457084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00384"
FT                   /product="probable tetracycline repressor protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_function: GO:0016566 - specific
FT                   transcriptional repressor activity; GO_process: GO:0006355
FT                   - regulation of transcription, DNA-dependent; GO_process:
FT                   GO:0016481 - negative regulation of transcription"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00384"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92220"
FT                   /db_xref="GOA:Q0SJR6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJR6"
FT                   /protein_id="ABG92220.1"
FT                   /translation="MGRPAKPLISRSATIAASIEIIDTEGIDAFSLPRVAKQLNVSTSS
FT                   LYHHFADRRELMTEVAKELMTGATVPESSSGTDWVEWFVELSLNYRDAILRHPNAALVL
FT                   VQFLPRDVLTRTYERCARILEDGGVPAQLHVVILDGLEKLALATTLSDLMRDPVGSTEV
FT                   FPKVDERRHPTLARALEANQWSSRELFVVTIRGFLAGVMGLAATQVSVESLRELLG"
FT   gene            complement(457084..457620)
FT                   /locus_tag="RHA1_ro00385"
FT   CDS_pept        complement(457084..457620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00385"
FT                   /product="probable nitrilotriacetate monooxygenase
FT                   component B"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00385"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92221"
FT                   /db_xref="GOA:Q0SJR5"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJR5"
FT                   /protein_id="ABG92221.1"
FT                   /translation="MSTRSDSSTQSAVNMRALRDVLGHFCSGVTVVTAMVGDEPAGFTC
FT                   QSFSALSLDPPQVLLCPSRRSTSWPTIRTAETFCINVLSSGQRDLSDSFAKSGGPKFTG
FT                   VQWRPAERGAPILEGVAAWFEVALTAEHDGGDHLIAVADMLDFGSDPVTEPLVFHRSRY
FT                   GGVVELSLGSIESGT"
FT   gene            complement(457632..457946)
FT                   /locus_tag="RHA1_ro00386"
FT   CDS_pept        complement(457632..457946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00386"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00386"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92222"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJR4"
FT                   /protein_id="ABG92222.1"
FT                   /translation="MRIVVDEISGKPQFRLEDADEFGSLHIEPADPKYRIWADRLSALG
FT                   RPSGAQQVFVDPDTIRGLAGEKALDPSWSTRFEAMIEFADCRGWISPAGEIRVHIALRV
FT                   "
FT   gene            complement(457930..458490)
FT                   /locus_tag="RHA1_ro00387"
FT   CDS_pept        complement(457930..458490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00387"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00387"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92223"
FT                   /db_xref="GOA:Q0SJR3"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJR3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92223.1"
FT                   /translation="MNGVQLTVAVDLSTPDAPVDSTIVVRSLDDPHTVRITAPNLREAQ
FT                   KKRAYIRAAGDTSSGRVDVLLDVVVHIAPDARTARSEAGTGQRRPSETGMTDGDTVVYV
FT                   GTPSGLASLILDIRAADIADGVTVVPAVTERNARDACVQLLLDEVLPILEARGPVQESA
FT                   VRQDVHYFPHTTMNGGEAHANRG"
FT   gene            complement(458487..458969)
FT                   /locus_tag="RHA1_ro00388"
FT   CDS_pept        complement(458487..458969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00388"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00388"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92224"
FT                   /db_xref="InterPro:IPR024311"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJR2"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92224.1"
FT                   /translation="MITDTEGISIAERIVGAWELVEYSTTSDSGKVDYPLGPEARGLII
FT                   YSSDGFMSAQIMRPGRTPYRSRNVHSGEVSERSEAAGGYLAYSGPYHVDEDRSAVWHEV
FT                   AVSLYPNWLGENQKRHVRFDGDRMTLSSDPLMFRTTTLSPALVWRRTAPRTGRTTS"
FT   gene            complement(458989..460164)
FT                   /locus_tag="RHA1_ro00389"
FT   CDS_pept        complement(458989..460164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00389"
FT                   /product="possible nonspecific lipid-transfer protein"
FT                   /note="GO_function: GO:0008415 - acyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00389"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92225"
FT                   /db_xref="GOA:Q0SJR1"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJR1"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92225.1"
FT                   /translation="MTDTFLRGAAAVVGASEFHYKRGESPDSELRMTLRAIVEAAADAG
FT                   VSPREIDGFVSYGGGDNDGTVVGASLMSPRIRWSTMIWGGGGGGAAAAITNAAVAIAAG
FT                   QARCVVVYRAMAQQDSGRLGYAKHHFDGHMLPHGVGSPAQACALRTRRMLEHDGVPESA
FT                   MRSLVLADYFHAQHNPHAAAYGRPLDEAEYEASRMIVEPYRLYDCSRENDGAVALILVA
FT                   ADRAEELSPSPAYVLAGSQGAVGGYAVDSENDLDYTSAGFSGAAGVAETLWADADLGPD
FT                   QVDVVQVYENFSGSGVAALIDHGLCPRGAEAGKVMTLENLTAPHGLLPVNTSGGNLADS
FT                   FVNGMGLAVEAVRQVRGSSTNQVPDAQVSLFIGGPMAALSSSVLLCTRDVL"
FT   gene            complement(460161..460643)
FT                   /locus_tag="RHA1_ro00390"
FT   CDS_pept        complement(460161..460643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00390"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92226"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJR0"
FT                   /protein_id="ABG92226.1"
FT                   /translation="MTPGAGTAREFPATALAGPYADGLDVPFWEGLRAGELRLQRCGEC
FT                   DLWIWGPRWMCGRCQTFDPKWTAVEPVGRIFSWSRTWHPFIAELAGELPFVTVLVELPD
FT                   AGGRRVLGLLAENGEGDIAIGDAVAGIIQQPADAPWPVLRWRLTSTFNQTERETRR"
FT   gene            complement(460718..461539)
FT                   /locus_tag="RHA1_ro00391"
FT   CDS_pept        complement(460718..461539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00391"
FT                   /product="probable carveol dehydrogenase"
FT                   /EC_number="1.1.1.243"
FT                   /note="GO_function: GO:0004022 - alcohol dehydrogenase
FT                   activity; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00391"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92227"
FT                   /db_xref="GOA:Q0SJQ9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR023985"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJQ9"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92227.1"
FT                   /translation="MATLDGLDGKVAVITGGARGQGRSHALTLAAAGAKIVVCDIAAPI
FT                   GEVQYALATSDDIEETIQLVKEAGGEIAGIQADVRSSADMRAVADLAVSQFGRIDILLA
FT                   NAGIHDHAESTIEIEDDAWQTMLDVKVTGAWKACKAVVPVMIEGGRGGSIVITSSVDGL
FT                   GASPSWGHYGAAKHGLQGLKDTLAFELADHNIRVNTVNPTGVNSPMAAGLSKVLPHVVR
FT                   KWKHNDRTNLLDVMMLEPQDISDAVLWLVSDAAKYVTGIDLPIDAGYLTKH"
FT   gene            complement(461589..462812)
FT                   /locus_tag="RHA1_ro00392"
FT   CDS_pept        complement(461589..462812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00392"
FT                   /product="monooxygenase"
FT                   /note="GO_function: GO:0004497 - monooxygenase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00392"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92228"
FT                   /db_xref="GOA:Q0SJQ8"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJQ8"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92228.1"
FT                   /translation="MEPEAGNNGSSVNNAPTSRKAPLRCGVFLPPYHNPRRNPTMAIEQ
FT                   DLRHVEDLDRLGFHQVWFGEHHSGGYEVGPSPELMIAAAAQRTSRIELCSGVISLPYHH
FT                   PLMVADRITFLDHMTRGRIRIGVGPGALVADSQMMGMDYNLLRPRMEESLDAILELLNT
FT                   PGPVDRKTEWFSLEDARVQLGPYSYPGVPITVAAAMSPSGPKLAGKYGLGLLSIGGTSA
FT                   KSVELLAQTWDITTHEANVYGQSVDRNDWAIVGNIHIADTFEQAVEDTRFGLRDFMDYR
FT                   HVVTPMKMIEPGEEVAHEELVRRVNESGYGCIGDANDAIDYIQKIIDRTGGFGTFLATA
FT                   HDWADIEATSRMYRILMRDVMHRFTGTCEPLLNSYHWTQARKEGFSERFATGISQATQD
FT                   YERAKSAG"
FT   gene            463274..464512
FT                   /locus_tag="RHA1_ro00393"
FT   CDS_pept        463274..464512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00393"
FT                   /product="cytochrome P450 CYP254"
FT                   /EC_number="1.14.-.-"
FT                   /note="GO_function: GO:0004497 - monooxygenase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00393"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92229"
FT                   /db_xref="GOA:Q0SJQ7"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJQ7"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92229.1"
FT                   /translation="MTSTQLDLPEHLITDFDVYDPSLAVPADVFQERVAALRKQGPVLY
FT                   SPHHGGHWVVTRYKEALQVLQDPETFSSFPNNLLNAAQGKFLPLELDPPEHSYYRQALQ
FT                   PLFSPKQMKALEPEIRKIITELIDQFADRGECEFISEFAHELPTRIFLALMGWPLSDAP
FT                   QFTEWTDITLQGIPGASEAESAEARAKAAGEIYEYFGKVVARVRSGEDSSESLTAQIIN
FT                   TPLDIDGTPRSLTDEELSRMFFLLLVAGLHTVQGALAWGLIHLSHNLEQREAIIDDPTL
FT                   IPSAVEEILRIETATSSGRRATRDAEIGGVSIKAGDQLLVVMTSANRDNDEFDSPEELQ
FT                   IERHPNRHIGFGAGPHRCLGSHLARLELRLAMEEIHRRIPDYALVPDNPAVFHSSQVRG
FT                   CEKLPITFTPPTH"
FT   gene            complement(464592..467018)
FT                   /locus_tag="RHA1_ro00394"
FT   CDS_pept        complement(464592..467018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00394"
FT                   /product="probable formyl-coenzyme A transferase"
FT                   /note="GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00394"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92230"
FT                   /db_xref="GOA:Q0SJQ6"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJQ6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92230.1"
FT                   /translation="MALPLQGVRVLELTDGFGDTAGRFLADLGAEVVRVELPGGSASRT
FT                   AQPILDGVSVPFALRNANKRGIVLDLDADDDRDRLRLLAQRSDILLESFPPGFLATRGV
FT                   GAADLCRVNPALVAVSITGFGQNGPYRDWAATEQILYALSGVLSRSGEPGEAPLLPPNG
FT                   LIDESVGVHSAWSALLAYYDRLHTGHGQLVDISAFEVIVHGFDPGFGVQGSAAAGRSED
FT                   FPRGRPDAANFYPVYRCGDGQVRICLLAKRQWQAMYEWLGRPEEFADPKYDTIPARFAA
FT                   SERLNPLIEQLFSTYTRDDLVAEGAARGIPIGGLNTVTEVLTTEHFAASGTFVDAEIAP
FT                   GVNARVPSGYAKINGERAGFRSRAPELGEHNDLVLRSASADTRVPIPAPQREPGTRPFE
FT                   GLRVLDMGVVVFGAELGRQFADNGADVIKIENSQFPDGLRQSKRGAALAASVAWGHRNR
FT                   RSLGLNLRSPEGIRIFKRLAEEADIVLANFKPGTLASMGLSYDELAAINPRIIVSESSA
FT                   FGSVGPWNKRLGYGPLVRAACGVSALWRYSDASDGLCDGSTVYPDHIAGQVTATTILAT
FT                   LIHRLQTGRGAAIEVAQADTAIVQLRNQLVAEHLAPGSISAPGNSDPYSAPSGVYPCAG
FT                   DDEWCVVTVRDDADWVALCGVLRRPDLVDDPRFATDELRIAHRAEADEVLAQWLLLHTP
FT                   TEAMDTLQAAGIPTGAMIRLPDLLTNSHLTARGAYTELEHELLPAPLPTAKQVAHFAAL
FT                   PDWPLQQAPLAGAQTREICEVVLGLSTVEIDTLVHDGVLQPPADDPALSPVSSTV"
FT   gene            complement(467061..468533)
FT                   /locus_tag="RHA1_ro00395"
FT   CDS_pept        complement(467061..468533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00395"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="GO_function: GO:0008802 - betaine-aldehyde
FT                   dehydrogenase activity; GO_process: GO:0008152 -
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00395"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92231"
FT                   /db_xref="GOA:Q0SJQ5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJQ5"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92231.1"
FT                   /translation="MNDRDTTRGDNATDRNELFIGGRWVTPKSGDTVDVIEAATEKVLG
FT                   TSAMASEADIDAAVAAARTALSGRWSALTNVERADLLDKFAAALKSRGRDTSRLVSREN
FT                   GMPIALSGGVNGFGPAAMISYYAALIRDAVNEDVRPSAFGGRTVVRREPVGVVAAITPW
FT                   NYPQPLAAMKLAPALAAGCTVVLKPAPETALDAFAFAEAAVEAGLPDGVVNVVPAGRDA
FT                   GAYLVSHPGVDKVAFTGSTAAGRAIGEVCGRLLRPVTLELGGKSAAIVTERVDLDLFGK
FT                   NLLEVSLVNNGQTCHASTRILAPRSRYDEVVEAVTETVRALTVGDPLDKATEIGPLVSA
FT                   AQRDRVLGYIEAGRAAGYRITTGGGTPAAQPQGWFVEPTVFAGVDNSARIAQEEIFGPV
FT                   LTITAYDGEDEAVAIANDSEYGLGGTVWTTDEQHGLDLAARIHSGTVGVNYYALDLDAP
FT                   FGGVKSSGLGRELGPEGLAPYFTSKSVYFGTR"
FT   gene            complement(468559..469752)
FT                   /locus_tag="RHA1_ro00396"
FT   CDS_pept        complement(468559..469752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00396"
FT                   /product="possible nonspecific lipid-transfer protein"
FT                   /note="GO_function: GO:0008415 - acyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00396"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92232"
FT                   /db_xref="GOA:Q0SJQ4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJQ4"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92232.1"
FT                   /translation="MSANIMRGAAAVVGVAEQHYKRGEAPHSEKRMTLEVILQACADAG
FT                   ISPREIDGFVSYAGGANDGAIIGGALLIDELRWSNMMWGGGGGSVAAAITNAATAIATG
FT                   QADCVVVYRAMSQADTGRLGYAKYHYGSHFLAHGIGSPAQICAMRTQRMLEHGGVPRTA
FT                   MRSLVLASYQHAQNNPTAQGYGRPLDEEAYQNSRLIAEPFHLFDCSRESDGAVALVLVS
FT                   AERAKTLRPDPAYLLAGAQGAPGGYSELIDNDLGEQYMSAGFGPANNGKPGVAERLWSA
FT                   AGLGPDDVDVVQVYENFSGPAVAALIDHGLCPPGEAAGTFMTVENLTAPNGKLPVNTSG
FT                   GNLADSFINGLNLAVEAVRQIRGTSTNPVDGAKTSLFIGGPMAPLVSSVLFGHEETL"
FT   gene            complement(469749..470201)
FT                   /locus_tag="RHA1_ro00397"
FT   CDS_pept        complement(469749..470201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00397"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00397"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92233"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJQ3"
FT                   /protein_id="ABG92233.1"
FT                   /translation="MTATEPAAEPWGPTPDGLDRPYWDGLRIDELRLQRCNGCRTWIWG
FT                   PQAICGHCHSFDLGWETVEPFGTVYSWNRSWYPYMDEYADRLPYVTVLVELPHADGRRV
FT                   LGILADDVETNPEIGDRVVGVFEHSEGAPWPLLRWRRAATAEGEKG"
FT   gene            complement(470198..470515)
FT                   /locus_tag="RHA1_ro00398"
FT   CDS_pept        complement(470198..470515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00398"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92234"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJQ2"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92234.1"
FT                   /translation="MSVEDFRALYEQHVGHVVAGNMKAALADMVQENIPQVFDGVDTPR
FT                   EAAQGFEIKDVRAEGDQMIGETVYDMGDRSIGLRSIWERHDGRWLAASLENFPTGTEAH
FT                   A"
FT   gene            complement(470601..472100)
FT                   /locus_tag="RHA1_ro00399"
FT   CDS_pept        complement(470601..472100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00399"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0008415 - acyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00399"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92235"
FT                   /db_xref="GOA:Q0SJQ1"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR040771"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJQ1"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92235.1"
FT                   /translation="MTLQSGTTLDPRTPVLVGTGQTSEREGGVEPVDLMVRAARAAAAD
FT                   AGSTRLLELVDSVRVVGLLSWRYRDPGALLGARIGATVRHTGYSGNGGSTPQVLVNGAA
FT                   EDIAAGRSDVVLIGGAESWRTRTKLRAQKLRPDWTVQGESVPAADILVADVPMAAESER
FT                   RIGLDRPSYVYPLFEQALRVSAGRSLEEHREVVGGLWSRFSKIAATNPNAWVQREYTAA
FT                   EIATPSPDNRMISTPYTKLLNSNNMVDQSAVLLMCSVETATRLGIPQENWVFPQSGTES
FT                   HDTYAIAEREALDGSPAIRIAGARALDLAGIGLDEIAYVDVYSCFPSAVQVAANELGLA
FT                   LDDPGRPLTVTGGLTFGGGPWNNYVSHSIATMATRLRESPGSYGLVTANSGYLTKHAMG
FT                   VYRTEPPVSGFKRLDVQAEVDAQSTTRALVSYAGTASAESWTVVYSRDGSPERGFLAAR
FT                   TATGERTLAVTTDAEDLVTLTELDIAGQQVSVSEEGHFRFA"
FT   gene            complement(472097..473134)
FT                   /locus_tag="RHA1_ro00400"
FT   CDS_pept        complement(472097..473134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00400"
FT                   /product="5,10-methylenetetrahydromethanopterin reductase"
FT                   /EC_number="1.5.99.11"
FT                   /note="GO_function: GO:0004497 - monooxygenase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00400"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92236"
FT                   /db_xref="GOA:Q0SJQ0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019951"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJQ0"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92236.1"
FT                   /translation="MRVGIAAGYWGSGPPRNVGRMLAEAEALGVDSFWTAETYGSDALT
FT                   PLAWWGAQTSTIKLGTSVCQMSARTPTALAMAALTLDHLSGGRVIIGIGASGPQVVEGW
FT                   YGQPYPRPLERTREYIEIMRQVWAREKPVTYSGRHYQLPVQGGSGLGKPLKSIVHPLRG
FT                   DIPVYMGAEGPKNVALAAEIADGWTPLWFSPKSDEFYRKALAEGFARDGARRTAEDFEI
FT                   ANVCWLVENDDVEKAASRLKPTVALYAGGMGAKGANFHNDVFARMGWGEVCAEIQELYL
FT                   SGRPDLAAQAVPTEMVEDVALIGPADKIIEEIETKWKNTCLTTLILGGWPKPGNRERIL
FT                   GAVQS"
FT   gene            complement(473183..473998)
FT                   /locus_tag="RHA1_ro00401"
FT   CDS_pept        complement(473183..473998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00401"
FT                   /product="possible enoyl-CoA hydratase"
FT                   /note="GO_function: GO:0004300 - enoyl-CoA hydratase
FT                   activity; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00401"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92237"
FT                   /db_xref="GOA:Q0SJP9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJP9"
FT                   /protein_id="ABG92237.1"
FT                   /translation="MSDAKLILTERPRPGILLIRLNRPDELNAMNVDLIEELHEVLAEV
FT                   RDDSLTRAIVLTGEGRAFCAGLDLRGYGTPQGAIEGEGRAQLGLRVQKHIAGLVDAFRS
FT                   TRAPIIAAVNGAAAGGGMSLALMADIRIMSETAVLHAAFIRRGLSNCDIGMSWLLPRMI
FT                   GFSRAAQIMLTGWSIDAAEAEHIGLASSVEPADKVLEVALDTAEAIAQNSPFGVWMTKE
FT                   VMWSNLEVPSMRAAIDLENRTQILSSLTRDHREAVVSFLEKRPPEFENH"
FT   gene            474100..474927
FT                   /locus_tag="RHA1_ro00402"
FT   CDS_pept        474100..474927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00402"
FT                   /product="short chain dehydrogenase"
FT                   /note="GO_component: GO:0005739 - mitochondrion;
FT                   GO_component: GO:0009536 - plastid; GO_function: GO:0004022
FT                   - alcohol dehydrogenase activity; GO_process: GO:0008152 -
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00402"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92238"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJP8"
FT                   /protein_id="ABG92238.1"
FT                   /translation="MTNLDGKVAVVTGAASGIGAATARAFAERGARVVVADIDDPRGQA
FT                   VAAGLGDRGAYLHTDVRNEADVEAAVAVAVDRFGRLDCMVNNAGRVGAWTFLEDTSLDE
FT                   WENGFAMLARSAFLGTKHAARVMRGQGSGSIVNVSSVAGIRTGFGPHPYSAAKAAVLQL
FT                   TRTAAVELAEYRIRVNALIPGGVATRIVGHGAGLEDDALDRSVDAVRRSLTNFQPIPRA
FT                   GEPEDLAHAAAYLASDDSTFVTGQSLGVDGGLTLGKKWPSNYRDEAQAASTLR"
FT   gene            475015..476376
FT                   /locus_tag="RHA1_ro00403"
FT   CDS_pept        475015..476376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00403"
FT                   /product="metabolite transporter, MFS superfamily protein"
FT                   /note="tc: 2.A.1.6; GO_component: GO:0016021 - integral to
FT                   membrane; GO_component: GO:0019866 - organelle inner
FT                   membrane; GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport; GO_process: GO:0046677
FT                   - response to antibiotic"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00403"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92239"
FT                   /db_xref="GOA:Q0SJP7"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJP7"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92239.1"
FT                   /translation="MTERTTIAAEISVDADSGPSRADSRRASRAAFVGTLLEYYDFSLY
FT                   ASAASVVFASVFFTGSSPLLGTLQAVGTFAVGFLVRPVGGVILGSLGDRIGRKRILVFT
FT                   LVLMGIATLFVGLLPSYAQIGWLAPALLVFLRILQGIGASGEYGGAALVAVEFSPAKRK
FT                   GLMGSLPGMGAALGGVLGTLSLLTVSSMMSQESFLAWGWRIPFLCSAVILAYGLWLRRS
FT                   LPETPAFRAIEESNTVSKSPLFDVIRQQPRALLTVLVMTIGQTGIGYFYIVFMGTFGKN
FT                   QLGFGGTEVLIGLIAAQLANAILIPLFGSLSDRVGRAPVIMFGFLYSAVFAWVGISLLA
FT                   GVGTPPLLYWVVMAAGNGIGVAAIFGPMGAYVIELFDTQHAYSGLGLGREAGNALGAAF
FT                   VPVIAVALAFDDTTVWLSLLICVVSLLGFGATVLSRSRSSSGMKRDDDRTPVTA"
FT   gene            complement(476515..477255)
FT                   /locus_tag="RHA1_ro00404"
FT   CDS_pept        complement(476515..477255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00404"
FT                   /product="probable 3-oxoacyl-[acyl-carrier protein]
FT                   reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="GO_function: GO:0004022 - alcohol dehydrogenase
FT                   activity; GO_function: GO:0004316 - 3-oxoacyl-[acyl-carrier
FT                   protein] reductase activity; GO_function: GO:0051287 - NAD
FT                   binding; GO_process: GO:0006633 - fatty acid biosynthesis;
FT                   GO_process: GO:0030573 - bile acid catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00404"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92240"
FT                   /db_xref="GOA:Q0SJP6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJP6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92240.1"
FT                   /translation="MDSPKVALVTGGGRGIGAAISRRLAADGFAVAVNYSRSARDAEEV
FT                   AAKIVADGGRAVAIRADISRAAEAERLIADTTVQLGAPTVVVNNAGMNKAGAARKQSPE
FT                   DFDEVIAVNLNGAFYCTHFALPAMYEAGWGRVIFVNSPSGGRRPSPGMSAYSAAKAGLV
FT                   GMAKSMALEVARRGITVNCVMPGFVATDIVASGGEAGVEALTKHWPSIPPESIASTISF
FT                   LVSDNAADISGEEIGVWRGGPVGV"
FT   gene            complement(477263..478786)
FT                   /locus_tag="RHA1_ro00405"
FT   CDS_pept        complement(477263..478786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00405"
FT                   /product="AMP-dependent acyl-CoA synthetase"
FT                   /note="GO_function: GO:0004467 - long-chain-fatty-acid-CoA
FT                   ligase activity; GO_function: GO:0008756 -
FT                   o-succinylbenzoate-CoA ligase activity; GO_process:
FT                   GO:0009234 - menaquinone biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00405"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92241"
FT                   /db_xref="GOA:Q0SJP5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJP5"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92241.1"
FT                   /translation="MSGTVVDALTYWSRSKPDLTAIDFDGDAVTYAELAAWADGVAHDL
FT                   ASRGVVPGDRVSFLGANSLEWAVASLAAMKVGAIAVGFNQRMLAGELITLVEDCEPTVV
FT                   YCEEALLPRLEEVQQTRNTFSIAVFEKDVRPLRGSDHAKYRTPVVDLDTPTAIVFTSGT
FT                   TGKPKGVIFTHATVAGEMHEWHLMEPIQPNNLRPVLVLPLFTAAGIIWGISRVVLHGGT
FT                   LFLQPGFDPAKALRVLAEDKANTLTGPPILFEQIAKAPGFADADLSHMVTAHVGGARVP
FT                   VDLLHKWQAQGVSLRQIYGQTEIGGSATAMPREEAAQHPDKCGWGGIFTKIRVVDAEGN
FT                   DLPANETGQILLRGPGMMPGYWRNEDATRSALIDGWLQTGDLGKLDENGYLTFVDRLKD
FT                   MIISGGLNISPAEIEAVINQIPGVEEVAVISVPDAKFGETPAALVRTTTEMKESEVVGF
FT                   CNERLADYKVPRYIVFMDEPLPRMPSGKIAKRQLRDAFADVPDNYDKVR"
FT   gene            complement(478913..480220)
FT                   /locus_tag="RHA1_ro00406"
FT   CDS_pept        complement(478913..480220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00406"
FT                   /product="probable ferredoxin--NADP(+) reductase"
FT                   /EC_number="1.18.1.2"
FT                   /note="GO_function: GO:0004324 - ferredoxin-NADP+ reductase
FT                   activity; GO_function: GO:0004497 - monooxygenase activity;
FT                   GO_function: GO:0005506 - iron ion binding; GO_function:
FT                   GO:0015036 - disulfide oxidoreductase activity; GO_process:
FT                   GO:0006118 - electron transport; GO_process: GO:0006725 -
FT                   aromatic compound metabolism; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00406"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92242"
FT                   /db_xref="GOA:Q0SJP4"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJP4"
FT                   /protein_id="ABG92242.1"
FT                   /translation="MAIVGSGPSAFYAAEELLTRRDVDVDVSMFERLPVAGGLVRFGVA
FT                   PDHQTTKAVERVFSRTARRNGFRAFLGVEIGRDISVDELLDHHHAVIYASGASDDRKLG
FT                   IPGEDLPGSFAAREFVAWYNGHPDSAGRTFDLSGRRAVVIGNGNVALDVARILACDPDR
FT                   LVPGDIAEHALDALRRSTIEEVVVLGRRGPEHAAFTTPELIALGALQEVEVSVHGGYDA
FT                   SDDAPIKLRTLADYARRSPRPGRRKITLRFHEAPVEILGDSHVQGIRIASTRMDGSEQD
FT                   LEASMVLRSVGYRGAPVPGLPFDSQRGTVPNVAGRVVDPVDERPVPGVYVAGWIKRGPT
FT                   GVIGTNRYCAAETVDALVADHQHALLPQPSRPGDELAEVVHSRCPDSFGFDGWKRIDRY
FT                   ERVEGRRRGRARQKLVEVGAMLAVARGTENDQYLPQ"
FT   gene            complement(480544..481830)
FT                   /locus_tag="RHA1_ro00407"
FT   CDS_pept        complement(480544..481830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00407"
FT                   /product="bifunctional 3-hydroxyacyl-CoA dehydrogenase/
FT                   3-hydroxybutyryl-CoA epimerase"
FT                   /EC_number="5.1.2.3"
FT                   /EC_number="1.1.1.35"
FT                   /note="bifunctional; GO_function: GO:0004300 - enoyl-CoA
FT                   hydratase activity; GO_function: GO:0016491 -
FT                   oxidoreductase activity; GO_process: GO:0006631 - fatty
FT                   acid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00407"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92243"
FT                   /db_xref="GOA:Q0SJP3"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJP3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92243.1"
FT                   /translation="MHTDTSVRTVRARIGSAVSSERSENLAGTTIGVVGAGMMGAAIAY
FT                   TCARAGADVVLWARTLENARRGKSYSDRREAHARKAGTSNRPMSQALLGRITPTECVRD
FT                   LSTSALIIEAVAENVAVKQQVLQMVEAVTDAPTVLASTTSTLPIATLSSKLQRPQYFIG
FT                   MHFFSPVDRMSLVETVVGSRTSQATVAASLTYARRLGKVPIVVGDSRGFFTSRLMERYL
FT                   DEALVAVGEGIDPGLVERAATAAGYPVPPLHLLDEITLTLNRAVQHENRLAVEAAGGTW
FT                   RGSEADSVRDRMIDECGRGGRSDGQGFYEYDSDGKRLGLWRVLREVFGPARHIPCSDMR
FT                   DRLLFVEVLEALRCLGEGVVGSETDADTGSVLGIGFPAHTGGVLAFRHSYPGGENGFTA
FT                   RARELAGRYGDRFLPPEQSSEPYDQPECP"
FT   gene            482103..483272
FT                   /locus_tag="RHA1_ro00408"
FT   CDS_pept        482103..483272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00408"
FT                   /product="ring hydroxylating diooxygenase"
FT                   /note="GO_function: GO:0005506 - iron ion binding;
FT                   GO_function: GO:0016702 - oxidoreductase activity, acting
FT                   on single donors with incorporation of molecular oxygen,
FT                   incorporation of two atoms of oxygen; GO_process:
FT                   GO:0006118 - electron transport; GO_process: GO:0006725 -
FT                   aromatic compound metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00408"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92244"
FT                   /db_xref="GOA:Q0SJP2"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJP2"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92244.1"
FT                   /translation="MTEVGAPREQRIRRALDHLRNDTTDEFDHITWFQPEEFTDPAIAK
FT                   RERDLIFGRVPSIVAHGSEIPRSGDFFTLQMPRNNIIVVRQRDGGVKTFVNLCRHRGAL
FT                   LEKEEKGRCRLFSCPYHRWSYDTDGTLRTITRDNTFGDPDTTSMGLVELPTEERHGFIW
FT                   VVDEANAEIDVAGWLGNEMDAILSGYDLDSKIAVQSEGFDEPVNWKIMQDAFLDGYHIQ
FT                   YAHPNTAAKHIHTNVMAFEDFGRHCRFIAPRKSIDRWIEEDPGDRSLAKDITETHFLLP
FT                   NSTLLRQPDHFQLLTFRPHPTDPQRCRMEMRLIVPPVADTEMTEEKWTRLWNKNWEILL
FT                   AVLHAEDFPLLRDSQHGMTSANAGRMVLGQNEVANQVFRRETQKLLATN"
FT   gene            483323..484474
FT                   /locus_tag="RHA1_ro00409"
FT   CDS_pept        483323..484474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00409"
FT                   /product="probable acyl-CoA dehydrogenase"
FT                   /note="GO_function: GO:0003995 - acyl-CoA dehydrogenase
FT                   activity; GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00409"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92245"
FT                   /db_xref="GOA:Q0SJP1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJP1"
FT                   /protein_id="ABG92245.1"
FT                   /translation="MQSDLFDRDHELFRESVRGFVDKHVVPQLEKWDADRLIDRETWLA
FT                   AGRQGLLGLPVPEAYGGPGELDYRFRFVIQQEIARVGASALQSGFSTNDDIVLNYLLRH
FT                   ADEEQRRRWLPGFVTGETIGAIAMSEPAAGSDLRAIQTTAVADGDTWVINGSKTFITSG
FT                   ILADIVIVFAKTDVSAGSRGFSLFVVEDGTPGFSRGRKLDKLGLHAQDTAELFFEDVRI
FT                   PKENLLGEVGSGFAYLMQSLPLERLGIGIAAQVSAEAVLGWTLDYVKERTAFGKRIGDF
FT                   QGMGFTLAELQTAVEVSRAYIDRCVREHNAGTLTAVDAAKAKLWATELQGRVIDAGVQF
FT                   HGGYGYMMEYPVAKAYIDARIQRIYGGTNEIMKEIIHRDLMKA"
FT   gene            484841..485302
FT                   /locus_tag="RHA1_ro00410"
FT   CDS_pept        484841..485302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00410"
FT                   /product="possible secreted lipase"
FT                   /note="GO_function: GO:0016298 - lipase activity;
FT                   GO_process: GO:0016042 - lipid catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00410"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92246"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJP0"
FT                   /protein_id="ABG92246.1"
FT                   /translation="MPLYYISRWGGESKVGTMVGVAAATNGISAYGMLNLLAGHPQAKD
FT                   LVGRAIPVVDDGTAGSAFVAETGVDGMTRPEVEYATVSSRSDPVVQLSESQPPPGPNVS
FT                   NVVVQDFCAENLTNHGTMVNDDITLRIIRNLLDPATAVAPSCHAVAPLP"
FT   gene            complement(485278..487461)
FT                   /locus_tag="RHA1_ro00411"
FT   CDS_pept        complement(485278..487461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00411"
FT                   /product="possible formate dehydrogenase"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_function: GO:0030151 - molybdenum ion binding;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00411"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92247"
FT                   /db_xref="GOA:Q0SJN9"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJN9"
FT                   /protein_id="ABG92247.1"
FT                   /translation="MTPKDTTQVHTFCRICEPGCGLLADVRDGEVVRLQPDRDHPVHQG
FT                   FSCHKGVHYLQVHSDPDRLDRPLKRTNPRSEERGDFEPVDWDVAAREIADRLREIRQKY
FT                   GRNALAVYQGNPSAFNGAYYANAATLARGFDTRMRFSAGTQDTSAKYAASEAIYGASMA
FT                   HPIPDLLHTDYFLCLGSNPQVSHMTLIHISDPMTKIRAVKKRGGTVLFVNPRRIESSSP
FT                   ETGEVLLIKPDTDFYFLAGVLHEIVFRIGYDRDVVERHARRVDELLDFVRQYPVDRIAA
FT                   VTGIDADTVRQVAADFCAAPSASIYMATGVNQGRQGTLAYWMLTMVSLFSGNLGRRGGN
FT                   IYSRGVADVVQGSKRKREDPFYDGPFGEMRTVSGDLPAALLPEFIGNPDDPIRALIVVS
FT                   GNPLLSVGGDGRLRRAFEQLDLIVTVDLYRTVTGEMADYVLPATDWLEREDVNFLNTMG
FT                   VAMEPYVQYTPAVVPAKGERRDDWWILSRIQQEMGVPTLLDDPDPNPFAAVDAMMRDSG
FT                   LSIDLLATMPCQTAVLPEADPAHVFSIAVQHDDGLIDCCPALFQRSYDTAERILEELAA
FT                   EPADQLKLITRRTHYMVNSWLHNLPVFKQGVHQSNPLWMSPDDARRRGLVEGDDVTVRN
FT                   RHGEIGAVLVCDDTLRPGVVAMTHGWGQSTARGLDVARRNPGVNVNRLAPTGTDGYDPL
FT                   SNQSQLTGINVEVIRTMGSPQGRSDVQGSGATA"
FT   gene            complement(487458..489086)
FT                   /locus_tag="RHA1_ro00412"
FT   CDS_pept        complement(487458..489086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00412"
FT                   /product="ferredoxin--NADP(+) reductase"
FT                   /EC_number="1.18.1.2"
FT                   /note="GO_function: GO:0004324 - ferredoxin-NADP+ reductase
FT                   activity; GO_function: GO:0004497 - monooxygenase activity;
FT                   GO_function: GO:0005506 - iron ion binding; GO_function:
FT                   GO:0015036 - disulfide oxidoreductase activity; GO_process:
FT                   GO:0006118 - electron transport; GO_process: GO:0006725 -
FT                   aromatic compound metabolism; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00412"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92248"
FT                   /db_xref="GOA:Q0SJN8"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJN8"
FT                   /protein_id="ABG92248.1"
FT                   /translation="MAYVVTQNCCNDATCVAVCPVDCIHPTPAEREYQRTEMLYIDPGA
FT                   CIDCGACADVCPVDAIVPGDAPAPDIDRYREINAEYFQRNPRSIAPGAHVQPLPLALAT
FT                   ADVADPPVMRVAIVGSGPSAFYAAEELLARRDIAAEVTMFERLPVAGGLVRFGVAPDHW
FT                   HTKTVDRVFDRTARRDGFTFHLGVEVGKDVTIDEVLAHHHAVIHASGAAGDRRLGIPGE
FT                   DLPGSHAAREFVAWYNGHPDHADRVFDLTASRAVVVGNGNVALDVARILVSDVETLRRT
FT                   DIADHALTALSDSRIEEVVVLGRRGPEHAACTTPELLALGSLPGIDVLVDGPVPTGPDA
FT                   PTKLRILADYSRREPTPGNKRIVLRFGTTPQEVTGDERTAGLIVTGTDTGTADRIECGL
FT                   VLRAVGYRGLPIAGLPFDEAAGTVANVSGRVTLPDTGQAVAGHYVAGWIKRGATGVIGT
FT                   NRYCAAETVEALLDDHRAGLLAAPTAGSADLAALVRERRPDALGGADWRAIDRFERERG
FT                   REAGRPRIKIVDAGEAAVVAGAAVR"
FT   gene            complement(489086..491323)
FT                   /locus_tag="RHA1_ro00413"
FT   CDS_pept        complement(489086..491323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00413"
FT                   /product="probable formate dehydrogenase"
FT                   /EC_number="1.2.1.2"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_function: GO:0030151 - molybdenum ion binding;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00413"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92249"
FT                   /db_xref="GOA:Q0SJN7"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJN7"
FT                   /protein_id="ABG92249.1"
FT                   /translation="MTIAEPKTGHRICPLCESTCGLLVELEGRDIVRVAPNPDDVMSAG
FT                   HSCAKGLGLGRIEGDPDRIRIPLLRTAGGGFREATWDEAFDEIGRRLPEFVTGDPGSCA
FT                   IYHGNPAAHHLDATFYLGELIGAVGTSNVYSPASVDTWPKNLAHMLLYGTGLGMSLPDL
FT                   DRTDYLLILGSNPMVSNGSTVTAPGMHHRLQALRERGGTLVVVDPVRTRTAEVADLHVP
FT                   IRPGTDALFLLGVLSVIASEGLSRPDRVPDVVDGLGAALAMVAEFEPDAVAAACGIDAD
FT                   VIRSVARGFAGAAAAVAHSRIGTCMQEFGTLANWLVEVLTIVTGNLDRPGGAMFALPPA
FT                   GGQNTWPVTRTPKLMFDRWRSRVRGLPEAMGELPAVCFAEEILTPGPGRTRALITLAGN
FT                   PARSLPNSGAIEDALGALEFMVSVDCYLNETTRHADVILPPPPVTTRGHHDVTLAHFQI
FT                   RNVARYTPPLLDLADGEMAEWQILLRLAAIAKGTPDRPVGEMDDEVAAVAARRAAKLVG
FT                   CESGRAMDAVAGRRGPQRLLDLRLRSGPYGDRFGLDPDGLTLALLEDNPDGIDYGPLAP
FT                   RVPEVLRTPDGRIDLMPDMIVSDLPRLRASVTRAAPDLLLINRRQRRGMNSWLHNALPQ
FT                   TDGGQCALLISPPDAAEQGLVNGDRVAVTSKVTTVTAELRIDDTLRPGVVSMPHGWGHD
FT                   GPGLRTSRSASVPGSNYNALVDDTTDLEALTASPIFNGVPVTVTRTSEEHP"
FT   gene            complement(491320..493452)
FT                   /locus_tag="RHA1_ro00414"
FT   CDS_pept        complement(491320..493452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00414"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="GO_function: GO:0003674 - molecular_function"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00414"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92250"
FT                   /db_xref="GOA:Q0SJN6"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJN6"
FT                   /protein_id="ABG92250.1"
FT                   /translation="MPPVTSRRTSFCRLCASSCGVLLDVEDGRITRVLGDAQHPISGGY
FT                   TCPKGRRGGDLVHGPDRLTTSMRRTGAGTHEPVPVARATADIADRLRTIVDRHGPDAVA
FT                   LFMGTQQNFAALTPPMARAWFRGTGSHKLFSTMTIDQSAKWVVAERMGTYLGGRQRFED
FT                   ADVWLLAGTNPVVSANGGDGDGAVVQNPSVTLRAARERGLRLIVVDPRHTETAALADVH
FT                   LAPRPGTDAVLFAGLLHVVLTEQLHDTDFCRRYTADLPGLADAVADVTPTVVHRICGVP
FT                   ADRVRAAAQVFAGGSRGMATSGTGLCMGPHSNLAEHLLAALNVVCGRYLREGERADDRA
FT                   VLTRHAPARAEVAPPARAYEHGFRSRIGGVRAMRGELPSGILADEILEPGPDRVRALIV
FT                   SGGNPAAALPDRAKALRALRSLDLLVCIDPRMSDTARLAHYVIAPTTMYERADHTAIME
FT                   PFFPRPFAQFTPAVLPAPPGVVDDWRFFLDLAAASGQPVKFAGRILDPDAPPTSGQMLA
FT                   MMAERGRVPFADVVTAPHGHLAGASGAVVGPATEDGAGHRLRLLPADVRAELVAALTDR
FT                   VVTEQFPLLLTVRRIREAVNSTGTRVPGLVPGGTNPASLHPDDLTALGITDGQVVTVRS
FT                   AAGRLRATARADRTLARGTVSMTHCFGSVDPRDDAGVNVNALTGTGAGVQAINAMPIMT
FT                   AVPVAVGPVAPEEEVS"
FT   gene            complement(493457..494863)
FT                   /locus_tag="RHA1_ro00415"
FT   CDS_pept        complement(493457..494863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00415"
FT                   /product="probable 4-hydroxybenzoate transporter, MFS
FT                   superfamily protein"
FT                   /note="tc: 2.A.1.15.1; GO_component: GO:0016021 - integral
FT                   to membrane; GO_component: GO:0019866 - organelle inner
FT                   membrane; GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00415"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92251"
FT                   /db_xref="GOA:Q0SJN5"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJN5"
FT                   /protein_id="ABG92251.1"
FT                   /translation="MAPIREVDISQLIDTAPVSALQKRAIALCLALAILDGMDAQLIGF
FT                   AIPALSEDWGLSKASFGLLLALSSGAMVVGSLLFGPIADRWGRRRVILLCTVLFSAFTL
FT                   ASAFAPSMGVLIVLRILAGIGLGGVTPNLIALTSEYSPARSRSTMVTIVVAGMSLGGFL
FT                   GGLAAAQLIPAYGWQSIFVAGGVLPLIVAALAWAGLPESGKFLAARGDHAGAAKILSAI
FT                   APQAGINGSVTFTVDAVVATRSPIRELFAGGRALDTILLWVVFVINFLVIYFLFGWMPS
FT                   LFSQAGQSASNAILAAALFNLGGMAGALSIGWITDRVGTAWARSRGSDAAYAVVMAGYT
FT                   LGALFIGAVAMFLANSTLLLITICIVGFGMSGSSAGIIAIAASIYPVAARSTGIGWAMG
FT                   VGRIGSIAGPTLGAALIAAGMDARTIFLLMIVPTAIAVLTLGGLFVRERVRGRTGAGVA
FT                   EPAAAPAEAH"
FT   gene            complement(494952..496493)
FT                   /locus_tag="RHA1_ro00416"
FT   CDS_pept        complement(494952..496493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00416"
FT                   /product="AMP-dependent acyl-CoA synthetase"
FT                   /EC_number="6.2.1.26"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0004467 - long-chain-fatty-acid-CoA ligase
FT                   activity; GO_function: GO:0008756 - o-succinylbenzoate-CoA
FT                   ligase activity; GO_process: GO:0009234 - menaquinone
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00416"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92252"
FT                   /db_xref="GOA:Q0SJN4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJN4"
FT                   /protein_id="ABG92252.1"
FT                   /translation="MNLADLTRFWGKTRSQQQAIVFGDTSQTWAEVDAITDALARGLAA
FT                   RGVRKGDRVAVMMLNRPELAHVILATLKLGAISVPLNFRLTAKELAPMVVDSAPRVVIV
FT                   EDGFASLLEVATEQAEFETYAIGGSAHPPYERLIDPGTAPVVAIAADDPGFICYTSGTT
FT                   GVQKGALITHRNAMTPGISQSITFGFSQGDRVLCSAPLVYTGSVLSIFMQLVVVPGATM
FT                   VLLREYDPEIALDTFEREQITATTTVPVIWERMTMLPDFGTRKLAKFTFAGTGGAPVSL
FT                   DLLDFYRSHGIPLTQCYGLTEASGMVSTLAYEDAVSRPGFAGLPLVGTHIRIGEPGVDT
FT                   PAGEVGEILVRGEHVLREYWNKPEATAATVGDGWLRTGDLGMQDDGGFLKIVDRSKDML
FT                   ISGGLNVYPAEIEKALHGIDGLVDLAVIGVKDDRWGEVPMVVFHSERPAADIVADIAEV
FT                   AGENLAKFKRPKHAVALGEPLPRTFSGKLAKPSLRQRFPEVPADALAVDGTVTPV"
FT   gene            complement(496687..497937)
FT                   /locus_tag="RHA1_ro00417"
FT   CDS_pept        complement(496687..497937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00417"
FT                   /product="probable formyl-coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00417"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92253"
FT                   /db_xref="GOA:Q0SJN3"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJN3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92253.1"
FT                   /translation="MSGYSLLDGLRVLEVAQLAPASLGGHLADLGAEVIKVESGPLGDP
FT                   VRVGGNRAIGDPDGPAFMHLRWNRGKKSVALDLRSPEGKHAFLDLARSCDAVVEGMRGG
FT                   YLDWLGVGYEQLRQVNPKIVLCTVSGMGTDGPYRALGTGGPVFDAYAGLREVNTPAEPP
FT                   AEGMAGSTTPPIAMYALGAYGAMGLLAALHKAGATGVGCHVEVSGIDVAAAWMPDLVDA
FT                   ELNRDRSVPRPSWLPDGRLPDWPRLEAYRTSDGEAILFGSHVEKFWHNFLVAVGRQDLI
FT                   GVDLTSTDAGAAARADLVWRALTEIFAQRTRAEWVQLFLDHGIAGGPVNSVADMLADPH
FT                   FQARENTYRVDYPGVGELEFVVSPVRVAGEKFAPALPPVVGADTAEVLRSVAGYEDARI
FT                   TAAIDPRTPRHEAPPAG"
FT   gene            complement(497934..498656)
FT                   /locus_tag="RHA1_ro00418"
FT   CDS_pept        complement(497934..498656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00418"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0008610 - lipid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00418"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92254"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJN2"
FT                   /protein_id="ABG92254.1"
FT                   /translation="MIRRSSLSSTESEIRMDATTVSTTDDIWSPSWDDPFEPTTDHDDE
FT                   FAELTDALRAVQEAVTRSRPTPEAAGRAARTLRDLAARLAAFEVGEDEQISGRRWDLAG
FT                   RGQTLTPALHLDEVTENRARGHVVVGRFHSGRYAMNGGVTPLIFDEILARLANSCGRPW
FT                   ARTAYLHVNYRAPAPLDVELRVEAEFAGQDGRKRFMRGAMYHGDVLVADVEGLWIELKP
FT                   EQTQNVSLAVGWGAEENS"
FT   gene            complement(498653..499414)
FT                   /locus_tag="RHA1_ro00419"
FT   CDS_pept        complement(498653..499414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00419"
FT                   /product="possible enoyl-CoA hydratase"
FT                   /note="GO_function: GO:0004300 - enoyl-CoA hydratase
FT                   activity; GO_function: GO:0016853 - isomerase activity;
FT                   GO_process: GO:0009062 - fatty acid catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00419"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92255"
FT                   /db_xref="GOA:Q0SJN1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJN1"
FT                   /protein_id="ABG92255.1"
FT                   /translation="MTSDDLHRSSPAPGVLQLDLARPDVHNAISLGLQRELDAALAEAA
FT                   HDPDVRVVVLAGEGAAAFSAGYDLKELRAMTPDAGVLSMLEREELLWRYFTFPKPTVAA
FT                   VHGIAHGAGTLLAVCSDLRVGGPGTRITVTAAKYGGANLTWVLDQLIGAGPTRDLLLTS
FT                   RAVSGEEAFRMGLVSRYAADGDVLGAALEAAEQIAAQPPESMREIKALLLDGPGQGLRS
FT                   RYDRENVVSRTTLRPRPVEEIFRSYFGSRAQ"
FT   gene            complement(499411..500673)
FT                   /locus_tag="RHA1_ro00420"
FT   CDS_pept        complement(499411..500673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00420"
FT                   /product="ring hydroxylating dioxygenase alpha subunit"
FT                   /note="GO_function: GO:0005506 - iron ion binding;
FT                   GO_function: GO:0016702 - oxidoreductase activity, acting
FT                   on single donors with incorporation of molecular oxygen,
FT                   incorporation of two atoms of oxygen; GO_process:
FT                   GO:0006118 - electron transport; GO_process: GO:0006725 -
FT                   aromatic compound metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00420"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92256"
FT                   /db_xref="GOA:Q0SJN0"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJN0"
FT                   /protein_id="ABG92256.1"
FT                   /translation="MQPPVDSTVINLSETLDKQCLMCHSRCMEREDKITLTERLIAHVD
FT                   NNSTDYADDLLRVPFSAFNDPELAERERKVVRRLPHIVAHVDELKKAGDFVTTELIGTP
FT                   LLVVRQTDGSVKAFSNVCRHRGAKVEFEESGCKRIFSCPYHNWAYGRGGDLRGMPHSEG
FT                   FDGMDRAQYGLVEFPCEVRHGLVWVVPTVGADLDIAAILGAKHDAEVTATGMAESFQVR
FT                   KETWRLDMNWKIAVDGVQDSYHLCQLHTKTVCNYLEGNITAYDLVDRSWRIVVARKSIT
FT                   EVRGADPDSFDVRDYSLANYTIYPGTMLVTEPNHFEIWTIVPDTEDPNVSYCTIRLLSP
FT                   KEPETPREKRILDKNWELLMETLHAEDWFVTKTITANAAHGQVDELIYGRNELPGQVFH
FT                   KMITRDAEEVAREEAAVGGAK"
FT   gene            500664..501266
FT                   /locus_tag="RHA1_ro00421"
FT   CDS_pept        500664..501266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00421"
FT                   /product="possible transcriptional regulator, TetR family
FT                   protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00421"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92257"
FT                   /db_xref="GOA:Q0SJM9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJM9"
FT                   /protein_id="ABG92257.1"
FT                   /translation="MAARTGNDPATDVRSTILTAAETCFERFGITKTTMEDVARAADMS
FT                   RATVYRYFSDRESLIIESVARRARKNMKPARAFIAKWPTIEERLVEGICNNVESGLRDP
FT                   MVHLLVSPSEMTLANSLLTTSGKAVELTSELWEPILRDAQEAGDIRADVDLALLCEWIS
FT                   ELEIMCISQLNGGTGSLERFREKLRAFLVPSLLPAGN"
FT   gene            complement(501300..501902)
FT                   /locus_tag="RHA1_ro00422"
FT   CDS_pept        complement(501300..501902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00422"
FT                   /product="possible transcriptional regulator, TetR family
FT                   protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00422"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92258"
FT                   /db_xref="GOA:Q0SJM8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJM8"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92258.1"
FT                   /translation="MARRRTAGVLSQDADVARSQILVAAQAMILRFGISKTTMEDIAKE
FT                   AGVSRPTVYRYFQDRETLTTELIRWRSRQTLDRGRKFLMECATFEDKLIEGLIYLVYDG
FT                   INDPIVRILVSPEHVGGDSWLETIPLATSLTTELWGPIFDEAKSNGEMRADIDTGEACS
FT                   WITLVQLMLAPRLDNSDPSDPSHRQMMRQFVLPAFLP"
FT   gene            complement(502092..503321)
FT                   /locus_tag="RHA1_ro00423"
FT   CDS_pept        complement(502092..503321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00423"
FT                   /product="cytochrome P450 CYP254"
FT                   /note="GO_function: GO:0004497 - monooxygenase activity;
FT                   GO_function: GO:0020037 - heme binding; GO_process:
FT                   GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00423"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92259"
FT                   /db_xref="GOA:Q0SJM7"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJM7"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92259.1"
FT                   /translation="MTTTQLPDRLIVDFDVYDQTLAMPEDVFQERAAALRAIGPVVYSK
FT                   AHGGHWIVTRYEEIHQVLRDPETFSSYPNNLVNAGQGKFIPIELDPPEHTYYRQALQPL
FT                   FSPKRMKELEPRIRDVINELIDDFAARGEAEFISEFAHELPTRVFLALMGWPLEDAEMF
FT                   TTTTDVALQGVPGGTEEESATAREAAANQIFGYFGAIVAGVRSGEITSDTLTAQIINAP
FT                   IEMGDGVRLLTDEELYRMFFLLLIAGLHTVQGSLAWAIIHLANNPGQRQEIVDDPDTVS
FT                   AAVEEILRIEAAVIAGRRATRDVEIGGVTIREGDQLIVLLCSANRDGAEFEDPDELRVD
FT                   RSPNRHLSFGAGPHRCIGSHLARIELKLAMEEIHKRLPDYRLVPEDPPILHATQVRGCI
FT                   RLPITFTPAS"
FT   gene            complement(503328..503561)
FT                   /locus_tag="RHA1_ro00424"
FT   CDS_pept        complement(503328..503561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00424"
FT                   /product="probable ferredoxin FdxD"
FT                   /note="GO_function: GO:0005489 - electron transporter
FT                   activity; GO_function: GO:0005506 - iron ion binding;
FT                   GO_function: GO:0016702 - oxidoreductase activity, acting
FT                   on single donors with incorporation of molecular oxygen,
FT                   incorporation of two atoms of oxygen; GO_process:
FT                   GO:0006118 - electron transport; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00424"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92260"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJM6"
FT                   /protein_id="ABG92260.1"
FT                   /translation="MRTHAQNRAPSLRVDRSACAGHGLCYGAAPDIVDSDDQGYPVVVA
FT                   ESVPQERRDQLDALVEMCPERALSVEPPTRKG"
FT   gene            complement(503577..503837)
FT                   /locus_tag="RHA1_ro00425"
FT   CDS_pept        complement(503577..503837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00425"
FT                   /product="possible short-chained dehydrogenase FabG"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00425"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92261"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJM5"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92261.1"
FT                   /translation="MGPGTPVIGQSYEETAGPWDPGVSPIPLKLQRPPSLVDNAKVALF
FT                   LVSDDSAYISGLTLPATDGGTLSRVAMMFEEDAPNPTLPVD"
FT   gene            complement(503837..504445)
FT                   /locus_tag="RHA1_ro00426"
FT   CDS_pept        complement(503837..504445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00426"
FT                   /product="possible short-chain type
FT                   dehydrogenase/reductase, N-terminal"
FT                   /note="GO_function: GO:0003858 - 3-hydroxybutyrate
FT                   dehydrogenase activity; GO_function: GO:0004022 - alcohol
FT                   dehydrogenase activity; GO_process: GO:0008152 -
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00426"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92262"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJM4"
FT                   /protein_id="ABG92262.1"
FT                   /translation="MKLQDKVAVITGGGSGLGRQGAQLFASEGAKVAVVDIDGDRAEQT
FT                   AKLVEQQGGTAIAITADVSDEAAVYRSVEATVDQFGKLDIMWANAGVVSRGGVPSVAGG
FT                   EHVEFQDLTDADWQHVLGVNLSGVVYSCKAAVPAMRANGGGTILATSSAASFAITASRC
FT                   TRRRKPASTAWFAASAWISDGTGFASTPSLPPTGCRRTS"
FT   gene            complement(504871..505221)
FT                   /locus_tag="RHA1_ro00427"
FT   CDS_pept        complement(504871..505221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00427"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92263"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJM3"
FT                   /protein_id="ABG92263.1"
FT                   /translation="MAIVGSGPSGCYAAESSRRGGLPRRDARYSVGLIRFGVAPDSSGD
FT                   QDGTPISPFMRWKRCWRARSRVPPGYVAREASASSPPRGRHAGSIEAMTATIVEEFSTT
FT                   SAPPGERRNALR"
FT   gene            complement(505223..505501)
FT                   /locus_tag="RHA1_ro00428"
FT   CDS_pept        complement(505223..505501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00428"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00428"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92264"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJM2"
FT                   /protein_id="ABG92264.1"
FT                   /translation="MRLGVPVDCIIRLRMSTATVTRRCSISDPIGYFEGASTDACPVVA
FT                   IASDCDLTSETLRYEEIDAAYHASRDPPIPGAEPRVAETARCRNAHC"
FT   gene            complement(505711..506724)
FT                   /locus_tag="RHA1_ro00429"
FT   CDS_pept        complement(505711..506724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00429"
FT                   /product="possible transcriptional regulator, AsnC family
FT                   protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00429"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92265"
FT                   /db_xref="GOA:Q0SJM1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJM1"
FT                   /protein_id="ABG92265.1"
FT                   /translation="MQDYEPDDVDFGLMHALQIEPRASWKALAPILDVDPVTLSRRYQR
FT                   LRDTGLIWITGYDAGTPGRGVLVEIECAPGKSVATAQAMAEDPMVAGIDFTAGGRDLLL
FT                   TLMAQDSADTSRFLLHRLGEYPAIRRARTHLITEVLFEAGNWRLRTLSAAQAARVPGPR
FT                   PPRPRASRTVSPDLKRVIHHELGIDGRAATTAIAERAGVSNQRITDAIATMRRDGSLLL
FT                   RTDIARTYSEWPVYAWYFMQVPAPLIERLRTSLGRIEEVRLAVLVASEYNLIMAVWLRT
FT                   LNDVHRFELLLEKLLPGSRVADRSVVMQIGKHLGHILDEQGRATGPVVPMTPPGRA"
FT   gene            506827..508293
FT                   /locus_tag="RHA1_ro00430"
FT   CDS_pept        506827..508293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00430"
FT                   /product="multidrug resistance transporter, MFS superfamily
FT                   protein"
FT                   /note="tc: 2.A.1.3; GO_component: GO:0016021 - integral to
FT                   membrane; GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport; GO_process: GO:0046677
FT                   - response to antibiotic"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00430"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92266"
FT                   /db_xref="GOA:Q0SJM0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJM0"
FT                   /protein_id="ABG92266.1"
FT                   /translation="MSSSRHLQGSDAATAAVGFLVVMEFASGLLQGWFSPLLPAIGERF
FT                   DASSAALNWVSAMYLLGTAACVPLIAKLGDLFGHKRLLVVATASVALGSFLVAFAPSFE
FT                   LLLVGRALQAPLGAFLPLEFAIVRDRDPATAGRSIGRLVGSLTLGAAVGGLLSGFLLDS
FT                   VIGDVSVVLLVPAVLMTICLAVVYFLVPETTVRKTGTVDWTGAVLLTVGLLGVLGGVSN
FT                   ANTWGWTNALTWAAIGVGSVVLVVWVFVERRVRHPLVDLDVVGRGMRVPMLMAMLFGAQ
FT                   LFGVQTPSALFLRASPETNGYGLGVTASMTGLILALFALAMFVGASVSDRLAHSALTVP
FT                   GSLALGAVLAAASYILMIVVPGNVALFTLWLVVAGLGGGVVVGVLPTVIVQQAPPDSVG
FT                   IASGLYNTSRTASGAVAGAVFALVMSSMITPALTAGGKQIPSVGAYHVVWAVCAALCVL
FT                   TAVLALKLRSQPANTENDTTPLADDEQVPA"
FT   gene            508329..509762
FT                   /locus_tag="RHA1_ro00431"
FT   CDS_pept        508329..509762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00431"
FT                   /product="probable amidohydrolase"
FT                   /note="GO_function: GO:0008237 - metallopeptidase activity;
FT                   GO_function: GO:0046983 - protein dimerization activity;
FT                   GO_process: GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00431"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92267"
FT                   /db_xref="GOA:Q0SJL9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR017145"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJL9"
FT                   /protein_id="ABG92267.1"
FT                   /translation="MSIDPYLLGTIDELGSQYTALSDAIWNKPELRWEEHTSVDAQIAV
FT                   AEAEGFTVTRAVAGIPTAFSAEAGSGTPVIAIVGEYDALAGLSQKSGSAVPEPEPGNES
FT                   GNGQGCGHHLLGGGSLLAATAVKRYLDANGLPGTVRYYGCPAEEAAAGKTFMVKEGAFD
FT                   DVDAAVSWHPGDTTTVQRIRTLAYVQAYVRFTGIAAHAGVSPERGRSALDALELMNVGT
FT                   NFLREHMPSDCRIHYAILDTGGRSPNVVQASAEAYYLVRSPDVAGMRELFARVTKIAEG
FT                   AALMTETTVEIEVDGGCSDILPNVVLEDSMQERLRELGPVPFDVTDLATAEAFITKTAS
FT                   GRTASTLGGEFDGDGGALHTGIVTFDARSLRPTMTGSSDLGDVSWVTPLVQCATACVAV
FT                   GTAAHSWQMVAQGKLPAAHKGMIHAAKIMASTAADLLTDAELLASARKEFSTRTSETPY
FT                   DSPLPDGVIAPPLRDTVAV"
FT   gene            509795..511036
FT                   /locus_tag="RHA1_ro00432"
FT   CDS_pept        509795..511036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00432"
FT                   /product="metal dependent amidohydrolase"
FT                   /note="GO_function: GO:0008237 - metallopeptidase activity;
FT                   GO_function: GO:0046983 - protein dimerization activity;
FT                   GO_process: GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00432"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92268"
FT                   /db_xref="GOA:Q0SJL8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJL8"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92268.1"
FT                   /translation="MTLVTPVGDTTETRAAALKDTAAQVVRNREKELLELSHRIHDTPE
FT                   IAFEEHRAAGLVGDTLRNAGFDTTVGVYGLDTAVEAVYGDGDLTVAICAEYDALPEVGH
FT                   ACGHNMIAAAGVGAALALAAVADEAGLRIKLLGTPAEEHGGGKIPMLEAGAWEDAALSL
FT                   MVHGASGTDMPCASLWMQAVDRFEVTFTGRAAHAAGAPEHGINAGAAATIALGALGLVR
FT                   QQFRAKTRVNAFVSHGGDVTNIIPARTVVQVEVRAPEIGEWREVKERVLACFEAGAIAT
FT                   GCEWTYEATEPPYAPMVQSAVLAAIWDENLQATGRELTSASLGGGSSDMGNVSQVVPSI
FT                   HPAIAVLGSTAIPHNADFADAAASPAADAAILDGATALAWTVLDAALDAEVRGELLRLQ
FT                   AERPEGFTRRASWA"
FT   gene            complement(511041..515105)
FT                   /locus_tag="RHA1_ro00433"
FT   CDS_pept        complement(511041..515105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00433"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /EC_number="5.1.1.11"
FT                   /note="GO_function: GO:0005554 - molecular function
FT                   unknown; GO_function: GO:0016788 - hydrolase activity,
FT                   acting on ester bonds; GO_function: GO:0016874 - ligase
FT                   activity; GO_function: GO:0048037 - cofactor binding;
FT                   GO_process: GO:0009058 - biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00433"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92269"
FT                   /db_xref="GOA:Q0SJL7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJL7"
FT                   /protein_id="ABG92269.1"
FT                   /translation="MFSRMAIRGTVVASVYPAAPAHKDRASRRRSSGASTLVGDLMEHA
FT                   ARANYREHRSDPFPLSAAQHGLWFAQQLAPDVPICIAQYVDIRGQLDVDLFREVALVAG
FT                   HEYESVFLRLVDVDGEPYQVVDPPADAAMGIVDFRSASDPMAAAEAWMQENYTARVDFE
FT                   HDYLCESSLLRVGDERHLWYSRIHHVALDGYGAMTMVNRVAALYTAAVHGLELEPNRAA
FT                   DLHTLHRLEGDYRASHRFSSDRDYWAERLHTRTNGASLTDIDAPPAAHSLTVRAALSAD
FT                   TVARLEDTDGRPGATAAAALIAAFACYLSRRTGRQDMLVDIPLSARTTAVLRRSGGMLA
FT                   NVAPLRVQVRSDDTVGDLVTRVQHELMGAMRHQRGNVEDILRELGVSAEARRISGPMIN
FT                   VMLFDQDLTFGSLTGDFRILTTGPVPDLSVNVYRSGTPASTIVEFEANPYRYRDDDLRS
FT                   HHAGVVGLIDELLAADPGTPLAVIGAAELECLTPVVGGVSVSEVSLPELLAASVVVDPG
FT                   AVAVVYGDRRLTYRELDEASNRLARVLLEAGVGAESVVAVAVARSVESVLSVWAVAKTG
FT                   AAFLPVDPQYPVGRVEHMLVDSGVVVGVTVSEVRDRLPGSVRWVVLDDAVVVSRLSSVS
FT                   AGVVTDVDRGAPVRVGQAAYVIYTSGSTGVPKGVVVTHRGLANVVAAQRSGFGVCAGAR
FT                   VLHCASPSFDASVFELVWALGLGARLVVVPPTVYGGEELARILVGESVTHAVLTPTALS
FT                   SVDPVGLGALGALVVAGEACPPELVARWAPGRRMFNAYGPTEATIMSNASGGLVVGESV
FT                   TVGGPVRGFGELVLDGRLRPVPFGAAGELYLSGPALARGYRNRMALTAGRFVADPFGGP
FT                   GDRMYRTGDVVRWRRSVGGPVLEYVGRSDFQVKIRGFRVELGEIESALLGYPGIDRAVV
FT                   NTSGDRLAGYVVPAAGSLLDTSAVLAHARARLAPHMVPATVTVLDAVPVTANGKLDRAA
FT                   LPEPDFTAARAAYRAPRNATEEVVATAFAEGLGLDRVGLDDNYFTLGGTSLTATSVIAR
FT                   IAESFARAVPVQWIFTHPTPEALAHMIATAPEDSRADGAADRSLDVLLPLRTTGTGNPV
FT                   FCIHPAIGLAWCFTGLVQYLGDRPVYGLQSPALTDPDLRVDSLEDLAARYVQRIRAVQP
FT                   HGPYHLVGYSVGGQIAHEMAVQLTEGGDEVATLAMLDTHLTGGYGPTTEKPTVAALLAE
FT                   LGAVVPGDGDAAATTDRAVEVLRRTGGLFAAVTADDLDAVHRVFTQTVDLALAHRPSTP
FT                   IRADLLFFGAADSVDAPTGVCAWRPHISGEIIEHAVPVSHQQMTSPEALAGIGPVLAQH
FT                   VTIAERRLALS"
FT   gene            515235..516197
FT                   /locus_tag="RHA1_ro00434"
FT   CDS_pept        515235..516197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00434"
FT                   /product="probable NADPH:quinone reductase"
FT                   /EC_number="1.6.5.5"
FT                   /note="GO_function: GO:0003960 - NADPH:quinone reductase
FT                   activity; GO_function: GO:0004022 - alcohol dehydrogenase
FT                   activity; GO_function: GO:0008270 - zinc ion binding;
FT                   GO_function: GO:0051287 - NAD binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00434"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92270"
FT                   /db_xref="GOA:Q0SJL6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJL6"
FT                   /protein_id="ABG92270.1"
FT                   /translation="MKAIIHTRFGGPEVLELAQVPKPTPKDGEVLVKVHATTVTTAECK
FT                   MRRGEPLWGRLILGLRRPRRKLRTLGLELAGEIEAVGKDVRRFRPGDQVFGFTGFDIGA
FT                   YAEYKCLPETASLALKPVNKTYEEAVAAVDGATTALFFLRDKAKVRTGQKVLVNGASGS
FT                   VGTYAVQLAKSFGAEVTGVCGPHNTELVKSLGADNVIDYTTEDFADDTEAYDVVFDAVG
FT                   RNSFARCKGSLTEHGCYVPTSGLNNNLLQLWTSIRGGRKVVTGMSVRKNDALAYIKQLL
FT                   EADTLRIVIDRSYPLERIVEAHRYVDTGHKSGNVVITVA"
FT   gene            516273..516647
FT                   /locus_tag="RHA1_ro00435"
FT   CDS_pept        516273..516647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00435"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92271"
FT                   /db_xref="GOA:Q0SJL5"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJL5"
FT                   /protein_id="ABG92271.1"
FT                   /translation="MLKSENPNPARPTRSFLDRRRGPSDRELLTTAKSVLITSRGYSDA
FT                   QAFDELLDVARRHHLSVQGAARCLIDLTSNTRHLTSRRPGTFPEWEGLRGQPSRHHRPS
FT                   QRMSSLHGRHHPHLATQIHP"
FT   gene            complement(516735..517340)
FT                   /locus_tag="RHA1_ro00436"
FT   CDS_pept        complement(516735..517340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00436"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00436"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92272"
FT                   /db_xref="GOA:Q0SJL4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJL4"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92272.1"
FT                   /translation="MAGRRGWGGSPPGSDEEASRRIVTAAVELISRKDTAISIADVAES
FT                   LGVIRQTVYRYFPSTDALLRAAAIAAVAGFLDRLTEHLVGIDDPADAVVEAVIYTLNEA
FT                   PRIPQLGIMLSGSHSHTEGITSDEALSFGMTMIRRFDVDWERHGYDEAALRELVEYQLR
FT                   TMQSFFISPGNPPRSQDELRAYLRRWVGSTVAVPHRPA"
FT   gene            517599..518549
FT                   /locus_tag="RHA1_ro00437"
FT   CDS_pept        517599..518549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00437"
FT                   /product="possible metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00437"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92273"
FT                   /db_xref="GOA:Q0SJL3"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJL3"
FT                   /protein_id="ABG92273.1"
FT                   /translation="MTDLHPRKMDFAFDEQDVPFLWNPDNPAWSNMSNAISFLAVGFEK
FT                   MIVKAIMQAKPRMTDPEVAEEAMAFMRQEGHHSTAHRQHVKALIRRYPGLQNTLDAVIG
FT                   EYDLLTEATSLNYRLAYTADLEATFTPVFKLMLDNDATLFRPGDDRVASLFIWHFVEEV
FT                   EHRSSAMIIFNSLVGEELYRMRMAPSIFAHVMKVMRIACAGFNQHVLLEERKVDSMSMF
FT                   ATHRTKQKLLTSFAPYLSKGVMPRAFDDLPRGEQLTALAGIVRSQMPKHDPTHEKLPTL
FT                   ADEWFARYDAGYDCTRWYTADSRERRTEPVPAVVN"
FT   gene            518549..519709
FT                   /locus_tag="RHA1_ro00438"
FT   CDS_pept        518549..519709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00438"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00438"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92274"
FT                   /db_xref="GOA:Q0SJL2"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJL2"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92274.1"
FT                   /translation="MADLCSLTFDQLSAALGFSCAEAGGLVEVRSPSALENWTLPVLEL
FT                   TIVVGSVLALVFAILRWRRNGDPTNLVLWFGATAYLFVIEPPLYFPAAFGIEEHVDTMF
FT                   AHNVFTVDFLWGRLPLYIIAIYPLMATLAFELVRMLGVFRKYGVLVGAICVGFVHHAFY
FT                   EIFDQLGPQLRWWEWSTTNPVNQPMFDSVPLPSVVVFAALWPMSLALCVQFFVGRHADR
FT                   GRDFTGLELVWRTIVIGLLASLGTFILPIPATILGMESTTVRGILYAAELIVIVLVAIP
FT                   ILLRQWSQLRRRTSDVPIYSNDFVRVYSVVYLGVMGILWVTALPSYFGAVDGVTSNGDP
FT                   IGNLWYTIACFAIAILCVAATFTVPRGPADGRGPISGEGAVPNAVR"
FT   gene            complement(519800..521257)
FT                   /gene="katA"
FT                   /locus_tag="RHA1_ro00439"
FT   CDS_pept        complement(519800..521257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katA"
FT                   /locus_tag="RHA1_ro00439"
FT                   /product="catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="GO_component: GO:0042597 - periplasmic space;
FT                   GO_function: GO:0004096 - catalase activity; GO_process:
FT                   GO:0006118 - electron transport; GO_process: GO:0006979 -
FT                   response to oxidative stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00439"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92275"
FT                   /db_xref="GOA:Q0SJL1"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJL1"
FT                   /protein_id="ABG92275.1"
FT                   /translation="MTNPNGLTTVAGAPVPDNQNSLTAGARGPMLLQDVWLLEKLAHFD
FT                   REVIPERRMHAKGSAAFGTFRVTHDITAHTNAAVFSEIGKRTEVFLRFSTVAGERGAAD
FT                   AERDIRGFAVRFYTEQGNWDVVGNNTPVFFFRDPLKFPDLNHAVKRDPRTNLRSAENNW
FT                   DFWTNLPEALHQITIVMSDRGIPNGYRHMHGFGSHTFSFVNDAGERSWVKFHFRTQQGI
FT                   KNLTDEEAAAVVAGDRESAQRDLFNAIEEGNYPKWTLFVQIMPEADAQTYHYHPFDLTK
FT                   VWSKKDYPLIEVGELELDRNPENYHADVEQAAFSPANIVPGIGFSPDRMLQGRLFSYGD
FT                   AARYRLGVNHHQIPVNSPRGATHVNSFHRDGVMRVDGNQGSVPSIEPNSHGRFADQRSY
FT                   AEPPLEVGVVADRFDYRADDDNYFEQPGNLFRSMSAEQQTLLFENTARAITGASAAVIE
FT                   RHIVNCAQADPAYGEGVRKACEAFGAL"
FT   gene            complement(521371..523155)
FT                   /locus_tag="RHA1_ro00440"
FT   CDS_pept        complement(521371..523155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00440"
FT                   /product="possible transcriptional regulator"
FT                   /note="GO_function: GO:0000166 - nucleotide binding;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_function: GO:0017111 - nucleoside-triphosphatase
FT                   activity; GO_process: GO:0000160 - two-component signal
FT                   transduction system (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00440"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92276"
FT                   /db_xref="GOA:Q0SJL0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJL0"
FT                   /protein_id="ABG92276.1"
FT                   /translation="MTPQPISTSHHRTTRDSKSDSELAPPSSSPAGSDYLRLSTWLRVS
FT                   WSRSRQALGDDDRPAAAYVERVATDTVLERAARSVLPDVTAYIENEPVALILTDANGIV
FT                   LSRTGGDSDLFAALDRVDLAPGFRYAETQVGTNGIGTSLEVGRPLLVDGDQHFSGPLRS
FT                   FSCAGAPVTHPVTGAILGVVDLTTAAQNSNTLLLSFATLAAARLRERMLDDATELDRAI
FT                   FSAYRSACRRSSRPVVAVGDEVVMMNSLARQQFDSPDQMAILERTRDIGGETTPVTILT
FT                   DLPSGTIARLSYEPTFTGSRLAGGIVRITKQVSSLRLSTPKVYAPIPPAIAGASPLWRH
FT                   TVQAVVDACRRQDWLVLDGEPGVGKTALIRAAHQLVPDRGLAVLDATALGDDLLPEVSD
FT                   ELDSGSDLAILHAHALDDAHLTALADLLQGPQAQEPPRRPWVVLTRYPQDSTDTTPLLR
FT                   MFPKSVTVPPLRHHLDDLPDLVRSLLDTLGATGLTLAPAASNQLARLAWRGNVTQLKTV
FT                   LEDTYRRQRSGVVEVDTLPPACRSTTRRTLTRMQALERDAIVDALALHAGDKTAAATAI
FT                   GMSRATIYRKIREFGIVL"
FT   gene            523358..524992
FT                   /locus_tag="RHA1_ro00441"
FT   CDS_pept        523358..524992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00441"
FT                   /product="propane monooxygenase hydroxylase large subunit"
FT                   /EC_number="1.14.13.25"
FT                   /note="GO_function: GO:0004497 - monooxygenase activity;
FT                   GO_process: GO:0006725 - aromatic compound metabolism;
FT                   GO_process: GO:0006730 - one-carbon compound metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00441"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92277"
FT                   /db_xref="GOA:Q0SJK9"
FT                   /db_xref="InterPro:IPR003430"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SJK9"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92277.1"
FT                   /translation="MSRQSLTKAHAKITELSWDPTFATPATRFGTDYTFEKAPKKDPLK
FT                   QIMRSYFPMEEEKDNRVYGAMDGAIRGNMFRQVQQRWLEWQKLFLSIIPFPEISAARAM
FT                   PMAIDAVPNPEIHNGLAVQMIDEVRHSTIQMNLKKLYMNNYIDPAGFDMTEKAFANNYA
FT                   GTIGRQFGEGFITGDAITAANIYLTVVAETAFTNTLFVAMPDEAAANGDYLLPTVFHSV
FT                   QSDESRHISNGYSILLMALADERNRPLLERDLRYAWWNNHCVVDAAIGTFIEYGTKDRR
FT                   KDRESYAEMWRRWIYDDYYRSYLIPLEKYGLTIPHDLVEEAWKRITDKGYVHEVARFFA
FT                   TGWPVNYWRIDAMTDKDFEWFEHKYPGWYSKYGKWWEEYNRLAYPGRNKPIAFEEVGYQ
FT                   YPHRCWTCMVPALIREDMVVEKVDDQWRTYCSETCYWTDAVAFRSEYQGRPTPNMGRLT
FT                   GFREWETLHHGKDLADIVSDLGYVRDDGKTLVGQPHLDLDDPKKMWTLDDVRGNTFQSP
FT                   NVLLNEMSDAERNAHIAAYRAGGAVPA"
FT   gene            525008..526120
FT                   /locus_tag="RHA1_ro00442"
FT   CDS_pept        525008..526120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00442"
FT                   /product="probable phenol hydroxylase"
FT                   /note="GO_function: GO:0004497 - monooxygenase activity;
FT                   GO_function: GO:0005489 - electron transporter activity;
FT                   GO_function: GO:0005506 - iron ion binding; GO_process:
FT                   GO:0006118 - electron transport; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00442"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92278"
FT                   /db_xref="GOA:Q0SJK8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SJK8"
FT                   /protein_id="ABG92278.1"
FT                   /translation="MAPRPLRRHPPLHHSFHESRRDPVADKHRINFEPVDIEMEVGEDE
FT                   YILDAAFRQGIHLMHGCREGRCSACKSFVLEGDIQMEDYSTFACNDAEVDEGHVLLCRS
FT                   TAYSDCTIELLNFDEDELLGGVPIQDVRTRVTRIEPMTKDIVSLRLAPVEPAGYEFKPG
FT                   QYSDLHIPGTEEHRSFSMATTRSTPGHVEFLIKKYPGGKFAGLLEDGISVGDEIALTGP
FT                   YGSFTIKEGHVLPMVFIGGGAGMAPLLSLLRHMSETGNTRQVHFYYGARTPQDLFYVDE
FT                   ILELGRGLTDFTFVACLSESMDPPPVGAIAVEDGNVTDVVGRREPDIGRAEVYLCGPPP
FT                   MVDAALELLEANGTPKDQIFYDKFTSPAFE"
FT   gene            526171..527277
FT                   /locus_tag="RHA1_ro00443"
FT   CDS_pept        526171..527277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00443"
FT                   /product="monooxygenase hydroxylase"
FT                   /note="GO_function: GO:0004497 - monooxygenase activity;
FT                   GO_process: GO:0006725 - aromatic compound metabolism;
FT                   GO_process: GO:0006730 - one-carbon compound metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00443"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92279"
FT                   /db_xref="GOA:Q0SJK7"
FT                   /db_xref="InterPro:IPR003430"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SJK7"
FT                   /protein_id="ABG92279.1"
FT                   /translation="MTATAESKQRSFPKIEFTDSEAGALEFPSSRSRTFTYYTPAKKRS
FT                   TMYEDVTVDVQPDPDRHLSQGWIYGFGDGPGGYPQEWTAAKSSNWHAFLDPNEEWDQTI
FT                   YRNNSKVVHQVELCLSNAKRARVYDGWNTPWLTFISRNLGAWMHAENGLALHVFTSIQR
FT                   SCPTNMINTAVAVNAAHKMRFAQDLALFNLDLSEATENFDGTAHKEVWQSAPEWQPTRE
FT                   VVERLTAVPDWCELLFGSNIVFEQLVGTLFRSELVMQIAAGNGDYITPTIVGTGEHDYD
FT                   RDLAYTRNLFRLLTRDPEHGEANKELFGTWLAIWVPRCLDAARALQPIWSQPADKAITF
FT                   ATSFDAATDKFRSLLEDLGLDIPKELDQ"
FT   gene            527274..527615
FT                   /locus_tag="RHA1_ro00444"
FT   CDS_pept        527274..527615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00444"
FT                   /product="possible monooxygenase component"
FT                   /note="GO_function: GO:0004497 - monooxygenase activity;
FT                   GO_process: GO:0006725 - aromatic compound metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00444"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92280"
FT                   /db_xref="GOA:Q0SJK6"
FT                   /db_xref="InterPro:IPR003454"
FT                   /db_xref="InterPro:IPR036889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SJK6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92280.1"
FT                   /translation="MSMQFGSSTEFSNMCGVTLMNTPIGRVVAEVMGAKDGVELTEYPS
FT                   MIRVDGQRLLDFDYEELTDALGQEFDGSIFEEISSTHYGRMVHLDEKTLLFASPEDAAE
FT                   YIGFDLTAQ"
FT   gene            527695..528741
FT                   /locus_tag="RHA1_ro00445"
FT   CDS_pept        527695..528741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00445"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0001760 -
FT                   aminocarboxymuconate-semialdehyde decarboxylase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00445"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92281"
FT                   /db_xref="GOA:Q0SJK5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJK5"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92281.1"
FT                   /translation="MYQKDGQKYFIVDGHVHVWDARESNQKNVHGKQFIDCFYDYHKNL
FT                   SPEEVVWDYDTYTYYGSERFERDIFVEGYVDHAIFQATLLSDFYHNGFGRTDEALALVA
FT                   KHPGKLTYNHAYDPRHEEAGLEQLRKDADRMNLQGVKLYTAEWHGDSRGYKLDDPWSRR
FT                   YLEECIELGIKNIHVHKGPTIRPLDRDAFDVSDIDKVATDYLDLRFVVEHVGLPRLEDF
FT                   CWIATQESNVYGGLAVALPFIHTRPRYFAQIIGELLYWIGEDKILFGSDYALWTPKWLI
FT                   EKFVDFQIPEDMLTDYAPITALQKQKILGLNAAALYDIDVPADLQLPEPAGQEGVEVAA
FT                   GAREVVSS"
FT   gene            528738..529481
FT                   /locus_tag="RHA1_ro00446"
FT   CDS_pept        528738..529481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00446"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00446"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92282"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJK4"
FT                   /protein_id="ABG92282.1"
FT                   /translation="MTTLAVGAEEDILAALATVTDPELDEPITDLGFVRSVMLDDDGVT
FT                   VHLRLPTAFCSPNFAYLMASDALDALRLVEDIGEVRVLLDDHHDSDKINTGLAADAGYV
FT                   GTFGSEAEESLHELRRTFRSKAHAAAMERCVEAHLKTTDVGVNEIYRLTLSDLAPGKAK
FT                   AALLRRRIGIGLSICPASRVFVDDDGKRIAPESVPMRLRFAKSVRISMEGNAHFCRGLL
FT                   ATRYADGESVGATPRITNLRTRSPR"
FT   gene            529478..530503
FT                   /locus_tag="RHA1_ro00447"
FT   CDS_pept        529478..530503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00447"
FT                   /product="alcohol dehydrogenase"
FT                   /EC_number="1.1.1.103"
FT                   /note="GO_function: GO:0004022 - alcohol dehydrogenase
FT                   activity; GO_function: GO:0008270 - zinc ion binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00447"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92283"
FT                   /db_xref="GOA:Q0SJK3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJK3"
FT                   /protein_id="ABG92283.1"
FT                   /translation="MKAVQVVGYHTKLQLTDIPEPTIDGPLDVIVRIGGAGVCRTDLHI
FT                   LEGQWEAKSGVALPYTIGHENSGWVHAVGDAVTNVTVGDKVILHPLITCGLCRACRSGD
FT                   DVHCQNSTFPGIDVNGGYAEYLRTTARSVVRIDDSLEPADVAALADAGLTAYHAVAKVA
FT                   KTTRPGDVCVVIGAGGLGHIGIQVLKAISGVTVVVLDRNPAAVELAVKIGADHGIVADG
FT                   THIQQVLDLTGGHGAEAVVDFVGEGGATAEGIAMLRRAGNYYVVGYGENIDVPTIDVIS
FT                   TEINFIGNLVGSYNDLQELMTLAAQGKVTLHTTRYRLEDFQQALDDLDAGRVRGRAILV
FT                   P"
FT   gene            530550..532199
FT                   /gene="groL1"
FT                   /locus_tag="RHA1_ro00448"
FT   CDS_pept        530550..532199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL1"
FT                   /locus_tag="RHA1_ro00448"
FT                   /product="60 kDa chaperonin GroEL"
FT                   /note="GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0051082 - unfolded protein binding; GO_process:
FT                   GO:0042026 - protein refolding"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00448"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92284"
FT                   /db_xref="GOA:Q0SJK2"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SJK2"
FT                   /protein_id="ABG92284.1"
FT                   /translation="MAKELRYNTDARARLEHGVNALADAVKVTLGPKGRNAVLEKLTGP
FT                   PTITNDGVTIAREIQLREPFANMGAQLVKEVAMKTNGVVGDGTTTATVLAQAMVREGLR
FT                   SVDAGANPMRVRRGIERAVSVVVDSLHEQASQIGGQSDLQRIATLAASDDEVIGHAISK
FT                   AVDYVGKSGVVTTEESDTLGLSVDIVDGIEFDHGYISGYMVTDPERMEAVHTNPLILLT
FT                   NKKITQVQDIMPSIEVAKRADRPLVVLAEEVDGPALQLLVGGNMHKTMQSVVVRAPGFG
FT                   HRRVAELEDLAVALGGHVIAKDTGIELSEISVEHLGSCDRITVTENETTIVGGHGDQRL
FT                   LDARIAQLESQHERAKIEADQESLELRIARLTGRVAVIRVGGATSVELKERMLRVEDAL
FT                   AATRAAVEAGIVSGGGTALAQSHRALADLDLTGDEAIGCDVVRRALAEPLRWIAINAGF
FT                   DGDEVVEVVAGLPLGHGFNALTGEYGDMFDDGVIDPFKVTRAALESAASIAALLITTET
FT                   AVVEEVLGNPGAIMAPGFGDLAEGMVRPSNIY"
FT   gene            532298..532624
FT                   /locus_tag="RHA1_ro00449"
FT   CDS_pept        532298..532624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00449"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0016491 - oxidoreductase activity; GO_process:
FT                   GO:0017000 - antibiotic biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00449"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92285"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJK1"
FT                   /protein_id="ABG92285.1"
FT                   /translation="MIFIVVKFNVLDKYRNDWLLVTKEFTDATRSEPGNLWFEWHRSAD
FT                   DPAQFVLIEAFRDGQAGSDHVAADHFRKGLDAMRPALSETPRILHTELPGTDWSRMGEL
FT                   EINR"
FT   gene            532675..534045
FT                   /locus_tag="RHA1_ro00450"
FT   CDS_pept        532675..534045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00450"
FT                   /product="probable glycolate oxidase FAD-linked subunit"
FT                   /note="GO_component: GO:0009339 - glycolate oxidase
FT                   complex; GO_function: GO:0008891 - glycolate oxidase
FT                   activity; GO_process: GO:0006118 - electron transport;
FT                   GO_process: GO:0015976 - carbon utilization"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00450"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92286"
FT                   /db_xref="GOA:Q0SJK0"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJK0"
FT                   /protein_id="ABG92286.1"
FT                   /translation="MTVVTTGPVAGLLAALGDAVMTDSDTMIAYTRDQSLLSPSGHPIA
FT                   VVRARTTDHVVTTLKTAHRYGIPVVTRGAGTGLAGGANAIDGCIVLSTEKLDRILTIDQ
FT                   QSRTATVEPGVINGDLAAAAADRGLWYVPDPGSRAVSTIGGNLATNAGGACCAKYGVTG
FT                   DHVARIKAVLADGRIIHTGAATRKNVAGLNLTQLLVGSEGTLAVIVEATMRLRRPPART
FT                   ATVVAAFAEPVQAVDAVIAIQEVADPSLVELMDRTTVSAVNDMTHMGLDQTAGALLLIQ
FT                   CDGDAAEQEARRSADACRAAAATELYVSADPAEGHALMQARSVALTALERRGSTLLDDL
FT                   AVPVPRLPHMLDAITRIADHHHLLVGTFGHAADGNLHPTIVFDAADPDATERAHQAFDE
FT                   MVAGCLALGGSITGEHGVGDLKRRYLEPMIGSVERSLMAEVKAAFDPTGILNPGRAI"
FT   gene            534042..534362
FT                   /locus_tag="RHA1_ro00451"
FT   CDS_pept        534042..534362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00451"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92287"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJJ9"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92287.1"
FT                   /translation="MTPTKPHVRSKRDDDLVLEFGNRWAVFGGGSAEDIFVTFGWTEAR
FT                   YFERLKVLAGRRFPPLDDTLRHRLLAVCAERLQRIAHPRSPASKGHVDDSASRPTPRPS
FT                   PH"
FT   gene            534465..536213
FT                   /locus_tag="RHA1_ro00452"
FT   CDS_pept        534465..536213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00452"
FT                   /product="possible transcriptional regulator"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0000160 - two-component signal
FT                   transduction system (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00452"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92288"
FT                   /db_xref="GOA:Q0SJJ8"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJJ8"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92288.1"
FT                   /translation="MTSKDLQKARELFLADDGLDSSVRQPISYSWQRSKSLKVRPDQLD
FT                   LPFVREPNLDCPLVAAAEPVLRQLADGLVDEPVSVILTSADGVILTRITASRRLNRTLD
FT                   DVQLIPGYSYSEEFVGTNGIGTTLETRQPTLVTGAEHYADCLGQLACAGVPITHPMSGA
FT                   LVGALDLTGWVEDGGPLLATLAKSATAQIEGRLLAQASADQTALLNAYLKACRRSPRTG
FT                   VLALGDDVVLVNRKLRVALDAQDQGALLEHAVDLSGAPAIQRHIVALPSGQTARLSSVE
FT                   DFGLGARRQLALFYVHLLEIPTSGSPALESIRVLPGITGNSASWRRSCQQIARCAREQQ
FT                   WVTVSGEAGSGRASALKAVAIEHIPIRTRIFTVAELAGDSAGLPALEQELGQDRFSVIL
FT                   RDIDLLGESQLRTVADLVQGREHAGWIGATIGGTDHNTDLDTLILPHFSHTVTMPALRH
FT                   RIDDLHSLVPHLLRQLGRGADLSLSPAAMRQLCKYSWPGNVTELRQVLHDVVQRQRSGV
FT                   VEVEQLPPMCRALSRHTLTQIEALERDAIVRSLEENHGNKKAAATALGISRATIYRKIK
FT                   EFGIDI"
FT   gene            536374..536619
FT                   /locus_tag="RHA1_ro00453"
FT   CDS_pept        536374..536619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00453"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92289"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJJ7"
FT                   /protein_id="ABG92289.1"
FT                   /translation="MTTNPLGADTDSVSPGSTTSRVWLVAALAHTCEPTDRPAVRDDLM
FT                   RTWVPEPGSGYRTHDGRRRATWAQLHSRFDLVEVTP"
FT   gene            complement(536990..537286)
FT                   /locus_tag="RHA1_ro00454"
FT   CDS_pept        complement(536990..537286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00454"
FT                   /product="possible conserved polyketide synthesis
FT                   monooxygenase"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0016491 - oxidoreductase activity; GO_process:
FT                   GO:0017000 - antibiotic biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00454"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92290"
FT                   /db_xref="GOA:Q0SJJ6"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJJ6"
FT                   /protein_id="ABG92290.1"
FT                   /translation="MILEHALLSVAPERVEEFESAFGRAESIISSMPGFLRLRLSRGLE
FT                   RPNVYLLLVEWEELEDHTEGFRQSSRYQQWKDLLHHFYDPFPLVEHYAPVREV"
FT   gene            537381..537989
FT                   /locus_tag="RHA1_ro00455"
FT   CDS_pept        537381..537989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00455"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92291"
FT                   /db_xref="GOA:Q0SJJ5"
FT                   /db_xref="InterPro:IPR039708"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJJ5"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92291.1"
FT                   /translation="MRREESAPVPTPIRLWRLGPWSRNRLMRRGDRYEAVLVLLAAMLI
FT                   LLLVPCAAAFGTATHTRLEQQTQTLRSGVHQVPAVLLEDTHPAPDTPDDALRHSHNQDS
FT                   ARVRWSTPNGDHTAVVPTDAHATAGQTTTISVGADGNLTGPIRSNREDTVVAVTAACGV
FT                   WALGSGSIALVPALVHAVSARTRMRQWASEWTRFDAPPR"
FT   gene            complement(538003..538935)
FT                   /locus_tag="RHA1_ro00456"
FT   CDS_pept        complement(538003..538935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00456"
FT                   /product="possible hydroxylase"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_function: GO:0016564 - transcriptional repressor
FT                   activity; GO_process: GO:0006808 - regulation of nitrogen
FT                   utilization; GO_process: GO:0009225 - nucleotide-sugar
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00456"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92292"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJJ4"
FT                   /protein_id="ABG92292.1"
FT                   /translation="MSDRAPFLMTGVGGGYSSISRLVAELLLRSGEPVRAMVHRDDGRA
FT                   DALRELGADIVVGDLTRPGDVAAALAGVRRMFFNMSVSADYLEAAAVVCAIADERGDLE
FT                   ALVNMSQMTVSQMTSTSTDESRHQRLHWLAERIMNWSGLPVVHVRPTVFLDNPLFTVVA
FT                   SRSVAERGVLALPFGTGRTSPVAATDVARVIAAILQDPAGRIGQVFELTGPAVLDIDGL
FT                   AEQYTRGLGRPVTGSDLPYGSFVELMGAVPGISSHTVQHLLTVATLHRDDRYNRLTTDV
FT                   EDVTGQPAQSVEQYVAAHRELFSRPAAAG"
FT   gene            539185..539715
FT                   /locus_tag="RHA1_ro00457"
FT   CDS_pept        539185..539715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00457"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00457"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92293"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJJ3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92293.1"
FT                   /translation="MSGLTIAPSSGLPEPTSRGPVPWRRSRKRPRAARRPRPDLVWLNL
FT                   DRTTVMRQVTTRTIRRHLRRKVLCYSTIETPLHRLFLLRDYIVRWVLSFERAGDMLRST
FT                   DTGGGHGRKIVRQLGRHRRRCRDVWRKRGRALPPPQAVGRVSTIARPGRSRTGCHVTHR
FT                   RHPSFISPHRSHW"
FT   gene            539907..540425
FT                   /locus_tag="RHA1_ro00458"
FT   CDS_pept        539907..540425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00458"
FT                   /product="probable dehydrogenase"
FT                   /note="GO_function: GO:0015036 - disulfide oxidoreductase
FT                   activity; GO_function: GO:0016705 - oxidoreductase
FT                   activity, acting on paired donors, with incorporation or
FT                   reduction of molecular oxygen; GO_function: GO:0050660 -
FT                   FAD binding; GO_process: GO:0006118 - electron transport;
FT                   GO_process: GO:0016117 - carotenoid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00458"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92294"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJJ2"
FT                   /protein_id="ABG92294.1"
FT                   /translation="MGFAGASSAPAAPLGTGPTPEIGYGPRCGGEAYAHAHAPTLRRNA
FT                   TDAILDQIERFAPGFRDQILATEVRSATDIDTYNPNYVGGDTLTGRNDPLQVVMRPRIS
FT                   LDPYRTGIPGTYLCSAATPPGWFLPLVTFMLSPALVPILIHGCGHLYDNLRPTAPIENA
FT                   RERDCDRTV"
FT   gene            complement(540727..540993)
FT                   /locus_tag="RHA1_ro00459"
FT   CDS_pept        complement(540727..540993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00459"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92295"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJJ1"
FT                   /protein_id="ABG92295.1"
FT                   /translation="MDSDAVAVAALIRYYGRPYPGGDAYVGAHFDSWSRTGDRAGEVDR
FT                   GPADDLVAVNRSPLARGPAWDLETAIWALPGIGRDEGDEADRP"
FT   gene            541525..542418
FT                   /locus_tag="RHA1_ro00460"
FT   CDS_pept        541525..542418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00460"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_component:
FT                   GO:0016021 - integral to membrane; GO_function: GO:0008119
FT                   - thiopurine S-methyltransferase activity; GO_function:
FT                   GO:0008689 - 3-demethylubiquinone-9 3-O-methyltransferase
FT                   activity; GO_process: GO:0008152 - metabolism; GO_process:
FT                   GO:0046690 - response to tellurium ion"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00460"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92296"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJJ0"
FT                   /protein_id="ABG92296.1"
FT                   /translation="MPIRQELSPKPSVLLHCVGMEEAGEVTEVKTTSSEADEWDARYSE
FT                   RARVWSGEPNGALVDEMTGARPGRALDVGCGEGADALWLARQGWAVTALDVSRIALDRA
FT                   GAHADGEDVDIKWVLSGLLDADLPAGGFDLVSAQYPALRRTAERSAERALISAVAPGGT
FT                   LLVVHHDIPDADAAREHGFDPADWVTPGDVAALLDDSWHMDVNEVRERSISGGAGAHHT
FT                   HDVVLRAHRLPHQSPSIGHRTANGSLGANAESHRKTTTGTAAPASTPCRHSHDRARYWD
FT                   HRQARWVKHHANQTRD"
FT   gene            542483..543010
FT                   /locus_tag="RHA1_ro00461"
FT   CDS_pept        542483..543010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00461"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00461"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92297"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJI9"
FT                   /protein_id="ABG92297.1"
FT                   /translation="MVRKCRRGMSRSRARLRPRSEYGQNGPYRTKENMMAKYLLLKHYR
FT                   GAPASVDDVPMDQWTPEEISAHVQYMNDFAARLESTGEFVDSQALSPEGTFVRYDGEGR
FT                   PPITDGPFAETKDLIAGWMVIDVETHERALELAGELSAAPGAGGKPIHEWLEVRPFLAA
FT                   SPTATECGFHNG"
FT   gene            complement(543540..545045)
FT                   /locus_tag="RHA1_ro00462"
FT   CDS_pept        complement(543540..545045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00462"
FT                   /product="probable transposase"
FT                   /note="GO_function: GO:0004803 - transposase activity;
FT                   GO_process: GO:0006313 - DNA transposition"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00462"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92298"
FT                   /db_xref="GOA:Q0SJI8"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJI8"
FT                   /protein_id="ABG92298.1"
FT                   /translation="MCAFAKFWLAVLTELKHRGVADVCIVVCDGLKALPDAITAVWDRT
FT                   IVQTCVIHLLRNTFRYASRRYWDEMSRDLRPIYTAANEAAAREQFDEFTGLFTQVLMIA
FT                   GHAGLGHFGTVAIDGTKIAANASIDANRGHEWLSEQVTRMVAEAEQTDATENIRAAQRA
FT                   HDDDDRVPARLMDQSSRARRIRQAADEVAAQLKRQRNNEDERDAAARARLAKSRAGEPV
FT                   VGRIPDGPHRLAEARAHLAREIATHQSKLERRAALIAAGKKPMGAPPVPLEQHSRIIRA
FT                   RRVVEAALAAEHTASATKPAKRVLPKTVANTTDPQSRLMPTRRGFLQGYNAQLAGTSDQ
FT                   IIAAVQIGQSPNDIASLVPMMEASGRAAAMLHTGTGRSEHIIGVVLADTGYCSDSNLSA
FT                   PGPERLIALNKTRDHAKAVIEQPVTGPPPEGASPRQAMSHRLRTPEGSRLYKRRGATVE
FT                   PGIGNLKKVLDRFSGRGLNSALGELNLAASAFNLMKIHRATAS"
FT   gene            complement(545082..547001)
FT                   /locus_tag="RHA1_ro00463"
FT   CDS_pept        complement(545082..547001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00463"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00463"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92299"
FT                   /db_xref="GOA:Q0SJI7"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJI7"
FT                   /protein_id="ABG92299.1"
FT                   /translation="METPDGRRPPRGLDRHPAATAARREGRIGTVLGVGVGVVHQTAQP
FT                   DQADHPDRAVHRLGLHTERPVRHRYHPSRTTDLVEPDQGRGERHTGIAAGPVDAADLSM
FT                   TLRIRDCRRCGRAVGKPDRDLCARCHWAASHAPVKHRCPGCGADRVLQPDTGRCERCSR
FT                   TCRICDAPVLFVARDLCKECLRRQRRDADRAECPRCSKRRILRSDAGYCGPCSHPGRPP
FT                   NPDAACVDCGRVTRLTGAGRCRPCWERSPHRITVRAANLAEALDDPPSWLGGFAAYLVG
FT                   RHHPSRACAMLTRLGKHLTDDAPVHPQALLDAVAADVPLARALEDFLTASKLALPPDRE
FT                   ERRAAARRQSRIDAVPAPLRPAVIGFAEHLVAGRDRARRTGTHPRGHATLEARLTALRD
FT                   FTEFLTTRRGKTDWAVVDVGDIEAFLHAHPRRRSFYLTGLRQFCRYALRRRLMLINPTA
FT                   GVQAPQTMAFRGPTLPVDRQRELFRRWSTDPHVHPHEAFVGLAALLHGATTQDLQHLAD
FT                   DDIDHDQHRIRLGRRPHPTPLDLWTWTALQRCLQHRRNLGSSNSHVLITMQTKATRTAA
FT                   SDSYVKHTLRAVGIQPRILRSTRLVDLVGTVDAKLVAAAYGMRNEAVIAYLSDHVDTAR
FT                   LPNP"
FT   gene            complement(547015..548067)
FT                   /locus_tag="RHA1_ro00464"
FT   CDS_pept        complement(547015..548067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00464"
FT                   /product="probable tyrosine recombinase"
FT                   /note="GO_function: GO:0003674 - molecular_function;
FT                   GO_process: GO:0006310 - DNA recombination"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00464"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92300"
FT                   /db_xref="GOA:Q0SJI6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJI6"
FT                   /protein_id="ABG92300.1"
FT                   /translation="MGDGRLRVIPGEVTPGVAMRDPQRFQAECVEAFVASWTARGFADS
FT                   TITNDVGVLERMLAGLGRPVWEVTAADVDRVVGELASSGRAVSTRRNYVQVFKGFHRFL
FT                   EVRKAAEIEAAFGVRLACPLDEFNAARHVGDDSPTANPPPAPERVAAFFEFLKARIATA
FT                   RKYGPAARDYALFRTLYHAGVRAEEVVMLDRGDVHFGRGTFGKLHVRFGKGAKGSGPRP
FT                   RWVPMLDGLDLVLRWYLDDVRGRFPDSSVLLCDESGGRMAAATIRNRLRHLMSVEGRPE
FT                   AEWFSPHGMRRACATHNYERGVDLVAIQQLLGHWTVASTMRYVRPSETFIEDAYQRAIS
FT                   ATLTELTGQE"
FT   gene            complement(548163..548618)
FT                   /locus_tag="RHA1_ro00465"
FT   CDS_pept        complement(548163..548618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00465"
FT                   /product="transposase"
FT                   /note="GO_component: GO:0005786 - signal recognition
FT                   particle (sensu Eukaryota); GO_function: GO:0003723 - RNA
FT                   binding; GO_function: GO:0004803 - transposase activity;
FT                   GO_function: GO:0005525 - GTP binding; GO_process:
FT                   GO:0006313 - DNA transposition; GO_process: GO:0006614 -
FT                   SRP-dependent cotranslational protein targeting to
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00465"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92301"
FT                   /db_xref="GOA:Q0SJI5"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJI5"
FT                   /protein_id="ABG92301.1"
FT                   /translation="MLTEIGPVEIQVPRDTDASFDPQIVKERQRRLTGVDEIILSLSSK
FT                   GLTTGEIVAHFDDVFGASVSRETIGKITDKVLAEMAEWSLRPLDPVIFIDAIHVKVRDG
FT                   QVTNRPIYVAIGVTVNGERDILGLWAGDSGEGYGTRTGSFPEFRAAA"
FT   gene            complement(548612..548869)
FT                   /locus_tag="RHA1_ro00466"
FT   CDS_pept        complement(548612..548869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00466"
FT                   /product="probable transposase"
FT                   /note="GO_function: GO:0004803 - transposase activity;
FT                   GO_process: GO:0006313 - DNA transposition"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00466"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92302"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJI4"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92302.1"
FT                   /translation="MTETLDPMDQTKIDHQKLAQQLLAQGKADGVELVGPNGLLNQLAA
FT                   NVLETALEAEMEEHLGYEKHQIEGRNGGNTPATADERKRC"
FT   gene            complement(549051..550076)
FT                   /locus_tag="RHA1_ro00467"
FT   CDS_pept        complement(549051..550076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00467"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00467"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92303"
FT                   /db_xref="InterPro:IPR021848"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJI3"
FT                   /protein_id="ABG92303.1"
FT                   /translation="MTELLTSDLTCLPWPFPAGDETFRYAVNVEPAPRYTPTLAGGWGR
FT                   HVVDLGLEYVPMMQLKREILAKDPGRVQILPHMMPACWDVMLYLMRQMADSYPETMQLT
FT                   GQGIRYHWRNTLLGIDQHFEMGDLVTLPEDPLTFIGCQVPDDILLLTERHDQLWFDAAI
FT                   VTFAADWSIKFDVGMNFNEIHRPVPGLTSGGITSRAQQFMRHLTTDRIFRRANWTFSAV
FT                   GSPHRDTSLETRPEWEDDIPKLIADGDYGRVQLRIELEHLIRLPLTGALVFNIHTYMAP
FT                   LSDIATIPAWAEQLAAIITELPADIAAYKGIDSYRHDAARWLRSRSRNGSTTEDASCTA
FT                   R"
FT   gene            complement(550137..550634)
FT                   /locus_tag="RHA1_ro00468"
FT   CDS_pept        complement(550137..550634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00468"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92304"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJI2"
FT                   /protein_id="ABG92304.1"
FT                   /translation="MTSIDESDIATAQVGITAASMDLSGRQYLLIAIGDAPSTTAKVAK
FT                   WGRDLASADRAVTLYSLPDGAGIADLIDTSTVGVRIMIAGAEYGVMQAVAVARAAGILP
FT                   CELFIHISHVDVISVFCPHCDTATRALAGPDHTIECSGCARDLVVRPHTSSHRAMYLAS
FT                   VA"
FT   gene            complement(550631..550897)
FT                   /locus_tag="RHA1_ro00469"
FT   CDS_pept        complement(550631..550897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00469"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00469"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92305"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJI1"
FT                   /protein_id="ABG92305.1"
FT                   /translation="MTSAASGTATEGLIHFPFPFPRDRYRYSADIEPSGARVATAAGVG
FT                   SERRVVIDDHHRAELAERARILSSDPRTPNHRACSSTTLRGMS"
FT   gene            complement(550894..551874)
FT                   /locus_tag="RHA1_ro00470"
FT   CDS_pept        complement(550894..551874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00470"
FT                   /product="phthalate 4,5-dioxygenase"
FT                   /EC_number="1.14.12.7"
FT                   /note="GO_function: GO:0004497 - monooxygenase activity;
FT                   GO_function: GO:0005506 - iron ion binding; GO_function:
FT                   GO:0008168 - methyltransferase activity; GO_function:
FT                   GO:0009055 - electron carrier activity; GO_function:
FT                   GO:0016651 - oxidoreductase activity, acting on NADH or
FT                   NADPH; GO_process: GO:0006118 - electron transport;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00470"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92306"
FT                   /db_xref="GOA:Q0SJI0"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJI0"
FT                   /protein_id="ABG92306.1"
FT                   /translation="MTEVVEAATTNAAVGSDLSVVVADTTMLCEDIRQVVLAPVGGGTL
FT                   PSFTPGSHIAVTWKPGTRNSYSLTGPAIEPDHYSISARLDRAGAGGSRWVHNLAVGDQV
FT                   NASRPRSAFAPIPNARHHVLVAGGIGVTPILSHVRAAVQWRRSFEVIYSFRSGFGAHVD
FT                   DLMELCGDRLTIVNTPQQFWDHVTPTLTRQPIGTHLYTCGPTPMIDAVTEAALARGWPL
FT                   QRVHSEPFSSGISAGGEPFTATLGRTGTTVTVGPDTSLLDALLDNGFDVPNLCRQGVCG
FT                   ECKLAVRGGQIEHRDLYLTDQEKSTGDVMMPCVSRAAGADLELEL"
FT   gene            complement(551871..552170)
FT                   /locus_tag="RHA1_ro00471"
FT   CDS_pept        complement(551871..552170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00471"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00471"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92307"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJH9"
FT                   /protein_id="ABG92307.1"
FT                   /translation="MGAAARIPAHALVRRPRPLCVMSIALTDPDDVACVGLAQVWARIE
FT                   TGVIEILDGNSGCTQRTRQVFCAHCHTVTLTVYHHFSRRHHAYLGYQADSEDLT"
FT   gene            complement(552282..552677)
FT                   /locus_tag="RHA1_ro00472"
FT   CDS_pept        complement(552282..552677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00472"
FT                   /product="possible ethanolamine utilization protein EutQ"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00472"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92308"
FT                   /db_xref="InterPro:IPR010424"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJH8"
FT                   /protein_id="ABG92308.1"
FT                   /translation="MTVADSSAIGQTVAPFRVTADFWKSLPQMPVAEYPGTEGFIDDVY
FT                   ANPDGSEMSAGYFELRHTDDPLDYLYEYDEMKVVLEGEFVLENLDTGQKEVAKAKDAIF
FT                   FPKGSRIRFSTPEGALAFYVGQRSFAP"
FT   gene            552762..553514
FT                   /locus_tag="RHA1_ro00473"
FT   CDS_pept        552762..553514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00473"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92309"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJH7"
FT                   /protein_id="ABG92309.1"
FT                   /translation="MGYALVNARDKEVLSVGAAGEVRESTWRRRSGSPAVPGSDHPEAA
FT                   LSAGLGGSLVEALRGQRRWKVALVHTLHPLFWIWTRKAGTRPTGPTVLAGHPEGSIVGA
FT                   FTQKVLRARWSADEAPSVLHFPAGSTGDHQRLEALTSGVADAAVLGSAFAPSALSRLGL
FT                   TDSLFFGVALKFPTAGVAVDVARTSVDHPSVRKVVAAQTAAIAKVKSRDPVALDAVASL
FT                   LHDNSRTDAQHACVQHFPTLRVVDRVRL"
FT   gene            complement(553601..555355)
FT                   /locus_tag="RHA1_ro00474"
FT   CDS_pept        complement(553601..555355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00474"
FT                   /product="possible phthalate 4,5-dioxygenase"
FT                   /note="GO_function: GO:0004497 - monooxygenase activity;
FT                   GO_function: GO:0005489 - electron transporter activity;
FT                   GO_function: GO:0005506 - iron ion binding; GO_process:
FT                   GO:0006118 - electron transport; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00474"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92310"
FT                   /db_xref="GOA:Q0SJH6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR005163"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJH6"
FT                   /protein_id="ABG92310.1"
FT                   /translation="MARLQSLNVGMPKDVPWQGRTVHTGIFKYPVDGPRMVRTLDIDGD
FT                   GQGDLDGHGGEIRAVLVYQCQSYDFWRRHLGRDDLEYGQFGENFTVDGLPDDEVHIGDR
FT                   YRIGDAEFEVTQPRVTCYRVGMRLGEPEMPALLVAHHRPGFYFRVIAEGHVQAGDEIIR
FT                   TRIGRHRMSVAAIDALLYLPDRDIGQLRNAVDIPALSPGWQRSFRDLLDAAERPTRAGE
FT                   PPAGAQPDGWAGFRPLRVARIVSESTTVASIHLAPQDDAPLTRPKPGQYLTLRVAGAGE
FT                   PPPVRNYSLSAAPSDNEYRISVKRETHGLVSTYLHTQLRVGDTLDVASPRGDFVLPEDH
FT                   DGTTPVLLLSAGVGVTPVLAMLHALAAAHSKRDIWWLHTAHSAAEHAFAAEAHRLLTGV
FT                   DRGHEHVYYTAQSSTANLDPPALPGRINREALVALGLPTNVTTYLCGPTAFMAVLREAL
FT                   MHLGVESDRIHTELFGALPAINPGLTDATHTPPHLPPGPVGSGPRITFTRSGLTVPWSD
FT                   EYSTVLDLAEACDVPTRWSCRTGVCHTCQTPILSGTVRYRPDPLEPPMPGTTLLCCSQP
FT                   ETDLVLDL"
FT   gene            complement(555571..556806)
FT                   /locus_tag="RHA1_ro00475"
FT   CDS_pept        complement(555571..556806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00475"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003824 - catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00475"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJH5"
FT                   /protein_id="ABG92311.1"
FT                   /translation="MNDSTQRLGAGRYIDAAQAPDTTVTSVHELTTADGAKVSGVLRMV
FT                   PGAHTVVALMHPRQDLTHHVLVPELLARGYAVWTQGTRSVNNDVALVHEQALLDVAAGQ
FT                   IFLRERGFDHIVTLGHSGGGTLFAFYHQQAGLPSGERLTHTPADRPIDLAGADMPRPDA
FT                   AIFMAPHPGQGALLLRLIDPSVVDESDPLSTDPDLNPFDPANGFADPPHSSSYSTEFIT
FT                   RYRRAQHDRITRLDTIARQRIDEAADARRRYKSTSDPGDRRAALAPRVLTVYRTDADLR
FT                   FVDLSLNPNERPYGSLFGRRPDLTNYGLVGFGRFSTPDAWLSTWSGLSSNADFLRCAPT
FT                   VTAPTLFVELTGDQACFPDDAKTMCDALGSTDKTHVRVAGTHFGGPIHDGAPTGASLAA
FT                   ADIGAWLATRFP"
FT   gene            complement(556803..557048)
FT                   /locus_tag="RHA1_ro00476"
FT   CDS_pept        complement(556803..557048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00476"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00476"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92312"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJH4"
FT                   /protein_id="ABG92312.1"
FT                   /translation="MTTLFILDVPENTAVAEVAGRNPAVTVDHVGPYFRIVSDSAIVID
FT                   RRATGCRHAVWYSSVAGLAQSRITQWDKDAMRVEPQ"
FT   gene            complement(557045..557701)
FT                   /locus_tag="RHA1_ro00477"
FT   CDS_pept        complement(557045..557701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00477"
FT                   /product="possible glyoxalase"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00477"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92313"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJH3"
FT                   /protein_id="ABG92313.1"
FT                   /translation="MEFTMSDLQHTVKGVDHVAYPTFDPAATVTFYRDVLGFPVVHSIC
FT                   AAGWGPEKHPDFIHFFFDIGNDDRLAFFYYFGLEPFDGGPQGDSYSRFAEDVPIFFIRS
FT                   RHLAIHVDSEDDLMEYRRRLDHSAWPVEMQIQHETIESIYTHDPNGYMIEITRALRPVT
FT                   PQEDLDANLTIDALVDVVTGPDPSMAALLTRKAELITERAAAWHQEQESKEMVTR"
FT   gene            complement(557713..558627)
FT                   /locus_tag="RHA1_ro00478"
FT   CDS_pept        complement(557713..558627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00478"
FT                   /product="possible maleate cis-trans isomerase"
FT                   /note="GO_function: GO:0016855 - racemase and epimerase
FT                   activity, acting on amino acids and derivatives;
FT                   GO_function: GO:0050076 - maleate isomerase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00478"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92314"
FT                   /db_xref="GOA:Q0SJH2"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="InterPro:IPR028615"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJH2"
FT                   /protein_id="ABG92314.1"
FT                   /translation="MSRGNCECRHGCEESRGEPTLAPLGVLTNHHRRRILVIGVNLRPT
FT                   PPQKGHNMGIHRIGLVVPSSNVTVETEMPALLNRHADARFSFHSSRMRMQSVSPEQLRA
FT                   MNAQRERCILELGDAGVDAILYACLVALMSVGPGEHQRVEGLIAEQLATGGSEAAIRSS
FT                   AGALVEALHAIHAERIVLVTPYMRPLAEQVVAYIEAEGIRVTDWRALEVADNAEVGCIP
FT                   GHRVMDAARSLDRAGADALVLSACVQMPSLDLVQSAEDEFGLPVLSAATAGAYSLLRAL
FT                   DLAVDIPGAGGLLRADAPATTVQ"
FT   gene            558730..560832
FT                   /gene="hyuA"
FT                   /locus_tag="RHA1_ro00479"
FT   CDS_pept        558730..560832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyuA"
FT                   /locus_tag="RHA1_ro00479"
FT                   /product="hydantoin utilization protein A"
FT                   /note="GO_function: GO:0047423 - N-methylhydantoinase
FT                   (ATP-hydrolyzing) activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00479"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92315"
FT                   /db_xref="GOA:Q0SJH1"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJH1"
FT                   /protein_id="ABG92315.1"
FT                   /translation="MAYVIGVDVGGTFTDAVLDDDAGTVLAAKAPSTPPDYSRGVIDVL
FT                   EVLAGQLGCPIEEMLANTHHIAHGTTSSLNALVMGNVPPVGFLTTKGHRDSIYIMNVEG
FT                   RYLGGSPEQLQNVMGQSKSHGLIPKKHALEVTERLDRDGNVVVALDEESARRSIRALLA
FT                   DGITAIAVSLLWSFRNPTHEQRIRELVHEIDPTVFVSLSSEVSPRIREFARNATTIMST
FT                   QIGPGLRDYLGSLESELRDRKLAGPLLVMQSNGGAVAAAEAPKNAISTVGSVLTGGVVG
FT                   AVSLGKQLGHRNIIATDVGGTTFLVGLVVDGEPVRASSTIINHHPINVPTLEVHAIGSG
FT                   GGAIAWVDPGGNLQIGPHSAQAVPGPACYGQGGIEPTNADANLVLGILPEHGLLGGRKP
FT                   LDKDLARDAIRTKIAEPLGLSIEDAAAAIYAVQNAQTGDLLRKTVVEAGHDPRDFVLYA
FT                   FGGAGPAHCAAYAREVGVREVIVPLGQVASAFSAYGLASSNIVLAAELSDPAAMPLDPV
FT                   RAERNFAQLESQVLEQLNRQGLTFTGVEIEREIDMRYTMQLAEVATAVPAGSLDAAGIH
FT                   AASDLFEQRYAELYGKDSGFREAGIQAITYRVRATGLLPFSPTLPEVKSADSADPTPAH
FT                   IGTRKVCLDGRIGYVDTDVYDYSKLLAGHVLHGPAIIEVPTTTVVVPHDTTGTVDRLGN
FT                   LTIVAQ"
FT   gene            560844..563168
FT                   /gene="hyuB"
FT                   /locus_tag="RHA1_ro00480"
FT   CDS_pept        560844..563168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyuB"
FT                   /locus_tag="RHA1_ro00480"
FT                   /product="hydantoin utilization protein B"
FT                   /note="GO_function: GO:0016812 - hydrolase activity, acting
FT                   on carbon-nitrogen (but not peptide) bonds, in cyclic
FT                   amides; GO_process: GO:0006520 - amino acid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00480"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92316"
FT                   /db_xref="GOA:Q0SJH0"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJH0"
FT                   /protein_id="ABG92316.1"
FT                   /translation="MTMQIPGSEIFSSRPIDPDALARSLPPTLAVHTVSQEHIDNLDPL
FT                   TYEVIRHRLWSVTDEMGEALKRMSGSPIVTDANDFDFAISDEIGQEVQVGLYNTMLVGA
FT                   VDLAIYWTLQHRATNPGITEGDMFLCNDPWVGGGLHQSDVIVYQPIFHEGKLFAWTSAI
FT                   CHEPDLGGSGLGSFDPSAQDVFSESLPTPPIKVVRDYELQRDVSDAWVRRSRVPMLVGL
FT                   DLRAKIGANTVGRNRLLAVIEQYGADTVKAVMKRMMADAEGRLRGKLTSLPDGTWKATG
FT                   YQDQSHTGDRGIHKITVAMTKTADHLTFDFTGTDPQTGVINCTYAGMRGGVMLALLPIL
FT                   AGDIPWSAGGLMRCFDLVSEEGTINNATFPAAVSRGPIGPAWLTGTLIAECLSQMLDRS
FT                   VDLGTSVQAACCGTWDTAVIAGLDERPEQSVPFLNIMMEPMAGGYGARPTADGMDTGGL
FT                   FCIPMGRIPDTEMTEFLYPLLTLWRREEPDSGGPGRQRGGVSASIAITPYGTSLPMGLV
FT                   LASAGKAVAQNNGLAGGYPGNTGVEVLARGTDIVEQFAAGRIPGALDDLGGGRELGACY
FT                   AESYVAPGEVLYMHWQGGGGYGDPLLRDPAAVAADFREGKVTENGAETVYGVILSGGDV
FT                   DEIRTSDRRDEMRTERRDRSGTTRSDAPALDLAGARRLDDNLAEVTIGDTRAIACAQCG
FT                   RLLGDDKTNAALDLARFEGPSSTAGPQVTSDPREYVDAPVVFRQLCCPGCWTAIYSGIV
FT                   PADHPDHALDIARLLPAVAER"
FT   gene            563212..564927
FT                   /locus_tag="RHA1_ro00481"
FT   CDS_pept        563212..564927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00481"
FT                   /product="probable 2,3-dihydroxybenzoate-AMP ligase"
FT                   /note="GO_function: GO:0008668 -
FT                   (2,3-dihydroxybenzoyl)adenylate synthase activity;
FT                   GO_function: GO:0016874 - ligase activity; GO_process:
FT                   GO:0006826 - iron ion transport; GO_process: GO:0008152 -
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00481"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92317"
FT                   /db_xref="GOA:Q0SJG9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJG9"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92317.1"
FT                   /translation="MTFSDWGGRLVTFPADRAGHYRESGMWSADPTGRRLHRIATRFPD
FT                   RTAVISAEGSMSFAELDRRTDRIAAGLVRLGLDRLDPVIFQLTNRLETVLAWYGCLKAG
FT                   LVPVATLAAHRMHEIGHVSRKVGAVGHIVEARTAGFDLVEFAREHAAGHPSIRHIISVG
FT                   DEAGKDQPGVTRLEDIGRETDPAAARAVVEQIEARIDPLDVVAFQLSGGTTGVPKVIPR
FT                   IHAEYWNNALLYAQRLGWDEHSRVAHLIPIIHNAGISCGLHAAHSVGACLVLATADAPA
FT                   AFELMARTEATEVLIGHGHYQAVLTPDFDKARASLRRVVLSGAKVPPELFERVDDGAGH
FT                   WAGQLFGMSEGLLTVTPIDSPTHARLTTVGTPIASDDEIRILEPGTEIDLPDGDVGELC
FT                   CRGPYTIPGYFDAPEHNRDAFTSDGFYRTGDLAAITVIDGERYLSIEGRIKDLINRGGE
FT                   KINAEELELLLLEHPRIANAAVVAMPDPRLGEKTCAYLVATDEEPLSMKAIQEHLARLG
FT                   VAKFKWPERLEWVPSLPHTNVNKIDKKRLRAAIAAKVLAEAEAEAEADARGAAV"
FT   gene            565091..566674
FT                   /locus_tag="RHA1_ro00482"
FT   CDS_pept        565091..566674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00482"
FT                   /product="monooxygenase/ aromatic ring hydroxylase"
FT                   /note="bifunctional; GO_function: GO:0004497 -
FT                   monooxygenase activity; GO_process: GO:0006118 - electron
FT                   transport; GO_process: GO:0019439 - aromatic compound
FT                   catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00482"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92318"
FT                   /db_xref="GOA:Q0SJG8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJG8"
FT                   /protein_id="ABG92318.1"
FT                   /translation="MNLARVAVLGGGPGGLYAARLLKLSHPDAEVTVYEQSAPDKTFGF
FT                   GVGLASRTQRNLREADSTSLEAIVAAAHPHDMSMQVGEHIARLQSGDLLAIARTSLLEV
FT                   LQQQARQAGVRLHFGERRDIADLDADLIIAADGINSGTRTQLADRFDPHIDTGTGLYLW
FT                   CGTDFALPSAIFTPVTTEHGTFVAHAYPYAPDHSTFLIETDEDTWRRAGFDVSTEQTAP
FT                   LDSDETSLHYLQAAFAGTLQHHRLIGNRTRWMRFRTISCGHWRSGNVVLLGDAAHTAHY
FT                   SIGSGTKLAMEDAIALDHALTASPNIEDALAQYERTRRPAVEYLQHIAHRSELWWESFP
FT                   QRMNLPVEQLLIAYMTRAGKVSLSRFHDTAPTLVRKGLANYADVPADAIPSTDITDWTI
FT                   GQPLDHGDRRFEHRIAPADLRDAATTTVLDIDFDSAWGPEATALVETAPTARTLWLTGP
FT                   STRSSLLSRLDFAERLGHHTDAVVVVEAPGSCRADVAAGLASVRMHLAFFSDPATSDAD
FT                   PALSGLRVST"
FT   gene            566671..567495
FT                   /locus_tag="RHA1_ro00483"
FT   CDS_pept        566671..567495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00483"
FT                   /product="probable transcriptional regulator, TetR family
FT                   protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00483"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92319"
FT                   /db_xref="GOA:Q0SJG7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJG7"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92319.1"
FT                   /translation="MSTRPATGARYPSDMTSEEAPNERRPRGRGKSRSSDQAATESAGL
FT                   RSNPRRELVEKQIIEQATRLFAERGFASTTLQDIADATGLTRPALYHYVANKDELLSRL
FT                   VSESTETPAALLHTINERTDLGPTEKLREMATAIALHQAQAPDRFQLIIRSEAELPEDI
FT                   SRNYEQSRRHVLKEFIHVIEDGIRIGEMRPVDPRTAALAVIGMLNWIAWWHQPGNADDD
FT                   RVIATQLADMAVRSLVHQDPQSATPEGPARAIAMIRQDLNYLERLLDESRPD"
FT   gene            complement(567533..567961)
FT                   /locus_tag="RHA1_ro00484"
FT   CDS_pept        complement(567533..567961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00484"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0005554 - molecular function
FT                   unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00484"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92320"
FT                   /db_xref="GOA:Q0SJG6"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJG6"
FT                   /protein_id="ABG92320.1"
FT                   /translation="MSTPDDWNANIIAEFRANQGRVGGPFEGAPVVLVHHRGRKTGRDR
FT                   VSPMMYLPDEQGPDTIYVFASKAGAPSNPDWYYNLVSAGEAEIERGTEQYPVTVVEVTG
FT                   DERDRIYTEQARRYPGFAEYAEKTAGIRTIPVLALRRA"
FT   gene            complement(568128..568571)
FT                   /locus_tag="RHA1_ro00485"
FT   CDS_pept        complement(568128..568571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00485"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00485"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92321"
FT                   /db_xref="InterPro:IPR009317"
FT                   /db_xref="InterPro:IPR037205"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJG5"
FT                   /protein_id="ABG92321.1"
FT                   /translation="MCFPGSLLPIPGPGARCFPGLHRWQATVETRFDACDSRCRVPCAD
FT                   PARRRPAAEIGKPGQPGTAAMVPGGQSRGTSRPRPRRSGAVNRTELPQTLRRSSKEVQA
FT                   AFAAAHEMAVRRYGEGEEAQRAAYGELKQSYELATDHWVPKQD"
FT   gene            568553..568879
FT                   /locus_tag="RHA1_ro00486"
FT   CDS_pept        568553..568879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00486"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92322"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJG4"
FT                   /protein_id="ABG92322.1"
FT                   /translation="MTPENTQQRQFHSRRREVLTRGDSMPVSPHTLLQHVQDRTTDLRR
FT                   WLDTGENTAALTAYLRDEPVDHRWLTTYKQLTHDLLRAVDHACPPSAPHETQAPNAGRP
FT                   PDRR"
FT   gene            complement(569140..570432)
FT                   /locus_tag="RHA1_ro00487"
FT   CDS_pept        complement(569140..570432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00487"
FT                   /product="probable transcriptional regulator, LuxR family
FT                   protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0000156 - two-component response regulator
FT                   activity; GO_function: GO:0003700 - transcription factor
FT                   activity; GO_function: GO:0005524 - ATP binding;
FT                   GO_process: GO:0000160 - two-component signal transduction
FT                   system (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00487"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92323"
FT                   /db_xref="GOA:Q0SJG3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJG3"
FT                   /protein_id="ABG92323.1"
FT                   /translation="MEDSARLQVDPWVEMRKVITGPLPDIATRFSRFLGRWWPHDALVI
FT                   FTRECTGRPRKVAGNREIVDRVTIDELDEIKQSIEPGGVVAGIRSLGGGRRRVWAVRDS
FT                   GDTLLVLVPRPSQAGPPEPDGVAAMFGIVATSIQQQVAQASPDYLAESRAASSERARTI
FT                   AELTEVHEATLSSILGTLRSNDLDDRRSRITASETASAALIALRSAGAADRALSEEAVT
FT                   TAFARLQGELRPLLRHREVDVDYVDPPADGRPLPGEVAHAARAMVRAIVLAFGAQPVLA
FT                   RLRIAWDCDGDNVLIEVRDQGPGTIDRNALTRQLSGRLHTLRGRIDIESIAGWGSRVTL
FT                   TIPLDPPAARPDEHLLSTLNPRELEVLAHLAVGKRNRAIAEELGISQSTIKFHVASVLE
FT                   KLDVANRGEAGAIGIRAGIAPGIAYSAPGTS"
FT   gene            570580..571161
FT                   /locus_tag="RHA1_ro00488"
FT   CDS_pept        570580..571161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00488"
FT                   /product="possible 6-phospho-3-hexuloisomerase"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_function: GO:0004590 - orotidine-5'-phosphate
FT                   decarboxylase activity; GO_function: GO:0005529 - sugar
FT                   binding; GO_function: GO:0016853 - isomerase activity;
FT                   GO_process: GO:0005975 - carbohydrate metabolism;
FT                   GO_process: GO:0006207 - 'de novo' pyrimidine base
FT                   biosynthesis; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00488"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92324"
FT                   /db_xref="GOA:Q0SJG2"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR017552"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJG2"
FT                   /protein_id="ABG92324.1"
FT                   /translation="MTITVEQTRTRFSDGRRIVLDENERLLNSVAAEQWDRAGSLITTA
FT                   RAVFVIGNGRSGLAVQMAAMRLMHLGLRVHVAGEVTGPAIGDGDLLIAVSGSGTTASVV
FT                   GAADTANKVGASVLAVTTASDSPLARRADEILVLPAADKQDHSAAITAQYAGSLFEQSV
FT                   LLAFDALFQALWSNEDQTAERLWERHANIG"
FT   gene            571198..571818
FT                   /locus_tag="RHA1_ro00489"
FT   CDS_pept        571198..571818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00489"
FT                   /product="probable 3-hexulose-6-phosphate synthase"
FT                   /note="GO_function: GO:0004590 - orotidine-5'-phosphate
FT                   decarboxylase activity; GO_function: GO:0004750 -
FT                   ribulose-phosphate 3-epimerase activity; GO_function:
FT                   GO:0004789 - thiamin-phosphate diphosphorylase activity;
FT                   GO_function: GO:0004807 - triose-phosphate isomerase
FT                   activity; GO_function: GO:0005529 - sugar binding;
FT                   GO_function: GO:0016832 - aldehyde-lyase activity;
FT                   GO_process: GO:0005975 - carbohydrate metabolism;
FT                   GO_process: GO:0006207 - 'de novo' pyrimidine base
FT                   biosynthesis; GO_process: GO:0009228 - thiamin
FT                   biosynthesis; GO_process: GO:0019647 - formaldehyde
FT                   assimilation via ribulose monophosphate cycle"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00489"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92325"
FT                   /db_xref="GOA:Q0SJG1"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJG1"
FT                   /protein_id="ABG92325.1"
FT                   /translation="MTKLQVAVDLLTTADALALTNKVAPYVDIIELGTPLIKSAGLSAI
FT                   SAIKAAHPDKEVFADLKTADAGFLEADLAFSAGADLVTVLGAAGDATIKGAVEAGQKHG
FT                   KKVVADLIGVENRVERAREIAKLGVAFVEIHAGLDEQAQPGYSIQTLLDDGKIAGVPFS
FT                   VAGGVKVDTIAAVRDAGADVAVAGGAIYSAEDPPRPRRHSRKH"
FT   gene            complement(571876..572241)
FT                   /locus_tag="RHA1_ro00490"
FT   CDS_pept        complement(571876..572241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00490"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92326"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJG0"
FT                   /protein_id="ABG92326.1"
FT                   /translation="MIVGAIETGCAAPRCGTRRGGSACIPTAAGFNQGATCTSRLSSQV
FT                   SGVSGRGMPWRTLISVAIERLVDQPARGAVGRWPPNQAWRPARRHDHSRGSRHLLPAEN
FT                   PSRLSAPGRNLTRGAKE"
FT   gene            572304..572594
FT                   /locus_tag="RHA1_ro00491"
FT   CDS_pept        572304..572594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00491"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00491"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92327"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJF9"
FT                   /protein_id="ABG92327.1"
FT                   /translation="MTTHTHLTTDHEEVRQWTQAHHGIPARVPHTTAGDVLRIDLHGVD
FT                   SGLEHISWTEWFAAFDQQGLALSYPDPHLQGGISAWFELVPRPRSRTADGP"
FT   gene            complement(573199..574596)
FT                   /locus_tag="RHA1_ro00492"
FT   CDS_pept        complement(573199..574596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00492"
FT                   /product="malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /note="GO_function: GO:0016597 - amino acid binding;
FT                   GO_function: GO:0016619 - malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) activity; GO_process:
FT                   GO:0006108 - malate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00492"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92328"
FT                   /db_xref="GOA:Q0SJF8"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJF8"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92328.1"
FT                   /translation="MPSPSPGYSITVRVHAPVGAGTTSTLAAAIASVKGAMTALDVVES
FT                   HPDHMVIDLTCDASDVAHADQISTAIAEVPGVIVGKVSDRTFLLHLGGKLEVVPTVPLK
FT                   HRDDLSRAYTPGVARVCTAIAEHPEDVRRLTIKRNTVAVVTDGSAVLGLGNIGAAASIP
FT                   VMEGKAALFKQFAGVDAWPVCLDTQDPDAIVEIVRALAPVYGGINLEDISAPRCFEIEA
FT                   RLRDILDIPVFHDDQHGTAIVVLAALTNALRVVGKSLDRARIVVSGVGAAGHAVIRLLV
FT                   AQGATNIIGCGRKGILSPDDTADEFRTWIAEHTNPEGRTGSLRDALVGADVFIGVSAPN
FT                   IVTGDDIAAMADESIVFALANPVPEVDPVAAGEHATVVATGRSDFPNQINNVLAFPGVF
FT                   RGLLDAHAVDITDEMLIAAAGAIADRVSPSELNATYIVPSVFDAGVAPAVAAAVREVAE
FT                   RGPQSEK"
FT   gene            574938..575312
FT                   /locus_tag="RHA1_ro00493"
FT   CDS_pept        574938..575312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00493"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00493"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92329"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJF7"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92329.1"
FT                   /translation="MSAQQNIETAKNGYAAYSAGDAEKAMSFFDDDIEWISPGNSTVSG
FT                   TFHGKPEVGAMWMKLAEKSTTTTPERFLADDDVVVVLTRVAAGGESADEADVLTFRDGK
FT                   VVKFQSAADTAMLERVFGTK"
FT   gene            575430..575678
FT                   /locus_tag="RHA1_ro00494"
FT   CDS_pept        575430..575678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00494"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92330"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJF6"
FT                   /protein_id="ABG92330.1"
FT                   /translation="MPSNWPQDHTIIGRRRSLPRKQHTPLPDRATRIAQSVAGARCEGL
FT                   SAGPAAQPRGHWVTRAPTRPTGTTCSDGRSTELAVRR"
FT   gene            complement(575901..576155)
FT                   /locus_tag="RHA1_ro00495"
FT   CDS_pept        complement(575901..576155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00495"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92331"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJF5"
FT                   /protein_id="ABG92331.1"
FT                   /translation="MWQRNSTMMWWSRRSRCPGCGPARRRGQLDDGKLGMWRDPATDRR
FT                   VAVWVPLWSSPNGRPTRQEALRSFWSPGAHCQFQKGTRT"
FT   gene            576172..576450
FT                   /locus_tag="RHA1_ro00496"
FT   CDS_pept        576172..576450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00496"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92332"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJF4"
FT                   /protein_id="ABG92332.1"
FT                   /translation="MRHRCAVVVTQALRDCRHRCRRLRLSAGPVVVRRDRRPRHRPRCP
FT                   VADLLKPPGDQLPPGRLVELPTLLGCQPRRQHGCPTRTMLPAFRTGQ"
FT   gene            complement(576654..577022)
FT                   /locus_tag="RHA1_ro00497"
FT   CDS_pept        complement(576654..577022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00497"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00497"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92333"
FT                   /db_xref="InterPro:IPR012544"
FT                   /db_xref="InterPro:IPR037063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJF3"
FT                   /protein_id="ABG92333.1"
FT                   /translation="MQTLQPIFDKREQLAQIQSGLLQGESVIAVYDCIGTGTGFVALTD
FT                   RRVILQDRSFVGNKTAITSIPYGKIRSVSVVSNKSWAGAFFSGGSIAIDAGKVHTAEFR
FT                   GMDKSRHVHDVILWHITR"
FT   gene            complement(577477..577830)
FT                   /locus_tag="RHA1_ro00498"
FT   CDS_pept        complement(577477..577830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00498"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00498"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92334"
FT                   /db_xref="InterPro:IPR007969"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJF2"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92334.1"
FT                   /translation="MFTSLKKSAVGAAAVAAVLGAAALGAVGTANATSYLSPEETYLTA
FT                   LDAEGISYGSSYYAVGFGYEICGDFESGYGFFEMTEAYLNKSDYYYTPYEVGFFIGDAV
FT                   GAFCPQYAYEIPA"
FT   gene            578540..578851
FT                   /locus_tag="RHA1_ro00499"
FT   CDS_pept        578540..578851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00499"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92335"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJF1"
FT                   /protein_id="ABG92335.1"
FT                   /translation="MSVDGDGAGRIDVLVLPAKGATLKPRRAARPLMDVLVDRLRIRRD
FT                   LPVHGAMRGGVEPEPVDAAFLPLGPAPGRAELAETVTRFYSDSDKRHPRSFSYLPSYS"
FT   gene            578865..579317
FT                   /locus_tag="RHA1_ro00500"
FT   CDS_pept        578865..579317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00500"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92336"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJF0"
FT                   /protein_id="ABG92336.1"
FT                   /translation="MFPTFVKSTARVATATPAPRIAGSIKRHTGLRAAICVGATIPLAL
FT                   FGHGIASAAGTVEIYGNAGEVDVYVTDGTPGENCLVNDNGYTFGGVVDDAGYLDFYIPA
FT                   EPGDHQVTVACDPQRRLRPMGHGRTHRPRTRTGPGPSPRTCPGLLG"
FT   gene            579668..579907
FT                   /locus_tag="RHA1_ro00501"
FT   CDS_pept        579668..579907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00501"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92337"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJE9"
FT                   /protein_id="ABG92337.1"
FT                   /translation="MTDSPPAANGGREAFVQRVEYLAEKCGERFPRRRREATIRDQARS
FT                   TGSWTVVRVVGYRLRKPESQLGRRHRFSWGEVAP"
FT   gene            complement(579924..580337)
FT                   /locus_tag="RHA1_ro00502"
FT   CDS_pept        complement(579924..580337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00502"
FT                   /product="transposase"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0004803 - transposase activity; GO_process: GO:0006313 -
FT                   DNA transposition"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00502"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92338"
FT                   /db_xref="GOA:Q0SJE8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJE8"
FT                   /protein_id="ABG92338.1"
FT                   /translation="MGWSIADHMRTELVTDAIEMAVRTRGGDVGGVIFHSDRGSQYTAA
FT                   SFVDVCRRHGIQQSRGRVGSSYDNALAESFFQGLKREWLHGRSWTSKSQARLELFEWLS
FT                   YFNRRRRHSALGYLTPVEFEQRLIASSTLSVAA"
FT   gene            complement(580820..581146)
FT                   /locus_tag="RHA1_ro00503"
FT   CDS_pept        complement(580820..581146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00503"
FT                   /product="probable transposase"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_function: GO:0004803 - transposase activity;
FT                   GO_process: GO:0006313 - DNA transposition; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent;
FT                   GO_process: GO:0006412 - protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00503"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92339"
FT                   /db_xref="GOA:Q0RW71"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RW71"
FT                   /protein_id="ABG92339.1"
FT                   /translation="MGRQSLYTEEFRKDAVALYRAADGKRTYADVAADVGVSGETLRTW
FT                   VRKDTAARNARSQDRSTGADGTEADELARLRAENARLRGAEKEWQLEREILRRAAAYFA
FT                   KEVK"
FT   gene            581276..582679
FT                   /locus_tag="RHA1_ro00504"
FT   CDS_pept        581276..582679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00504"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0005615 - extracellular space;
FT                   GO_function: GO:0008658 - penicillin binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00504"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92340"
FT                   /db_xref="GOA:Q0SJE6"
FT                   /db_xref="InterPro:IPR004043"
FT                   /db_xref="InterPro:IPR036609"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJE6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92340.1"
FT                   /translation="MSENPGSPGGPHWQPSGPEWQPQAQQWQPHAQQWPPAGGQPPGPP
FT                   PPPPPRRSPGGGRWPLLVGLIAAVLIGLLVGGYLLFVRGDADEGEVLLEAAASEGPFPW
FT                   TPPVVPPDAPTTLPESMPTMAPSAPDPGRPGLIAVPGDRTGIYGGSLELSVCDKPKLIG
FT                   FLEQNPGQRAAFGEVLGITDVRAFVESLTPVILGSDTRVTNHGYENDRPTPLQSVLQAG
FT                   TAVLVDDRGVPRVRCQCGNPLLPPQPTKAAPTYTGQRWPGFEPDKIVVVQSAPTPVTQL
FT                   TVINIVTGAPVVINVGSGTPQQPTTTPTRTTTAPPPPLRTTAAPPPPLRTTVAPPPPLR
FT                   TTAAPPPPPRTTMAPPPRTQPPTTQALPPADWSTTAEAFRGQDGGRASFDCPPGGTFGS
FT                   VWGSGTYTDDSSVCTAGVHAGVISQQSGGVVIIEISPGLGSYQGSTANGVTSQDWGNWY
FT                   GSFQVAGGG"
FT   gene            complement(582702..584561)
FT                   /locus_tag="RHA1_ro00505"
FT   CDS_pept        complement(582702..584561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00505"
FT                   /product="serine/threonine-protein kinase"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0004674 - protein serine/threonine kinase
FT                   activity; GO_function: GO:0004713 - protein-tyrosine kinase
FT                   activity; GO_function: GO:0005524 - ATP binding;
FT                   GO_process: GO:0006468 - protein amino acid
FT                   phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00505"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92341"
FT                   /db_xref="GOA:Q0SJE5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR035016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJE5"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92341.1"
FT                   /translation="MGGAELEPGDVFAGYTIQRVLGVGGMGAVYLARDPHLPRNTALKL
FT                   LDRSLTTDDCFRSRFELEADHAARLEHPNIVSVFDRGREANQHWIAMQYVAGTDAAVAL
FT                   REGPMDPPRAVHIVAETAKALDYAHENGVLHRDVKPANILLGMSGAGQPERVLLTDFGI
FT                   AKALDETQHLTRTGSLVATLQYSAPEAFQGIPLDLRADVYSLGCTLFCLLTGHPPFTGS
FT                   TQEVMRGHLCGPVPRISAVRGDLPPTFDDIVSAALTKRREDRLPSCHALSAGVQLALSR
FT                   MQSAQTAKQILTRRQTANVHAAPDTPTSRQPTPRRQGQQLPPLAPQPPPPQRNSVPPRR
FT                   KRAGVLLALALLALLAVGAAVVFVSWPNRSATQTTLPFEGLDYPVGVAVNTAGDLVVAD
FT                   SNNNRVLRLAAGAGAQEVLPFTDLDHPSGVATNGAGDVFVADTRNNRVLELAAGATTQT
FT                   VLPFTGLAGPAGVAVSDAGHLFVADNNNNRIVALPAGAASPQVLPLSDLHGPVGVAVNS
FT                   GGDVFVTDTDNNRVLFLPAGATDQTVLPFTGLASPTGVAADSTGVFVADYGGGRVVALR
FT                   AGADTPAVVRFTGLHGPIWVAVTATGDLVVTDGDRVLQLSGDG"
FT   gene            584926..585216
FT                   /locus_tag="RHA1_ro00506"
FT   CDS_pept        584926..585216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00506"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92342"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJE4"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92342.1"
FT                   /translation="MPATVNDPSSSNTGAILTPVIRSTNANTPLDVLVLAAAARSLVSS
FT                   IPPLSRTSATRDSGAVPTSDHVTTTLSVSSQKFAGSKPFAPQLVVPEASAL"
FT   gene            585344..586147
FT                   /locus_tag="RHA1_ro00507"
FT   CDS_pept        585344..586147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00507"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00507"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92343"
FT                   /db_xref="GOA:Q0SJE3"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJE3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92343.1"
FT                   /translation="MGCVPPLSLWKRLYLLCTRPDGLVAEYDELGALVRAGVLAELYLT
FT                   GEVADRKGHAVIESTPVLPGALEQHLIAQISASHPRTWEHWIGTDPRPTERLARDQLVS
FT                   ETIVATEQRRSLGMVPYTRYRASDLELRARLRAAVEDTLRAAKADEPDHDAITRAAQGA
FT                   LSMLPDNAKSLPRTQQHELLAELRERAESSLRASHPRGQGRAVTDTDAVYAALSVRIPY
FT                   RCKHFQVEGDYHDQILSFSKRIGPIAPALSSALRTMKWTRAASFT"
FT   gene            586384..586752
FT                   /locus_tag="RHA1_ro00508"
FT   CDS_pept        586384..586752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00508"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00508"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92344"
FT                   /db_xref="InterPro:IPR007969"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJE2"
FT                   /protein_id="ABG92344.1"
FT                   /translation="MKRTRHVPQTVKSVKSAARVATVTAVLGVAAVGGVGVANATSYAP
FT                   EEVYLTALDEEGIPYDSAYYAVALGYAVCGDFESGYDFYDIGLDFLSESSYSPYEAGFI
FT                   IADAVTVYCPQYTYALPA"
FT   gene            complement(586934..588067)
FT                   /locus_tag="RHA1_ro00509"
FT   CDS_pept        complement(586934..588067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00509"
FT                   /product="probable transcriptional regulator, EmbR family
FT                   protein"
FT                   /note="GO_function: GO:0000156 - two-component response
FT                   regulator activity; GO_function: GO:0003677 - DNA binding;
FT                   GO_function: GO:0005524 - ATP binding; GO_process:
FT                   GO:0000160 - two-component signal transduction system
FT                   (phosphorelay); GO_process: GO:0006915 - apoptosis;
FT                   GO_process: GO:0009405 - pathogenesis; GO_process:
FT                   GO:0017000 - antibiotic biosynthesis; GO_process:
FT                   GO:0042829 - defense response to pathogen"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00509"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92345"
FT                   /db_xref="GOA:Q0SJE1"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJE1"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92345.1"
FT                   /translation="MDGTQPGTGLHFDVLGPVQMTIDGIAPPLGGPKQRAVLAALIINR
FT                   NHPVSAEALADRVWNHRPPPEARASLQVFISNLRRILRHAGVDARAVLASAPPGYRLIV
FT                   PDQGCDLGRFLAEKRAGTQAAAARRFEDASGHLAAALAEWKGPALDDLRDLEFAETFAA
FT                   AIEEEKVSALAARAEAEIVCGRAEAVIPELVSLASVYPHREPLWGQLITALYVCGRQSD
FT                   ALEACRRLRSNLAEELGIDPGRDLLELEGRILRQESLAVTETALATAAHTVTVLETLER
FT                   ALAAQLRDRQGHVFRIGSAGVRIGRMPDNDIVLAQGKVSRHHTIIVDTGMNFVLRDLRS
FT                   SNGVYVGGNRVVDSVWLVDGDIIRIGDTELEFQIVLE"
FT   gene            588251..589051
FT                   /locus_tag="RHA1_ro00510"
FT   CDS_pept        588251..589051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00510"
FT                   /product="possible serine/threonine protein kinase"
FT                   /note="GO_function: GO:0004674 - protein serine/threonine
FT                   kinase activity; GO_function: GO:0004713 - protein-tyrosine
FT                   kinase activity; GO_function: GO:0005524 - ATP binding;
FT                   GO_process: GO:0006468 - protein amino acid
FT                   phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00510"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92346"
FT                   /db_xref="GOA:Q0SJE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJE0"
FT                   /protein_id="ABG92346.1"
FT                   /translation="MGEHGILRPSEVFAGYTIERVVGVGGMGTVYAAAHPRLPRRIALG
FT                   CRVLAAVGAGRDPELWTRNRNVVTAAYPEVGEVHGRRSAGPQDIHRFHALLRPPWGVDD
FT                   RAVHRRRWPANPPPPCGGVRVHGRRVLAADPHLTLELGRIVGFGSGLAVYLTLTVTGIP
FT                   AERARHETRTLTDPADRSARWSYLGVCAGADRIAVADPYLAHPDLQACTAGLCTYRTEP
FT                   QYWIDTPAPVRSVTLTAGWPQIGLAPTVATLTLARRDHVSTNRR"
FT   gene            589089..591329
FT                   /locus_tag="RHA1_ro00511"
FT   CDS_pept        589089..591329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00511"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0000155 - two-component sensor
FT                   activity; GO_function: GO:0005554 - molecular function
FT                   unknown; GO_process: GO:0000160 - two-component signal
FT                   transduction system (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00511"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92347"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJD9"
FT                   /protein_id="ABG92347.1"
FT                   /translation="MGFDSADPDLWRSVFERATDLVMVSDFVSGRIMFLNSAGIRLVGL
FT                   HDDADARARTTAEFLTDAGLAQTPEVEAALTCDGHWEGISELRHFGTGAPIPVSISTFT
FT                   VRDGEAGPAVIAIIARDRRHRRTHDRRFRKALDEAAHRAREQHALAELGQLAVDADLDT
FT                   LLPAATGAAASLIGVQCASISRITDTDALEVLAYRGHPPQPRSFATGSASQPGYALATG
FT                   EVVVCPNRQQETRFATTTMAGRGLRSGISVPIGDGTRWGVLTVHSAHPRDYTDRDVAFL
FT                   RAVAAVLSAAIGRIDTETRVRQQSSRDPLTGLPNRTAAYRRITAALHTAHQDHTLLALL
FT                   LVDLDDFKVVNDSLGHAHGDAALIRLAERLVGAVRPADTVARLGGDEFVLVCEDIGTAD
FT                   AATALADRITTALRTPDHSARTPVPLRASIGIALSDQTCTADELIRRADLAMYRAKSAG
FT                   AGGHALYHPGDRDSYDADRVLRMSTDLRTALDRDQLTLLYQPIVDLRNGAVVAVEALVR
FT                   WAHPTLGNISRTEFVAVAERTGLIGPLGSWGLRTACRQGVAWPTHPGTDVRVHVNVSTV
FT                   QLRDPIFADQVADILADTGLPAHRLGLEISETASASVTARTVGILTALHELGVVLLLDH
FT                   LGTGHGPLGYLIRYPIFDSLKIDRSYITALPGPRPEAVVTAFVTIARAYGATVIGNGVE
FT                   TRIQLDTLHACGCDLAQGSYLAEPAPADAIPAQQRDHRAGTDAPKPAPPPAH"
FT   gene            complement(591665..591919)
FT                   /locus_tag="RHA1_ro00512"
FT   CDS_pept        complement(591665..591919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00512"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92348"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJD8"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92348.1"
FT                   /translation="MTTSRRITKVVFQNILPQDRTVWRTAAAAAQPTALDPTVLADDVP
FT                   VVRVDPIIALHDVLGSPGPDAAEAAEHLRGAILDGTWRG"
FT   gene            complement(591932..592336)
FT                   /locus_tag="RHA1_ro00513"
FT   CDS_pept        complement(591932..592336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00513"
FT                   /product="possible dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00513"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92349"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJD7"
FT                   /protein_id="ABG92349.1"
FT                   /translation="MLTPALAVDIGERGITVNAVAPAALDTDMNARWLRGDDHARATAA
FT                   STTALRQLATPDDIACGRMFPARTTDFSLFRQVEEPTARRARPRAQRNDTRCGAGCRSR
FT                   RLLRRQPDGCHAANPKLEPSTSYRTGSKCC"
FT   gene            complement(592440..592823)
FT                   /locus_tag="RHA1_ro00514"
FT   CDS_pept        complement(592440..592823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00514"
FT                   /product="possible short-chained dehydrogenase"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00514"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92350"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJD6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92350.1"
FT                   /translation="MHIGRRVALVTGGQPRHRGGRRTCGDRLRRRRIVHYGSDRTAAAA
FT                   AMDDSNTAAGHLAPAVQADLSRPEGPETLMRKFDSELNGLGLDRGLDILVNNAGINRCG
FT                   ALERVTVEDFDRLARSTSESRSS"
FT   gene            complement(592826..593866)
FT                   /locus_tag="RHA1_ro00515"
FT   CDS_pept        complement(592826..593866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00515"
FT                   /product="probable 4-hydroxy-2-oxovalerate aldolase"
FT                   /EC_number="4.1.3.-"
FT                   /note="GO_function: GO:0016829 - lyase activity;
FT                   GO_process: GO:0009399 - nitrogen fixation; GO_process:
FT                   GO:0019439 - aromatic compound catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00515"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92351"
FT                   /db_xref="GOA:Q0SJD5"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR012425"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017629"
FT                   /db_xref="InterPro:IPR035685"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SJD5"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92351.1"
FT                   /translation="MSTTTPTADDDDVTLYIQDVTLRDGMHATRHHITPENVAVIAGAL
FT                   DSAGVDAIEVSHGDGLAGHSLTYGPGSNTDWEWIEAAAAVVHCAKLTTLLLPGIGTVAE
FT                   LKRARALGVQSVRVATHCTEADVSAQHISTARELGMDVSGFLMMSHLAEPQQLAEQAKL
FT                   MESYGAHCVYVTDSGGRLTMDGVRQRVRAYRDILDAETQIGIHAHQNLSLSVANSVVAV
FT                   EEGVTRVDASLAGHGAGAGNCPIEPFVAVADLHGWKHNCDLFALQDAADDVVRPLQDRP
FT                   VQVDRETLTLGYAGVYSSFLRHAETAAKQYGLDTRQILLAVGERGLVGGQEDLITDIAL
FT                   DLAARQ"
FT   gene            complement(593863..594810)
FT                   /locus_tag="RHA1_ro00516"
FT   CDS_pept        complement(593863..594810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00516"
FT                   /product="acetaldehyde dehydrogenase"
FT                   /EC_number="1.2.1.10"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0008774 - acetaldehyde dehydrogenase (acetylating)
FT                   activity; GO_function: GO:0051287 - NAD binding;
FT                   GO_process: GO:0006520 - amino acid metabolism; GO_process:
FT                   GO:0015976 - carbon utilization"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00516"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92352"
FT                   /db_xref="GOA:Q0SJD4"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR003361"
FT                   /db_xref="InterPro:IPR015426"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SJD4"
FT                   /protein_id="ABG92352.1"
FT                   /translation="MSTTKVAVIGSGNIGTDLVIKLEQVAKNVEIAVLVGIDPASDGLA
FT                   RARRLGISTVDTGVQGLIEHPEFDDIEIIFDSTSAKAHLTNAEALRPYGKHLIDLTPAA
FT                   IGPYVVPAVNLDQHLGAPDVNMVTCGGQATIPIVAAISKVTDVHYAEIVASIASKSAGP
FT                   GTRANIDEFTETTAKAIEEVGGAAHGKAIIVLNPADPPLIMRDTVLALVSNPDQDAIRQ
FT                   SITDMVATVAAYVPGYRLKQDVQFTELGGADTVATLTGGADIGSPVWKVSVFLEVEGAA
FT                   HYLPAYAGNLDIMTSAALQVAEKLAERTALEIAR"
FT   gene            complement(594829..595629)
FT                   /locus_tag="RHA1_ro00517"
FT   CDS_pept        complement(594829..595629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00517"
FT                   /product="probable 2-oxopent-4-enoate hydratase"
FT                   /EC_number="4.2.1.80"
FT                   /note="GO_function: GO:0008684 - 2-oxopent-4-enoate
FT                   hydratase activity; GO_process: GO:0006725 - aromatic
FT                   compound metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00517"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92353"
FT                   /db_xref="GOA:Q0SJD3"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJD3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92353.1"
FT                   /translation="MTSVRPVDNHLIEDAAARLADAERAGAPCTPVRDLIGRTDIDTAY
FT                   RVQTRNVDAAVAAGHRIVGRKIGLTSPAVQAQLGVDQPDFGVLFDHMDVSSELQVRRSR
FT                   MLQPRIEAEIAFILSRDITDPITSEDAPEYVAQVVASFEIVDSRIADWDISLADTIADN
FT                   ASSGLYVLGASIPRTQAPDLSAISMTMTENGTEVSSGVGADCLGSPWNALVWLANTSLS
FT                   YGSPLRAGEVVLSGALGPMVPVVAGATYAASITGIGDVRVSFTD"
FT   gene            complement(595673..596617)
FT                   /locus_tag="RHA1_ro00518"
FT   CDS_pept        complement(595673..596617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00518"
FT                   /product="3-(2,3-dihydroxyphenyl) propionic acid
FT                   dioxygenase"
FT                   /EC_number="1.13.11.-"
FT                   /note="GO_function: GO:0008198 - ferrous iron binding;
FT                   GO_function: GO:0016702 - oxidoreductase activity, acting
FT                   on single donors with incorporation of molecular oxygen,
FT                   incorporation of two atoms of oxygen; GO_process:
FT                   GO:0006118 - electron transport; GO_process: GO:0006725 -
FT                   aromatic compound metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00518"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92354"
FT                   /db_xref="GOA:Q0SJD2"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR023789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SJD2"
FT                   /protein_id="ABG92354.1"
FT                   /translation="MPVALCTMSHSPLMGRNDPAQTVIDDVDAAFENARTFIADFAPDL
FT                   IVIFAPDHYNGVYYDLMPPFCIGAAAQSVGDYGTESGPLNVDRDAAYTVAREVLASGVD
FT                   VAFSERMHVDHGFAQALQLLVGSITAVPTVPIFINSVAEPLGPVSRVRLLGEAVGRAAA
FT                   NLDKRVLFVGSGGLSHDPPVPQFATAPTEVKEKLIDGRNPTEAERNAREQRVIDAGRDF
FT                   AAGVATIAPLNPEWDRNLLDVLTSGEIEQIDSWTNEWFVEQAGHSSHEVRTWIAAYAAM
FT                   SAAGKYRVTSTFYREIPEWIAGFGISTAVAVDE"
FT   gene            complement(596738..597607)
FT                   /gene="ohpC"
FT                   /locus_tag="RHA1_ro00519"
FT   CDS_pept        complement(596738..597607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ohpC"
FT                   /locus_tag="RHA1_ro00519"
FT                   /product="2-hydroxy-6-ketonona-2,4-dienedoic acid
FT                   hydrolase"
FT                   /EC_number="3.7.1.-"
FT                   /note="GO_function: GO:0016787 - hydrolase activity;
FT                   GO_process: GO:0019439 - aromatic compound catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00519"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92355"
FT                   /db_xref="GOA:Q0SJD1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJD1"
FT                   /protein_id="ABG92355.1"
FT                   /translation="MTRPYTSVWNDLNQVEFSQGFIQAGPYRTRYLHAGDTSKPALILL
FT                   HGITGHAEAYVRNLAAHAEHFNVWAIDFIGHGYSSKPDHPLEIKHYIDHVLQFMDAIGV
FT                   EKASFSGESLGGWVTAQFAHDHPEKVERIVLNTMGGTMANPKVMERLYTLSMEAAKDPS
FT                   WERVQARLEWLMADPAMVTDDLIRTRQAIFQQPDWLKACEANMALQDPETRKRNMITDA
FT                   TLEGITAPALMLWTTKDPSGPVDEAKRIASHIPGAKLAIMENCGHWPQYEDADTFNQLH
FT                   LDFLLDRA"
FT   gene            complement(597604..599514)
FT                   /gene="ohpB"
FT                   /locus_tag="RHA1_ro00520"
FT   CDS_pept        complement(597604..599514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ohpB"
FT                   /locus_tag="RHA1_ro00520"
FT                   /product="3-(2-hydroxyphenyl) propionic acid monooxygenase"
FT                   /note="GO_function: GO:0008270 - zinc ion binding;
FT                   GO_function: GO:0015036 - disulfide oxidoreductase
FT                   activity; GO_function: GO:0016788 - hydrolase activity,
FT                   acting on ester bonds; GO_function: GO:0018662 - phenol
FT                   2-monooxygenase activity; GO_function: GO:0018666 -
FT                   2,4-dichlorophenol 6-monooxygenase activity; GO_process:
FT                   GO:0006118 - electron transport; GO_process: GO:0019439 -
FT                   aromatic compound catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00520"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92356"
FT                   /db_xref="GOA:Q0SJD0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJD0"
FT                   /protein_id="ABG92356.1"
FT                   /translation="MTDMSDHDRTSYDTDVVIVGLGPAGGTAALALATYGLRVHAVSMF
FT                   PWVANSPRAHITNQRAVEVLRDLGVEDEARKYATPWDQMGDTLFTTSLAGEEIVRMQTW
FT                   GTGDTRYGDYLSGSPCTMLDIPQPLMEPVLIKNAAERGAIISFHTEYLDHTQDADGVTV
FT                   RFRDVRSGTEFTQRARFLLGFDGARSKIAEEIDLPFQGKLARAGTAYVLFNADLSKYVA
FT                   HRPSILHWIVNSKAGFGEIGMGLLRAIKPWNQWIAGWGFDMAKGQPDVSDDVVLEQIRT
FT                   LVGDPHLDVEIVSRSFWYVNQQYAEHYQSGRVLCGGDAVHRHPPSSGLGSNTSIQDAFN
FT                   LAWKVAFVVKGYAGQGLLESYSPERVPVGKQIVARANQSRKDYAGLREWFDSGSDDPVA
FT                   AGLEKLKEPTPEGVALREQLYEALEVKNTEFNAHGVELNQRYASSAVVPDPEAGDEVWA
FT                   RDRQLYLQATTRPGAKLPHAWLVGADGTRISTLDVTGKGMMTLLTGIGGQAWKRAAAKL
FT                   DVPFLRTVVVGEPGTIDPYGYWRQIRDIDEAGALLVRPDGYIAWRHSAPVWDDSEALTS
FT                   LEDALTAVLDRPSGSSAPAPDATQEPQYNTQAVPITVPHTTPADAAPASATSTTTEGVN
FT                   R"
FT   gene            complement(599519..600925)
FT                   /locus_tag="RHA1_ro00521"
FT   CDS_pept        complement(599519..600925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00521"
FT                   /product="metabolite transporter, MFS superfamily protein"
FT                   /note="tc: 2.A.1.6; GO_component: GO:0016021 - integral to
FT                   membrane; GO_component: GO:0019866 - organelle inner
FT                   membrane; GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport; GO_process: GO:0046677
FT                   - response to antibiotic"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00521"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92357"
FT                   /db_xref="GOA:Q0SJC9"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJC9"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92357.1"
FT                   /translation="MSNTSASSTKPAATSPLRVAMASFIGTTVEYYDFFIYGTAAALVF
FT                   PTLFFPDVSPAIGILLSFATFGVGFLARPLGGIVFGHFGDRVGRKKMLVISLVGMGSAT
FT                   VLMGLLPGYAQIGIAAPILLTLLRLVQGFAVGGEWGGATLMAVEHAPTAKKGFFGSFSQ
FT                   MGAPAGTSVATLAFFAVSQLPDEQFLSWGWRLPFLFSAVLIVIGLFIRLSLTESPDFAE
FT                   VKAQSAVVRMPIAEAFRKHWKEILLIAGTYLSQGVFAYICMAYLVSYGTTVAGISRTFA
FT                   LAGVFVAGIVAVILYPVFGALSDTFGRKTMYLLGAVAMGVVIAPAFALINTGNPWLFMA
FT                   AQVLVFGIAMAPAAGVTGSLFTMVFDADVRYSGVSIGYTLSQVVGSAFAPTIATALYAS
FT                   TESSTSIVAYLLVVSAISVVSVILLPGGWGRKGAASQLVRDEAGSARPTPAVTTFSTPD
FT                   TATDLRVLDK"
FT   gene            complement(601245..601970)
FT                   /gene="ohpR"
FT                   /locus_tag="RHA1_ro00522"
FT   CDS_pept        complement(601245..601970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ohpR"
FT                   /locus_tag="RHA1_ro00522"
FT                   /product="transcriptional regulator, GntR family protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00522"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92358"
FT                   /db_xref="GOA:Q0SJC8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJC8"
FT                   /protein_id="ABG92358.1"
FT                   /translation="MSTTSTDPEAAALLANVRTSGARLSAAMYDILKTRLLEGRYAAGE
FT                   KIVVESIRQEFGVSKQPVMDALRRLSSDKLVYIFPQSGCEVVSYTQREVEDFFTLFGGF
FT                   EGTIAAVAAARRTDAQLTELGLISSRIDALLTSHDPEVRAHGYRIHNREFHAAIHTMAH
FT                   SRIMAETSQRMWDMSDFLINTTGITNPLSSALPERQDDHHAIIEAIRQQDEATAREAME
FT                   RHIVGTISVIRNEADDSVG"
FT   gene            602335..603408
FT                   /locus_tag="RHA1_ro00523"
FT   CDS_pept        602335..603408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00523"
FT                   /product="probable methylenetetrahydromethanopterin
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00523"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92359"
FT                   /db_xref="GOA:Q0SJC7"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJC7"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92359.1"
FT                   /translation="MEFCIGTCAKIDQVAMVKQAEDLGFSHFGVGEGPLLFSDPYQYLA
FT                   LAATQTSSINLGTMVTNPLTRIAPVTANSMATLNALAPGRTFLGIGTANNALRSMGNRT
FT                   AKISELTHAIEVSRELMAGRRVTHNWLGQSREVEFLDKDSGFYNVTDHIPMWVAAGGPR
FT                   GLAEAAKYADAVVYCLGPNVEMIKLIRSRLDKAVADAGRAPGSVKLVSLSWFYQLGSGE
FT                   TWEDGVTNGFGSGPISSCITNAGLMDQHRDQLGDSIVDASITAAQRYLGDPKAPDQPHY
FT                   LDVWAKYLRGLDPAHRPIITKELVDYWCLYGSPAELRDKAALMREAGVDILQVFLSNPF
FT                   TAARDIDNIGHSILAHA"
FT   gene            603434..604057
FT                   /locus_tag="RHA1_ro00524"
FT   CDS_pept        603434..604057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00524"
FT                   /product="possible isochorismatase hydrolase"
FT                   /note="GO_function: GO:0008908 - isochorismatase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00524"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92360"
FT                   /db_xref="GOA:Q0SJC6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJC6"
FT                   /protein_id="ABG92360.1"
FT                   /translation="MMELDPRTTAVVAVHCQGDVVGPTGAFADFFHQQVSERRVIDQIA
FT                   ALIAAAREAGAPVVYTRVAWKPDFSDLEVNSPLLGIVAQSGCLKEGSELAEIVEPLKPN
FT                   GDDIVLTHQRIGAFAGTDLDTILRGKGITTLLFAGVATNASVEGTARVASDLGYRVVIV
FT                   EDACSAANPEAHEASINSLGLLAEIATVDDIRTALTASVTGTTA"
FT   gene            604177..605286
FT                   /locus_tag="RHA1_ro00525"
FT   CDS_pept        604177..605286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00525"
FT                   /product="Zn-containing alcohol dehydrogenase"
FT                   /note="GO_function: GO:0004022 - alcohol dehydrogenase
FT                   activity; GO_function: GO:0008270 - zinc ion binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00525"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92361"
FT                   /db_xref="GOA:Q0SJC5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJC5"
FT                   /protein_id="ABG92361.1"
FT                   /translation="MKSTMRVARLHEINQPMQIEELPTPEPRATDVLVQVKACNVVPNL
FT                   SNVLATYSEWFPYLPLPKLPAIFGLDSAGVVAAVGSHVTDVAVGDRVYVNPGISCGGCR
FT                   ACRQGHDQNCDKYTFMGYFSFGADGQQIFDAYPYGGLGGYLTAPQRNLVKLPDSVSFEE
FT                   GARFGYLGTGYSALCKAGAGAGSTVLIDGISGTLGLGTCLSALALGASHIFGTGRNADL
FT                   LEDVRSIAPDRIHVLPAGEGDLRSWVREHNNGEGVDIVIDSLGPGAPAESFLDAITTLR
FT                   RGGVAVDIGGMMERPPLDMFSLMCSQISVLGSLWFSTAEAQDMADLAGAGVLDLSVFEH
FT                   HSFPLEKINEALADLPARHGGFTNFVSVP"
FT   gene            605314..605676
FT                   /locus_tag="RHA1_ro00526"
FT   CDS_pept        605314..605676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00526"
FT                   /product="possible transcriptional regulator, WhiB family
FT                   protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00526"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92362"
FT                   /db_xref="GOA:Q0SJC4"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJC4"
FT                   /protein_id="ABG92362.1"
FT                   /translation="MRGARPPSSKRSTAVRAYRTVRQSDLPEPEELSWRLAATCRIVSP
FT                   ALFFHPTNERGPKRQKRIHEAKKICSQCPVQRPCRDYALAVREPFGIWGGMSEEDRDRI
FT                   LGRGRGRADNTTERSA"
FT   gene            605838..606404
FT                   /locus_tag="RHA1_ro00527"
FT   CDS_pept        605838..606404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00527"
FT                   /product="possible serine/threonine-protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00527"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92363"
FT                   /db_xref="GOA:Q0SJC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJC3"
FT                   /protein_id="ABG92363.1"
FT                   /translation="MQSRTTLSTAELITGQICDSSLSTPASLSDKDAHATDRAAEPREP
FT                   SDEESLALPGIAADAAWSDSQPTGNCICRGCCLRRTQLRAGFAVDAMALPMGTGESANT
FT                   QRAVGLETDETQRPADIGSRPGSGRALTPPTPATRFRPPIPAKVPVVRQRLIDMREDGR
FT                   RPRLTVIHAPAGYGKSTLAFNGSRH"
FT   gene            606416..607354
FT                   /locus_tag="RHA1_ro00528"
FT   CDS_pept        606416..607354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00528"
FT                   /product="possible transcriptional regulator"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_function: GO:0004674 - protein serine/threonine kinase
FT                   activity; GO_function: GO:0004713 - protein-tyrosine kinase
FT                   activity; GO_function: GO:0005524 - ATP binding;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent; GO_process: GO:0006468 - protein amino acid
FT                   phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00528"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92364"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJC2"
FT                   /protein_id="ABG92364.1"
FT                   /translation="MSAAWLTIDTDDNNVVWFLGHLIEALRRVRPELSQDLGQVLEEHG
FT                   DRAQQYVLTNLINDIHAGGDRVAVILDDWHRVTEPGTIAALGYLLDNGCHHLQFVVTSR
FT                   TQTGLPLSRMRVRDELVEVGPEALRFAPDESKRFLVDVNGLVLADSEIDRLTASTDGSV
FT                   AALQPASLSLRDAKDPRLLIDHLSGRHRTIGEYLVENVLDAVEPRILEFLLATSIPAGA
FT                   GAGSSRAPRGPTSVKSAGRAVRQFWCPVFRRSSGFPPETEPPNTTAGVANPAVMTRSLA
FT                   RRASSSHGRSNRAGCCACETVTATSSGAGAP"
FT   gene            complement(607518..607898)
FT                   /locus_tag="RHA1_ro00529"
FT   CDS_pept        complement(607518..607898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00529"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00529"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92365"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJC1"
FT                   /protein_id="ABG92365.1"
FT                   /translation="MTTATTEVETTRKLLQAADTDIAEFFDYFSDDCVFRMGNNAPVIG
FT                   KSAIQSWVAQYLTSVASMRHEIIEQWSEGTVAALRVEVTYTLQNGESFTLPAVTRTRVE
FT                   NNKVTEYLIFMDPSPVISGTTQ"
FT   gene            complement(607999..608610)
FT                   /locus_tag="RHA1_ro00530"
FT   CDS_pept        complement(607999..608610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00530"
FT                   /product="probable NADH dehydrogenase/NAD(P)H
FT                   nitroreductase"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00530"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92366"
FT                   /db_xref="GOA:Q0SJC0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR023936"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJC0"
FT                   /protein_id="ABG92366.1"
FT                   /translation="MVGSNSTIERLDDAARDLLFAEARTVNNFAPTPVSDAELAQIWEM
FT                   ARWAPTAANSQPLRVQYVRTDDARRRLIEHLDEGNREKTTSAPVTVILAVDSGFHEHLP
FT                   HLLPIRPQIREVFAANDALRERTGNFNAALQAGYFILAIRAAGLAAGPMTGFDPKGMDT
FT                   EFFSGTTWRSILVVNIGHPGENPWFERLPRLDPAETVHWA"
FT   gene            complement(608779..609942)
FT                   /locus_tag="RHA1_ro00531"
FT   CDS_pept        complement(608779..609942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00531"
FT                   /product="probable pigment production hydroxylase"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00531"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92367"
FT                   /db_xref="GOA:Q0SJB9"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJB9"
FT                   /protein_id="ABG92367.1"
FT                   /translation="MDITRTELMDRVHALVPAFAERAQKTEENRAPFDETITDLIDSGI
FT                   LATLTPKEYGGLELGLDVAAEIVRTISAACPSTGWVTSFYIGAAWRVNIFTEQAQREVF
FT                   ADKPYTLTAGTAAPLGQVQKVDGGYRITGQTAWNSGSVHAEWFTFAGVVFEEGSAPTSL
FT                   WFLVPREDVKILDTWFIAGMAGTGSNDISVDDVFVPDYRTGPFDLALAGTAPGQLIHPN
FT                   PMYHLPFLPFAMAEVTPVVVGALRGAADAFVQRTRDRQGTISQEKASGKQAAQMRLGRA
FT                   LAAADAAETLLDAFFERLTAQRPEQSDPRDRAEMKLKAAYLADLARNALNDMVRGIGGD
FT                   GYRNSAPIQRFFRDLSVLSVHAFLDIDTASETIGRFTLDLPVSDPLL"
FT   gene            complement(610082..610723)
FT                   /locus_tag="RHA1_ro00532"
FT   CDS_pept        complement(610082..610723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00532"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="GO_function: GO:0003935 - GTP cyclohydrolase II
FT                   activity; GO_function: GO:0008686 -
FT                   3,4-dihydroxy-2-butanone-4-phosphate synthase activity;
FT                   GO_process: GO:0009231 - riboflavin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00532"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92368"
FT                   /db_xref="GOA:Q0SJB8"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJB8"
FT                   /protein_id="ABG92368.1"
FT                   /translation="MTTSFAPRAPRQRSWSTIAAGSRALAAGELIILSHLRRVVLVGSA
FT                   SAVTTEQMAFLIRHTTGFLQVALHERICDLLVLPEATPTVRTSSTLGHGQCVTVDAAAG
FT                   ITTGISGADRARTARILADPATGPGDLTRPGHLVPVRLTPTEFRTRQTTASLALALTDA
FT                   TATQCSGAVFADLDGIADPISVGDRHDAEILADRYGLTLVAGPDLKGNVR"
FT   gene            complement(610815..611312)
FT                   /locus_tag="RHA1_ro00533"
FT   CDS_pept        complement(610815..611312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00533"
FT                   /product="probable nitrilotriacetate monooxygenase,
FT                   component B"
FT                   /note="GO_function: GO:0004497 - monooxygenase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00533"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92369"
FT                   /db_xref="GOA:Q0SJB7"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJB7"
FT                   /protein_id="ABG92369.1"
FT                   /translation="MHTTLSPVQETFKDVMSHVATPVAVVTSMDGGLPFGTTVSAFTSL
FT                   SMTPPMVLVSLDRGSETLELITASKKFGLNVLASDQQGTALKFAKMGGIGKFQGVRWEI
FT                   DHDLPRIAGAAGWIACHVDQFVEGGDHVVVLGTVVAAENNYSDPLTYHRRVFGTHSALE
FT                   SA"
FT   gene            complement(611537..612814)
FT                   /locus_tag="RHA1_ro00534"
FT   CDS_pept        complement(611537..612814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00534"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0044238 - primary metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00534"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92370"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJB6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92370.1"
FT                   /translation="MPHWTGELSGRRARQSELEWLSPDADRIRAVLGDGAVTWAVEVGQ
FT                   DIAAKISRKVPAVGEGALPLDAIRRATTATVCRALTLVAGLGESETSLASAEVEEIARD
FT                   FARRGMELDDLLRTIRVGYAVLAAALLDAVTRLIPPSESGNEMRRISLLLFEVLDDFTG
FT                   VAASAFLEEQSAWAAGVSAARLDLVTKIIAADPIESAHAEQVLGYPLGGHHVALIAWSG
FT                   PHSGHDLRAVVDPALRQWGTPTASLVIPVGLQAIWAWGAITPDPTRALTSTLPAFGDTF
FT                   VVTGQLGSGIDGFRRSHLEARAVERLVRLRVGHPPTTTAHEHIALEVLLLADPEAAVQF
FT                   ASRLLGPLAGNDPRMADLRSTLSLYLDMDHGLAKVATAEHISKNTVTYRVQKALSLCTP
FT                   SGGSSTDLRAALRIYEWLRDAPIAQW"
FT   gene            complement(612795..613118)
FT                   /locus_tag="RHA1_ro00535"
FT   CDS_pept        complement(612795..613118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00535"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92371"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJB5"
FT                   /protein_id="ABG92371.1"
FT                   /translation="MTPSILAVGDREGICGHRTTEGPFVGYVCLPGAGAIPDNSRCADL
FT                   CRRLLCGPRHVVVSPFHEIPPGMATGYGTGTAGEIGLQTKTAGVLVVPWRRIGRMLSAA
FT                   LDW"
FT   gene            613121..613693
FT                   /locus_tag="RHA1_ro00536"
FT   CDS_pept        613121..613693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00536"
FT                   /product="extradiol dioxygenase, type I"
FT                   /note="GO_function: GO:0008198 - ferrous iron binding;
FT                   GO_function: GO:0016702 - oxidoreductase activity, acting
FT                   on single donors with incorporation of molecular oxygen,
FT                   incorporation of two atoms of oxygen; GO_process:
FT                   GO:0019439 - aromatic compound catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00536"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92372"
FT                   /db_xref="GOA:Q9KWM6"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KWM6"
FT                   /protein_id="ABG92372.1"
FT                   /translation="MTATPKFAHVVLQTSRFEEMRDWYCTVLDAHVVYEGHGLCFITFD
FT                   EEHHRVALLGAPVQLEPRNPGAAGMHHTAYTFDTLDDLLDRYDSLKEKGIEPKVPIQHG
FT                   VTTSLYYQDPDGNFVELQIDNFATPDEATAYMNGPEYGNNPVGVSFVPEAMRQALAQGT
FT                   PVSEITTHSWALQTSPDLPDPMAALTS"
FT   gene            613762..614652
FT                   /locus_tag="RHA1_ro00537"
FT   CDS_pept        613762..614652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00537"
FT                   /product="possible fumarylacetoacetate hydrolase"
FT                   /note="GO_function: GO:0016829 - lyase activity;
FT                   GO_function: GO:0016853 - isomerase activity; GO_process:
FT                   GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00537"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92373"
FT                   /db_xref="GOA:Q0SJB3"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJB3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92373.1"
FT                   /translation="MRVANQAGRLQIVADGIAVDVETASGGRFSAEPQQIFDRWDEFTA
FT                   WAATVNFAAGAPVVESELGAPVPRPGQIFAIGVNYADHVEESGLTLPDAPFVFTKFPAS
FT                   ITGPYDTIEHPGGLVDFEVELVAVIGKEARHVPVAEGWEYVAGLTLGQDLSERDLQLSG
FT                   PPPQQFTLGKSFAGFAPIGPVLVTPDEFADPDDIEVSTILSGELMQNSRTRHLIFPIPV
FT                   LVSYLSSILPLRPGDLIFTGTPSGIGFTRDPKRLIGVDDELVSRADTIGEMRHHFTAAT
FT                   RPHPLTTVSRSTSHV"
FT   gene            614645..616411
FT                   /locus_tag="RHA1_ro00538"
FT   CDS_pept        614645..616411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00538"
FT                   /product="aromatic ring hydroxylase"
FT                   /EC_number="1.14.13.20"
FT                   /note="GO_function: GO:0008270 - zinc ion binding;
FT                   GO_function: GO:0015036 - disulfide oxidoreductase
FT                   activity; GO_function: GO:0016788 - hydrolase activity,
FT                   acting on ester bonds; GO_function: GO:0018662 - phenol
FT                   2-monooxygenase activity; GO_process: GO:0006118 - electron
FT                   transport; GO_process: GO:0019439 - aromatic compound
FT                   catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00538"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92374"
FT                   /db_xref="GOA:Q0SJB2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJB2"
FT                   /protein_id="ABG92374.1"
FT                   /translation="MSEITVPVLIVGGGGCGLTTSILLSEHGIDHHLVERHTSTSHLPK
FT                   AHYLNQRTMEVLRQVGVADSIYAVGTPPKNMGKTRWVTSLGGDGELDGRTLYTLESFGG
FT                   GRLESAYAVDSPCPSTNYPQIRLEPLLREHAEKRAPDSIHFGRELVSFEQDENGIHAVV
FT                   LNRDTQETYTVHAQYMVAADGGKTVGPELGVKMEGPTGILDMVSTHFTADLSQWWEDDV
FT                   LITWLLNPEGAGSWNSGAMAAMGPTWGKHSEEFVLHFTFRPDDPARFDEEAIVPRLREL
FT                   LKLPDLELKIHKVSHWILEGVLADKYQVGRIFLAGDAAHRHPPTTGLGLNTAIQDAHNL
FT                   AWKLAAVVKGDAAPALLDTYEPERRLVGMRNVDWAMFTFLNHMVVDAGLGLIPGQPLEA
FT                   QVQVFRDYFSDTPMGETRRARAAEVISTQRTEFQAHDLEIGFAYRDGALVPDGTEAPPR
FT                   DPMGHNYHPTTRPGHRLPHAWLEHDGRQISTHDLTGNNAHFVLITAADGAAWSDAARLA
FT                   NDKFGVQIKVAQIGAGTDYTDPTGRWSELRQIDDTGAILVRPDNHVAWRSTGAVADPAD
FT                   ELTRALGTVLSR"
FT   gene            616498..618498
FT                   /locus_tag="RHA1_ro00539"
FT   CDS_pept        616498..618498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00539"
FT                   /product="acetoacetate--CoA ligase"
FT                   /EC_number="6.2.1.16"
FT                   /note="GO_function: GO:0016405 - CoA-ligase activity;
FT                   GO_function: GO:0030729 - acetoacetate-CoA ligase activity;
FT                   GO_process: GO:0019287 - isopentenyl diphosphate
FT                   biosynthesis, mevalonate pathway"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00539"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92375"
FT                   /db_xref="GOA:Q0SJB1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJB1"
FT                   /protein_id="ABG92375.1"
FT                   /translation="MTAPGREVLWTPPPERVSASNMSRYQRWLAAEKNVCTTDFDSLWC
FT                   WSISDLEKFWLSIWEYFDVIASAPPQTVLSDPRMPGARWFPGTRLNWAENLLRHTDRTG
FT                   PAIISVDETGTTGELSRAELVAQVANLAAHFRKIGVQPGDRIAAMLPNIAPTVAAVLAA
FT                   ASVGAVWSCCAPDFGVKGLVDRFAQIEPTVLIGVDGYQFNGKRVDRRDVFATLLDQLPT
FT                   VRHAVVVDNLGLPFIGEHRPSIAAYADVVVGDAAPQYEQVPFDHPLWILYSSGTTGLPK
FT                   GIVHSHGGIVLEALKANALHYDLGPTDRVFIAASTAWVVWNMLVDTMVTGAAIITYDGS
FT                   PTYGRPDHQFEICARYGATRFGTGAAYLTLCEKAGTEPGTAFDLSGLRSIMSTGSPLPD
FT                   TTWRWIYDTVSPDVHLGSDSGGTDVATGFIGANPLSPVRVGELQGPYLGVDVQAWTETG
FT                   EAVVGEVGEMVITAPMPSMPIYFWNDPDGNRYRDAYFEVYPGVWRHGDWITMEADGGCV
FT                   VHGRSDSTINRGGVRMGSADIYQAVEALPEIAEALVIGAELPHGGYHMPLFVVLRDGYD
FT                   LDDALVEKIRTTIRREASPRHVPDEIIDVPAIPITRTGKRLEIPVKKLIQGVSPETAIN
FT                   RATVADTDALDWYIDYAQRFQDHRADTSTLT"
FT   gene            complement(618568..619266)
FT                   /locus_tag="RHA1_ro00540"
FT   CDS_pept        complement(618568..619266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00540"
FT                   /product="transcriptional regulator, GntR family protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00540"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92376"
FT                   /db_xref="GOA:Q0SJB0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJB0"
FT                   /protein_id="ABG92376.1"
FT                   /translation="MTTSTRNPQPPVRSLTPTSVPEQVAKEIRRSILAGELRPGQTFSL
FT                   REISSQLGVSFIPVREALKELEAQGLVVTRPGKSAMVAPLSHEDLHGIYRLRRQLEPEI
FT                   AGRACKLLDDADLRRLENYVTMFGDESLDLDDIYQAHHAFHYELLRPAATAWDLRVLDG
FT                   LWHAAERYVRLAFSGREAEPDEHERRGHVHAEILTVVRTRNMRKVAAATRQHLDDNEQI
FT                   ALRALDPIAP"
FT   gene            complement(619359..619835)
FT                   /locus_tag="RHA1_ro00541"
FT   CDS_pept        complement(619359..619835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00541"
FT                   /product="transcriptional regulator, AsnC family protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00541"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92377"
FT                   /db_xref="GOA:Q0SJA9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJA9"
FT                   /protein_id="ABG92377.1"
FT                   /translation="MPSTHQADQIDARLLLALAESPRATTIALADRIGLSRNTVQARMG
FT                   KLDDSHALRSFERRIDPAILGYPLQAYILTNVTQRKLARVGAALDGIPEVLEVLGLSGV
FT                   ADLLLHVAVRDADDLYRVAGDILGIKGVKRTTTALVMREMVDYRIAPLVEKLID"
FT   gene            620109..622460
FT                   /locus_tag="RHA1_ro00542"
FT   CDS_pept        620109..622460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00542"
FT                   /product="pyruvate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.1"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006096 - glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00542"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92378"
FT                   /db_xref="GOA:Q0SJA8"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJA8"
FT                   /protein_id="ABG92378.1"
FT                   /translation="MHDTLPVAPGTATPPAQAGGPVDLETLETIRQRVLWLSTSMIHHA
FT                   NRIRPNPTGLKVGGHQASCASMVSIMTSLWFEQLQPGDRVSVKPHASPVLHGINYLLGE
FT                   LDEKYLTTLREFGGLQSYPSRSKDPDTVDYSTGSVGIGATAPIWGAMARRYVETTTGGA
FT                   GTGRQYSLVGDAELDEGAVWEAILDPGIADLGEVVWIVDLNRQSLDRVIPNIAANRLEK
FT                   MFDAAGWQVITVKFGRLLEELFTRPGGQALRTRILDMPNPEYQRLLRCSADEVRTRLPG
FT                   NGPGSTEISALIAGLDDATLTAAIRNLGGHDLSALTAAYRQIDDTRPTVIIAYTIKGYG
FT                   LPTQGHPQNHSSLLSVDEYASLAADLGMDPASPWGRFAADSAAGRRCASNAERLRRNPV
FT                   PALPALTIPTDIGRTPKGTATTQAALGRVLLDLTREAPEAAKRVVTVSPDVSSTTNLAG
FT                   WVNKVGVWSAAERRNWFDDDRETIMHWNERPTGQHMELGIAETNLVGLMGELGATWSRW
FT                   GQPLFPIGVMYDPFVERALEPWSYGIYAGGQSILVGTPSGVTLAAEGGAHQSIKTPSIG
FT                   LEQPGCISYEPAFAIDTEWTLLASIGRLGRPDGTSAYLRLSTRPVDQTLAAVPTDPAAR
FT                   ECRRRQVVAGGYPLVRRDDAQVTLVAIGAMITEALAAADRLAEQGIPADVVCITSPGLL
FT                   FEAVQGRQGRGSGESWILDQLFPADRATPIVTVLDGHPHTLAFLAGINQVRSTALGVSK
FT                   FGQVGSLDEVYRYHGIDTDSIVRAALDIIP"
FT   gene            622504..623607
FT                   /locus_tag="RHA1_ro00543"
FT   CDS_pept        622504..623607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00543"
FT                   /product="dihydrolipoyllysine-residue succinyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="GO_function: GO:0004149 -
FT                   dihydrolipoyllysine-residue succinyltransferase activity;
FT                   GO_function: GO:0004742 - dihydrolipoyllysine-residue
FT                   acetyltransferase activity; GO_function: GO:0005515 -
FT                   protein binding; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00543"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92379"
FT                   /db_xref="GOA:Q0SJA7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJA7"
FT                   /protein_id="ABG92379.1"
FT                   /translation="MTTEQLEGTTVRMPALGESVDEGTITRWLKQPGDHVTAEEPLLEV
FT                   ATDKVDTEIPSPVTGILQRHLAEENDVVAIDAELAIITESGGTAAAPAAPPIPAPTADP
FT                   AQTPPPPEPDTATPPATLGTAASLPATGSTTEKLPRIRRTIAKRMVESLQTAAQLTTVL
FT                   EVDVTAIARLRATHKDAFLQRTGIKLSFLPFFAQAAVDALAEHRVLNASLNTDVTEVTY
FT                   YDHCHLGMAVDSAKGLMVPVIRDAQQLGIEGLAQAIADKADKVRTGTITADDLTGGTFT
FT                   LTNTGSRGALFDTPIINQPQTGILGVGAVVERLVPSRQDGELRIDVRSMAYLSISYDHR
FT                   IVDGADAARFLTTVKARLENGFTPNDL"
FT   gene            623649..623900
FT                   /locus_tag="RHA1_ro00544"
FT   CDS_pept        623649..623900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00544"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92380"
FT                   /db_xref="InterPro:IPR021678"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJA6"
FT                   /protein_id="ABG92380.1"
FT                   /translation="MTRDDQAMLAFATRWCRYGGGDEYILPEFGITPQVFYQRLLAMVT
FT                   STVINDVDFSTRTYLMDFCSSKLARPASKSVAAAHTAV"
FT   gene            complement(623955..624194)
FT                   /locus_tag="RHA1_ro00545"
FT   CDS_pept        complement(623955..624194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00545"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92381"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJA5"
FT                   /protein_id="ABG92381.1"
FT                   /translation="MAIDGADLSSGSVVCEVMVRGTTAPAQLQLRSIAAADALDITAET
FT                   TVDRTVYPMLGPWAGVSRRANLGITLVARPTGNA"
FT   gene            624926..626716
FT                   /pseudo
FT                   /locus_tag="RHA1_ro00546"
FT                   /note="acetolactate synthase"
FT   gene            complement(627351..627743)
FT                   /locus_tag="RHA1_ro00547"
FT   CDS_pept        complement(627351..627743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00547"
FT                   /product="possible transcriptional regulator, WhiB family
FT                   protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00547"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92382"
FT                   /db_xref="GOA:Q0SJA4"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJA4"
FT                   /protein_id="ABG92382.1"
FT                   /translation="MSETDPMTCISARAPNTVPASRREGTPRTGPPADRDRGDWRMLGS
FT                   CRNVESSLFFSPEGERGRDRARREARAKRVCQDCPVLTECREYALAVAEPYGTWGGMSE
FT                   NDRRRHIRPRQREGRAADLPVEEPLR"
FT   gene            complement(627749..627985)
FT                   /locus_tag="RHA1_ro00548"
FT   CDS_pept        complement(627749..627985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00548"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92383"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJA3"
FT                   /protein_id="ABG92383.1"
FT                   /translation="MIRTDFGMDTAAFCRALVAYLDVAAPAPLRPLGRANDHRRSSKVL
FT                   AGHVNLKRPSGLVVKNVVCERITAVTGPQHKYP"
FT   gene            complement(628083..628388)
FT                   /locus_tag="RHA1_ro00549"
FT   CDS_pept        complement(628083..628388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00549"
FT                   /product="possible epoxide hydrolase"
FT                   /note="GO_component: GO:0005792 - microsome; GO_component:
FT                   GO:0016020 - membrane; GO_function: GO:0004301 - epoxide
FT                   hydrolase activity; GO_process: GO:0009636 - response to
FT                   toxin"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00549"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92384"
FT                   /db_xref="GOA:Q0SJA2"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJA2"
FT                   /protein_id="ABG92384.1"
FT                   /translation="MRRANNLAVMLRTLALDEGNGEWSYSFPDTNLSELVAYWWDGYDW
FT                   RRAEAAINAYEHCQVSVVGVPVHLMRKPGLGPYPSWVTTRWSDPTPFLHGATSVAK"
FT   gene            628681..628983
FT                   /locus_tag="RHA1_ro00550"
FT   CDS_pept        628681..628983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00550"
FT                   /product="long-chain-acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.8"
FT                   /note="GO_function: GO:0003995 - acyl-CoA dehydrogenase
FT                   activity; GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00550"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92385"
FT                   /db_xref="GOA:Q0SJA1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJA1"
FT                   /protein_id="ABG92385.1"
FT                   /translation="MRHSATDLTLSKTDVTQGYLDQCLLAHTHGGLSAMDAAKAKWWSE
FT                   EIQNEVLDSCVQLHGGYGYMNEYRTARAWKDARITKIWAGTNEFMKESIGRDLGL"
FT   gene            629099..629725
FT                   /locus_tag="RHA1_ro00551"
FT   CDS_pept        629099..629725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00551"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0000287 - magnesium ion binding;
FT                   GO_function: GO:0016787 - hydrolase activity; GO_process:
FT                   GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00551"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92386"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJA0"
FT                   /protein_id="ABG92386.1"
FT                   /translation="MVVLLRHAHAIGKQSWRGSDAHRPLSALGQEQAAGLVDTLTGVEL
FT                   RVLYCSPTTRCLDTLAPLAAAYGLAIHEHPLLAPDAAADDLFAALDTVDLTGTLWGTAL
FT                   AACTRTDGTRAFPIGDTAKVGPGFSMPTPRRATSIPIRRSSRLRRWGSPLRKCNERLRA
FT                   VDPGDPATLPSVTQVTLIRGSVGVTFPALPDTVRIAADAGPAAPE"
FT   gene            629741..630037
FT                   /locus_tag="RHA1_ro00552"
FT   CDS_pept        629741..630037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00552"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92387"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ99"
FT                   /protein_id="ABG92387.1"
FT                   /translation="MSTTQLHPNTHPATSTSHWKRLATAAAATAALGLVPVAAANATTA
FT                   PPNATQPAAAVTHDSPLDRDNDIQQQHQHDRQRDQRQDRRADTIVLDQILLDG"
FT   gene            630176..630385
FT                   /locus_tag="RHA1_ro00553"
FT   CDS_pept        630176..630385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00553"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00553"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ15"
FT                   /protein_id="ABG92388.1"
FT                   /translation="MNTIEPPATEAVTTTATTFGSTADLTSALIRAATAHGQHETRTGA
FT                   ADPNWPDWYAAYMVAEQAGTEPPL"
FT   gene            630442..630909
FT                   /locus_tag="RHA1_ro00554"
FT   CDS_pept        630442..630909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00554"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92389"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ14"
FT                   /protein_id="ABG92389.1"
FT                   /translation="MSTIHLHQTTTATPEQFLDALTDFGPGRQAIFGNSADDHLQVHEL
FT                   DTTHADVTEGSGGAWERLHYDWTDPHRIVMTTTDSNLWGGNSGHTYTLTPRPDGTTDID
FT                   AVVVRDGKNLKGRALAAVLGVFGTRVLGKAFDNTIAAIEARNHTPRTANNT"
FT   gene            complement(631483..633057)
FT                   /gene="zwf1"
FT                   /locus_tag="RHA1_ro00555"
FT   CDS_pept        complement(631483..633057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf1"
FT                   /locus_tag="RHA1_ro00555"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="GO_function: GO:0004345 - glucose-6-phosphate
FT                   1-dehydrogenase activity; GO_process: GO:0006006 - glucose
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00555"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92390"
FT                   /db_xref="GOA:Q0SJ96"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ96"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92390.1"
FT                   /translation="MQERDPLAASSDGGLGEALIGNSGQVTEPVSMVIFGITGDLARKK
FT                   LVPAIYDLAHGCQLPPDFDLVGFARDGAHTEARLREAVIAHARTPFDPAVWAGLVERIH
FT                   VVQGSFDDTAAFARLSARLAELDVRRGKPGNYVFYLSVPPSAFATVCDQLAITGLHRGD
FT                   RGWRRVVVEKPFGHDLASSQTLGVALERVFPPSSIYRIDHYLGKETVQNILALRFANGM
FT                   FEPLWNNRHIDHVQITMAESVGVSGRAGYYDGVGAARDVIQNHLLQLLALIAMEEPVAF
FT                   DADSIAAEKIKVLSATGLLGPLAETSARGQYGAGVENGVPVTGLADEAGFPADSTTETF
FT                   AALTVGIATRRWAGVPFFIRTGKRLARRTGVPFFIRTGKRLARRTAEIAVTFTPPAHGS
FT                   PAARAAAVSNVLVLRVQPDDGIELHIGAKRPGGGMHIQPVSLGMDFRSVFDPAPEAYER
FT                   LICDVLRGDATLFPRREEVEWSWRVIDPLLEHWAALGRPDNYPSGASGPESAERILSRT
FT                   GREWRSL"
FT   gene            633274..634173
FT                   /gene="gnd1"
FT                   /locus_tag="RHA1_ro00556"
FT   CDS_pept        633274..634173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd1"
FT                   /locus_tag="RHA1_ro00556"
FT                   /product="phosphogluconate dehydrogenase (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /note="GO_function: GO:0004616 - phosphogluconate
FT                   dehydrogenase (decarboxylating) activity; GO_function:
FT                   GO:0008442 - 3-hydroxyisobutyrate dehydrogenase activity;
FT                   GO_function: GO:0050661 - NADP binding; GO_process:
FT                   GO:0006573 - valine metabolism; GO_process: GO:0009051 -
FT                   pentose-phosphate shunt, oxidative branch; GO_process:
FT                   GO:0019521 - D-gluconate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00556"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92391"
FT                   /db_xref="GOA:Q0SJ95"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ95"
FT                   /protein_id="ABG92391.1"
FT                   /translation="MKLGLVGLGRMGLNMRERLRERGLEAIGYDPHAAASDVDSLESLV
FT                   ESLPAPRAVWVMVPAGTPTRQVIGQLSRLLAPGDLVVDGGNSRFTDDKVNADILAEHGI
FT                   RYLDCGVSGRVWGRTNGYALMAGGDAADIDRLMPVFDALRPDGDREDSFVHAGAVGAGH
FT                   YAKMVHNGIEYGLMQAYAEGYELLAAEDSIVDVPAVLRAWSKGTVVRSWLLDLLVQALS
FT                   EDPDLAAISGYTEDSGEGRWTVEEAIAHAVPAPVISAALFARFASRQHDSPAMKAVSAL
FT                   RNQFGGHAVRRSETAGIA"
FT   gene            complement(634208..634459)
FT                   /locus_tag="RHA1_ro00557"
FT   CDS_pept        complement(634208..634459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00557"
FT                   /product="possible transcriptional regulator"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00557"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92392"
FT                   /db_xref="GOA:Q0SJ94"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ94"
FT                   /protein_id="ABG92392.1"
FT                   /translation="MGGPSGVSERAFTRRFLREVGVSPAAWRLRARLLAAIPMLRSQPV
FT                   TRVASTLGYASPAAFSFAFSREFGMAPSAAGRREDTHR"
FT   gene            complement(634438..634539)
FT                   /locus_tag="RHA1_ro00558"
FT   CDS_pept        complement(634438..634539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00558"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92393"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ93"
FT                   /protein_id="ABG92393.1"
FT                   /translation="MLPTSADLVALCRSYLGKPEVGVTNAEWAGRVA"
FT   gene            complement(634621..635028)
FT                   /locus_tag="RHA1_ro00559"
FT   CDS_pept        complement(634621..635028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00559"
FT                   /product="possible transcriptional regulator"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00559"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92394"
FT                   /db_xref="GOA:Q0SJ92"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ92"
FT                   /protein_id="ABG92394.1"
FT                   /translation="MSVDFFRESVGRLGVVRNVPLGDIDSIERDVLPIATDYPAGFVLD
FT                   WHEHRRAQFLYGATGTMVVETDNGTWTVPTAQGVMIPPATRHRVRMLGVSTSSLYIEPA
FT                   AVPWWPMACVVVEVSSLLRELLLVAADLPAE"
FT   gene            635069..635845
FT                   /locus_tag="RHA1_ro00560"
FT   CDS_pept        635069..635845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00560"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92395"
FT                   /db_xref="GOA:Q0SJ91"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ91"
FT                   /protein_id="ABG92395.1"
FT                   /translation="MNMFVLVLIGLVTGLTTVLFGFGGGFVTVPVVLWAEAGLGDSAAR
FT                   VAVATSAAVMMVNAAVATSATSRTVLRHLRDSRCLLALLGLGGVAGALLARLVPGAIIQ
FT                   WGFVIYLVGTIVDVLVRPGFFRPAAPHTTDSRQRFAIPTSLGLPIGASAAFLGVGGSVM
FT                   TVPLLRRSGLMMGVATALATPLTLAISLPAVLIFLVGRGPGSPAGAALAGSIDLAAALA
FT                   LLLGALPVIVTLRDAHPVCPTVSTRSVTCCSSSRSP"
FT   gene            complement(635995..636861)
FT                   /locus_tag="RHA1_ro00561"
FT   CDS_pept        complement(635995..636861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00561"
FT                   /product="possible DNA binding protein"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00561"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92396"
FT                   /db_xref="GOA:Q0SJ90"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ90"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92396.1"
FT                   /translation="MEIAKEIKDFLTTRRARITPDQVGLPTGGRRRVAGLRREVVAMLA
FT                   GVSAEYYVQIERGGVSGVSDEVLYAIATALRLDDEETKHLFTLARAASTRPRRRIAPRA
FT                   RVEVPEPVQALVDAMITAPAVVQNGHLDIVAVNALGRALYADVFDRSDGVPNLARFIFL
FT                   DRRAGETFPDWNHAADDAVAILRSEAARSPYSAAVTGLVGELATRSDEFRTRWATHDIK
FT                   AHRRGTKRFHHPVVGDLTLRFEALEVASAAGLTLFGFTAEPGSPSEESLRLLSSWAASD
FT                   RPEHQHS"
FT   gene            637047..638516
FT                   /locus_tag="RHA1_ro00562"
FT   CDS_pept        637047..638516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00562"
FT                   /product="possible hydrolase"
FT                   /note="GO_function: GO:0016787 - hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00562"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92397"
FT                   /db_xref="GOA:Q0SJ89"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ89"
FT                   /protein_id="ABG92397.1"
FT                   /translation="MTTKTTETVSVKTPYWDIAADIYFPPGFDESKQYPAIISAHPIGS
FT                   CKEQTSGNVYGTALADAGYVVIAFDASYQGASGGEPRFTEDPTQRVQDFSFVVDHLVTL
FT                   PYVDADRIGVLGICGGGGYSISAAKTERRIKVVGSVVGVNFGHLLHEAFSGYDPIATRE
FT                   AIAGQRTAEARGAEPNVENLLPPTVDAAAGTGLDVVEATDYYKTPRGEKPNGATRSLIS
FT                   RRAAGYGWDAFTHAKYSSPSRCVSSSETSPVRSVPTVTASRSTAAPAPRRSNSSWPKAS
FT                   RTTTCTTSPTRSGRLSTPSSPSTTRTSDRTSTHHNQKDSVMDSITFPNGPITMAGNLFL
FT                   PDNFDPQASYAAVVTVHPGGGVKEQTAGLYAAKMAEEGFVALAYDASFQGESGGDPHHL
FT                   EDPFARAEDVRAAVDFLQSLGYVDAERIGVLGVCAGGGYAVNAALTDYRIKAVTTVSAV
FT                   NIGASFRRGWYGTDSDAAFFRENLAAHSEAN"
FT   gene            638735..639160
FT                   /locus_tag="RHA1_ro00563"
FT   CDS_pept        638735..639160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00563"
FT                   /product="possible nitroreductase"
FT                   /note="GO_function: GO:0016657 - oxidoreductase activity,
FT                   acting on NADH or NADPH, nitrogenous group as acceptor;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00563"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92398"
FT                   /db_xref="GOA:Q0SJ88"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ88"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92398.1"
FT                   /translation="MHFTVYRERRRASGWQLYQAVGVERGDREASALQAFENFRFFGAP
FT                   HVAIITTDAVHGVYGAVDTGLYVGTFLLAARSLGLGAIPQAALASHSPLIRKHFDIPAD
FT                   RKILVGISFGFADTDHPANNYRTTRAPLNEVVTRIRE"
FT   gene            639259..640734
FT                   /locus_tag="RHA1_ro00564"
FT   CDS_pept        639259..640734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00564"
FT                   /product="multidrug resistance transporter, MFS superfamily
FT                   protein"
FT                   /note="tc: 2.A.1.3; GO_component: GO:0016021 - integral to
FT                   membrane; GO_function: GO:0003824 - catalytic activity;
FT                   GO_function: GO:0008199 - ferric iron binding; GO_function:
FT                   GO:0015520 - tetracycline:hydrogen antiporter activity;
FT                   GO_process: GO:0006725 - aromatic compound metabolism;
FT                   GO_process: GO:0015904 - tetracycline transport;
FT                   GO_process: GO:0046677 - response to antibiotic"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00564"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92399"
FT                   /db_xref="GOA:Q0SJ87"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ87"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92399.1"
FT                   /translation="MKTASRRTHHQLTFAVLTVGVGAYALLQSLVMPVLPTLESALGTT
FT                   QTDITWVLTAYLLSASIFTPVMGRLGDMHGKKRVFVIALVALAAGSLLAALATSLSVMI
FT                   AARVIQGIGGGVLPLAFGIIRDEFPEEKVVGAVGIIAALTAVGAGLGIVLAGPIVTVLG
FT                   FHWLFWIPLIMVVLAGLAAQILVPESRVRTAGKINWLTALLLSGWLVALLLGVSQAPTW
FT                   GWGSPIVIGLLVAAAVLAATWVAAEARSANPLIDMRMMRIRSVWAANLVALLMGVGMYA
FT                   AFGFLPQFLQTPPSAGFGFGASVTESGLMLLPLSVGMFLLGLASGRLATRLGSRNLVIA
FT                   GSIVSAIGYFVVAFLHETETDIYLATALTGIGFGLAFSAMSNVVVAAVPSEQTGVASGM
FT                   NANIRTIGGSLGAAFMASVVTAGASTSGVPQESGYTNGFVMLGVAVALGAVAALFIPAM
FT                   KRDDTTNLEPSPELRHPELALVAGGTLVGDESE"
FT   gene            640743..641375
FT                   /locus_tag="RHA1_ro00565"
FT   CDS_pept        640743..641375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00565"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00565"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92400"
FT                   /db_xref="GOA:Q0SJ86"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ86"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92400.1"
FT                   /translation="MSDPAGGKALRRDAAENRQRLLDAAATVFSARGLDVGVDEIARVA
FT                   GVGIGTLYRRFPTKDALISELVRQVLEDFLTLAHEALSAPEGEGLEQVLYGSGAILASN
FT                   RGCLSRMWNDDQTTVLRNEYRRILFELLAGAKQHGRIREDATEADLDLIFWSLRGVVAT
FT                   TRGVTDTGWRRILAVMIAGLRPGAERLDAAPLSAQDVAQIMENLWPR"
FT   gene            complement(641400..641801)
FT                   /locus_tag="RHA1_ro00566"
FT   CDS_pept        complement(641400..641801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00566"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00566"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92401"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ85"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92401.1"
FT                   /translation="MQIDPHTPTTKNPPEQFTGDVWLDRIAFPRDPGQRMVVAKVRFAP
FT                   GARTAWHSHAHGQTLHIAEGTAWVKSRGGPKVEAHAGQTLYCPPNEQHWHGASADSFME
FT                   HLAMLDNADDPATTTTWLEHVTDDEYLTG"
FT   gene            complement(641813..642697)
FT                   /locus_tag="RHA1_ro00567"
FT   CDS_pept        complement(641813..642697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00567"
FT                   /product="probable 2,5-didehydrogluconate reductase"
FT                   /EC_number="1.1.1.274"
FT                   /note="GO_function: GO:0050109 - morphine 6-dehydrogenase
FT                   activity; GO_process: GO:0009820 - alkaloid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00567"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92402"
FT                   /db_xref="GOA:Q0SJ84"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ84"
FT                   /protein_id="ABG92402.1"
FT                   /translation="MTILQLTLNNEITMPALGFGVYQTPPDDTVAAVEAALETGYRHID
FT                   TAAAYQNEREVGEAIRRSGIDRSDIFVETKIWITDYGYDATLHAFDKSSRKLGIDQIDL
FT                   LILHQALPGGFALTVEAYKALETLLADGRVRAIGVSNFMSDHLTRLRDETSVVPAVNQI
FT                   EVHPYFRQSDVLTANAEHGIVSQAWSPIGGITFYRNGSHGSTLDDPTLQSIAAAHGKTP
FT                   AQTMLRWHLQQGRQVIPKSVTPSRITENFEVFDFDLTADQLAAIDALDTGVRGGPEPDD
FT                   ITRETFGLEIPEA"
FT   gene            complement(642781..644187)
FT                   /locus_tag="RHA1_ro00568"
FT   CDS_pept        complement(642781..644187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00568"
FT                   /product="probable multidrug efflux transport protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0015520 - tetracycline:hydrogen antiporter
FT                   activity; GO_process: GO:0015904 - tetracycline transport;
FT                   GO_process: GO:0046677 - response to antibiotic"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00568"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92403"
FT                   /db_xref="GOA:Q0SJ83"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ83"
FT                   /protein_id="ABG92403.1"
FT                   /translation="MTTAVSGRATTSRTAILGIILASYFMVLLDNSVIFTGLPSIRSGL
FT                   DLSSGALSWVQDAYTLVFGGLLLLAARAGDIVGRRRLFRIGLAIFGTASLLVGIAPAGW
FT                   WMIAARAVQGIGAAIVAPTSLALITTYFDGEARNRAIAWYAATAGIGASLGLLVGGALT
FT                   EWISWRAAFLVNVPIAVALIVWSRTVLVETPRRTGRFDVIGALGATFGMGAVIFGIIES
FT                   AEAGWGSARVQAALALGALLLVGLVVHESRVQQPILPLRLFRSRERAGAYSARLLYLGA
FT                   MIGFFYFTTQLLQDGFGFSPLHAGLGFLPMTLVNFVVALVVPRLGARLSNGTLLATGTA
FT                   LTLAGMAWLSRIGPLDTYLMDVALPIVLVGAGQGLAFGPLTNAGIAGVDSADAGAASGL
FT                   VNTAHQLGMALGLGILVALAADAGANLDGPAAVTEHVDAALTGGTVLLVLALVVVLMVI
FT                   VPAARHRPVE"
FT   gene            complement(644184..645233)
FT                   /locus_tag="RHA1_ro00569"
FT   CDS_pept        complement(644184..645233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00569"
FT                   /product="possible alcohol dehydrogenase"
FT                   /note="GO_component: GO:0005576 - extracellular region;
FT                   GO_function: GO:0004022 - alcohol dehydrogenase activity;
FT                   GO_function: GO:0005520 - insulin-like growth factor
FT                   binding; GO_function: GO:0008270 - zinc ion binding;
FT                   GO_function: GO:0051287 - NAD binding; GO_process:
FT                   GO:0001558 - regulation of cell growth"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00569"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92404"
FT                   /db_xref="GOA:Q0SJ82"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ82"
FT                   /protein_id="ABG92404.1"
FT                   /translation="MKATYMFGAGDVRVIDVPDHTIQSSTDALVRIVRACVCGSDLHPY
FT                   HSMDAEPAGRSMGHEFIGVVEAIGSDVRTLRVGDFVIAPFAVSCGTCVFCTAGLQTSCV
FT                   RGGFWNDASLGTAGGQAEAVRVPLADGTLVTVPVGEDADDALLNSLLTLSDVYGTGWHA
FT                   AVRGGVGAGSVVTVIGDGAVGLSAVLSARLLGAEQIVLMGRHQRRTDLGREFGATDVVA
FT                   KRGEEGIAKVRELTGGLGSAVVLEAVGHRPAYDQAVGVVRAGGVISRVGVPQYEDAPVG
FT                   FGSLFGPNVTLTGGPAPVRAYIEQLLPAVLDGTVQPGKVFDRTVGLGQTPEGYAAMDAR
FT                   DALKVAVRP"
FT   gene            645335..646234
FT                   /locus_tag="RHA1_ro00570"
FT   CDS_pept        645335..646234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00570"
FT                   /product="possible DNA binding protein"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00570"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92405"
FT                   /db_xref="GOA:Q0SJ81"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ81"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92405.1"
FT                   /translation="MSSTDLRTEIREFLSTRRARITPEQSGLPVFGGNRRVKGLRREEV
FT                   AMLAGVSVDYYVRMERGNLAGASDSVLDALVSALQLDDAERDHLFALARQAQASTTRRP
FT                   RTPLVTVRPAIQQVLDAITDAPAWVRNGRHDIIAMNDLARALYSPVLADPRRPANTTRF
FT                   VYLHPQAAEEFFVDYDTIARDAAAMLRLEAGRNPHDKALIALVGELSTQSELFRQRWAS
FT                   QDVRFHRSGRKRLRHPSVGQLDLDFEALELPSEPGLQLNIYTAAAGTPSADALKLLASW
FT                   AASQDQLGTEHDAPSRPH"
FT   gene            complement(646315..647130)
FT                   /locus_tag="RHA1_ro00571"
FT   CDS_pept        complement(646315..647130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00571"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0008372 - cellular component
FT                   unknown; GO_function: GO:0005554 - molecular function
FT                   unknown; GO_process: GO:0000004 - biological process
FT                   unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00571"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92406"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ80"
FT                   /protein_id="ABG92406.1"
FT                   /translation="MNYFVPRGGLPPQTDLTTDRAVFTEAYAVLPRRTMSDITASLLPH
FT                   WNGTRAWVLARPLSGFAETFSQYIVEVSSGGGSDRPDADPGAEAVVFVVDGALTLTLDG
FT                   VEHVLDAGGYAFLAPGARWNLHNHGPATATFHWIRKAYAQVDGIEVPESFVTREQDIEG
FT                   VEMPDTNGAWKTQRFVDPTDIRHDMHVNIVSFEPGGAIPFPETHVMEHGLYILEGKAVY
FT                   LLNKDWVEVQAGDFLWLRAFCPQACYAGGPSRFRYLLYKDTNRHAGLQL"
FT   gene            complement(647255..647998)
FT                   /locus_tag="RHA1_ro00572"
FT   CDS_pept        complement(647255..647998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00572"
FT                   /product="repressor LexA"
FT                   /EC_number="3.4.21.88"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0008992 - repressor LexA activity; GO_process:
FT                   GO:0006260 - DNA replication; GO_process: GO:0006281 - DNA
FT                   repair; GO_process: GO:0006508 - proteolysis; GO_process:
FT                   GO:0009432 - SOS response; GO_process: GO:0045892 -
FT                   negative regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00572"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92407"
FT                   /db_xref="GOA:Q0SJ79"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ79"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92407.1"
FT                   /translation="MERDRLRFWSHAYAVLEGAVVTPYDSSVTDYDDLDMFGGLDASTL
FT                   PSRQRRILAAIRDCVAAHGCTPSTRQIGDAVGLRSASSVSKHLKSLEEKGFLRRGTAMA
FT                   RQLDVRPFLSEGKRGRSSENNVTVPVVGDIAAGAPILAEEHADEMLTLPRELVGSGTVF
FT                   GLRVRGESMIDAAICDGDVVVVRRQDEAHSGEIVAAMIDGEATVKVLRRRDGHVFLEPR
FT                   NPAYAVIDGDDAVVLGKVVSVMRRI"
FT   gene            complement(648311..649600)
FT                   /gene="dghA"
FT                   /locus_tag="RHA1_ro00573"
FT   CDS_pept        complement(648311..649600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dghA"
FT                   /locus_tag="RHA1_ro00573"
FT                   /product="glutamate dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.4.1.3"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006520 - amino acid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00573"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92408"
FT                   /db_xref="GOA:Q0SJ78"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ78"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92408.1"
FT                   /translation="MTTTTECGFGRTPEHRESDYRENAATQPRVDAATVRGGEPLLRVT
FT                   WSDPVTEARGYLVVHTLVSDLATGGTRMRAGCTMSEVEDLAKGMAAKTAVFDLPVGGAK
FT                   GGIDFDPKDPRAIGVLERFCQAMRPWLAAHWVTAEDLGVPQHLLDDVFARLGLQQSYHA
FT                   AISRAEDPQRTLRRVRAALNAPVPSGFLLGDVIGGYGVAQACIGTVNAYGWTPADTTVA
FT                   IQGIGTMGGGAAWYLYEAGMRVIAVADAFGTLYCPDGLDVPALLDLRDCYGEIDRSRVP
FT                   SHVQRLPSTAVIATAADILVPAAISYAITSDNVHQVAAKVLIEAANAATTPRAEAVLTG
FT                   RGIPVVPDFVANAGAVAWAWWVLLSQVGTDPEDSFLRLRTEMLAKVALLLGQWKLDGVA
FT                   PRQTAWDLVGANRHAPAPTDPLAVPALTIP"
FT   gene            649787..650710
FT                   /locus_tag="RHA1_ro00574"
FT   CDS_pept        649787..650710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00574"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent; GO_process: GO:0009086 -
FT                   methionine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00574"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92409"
FT                   /db_xref="GOA:Q0SJ77"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ77"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92409.1"
FT                   /translation="MELSLRRLRMLRELHRRGTVTAAALALHYTTSAVSQQLTQLERDV
FT                   GAKLFERRGRRVQLTEIGLLLAEHAEDIIRSVERATTALEQTQDGVTARLTVGVWASVA
FT                   SSLVPSALTLLAAEHPGIEVRTRELAPEDTAVAVRDGSLDFSFVIDYSDYPMQWDPELT
FT                   RVVIAVERLHAALPPGTVSAKTMALADLAEHPWILAGPTSHFGRAVRLACQRCGFEPRI
FT                   NHEVGEQATALAMVAAGLGVTLVSDLGLTLRPPGMDVVALTEPLMRTISIAHRGTEAHR
FT                   PPLQLVIDAVRAAAAARGLAARSPYP"
FT   gene            complement(650736..651473)
FT                   /locus_tag="RHA1_ro00575"
FT   CDS_pept        complement(650736..651473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00575"
FT                   /product="possible monooxygenase"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00575"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92410"
FT                   /db_xref="GOA:Q0SJ76"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ76"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92410.1"
FT                   /translation="MSRTVRRGQYAAVCPSIVEGLHDQSFTAPVAKLGAVTAQVRRLLD
FT                   GDRVRPTATHDHRPLRLGVAARTGLPIYLAGLGNKSIQLAGEVADGWTPFLVPRSWLPS
FT                   RRALLQQAGARSGRPTRFSVCPAVPTAVAADHATTREIASWWVAFYLTSMGSLYRRSLS
FT                   ERGYREQVEAVLAGNPTHDTTDVPAEALVLLDELTVWGTPDTAHDQLQHWYTAGAEMPI
FT                   LALPPHRTITELDYMLETMRPHA"
FT   gene            651475..652251
FT                   /locus_tag="RHA1_ro00576"
FT   CDS_pept        651475..652251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00576"
FT                   /product="possible hydroxylase"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00576"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92411"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ75"
FT                   /protein_id="ABG92411.1"
FT                   /translation="MLVEAAVVAGTAGSRADGLHATVARRVAARVYNHHPPLTCVYYSY
FT                   WSGLGDVRASFHARTGQLILVWPTNDGLTCIYVGWPRREFPRVRTDLDRSFHAALDLVP
FT                   GLRDTVASGQREQRFVGTADLPNQYRTSVGPGWALLGDAGHHKDPSTGMGIADAFLSAD
FT                   LLAEAIHSTRAGRPVDDALGDYQRQRDQLTANGFELALSTARLAPLSNGLTAFYRAAAA
FT                   QPEVVERIFGVLGGSVPIRDVYSAANIASVLAQANS"
FT   gene            652303..653847
FT                   /locus_tag="RHA1_ro00577"
FT   CDS_pept        652303..653847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00577"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00577"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92412"
FT                   /db_xref="GOA:Q0SJ74"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SJ74"
FT                   /protein_id="ABG92412.1"
FT                   /translation="MRGGPCGGYPRRMTAIPDSTVGTNTAVAGLESTFADELGALTVPW
FT                   QGAHAPDPTLLVLNEQLAASLRLDVQTLRSEDGVGVLSGSTAPAGAKPVAMAYAGHQFG
FT                   GYAPLLGDGRALLLGELTSSDGQRVDLHLKGSGPTPFSRGGDGFAVIGPMLREYLVSEA
FT                   MYALGIPTTRALSVVATGQNVHRYGAEPGAVLARVAASHLRVGTFEYAVRQGEVLQPLA
FT                   DYAIARHYPELTELPPGRDGNRYLSFFEAVVEAQASLVAKWMLTGFVHGVMNTDNTTIS
FT                   GETIDYGPCAFLDAFDPAAVFSSIDHGGRYAFGNQPVVLKWNLARLAETLLTLFDSTPD
FT                   DAITAVSAVLATFDERYDGHYAAGMAAKLGLAGELVDRALVDDLLTLLEEHGADWTGTF
FT                   RALADELRGHSTPLDGLVPREHIGPWLERWRGDLTKHGRGAAETADAMDCVNPLYIPRN
FT                   HQLDAALRAATDGRLAPFEKLLEVVTHPFDRRDEWSDYTTPAPPSFSKSFQTFCGT"
FT   gene            complement(654010..654351)
FT                   /locus_tag="RHA1_ro00578"
FT   CDS_pept        complement(654010..654351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00578"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00578"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92413"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ73"
FT                   /protein_id="ABG92413.1"
FT                   /translation="MTKYLISFPSGAMVLPDEDLQAVSDASHAVVEEAKDAGVWVFGGG
FT                   IDESVPPVLVDGDGTVTEGTYPQTKQLEGGYAVLELPSREAALEWAAKIAVACRCAQEV
FT                   RAFHYDPAS"
FT   gene            654869..655282
FT                   /locus_tag="RHA1_ro00579"
FT   CDS_pept        654869..655282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00579"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92414"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ72"
FT                   /protein_id="ABG92414.1"
FT                   /translation="MALRRLTMADIKPDATTTCPSISDVGSINNSHPVEPYACDHTTIT
FT                   MAKIHVKACPNVINAPAHVRSARRTSPIVPATAPTNAAIKPTGVGSNTIRPRSGPGSTI
FT                   PVVTSCGTTNSHTDTAHSTETTDALVDTFIAST"
FT   gene            655453..655719
FT                   /locus_tag="RHA1_ro00580"
FT   CDS_pept        655453..655719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00580"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92415"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ71"
FT                   /protein_id="ABG92415.1"
FT                   /translation="MGKRTVPSGTVHRVPADLRTALADDGQALKAWNDITPLARNEWIC
FT                   WVEDAKLDETRARRIKRAHTELAEGKRRPCCWPGCSHREKTGK"
FT   gene            655901..656818
FT                   /locus_tag="RHA1_ro00581"
FT   CDS_pept        655901..656818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00581"
FT                   /product="probable oxidoreductase, Zn-binding"
FT                   /note="GO_function: GO:0008270 - zinc ion binding;
FT                   GO_function: GO:0016491 - oxidoreductase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00581"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92416"
FT                   /db_xref="GOA:Q0SJ70"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ70"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92416.1"
FT                   /translation="MKAVHIHENRGPANPELLVLEDAPDPHAATGDVIVRVHAASFVPD
FT                   ELDWPGTWTDRAGRDRTPCIPAHEVAGVVTEVGYGTTGFEVGDRVFGLTDWHRDGGAAE
FT                   YVAVEARNLAAIPDTVGFQASAALPLAGLTAWQGMFRHGGLEFGDAADRTVVVHGGAGG
FT                   TGSLVVQLAHAAGSRVVATGRRAAEERARAHGADGFLPLDGERDLDQLAPVDLVFDTIG
FT                   GDALARSAAIVKPGGVLVSISAPPTVTPRGGRTVFFIVEPDRSELVKLAQLTSQGYLRP
FT                   HVGAVHPLAETRAAFLSKRRGVPG"
FT   gene            657037..657480
FT                   /locus_tag="RHA1_ro00582"
FT   CDS_pept        657037..657480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00582"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00582"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92417"
FT                   /db_xref="GOA:Q0SJ69"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ69"
FT                   /protein_id="ABG92417.1"
FT                   /translation="MTSTPPSTGTSNATPAPTGGTTKKARIAGLVVSALVVLFLLFDSL
FT                   IHIANTQMVREAMAELGFAENLNRVIGVVLLVCLILYIVPATAILGAVLLTGYLGGAVA
FT                   TNMLTEQPIVSTTLFPIYVGIFVWGGLYLRDARVRSIMPVRRT"
FT   gene            complement(657533..658825)
FT                   /locus_tag="RHA1_ro00583"
FT   CDS_pept        complement(657533..658825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00583"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00583"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92418"
FT                   /db_xref="GOA:Q0SJ68"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ68"
FT                   /protein_id="ABG92418.1"
FT                   /translation="MSREDPDRLSADDAHILGLESAVITGHTLKLVVLGPATSPLDVEA
FT                   LRTAVAERLSSQPRATQRIDTSGPEPRWVEATAFEISDHVRRREEPGCASRDDLWRAVS
FT                   KLMSEHLDHERPLWTFDLIGPLGDGREAIAVRIHHAMADGISAVRFLDDVLWDRHLEPP
FT                   LGGTRPGLRAASPQRSRIDEALRMPAVVHRELGHRGSHSPFDRPISAARELAFTVAPLA
FT                   ELKAIGASRPGRPTVNDVLLAIVAGGLRSWLGAGQAALPRLRAQVPVSLHHRDEGAGEL
FT                   GNRDSFLNVDLPLAEADPLTRLDRINAETSKRKLLDDAEELFDLFHALGRVKRVEEAAK
FT                   RLAGSAREFSLSISNVPGPPVPVSVSGRRVERLFSSSEPAAHHALRISAISCAGIVGIG
FT                   LCTDPEALPDVARLAVAMEDSYAELRDAAIT"
FT   gene            complement(658944..660590)
FT                   /locus_tag="RHA1_ro00584"
FT   CDS_pept        complement(658944..660590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00584"
FT                   /product="possible proteinase"
FT                   /note="GO_function: GO:0008233 - peptidase activity;
FT                   GO_function: GO:0008415 - acyltransferase activity;
FT                   GO_function: GO:0016491 - oxidoreductase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00584"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92419"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ67"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92419.1"
FT                   /translation="MPGIDGHLDSRQRAGARFARRTRFVALVGGLTATLALGPVPLATA
FT                   QPAPGDDLRWGSCPAEYELDPASDQCASVTVPRNYADPAAGTIDVLVTRHRAEDPGSRR
FT                   GVLFTNPGGPGGDAIGSNSMFVEILPDAVRTQWDVIGVQPRGLPYAGAVECVLAPEQTT
FT                   AMSLGFGGAATRNACESAAPGTTAHLTTENTAKDWEQVRLALGEDVIDIYGLSYGTILG
FT                   STYATLFPQHTGRMVLDSAVDQKWLWNDVLWQQNDGYKDRFYDLMDWIAAHDDTYGLGD
FT                   TPLKVYQRWSDRIVEEAGGNPTLAPPPAQIGDVPPGLQAVADAYRGGVDLTGPARVQFE
FT                   AFVRRLADPSHAQMSSSIYVMTRQVLPARNSWPLMARVIRDGRDAIPDGTAMDDLTEQE
FT                   YERIAQAQMMQSLVLCNENNVAARPDRIPGWLFSTFVTGDLFDLIGYSYSAGPECTGAP
FT                   PVVALPTLGNRGLATAPLVLQGMRDPQTPYQGGVQLAHDMGAHLVTVEGGDHGAGIQGG
FT                   NAVVDQTVTEYLETGRTAVTHAPEAPITAPL"
FT   gene            660860..661231
FT                   /locus_tag="RHA1_ro00585"
FT   CDS_pept        660860..661231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00585"
FT                   /product="possible dihydrolipoamide acyltransferases"
FT                   /note="GO_function: GO:0016740 - transferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00585"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92420"
FT                   /db_xref="GOA:Q0SJ66"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR025540"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ66"
FT                   /protein_id="ABG92420.1"
FT                   /translation="MRYEVVESDTATALGSGDVPVLSTPRLIAWMEAATVTCAASFIGA
FT                   GQTTVGTAVRIEHRGPTPVGATVEIAAGPPAAAVGHRLTFTVRATDSSGKVVASGEIDR
FT                   AIVDRDRFLAAASPAKPDR"
FT   gene            complement(661312..661734)
FT                   /locus_tag="RHA1_ro00586"
FT   CDS_pept        complement(661312..661734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00586"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92421"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ65"
FT                   /protein_id="ABG92421.1"
FT                   /translation="MVNRNGCRIERVGSRVPDSRECRPICGRCKERPFDAKRCRPARPG
FT                   AAQIRTARPSPRVGTTPDGEPNEPSTTHHPSRPRPHTPESRNRMTIDHDKSELPLFSAQ
FT                   RTLTHSTPEPVSDAPRTGDSPTQTSAEIHRSLFSDE"
FT   gene            661961..663304
FT                   /locus_tag="RHA1_ro00587"
FT   CDS_pept        661961..663304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00587"
FT                   /product="succinate-semialdehyde dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.2.1.16"
FT                   /note="GO_function: GO:0009013 - succinate-semialdehyde
FT                   dehydrogenase [NAD(P)+] activity; GO_process: GO:0008152 -
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00587"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92422"
FT                   /db_xref="GOA:Q0SJ64"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ64"
FT                   /protein_id="ABG92422.1"
FT                   /translation="MSLYAVVDPATGKTVREYPTATDEQMQAALSAAEKAHREWSRGST
FT                   VVERAELLRKVAELHTERRDELAKIIQREMGKPLDQSLGEVDFSAAIYQYYADNAEKFL
FT                   ADEPIDLVEGDGTALIRRNSIGVLIGIMPWNYPYYQVARFAGPNLALGNTIVLKHAPQC
FT                   PESAAALHQIFTDAGYPEGAYVNVYATNEQIADAIADPRVQGVSLTGSERAGAAVAEIA
FT                   GRNLKKVVLELGGSDPFIVLSSDDLDATVKAAIEGRFENTGQACNAAKRFIIAEDLYDD
FT                   FVGRFTAEVLATADGLAPLSSVAAADRLSEQVQQAIAEGATLVSEGERQGAFFPPAVLT
FT                   NVSRDSRTYREELFGPVATIYKVRSEDEAVELANDTPFGLGSYVFTTDPDQAYRVADSL
FT                   EAGMVFVNAVGAEGVELPFGGVKRSGFGRELGKYGIDEFVNKKLIRVS"
FT   gene            complement(663429..663632)
FT                   /locus_tag="RHA1_ro00588"
FT   CDS_pept        complement(663429..663632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00588"
FT                   /product="cold shock protein"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00588"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92423"
FT                   /db_xref="GOA:Q0RYH3"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RYH3"
FT                   /protein_id="ABG92423.1"
FT                   /translation="MAQGIVKWFNGEKGFGFIAPDDGTPDVFVHYSEISGSGFKSLDEN
FT                   QRVEFEVGQGQKGPQATNVRSV"
FT   gene            complement(663789..664196)
FT                   /locus_tag="RHA1_ro00589"
FT   CDS_pept        complement(663789..664196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00589"
FT                   /product="possible methyltransferase"
FT                   /note="GO_function: GO:0008757 -
FT                   S-adenosylmethionine-dependent methyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00589"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92424"
FT                   /db_xref="GOA:Q0SJ62"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ62"
FT                   /protein_id="ABG92424.1"
FT                   /translation="MTLVVADGENADEAVNGQRFAAVLCHGVLGYLEQPEPLVDQLCRC
FT                   TGAGGVVSITTGNAKAMAVRPALEQRWDDALASFDTGGEIGVLGVPTRADTVEELRELV
FT                   RIRGVEPMRLLPSTQPRLSPRGTQRSGLTGH"
FT   gene            complement(664193..664672)
FT                   /locus_tag="RHA1_ro00590"
FT   CDS_pept        complement(664193..664672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00590"
FT                   /product="possible methyltransferase"
FT                   /note="GO_function: GO:0008757 -
FT                   S-adenosylmethionine-dependent methyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00590"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92425"
FT                   /db_xref="GOA:Q0SJ61"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ61"
FT                   /protein_id="ABG92425.1"
FT                   /translation="MESESLRSCRFSEKTVEPAPHARRDTAEAGQSADRLTRSRIDPID
FT                   NVDNGPRSRPSSRCSNHHLGAVGDDTWAGVADQFADEAYASVKGRVRIYVLHQQLLEHL
FT                   PAPPATVLDVGGGAGNQSFPLARAGYDVTVPDPSSVMLDKLDSDSSDCLVRPSDG"
FT   gene            664696..665835
FT                   /locus_tag="RHA1_ro00591"
FT   CDS_pept        664696..665835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00591"
FT                   /product="possible aldo/keto reductase"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0005244 - voltage-gated ion channel
FT                   activity; GO_function: GO:0016491 - oxidoreductase
FT                   activity; GO_process: GO:0006813 - potassium ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00591"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92426"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ60"
FT                   /protein_id="ABG92426.1"
FT                   /translation="MEQTRCCAVSPAPGDTARQSVTGPRQQPNRTEETTPMTDSPLDLT
FT                   YAAAEDRYEKVPYHRTGNSGLDLPAFSFGLWQKFGSDYAFATQREIILHAFDLGITHFD
FT                   NADRYGPPHRAAQKNFGAVLAKDLAPYRDELILSTKAGNPIGPSPYLKGGSRKSILTSL
FT                   DHSLRDLGTDYVDIFYHHSPDLSTPLEESVGALVSAVEQGKALYVGISNYLPDRTHEAA
FT                   ELLRQAGVPLLIHQARYSIYDRRPEQNGLLDTARQDGFGLIVYSPLAQGLLTDKYLETI
FT                   PERARAQNSAFLTPDVIDETYRQRTAELNKIAEARGQSLAQLALQWVLRRQEVTSALIG
FT                   ASSTEQLDHNIAALNFPPLTDEELALIEEHGVHGTGLRL"
FT   gene            complement(665931..666995)
FT                   /locus_tag="RHA1_ro00592"
FT   CDS_pept        complement(665931..666995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00592"
FT                   /product="alkanesulfonate monooxygenase"
FT                   /EC_number="1.14.14.5"
FT                   /note="GO_function: GO:0004497 - monooxygenase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00592"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92427"
FT                   /db_xref="GOA:Q0SJ59"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ59"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92427.1"
FT                   /translation="MSLEFLWYIPNQVTPGHRGDAVTVDHNSLDTLTTQAKALEEHGWK
FT                   GALIGTGWGRPDTLTVAAALAARTATFEPLIAIRPGYWRPAHFASAVATLDHLTGGRVR
FT                   INIVSGKDNLGAYGEHESDQAHRYARTKEFLQLVRKLWTEENVTYRGEHFQVTDSTVLP
FT                   RISPREDRPHPKLYFGGASEAAERVAATEADVQLFWGEPLAGVQERIERLRSLSQELGR
FT                   EHAPLEFGLRITTFVRDTTEQAWAEAEAKVAEMAKNQGAPPQNPHRQTAVGQQRLLDLA
FT                   TRGDVLDDNLYTAPGKVGGGGAGTTWLVGSPEDVAKSLRKYQDLGITHFVLSDTPYLPE
FT                   IERQGNQLLPLLRE"
FT   gene            667534..668043
FT                   /locus_tag="RHA1_ro00593"
FT   CDS_pept        667534..668043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00593"
FT                   /product="probable acetyltransferase, GnaT family protein"
FT                   /note="GO_function: GO:0008080 - N-acetyltransferase
FT                   activity; GO_function: GO:0016614 - oxidoreductase
FT                   activity, acting on CH-OH group of donors; GO_function:
FT                   GO:0050660 - FAD binding; GO_process: GO:0006118 - electron
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00593"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92428"
FT                   /db_xref="GOA:Q0SJ58"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ58"
FT                   /protein_id="ABG92428.1"
FT                   /translation="MPSELALSTHHVREVSWFDPDAEALRAAMADEVGPRYSDRVSTAD
FT                   RAATNAVDPTSVFLTVVVYTAAGATDNRESVGHAALRWNGDDLELKRMFVTVEHRGTGV
FT                   STALLSAVEDAARKAGRPRLILQTGDRQPDAVRLYEKSGYSRIPIFSPYEILPFSNCFE
FT                   KVFDQG"
FT   gene            complement(668058..669470)
FT                   /locus_tag="RHA1_ro00594"
FT   CDS_pept        complement(668058..669470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00594"
FT                   /product="probable cystathionine beta-synthase"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0004122 - cystathionine beta-synthase activity;
FT                   GO_process: GO:0006535 - cysteine biosynthesis from serine;
FT                   GO_process: GO:0019343 - cysteine biosynthesis via
FT                   cystathione"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00594"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92429"
FT                   /db_xref="GOA:Q0SJ57"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ57"
FT                   /protein_id="ABG92429.1"
FT                   /translation="MTILDPPTVDAASLGVYDSITDAIGNTPLVRLNRVTGSISATVYA
FT                   KLEFLNPGGSVKDRAALAMIHAAEESGELLPGGTVVEGTSGNTGVGLTLVAAARGYRSV
FT                   VVVPDKTSVEKIALLRAHGAQVHVTPGGRPSHHPEFVRNVATRLAAEIPGGWLAGQYDN
FT                   PANPDAHRTTTGPEIWRQTRGRVTHFVAGVGTGGTITGTGEFLTKISGGAVKIIGADPE
FT                   TSVYGGGDGRAWYIESVGHFLHPQTEHDEWPDSYHPDVVDRLERIPDIEALTVLHRLAR
FT                   EEGLLVGGSAGTAVAAALRVARTLGPDDVVVVIVPDSGRAYLSKYFDNEWLGRLGFPLY
FT                   HAATGPVVRDALGGRGIAPRAVPSTATVAEARELLADTPALPVVLARPVTGPVVVAEIQ
FT                   GTVSAAALSDAPDDDPIGVHVDQPLPVVGVTEELSVAVRRIAGHRGPVVVSENGRAVVL
FT                   VDADVVRTSPVA"
FT   gene            669688..669963
FT                   /locus_tag="RHA1_ro00595"
FT   CDS_pept        669688..669963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00595"
FT                   /product="possible transcriptional regulator, WhiB family
FT                   protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00595"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92430"
FT                   /db_xref="GOA:Q0SJ56"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ56"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92430.1"
FT                   /translation="MSTPVTTLQPHDTELWQWRLSARCHEADAEIFFPADAERRNARSE
FT                   REDLAKEFCRGCAVVEECLEYALHTGQQHGVWGATTPGERLARLGR"
FT   gene            complement(670144..670998)
FT                   /locus_tag="RHA1_ro00596"
FT   CDS_pept        complement(670144..670998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00596"
FT                   /product="probable transcriptional regulator, GntR family
FT                   protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00596"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92431"
FT                   /db_xref="GOA:Q0SJ55"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ55"
FT                   /protein_id="ABG92431.1"
FT                   /translation="MCRSELVCFECPGRSLVYGIPNDPGAEEITEACNDARESLRPSRP
FT                   IPRTWSRAMTTRRTAQRSASIGGTHQSLRDRAYIELRERIIEGRYPAGFRLVERELSEE
FT                   FGLSRIPLREALQRLESEGFVTVAPRRGAVVAKFDAAAAEHLFDVRESLEGLAARLAAL
FT                   HATADELDALRAIVARSRAAAETGKTRQVVALNADFHRTIVEASHNPLLQDLMAPLDAR
FT                   LRRLFHLTSTRDDGDTMCGEHEQLYQALRARDADGAEELARRHVVGTRVEALRSLAAET
FT                   ETT"
FT   gene            671033..672304
FT                   /locus_tag="RHA1_ro00597"
FT   CDS_pept        671033..672304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00597"
FT                   /product="probable N-isopropylammelide
FT                   isopropylaminohydrolase"
FT                   /EC_number="3.5.99.4"
FT                   /note="GO_function: GO:0047420 - N-acyl-D-amino-acid
FT                   deacylase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00597"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92432"
FT                   /db_xref="GOA:Q0SJ54"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ54"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92432.1"
FT                   /translation="MHHSIGTVHDPTAPDTATPTALEDVTLPCGRRADVVLHGDRIESV
FT                   DDHRPGHHRPGAYRLGGALLLPALVDGHCHLDKTLLGSPWQPHRTSPTLREQIATERLS
FT                   RRNTQAPATERAAALARRMVSLGTGHVRSHVDIDPDVQLTGLHALLAVREQFRTRLGIQ
FT                   LVAFPQSGVVTAPGVADLLDAALADGADVIGGLDPAGFDGDVDGQLNVVFGLAERHGAG
FT                   VDIHLHDGGEAGAHQLREIATRTKALGLGGKVTVSHAYALGQLDYHDLDRVAEALARAG
FT                   VAIMTNGPSRSMPPVLRLREHGVRVFAGSDNIRDTWWPYGTADMLERATIIGLQGELMT
FT                   DDDLRYAAALATDEAAAALGLTDYGLAPGKRADVVAVAAGSVPEAVASHPERLLVLHGG
FT                   RIVGPTPLTTIRIQPPTFEDSRDH"
FT   gene            672294..673781
FT                   /locus_tag="RHA1_ro00598"
FT   CDS_pept        672294..673781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00598"
FT                   /product="probable amino acid transporter"
FT                   /note="tc: 2.A.3; GO_component: GO:0016021 - integral to
FT                   membrane; GO_component: GO:0019866 - organelle inner
FT                   membrane; GO_function: GO:0005279 - amino acid-polyamine
FT                   transporter activity; GO_process: GO:0006865 - amino acid
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00598"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92433"
FT                   /db_xref="GOA:Q0SJ53"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ53"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92433.1"
FT                   /translation="MITDRNVSQAEAPAQKTADGRLAAGRIGTFDLVFFVVAAAAPLTV
FT                   LAGVAPFAIGIGGAGAPLAYLIAGALLTLFAAGFTAMSLYVRNAGAFYAYVARGLGRSL
FT                   GVGIAYIAVMSYNLITPGVAAAFGYFAAGTIRSATGADVPWWVLSGVCVAAVGVLGWLK
FT                   VTLSAKVLGVALILEVASLLVMNAGILGERGLAALDVKSFDPGTLATGGVAGMFVLVIG
FT                   AFTGFEATAIYAEEARDPKRTVPRATYIAVGFLALFYAGGVWLIMGAFGTDTAVAMAGS
FT                   AAGPDLTFEAGGLFVGAWLADTMHALIIVSAFAAALAFHNAAARYLFALGREGLLPRFL
FT                   GRVSARHGSPSGAVIAQTGFSAVIVLAGAASAVDPYSVVFLWTNSIGVLGIMAMQAFAA
FT                   LAVYAFFRRDRRGLSAARVVWAPLISCAGLTVLTVLAIVHFDLLTGRSGFVNVLLLAPL
FT                   PIVAAAGLYVALRIRRSDPARYASLTSVDVERDRETR"
FT   gene            673778..674986
FT                   /locus_tag="RHA1_ro00599"
FT   CDS_pept        673778..674986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00599"
FT                   /product="N-isopropylammelide isopropylaminohydrolase"
FT                   /EC_number="3.5.99.4"
FT                   /note="GO_function: GO:0047420 - N-acyl-D-amino-acid
FT                   deacylase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00599"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92434"
FT                   /db_xref="GOA:Q0SJ52"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ52"
FT                   /protein_id="ABG92434.1"
FT                   /translation="MTVEDTTVTVFRDVRPFGGAARDLIAVNGILAQSIPDGAAVDYVD
FT                   GLGKTAVPTLVDAHIHPDKTAWGEPWYSRRTAHAIEELVAGDVELHHAQPPVADRALRL
FT                   MSHAATLGTRAMRAHVDVAPAYGLAGVEAVATARDALRHAMDVQIVAFPQHGVDRTPGA
FT                   AGLLEVAAESGLIDVIGGIDPAGFDHTPGGTGRDPRQLDIVFGIAKRHELPIDIHLHDT
FT                   GETGAATLTDIAQRTRAAGLQGRVTVSHAFAVAELSCHSLESTADLLAEADIALTTAAL
FT                   SATTALPFRHLSQRGVRVGLGSDGVRDNWSPFGNADMLHRAWLLGWALDARLDADLEAC
FT                   YTLAADGGAAVMGLPRADLQPGSPADFMLLDGECVPQIVVDVPRRDTVVRAGRVVARDG
FT                   LLL"
FT   gene            complement(675011..675679)
FT                   /locus_tag="RHA1_ro00600"
FT   CDS_pept        complement(675011..675679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00600"
FT                   /product="possible anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00600"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92435"
FT                   /db_xref="GOA:Q0SJ51"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ51"
FT                   /protein_id="ABG92435.1"
FT                   /translation="MVITDRCQQMRTMLGMYALGRLDDSETITLRAHLDGCPGCRTELR
FT                   LLTPVAAALSAADPDRITEPAPRPSSTLPDAIFGAVDRERGRKPYHRIAVAAAAVVIAV
FT                   GLVAGGFFLRGGTPTAPPGQPVAFTVLAAGVDASARVENRAWGTGISLDVAGLPQGRTY
FT                   NVWLQRSDGSRMNAGSFIAGGDKTMSMQLAVGLPMSDATMLGVSAPGDDRTLLQAPLRS
FT                   "
FT   gene            complement(675666..676208)
FT                   /locus_tag="RHA1_ro00601"
FT   CDS_pept        complement(675666..676208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00601"
FT                   /product="sigma factor, sigma 70 type, group 4 (ECF)"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_function: GO:0003899 - DNA-directed RNA
FT                   polymerase activity; GO_function: GO:0016987 - sigma factor
FT                   activity; GO_process: GO:0006352 - transcription
FT                   initiation; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00601"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92436"
FT                   /db_xref="GOA:Q0SJ50"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ50"
FT                   /protein_id="ABG92436.1"
FT                   /translation="MRTRGGQSEGGLDDETVLRAAYDEHGRELFALAYRSLGDRGRAEE
FT                   AVQETFLRAWRRADRYDPRRATLRTWLYAICRNVVIDAIRARAARPELADAAPPELPAP
FT                   ERPLEQLLVGLEMEEALRRLSDQHRCVLVEIHLRDRPAAEVAAQLGIPVGTVRSRVYYA
FT                   LKALRLVLEEMGWHGDY"
FT   gene            676432..676890
FT                   /locus_tag="RHA1_ro00602"
FT   CDS_pept        676432..676890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00602"
FT                   /product="possible lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00602"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92437"
FT                   /db_xref="InterPro:IPR005297"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ49"
FT                   /protein_id="ABG92437.1"
FT                   /translation="MLKKSILAAAGAGATIALMSACGAATDDAQRPMPPSASAAGQVEL
FT                   GTRDTALGTVLTDGDGFTLYRFDEDTPGTIRCTGPCAEIWPPTLGAPQPDATLSARAGA
FT                   TTRPDGTEQITYDGHPLYRFAKDTAPGQTGGDGVKGTWHVVTVDSAHG"
FT   gene            676883..677986
FT                   /locus_tag="RHA1_ro00603"
FT   CDS_pept        676883..677986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00603"
FT                   /product="catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="GO_function: GO:0004096 - catalase activity;
FT                   GO_process: GO:0006118 - electron transport; GO_process:
FT                   GO:0006979 - response to oxidative stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00603"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92438"
FT                   /db_xref="GOA:Q0SJ48"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024168"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ48"
FT                   /protein_id="ABG92438.1"
FT                   /translation="MDDATTPPVQAPRPAVSRRSALLGLAAVGAIAAVDVGGFLCAAGT
FT                   LDADALTPARLTDRFEEVAGHHDGFRRNHAKGVGATGYFTATGAGSIVSTASVFRAGRI
FT                   PVTGRFSLSGGNPSTPDADDTVRGLGLAFDLPDGEQWRTAMINTPVFPDRTPDGFYERL
FT                   LASKTDPATGKPDPDRMAAFLSRHPETAAAMNFIRQHPPTSGFDNSTFYGLNAFHCTND
FT                   AGVMVPVRWTLVPEQPARSPGLPPLGRDHLFDTLTAAVSRATLRWRMLLTIGQPGDRTD
FT                   DATRPWPPTRQVLDVGTVTIEAVRTEAPHNARDLNFDPLILPTGIAPSDDPLLSARSAV
FT                   YTESFTRRSGEPEPPAPVDVDGVRDDR"
FT   gene            677976..678599
FT                   /locus_tag="RHA1_ro00604"
FT   CDS_pept        677976..678599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00604"
FT                   /product="cytochrome B561"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00604"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92439"
FT                   /db_xref="GOA:Q0SJ47"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ47"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92439.1"
FT                   /translation="MTADPTARPLRFAPTVRLLHWAMAVMVIAQLLVGAVMVTTLDHYH
FT                   LLRAVHVPLGAAILLLVIVRIGNRLVCRTPAPPATMGPVERRVATASEYLLYGLLVIQP
FT                   LTGWAMLSAGGNPITLYQHLHLPTLLAPDPTVYAVLRRAHTAFAYLLFFTFTAHMTAVL
FT                   FHVLVLTDRLLDRMAPWRTRRESSPTASRPAPARIVDDVAAEQD"
FT   gene            complement(678895..679692)
FT                   /locus_tag="RHA1_ro00605"
FT   CDS_pept        complement(678895..679692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00605"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92440"
FT                   /db_xref="GOA:Q0SJ46"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SJ46"
FT                   /protein_id="ABG92440.1"
FT                   /translation="MRPDALIQDDYARWFVEAAGEPHFTGLLADPSLLGDMRFSGFMGS
FT                   RTRFFDEFFSSATGAGVSQAVILAAGLDARAYRLDWPTGTTVFEVDQPQVLEFKAEVLA
FT                   DHGATAKADRRPVAVDLRDDWPAALEAAGFDPGKPTAWSVEGLLAYLPGAAHDALFERI
FT                   DELSSPGSHVAVDNFAEGTDMQRFDAIRAKYFAENPFGDIDIAELFYGDERADPVQWLT
FT                   GHGWSVRRSTSLELAAAYGRPVPDLPEELVDLSERSTYLTAVK"
FT   gene            679751..680044
FT                   /locus_tag="RHA1_ro00606"
FT   CDS_pept        679751..680044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00606"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92441"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ45"
FT                   /protein_id="ABG92441.1"
FT                   /translation="MSQLSPSVRIAEIPSRSHRNSEPTTEQRKPATRPEKFGKASPKSG
FT                   PSVIDRTRAILRSGHRNQPEPIRLPRARSVTFPLTAEVTRPSGTGPNMWCTT"
FT   gene            680322..680453
FT                   /locus_tag="RHA1_ro00607"
FT   CDS_pept        680322..680453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00607"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92442"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ44"
FT                   /protein_id="ABG92442.1"
FT                   /translation="MEIDDWRVRDRQFRWFTWRFRQFQEWGLVFARTQMEEAPARRP"
FT   gene            complement(680658..682463)
FT                   /locus_tag="RHA1_ro00608"
FT   CDS_pept        complement(680658..682463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00608"
FT                   /product="possible transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00608"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92443"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ43"
FT                   /protein_id="ABG92443.1"
FT                   /translation="MADTGFTALRQFSFTTRPYLAVDDATGAPIGLDDLDVRVGWMLDL
FT                   ISGAEAHLLSRLWQPATFDVLVAGCDSRGRKLPMQGHVAAARLGWTPHYPDGVYVPSRV
FT                   TRVVTAQAVGTLRALAYRDTAITALSARFDPATGRIAAPTTAAEYVPCGYARGVVRQLT
FT                   ARSHRTAGVAAERLRITDVQAPPQTSAMARLSAADRQLAHITVTDAVMTLTVTLPTTPA
FT                   PEGRAQWRRVRVTAAIPPHLHARPISEWHLPTLHLDHRGLLLRCAANEAVPVADMRSGT
FT                   TAVGVDWSPSTLGAAAVATETPDGLVSDYRGFTYDDRGLGAKLARLQTEGQMLHRKAAR
FT                   LTRLAATAPPEVRAELEAKIAVLDEHRTAVGAKRGKINRELAFHFARQATDYAVDAQAQ
FT                   LIAVEDLTTLETRGHGHVNNNRAAQSARRQAVVALAHTAAEVGITVVSVPARGSSALCP
FT                   GCDEPLARPGGYHDAWCTRCKVGGNRDHIAGVNLAKRALLGKNNVTPRRGQLPAIRVAE
FT                   HAPVRQCRHKKSPTPRRPRHRRVRHSLPIAPQRMGVTPKQHVPAPQASVWDTVKPVPPH
FT                   GDAGSRDTRPSPTPATQVVDSVRST"
FT   gene            682850..683230
FT                   /gene="dadA1"
FT                   /locus_tag="RHA1_ro00609"
FT   CDS_pept        682850..683230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dadA1"
FT                   /locus_tag="RHA1_ro00609"
FT                   /product="D-amino acid dehydrogenase small chain subunit"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00609"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92444"
FT                   /db_xref="GOA:Q0SJ42"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ42"
FT                   /protein_id="ABG92444.1"
FT                   /translation="MEPKLGLSPYHDAIRIAGVFELPARDERVPERRIRRLVDRVHPYL
FT                   AGWTPDTKVEIRSGRAGLRPATPDSLPFIGPVPGHRGLYLAAGHGMLGVTLAPATAEGI
FT                   ADMVTTRRILEAMLPFQLAGRI"
FT   gene            683327..684031
FT                   /locus_tag="RHA1_ro00610"
FT   CDS_pept        683327..684031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00610"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92445"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ41"
FT                   /protein_id="ABG92445.1"
FT                   /translation="MRRVVRAFWGPRPEPVETLAGRWRQTLEHVTELLPAAAPPVRGEW
FT                   RQVHTSGPDTTCSPDDLTAALLDAQRAEAWSDLTGTGLRLIHTGADGWAVELSGVAGGV
FT                   PQFLLQSLVMAVDAPEGTVVPESELLAMLASVWEPDFGDVSDDDILDALEDDAGFTVGD
FT                   PVVGRFGYLSAARAVLVPDGPEAVRQDTLDGGVLLHIAAPGDIDTIFRVYGRLRDAGAL
FT                   APLPRPLDRPTL"
FT   gene            684213..684620
FT                   /locus_tag="RHA1_ro00611"
FT   CDS_pept        684213..684620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00611"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00611"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92446"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ40"
FT                   /protein_id="ABG92446.1"
FT                   /translation="MAKYLLLKHYRGAPAAVNDVPMDQWTPEEISAHIQYMQDFADRLE
FT                   GSGEFVDGQALAPDGMFVRYDGEGRPPVTDGPFAETKDLIAGWMMIDVDSYERAIELAG
FT                   ELSAAPGAGGKPIHEWLEVRPFLTEPPTIAD"
FT   gene            684808..685443
FT                   /locus_tag="RHA1_ro00612"
FT   CDS_pept        684808..685443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00612"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00612"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92447"
FT                   /db_xref="InterPro:IPR008319"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ39"
FT                   /protein_id="ABG92447.1"
FT                   /translation="MTDKTDFKKTLAAYQAPRGEFRIVDVPDLQYLMIDGHGDPNTSPA
FT                   FSDAVEALYPLAYKLKFASKRDLGRDYVVPPLEGLWWADDMDSFTTVRDKSRWDWTMMI
FT                   MTPNWVDQAMFTTAVDQVGAKNRPVRLDDVRLADLSEGRCVQTLHAGSFDDEASVLAQL
FT                   HDDFIPSNGLCVSGKHHEIYLNDFRRIAPEKQRTILRQPITTRAASGA"
FT   gene            complement(685502..686440)
FT                   /gene="dapA1"
FT                   /locus_tag="RHA1_ro00613"
FT   CDS_pept        complement(685502..686440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA1"
FT                   /locus_tag="RHA1_ro00613"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="GO_function: GO:0008840 - dihydrodipicolinate
FT                   synthase activity; GO_process: GO:0019877 - diaminopimelate
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00613"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92448"
FT                   /db_xref="GOA:Q0SJ38"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ38"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92448.1"
FT                   /translation="MTRVRRAYTRAMTDSSAPVAPFGRVLTAMATAFTVDGEIDEEATA
FT                   RIAVHLVDHGHDGLVVSGTTGEAATTTTAEDGRILQVVKDAVGDRAKIVAGVGTNDTRH
FT                   TLELARQAVMHGADGLLLVTPYYNKPSQGGVLQHFRYVVEAVDAPVMVYDIPSRAGTKL
FT                   APSTFETMAEWPSVVAVKDAAGDPTQAIMLRELGYAVYSGDDSLTLGFLAYGACGVVSV
FT                   LGHVAGDEIRTMIDAFVSGDVETAREINARLQPALRAVMGVPNYGATTVKGALQLLGVL
FT                   QNRIVRSPLLALDDGEYEALRTGLHASGLLH"
FT   gene            complement(686611..686859)
FT                   /locus_tag="RHA1_ro00614"
FT   CDS_pept        complement(686611..686859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00614"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92449"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ37"
FT                   /protein_id="ABG92449.1"
FT                   /translation="MHPAGETDRLALFPRVLLNRGTSMLLTVTAVGLRSRRGRDAGLEW
FT                   LMGSAQFEDTPAVLKLGRTAGRITGLPRAGFLETGQS"
FT   gene            686897..687430
FT                   /locus_tag="RHA1_ro00615"
FT   CDS_pept        686897..687430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00615"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92450"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SJ36"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92450.1"
FT                   /translation="MPMIARTTLLAVATI