(data stored in ACNUC7421 zone)

EMBL: CP000434

ID   CP000434; SV 1; linear; genomic DNA; STD; PRO; 332361 BP.
XX
AC   CP000434;
XX
PR   Project:PRJNA13693;
XX
DT   29-JUL-2006 (Rel. 88, Created)
DT   04-FEB-2014 (Rel. 119, Last updated, Version 3)
XX
DE   Rhodococcus jostii RHA1 plasmid pRHL3, complete sequence.
XX
KW   .
XX
OS   Rhodococcus jostii RHA1
OC   Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae; Rhodococcus.
OG   Plasmid pRHL3
XX
RN   [1]
RP   1-332361
RA   McLeod M.P., Warren R.L., Araki N., Hsiao W.W.L., Myhre M., Fernandes C.,
RA   Miyazawa D., Wong W., Lillquist A.L., Wang D., Dosanjh M., Petrescu A.,
RA   Morin R.D., Yang G., Stott J.M., Schein J.E., Shin H., Smailus D.,
RA   Siddiqui A.S., Marra M.A., Jones S.J.M., Holt R., Brinkman F.S.L.,
RA   Miyauchi K., Fukuda M., Davies J.E., Mohn W.W., Eltis L.D.;
RT   ;
RL   Submitted (24-JUL-2006) to the INSDC.
RL   Microbiology and Immunology, University of British Columbia, 1365-2350
RL   Health Sciences Mall, Vancouver, BC V6T 1Z3, Canada
XX
DR   MD5; 12f31495cabdec2f9d041cb32dfa1cf1.
DR   BioSample; SAMN02604146.
XX
CC   Bacteria available by contacting Lindsay Eltis (leltis [at]
CC   interchange.ubc.ca).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..332361
FT                   /organism="Rhodococcus jostii RHA1"
FT                   /plasmid="pRHL3"
FT                   /strain="RHA1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:101510"
FT   gene            377..655
FT                   /locus_tag="RHA1_ro11001"
FT   CDS_pept        377..655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11001"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00648"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVN8"
FT                   /protein_id="ABH00648.1"
FT                   /translation="MYITRVNTDSSTDYRNMLSINNFRNRLKQDEQTPVRPPTPRRRHS
FT                   PEPGRRRPHITNRGHVITPGHSGITPPHSTRPAPRGSGAGRARREAN"
FT   gene            complement(652..921)
FT                   /locus_tag="RHA1_ro11002"
FT   CDS_pept        complement(652..921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11002"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00649"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVN7"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00649.1"
FT                   /translation="MTVEVVIVRDPDGPTSVWVFVGGEAVEVAESCIDAGAGWDWEDWT
FT                   EHRDEMLAGASPAARELLLTLFDGPPGGVYVEGRDGRPWLDPAA"
FT   gene            complement(918..1274)
FT                   /locus_tag="RHA1_ro11003"
FT   CDS_pept        complement(918..1274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11003"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00650"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVN6"
FT                   /protein_id="ABH00650.1"
FT                   /translation="MTTTTNTNIATPAEVYMCQGERALNRGTHYIEESIWVYLMRDWDG
FT                   IDRWVLDPVTVDGCGLDSGLEDGARNSECVCEDKVECNAIRDRMDRAALPSADDLLHLL
FT                   AESLGYMVTRAAQS"
FT   gene            complement(1295..1675)
FT                   /locus_tag="RHA1_ro11004"
FT   CDS_pept        complement(1295..1675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11004"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11004"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00651"
FT                   /db_xref="InterPro:IPR024559"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVN5"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00651.1"
FT                   /translation="MSTAASTLTAQAVRIGVDGRLEVIDLGARESTGAAIRSAIGCRWF
FT                   DVVRLTPDLDMWVDDEGAIQADAQVNLMATAIARAHGAIWQPFCGAVVFAAHDGNGATV
FT                   GLSDAQKDALLTGAVFAPTVNH"
FT   gene            complement(1672..2379)
FT                   /locus_tag="RHA1_ro11005"
FT   CDS_pept        complement(1672..2379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11005"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00652"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVN4"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00652.1"
FT                   /translation="MSVDVAVIENVTSGAGVAAPAGGVFPADGVFVEVREGEAWTAGWL
FT                   VADRIDVSALSVNGVAEDKRLVSVALVPLSPDAPVWQGRVHPDQVVVASVQRPVPVFWD
FT                   RVAGSLAAVMISRREVATLRERLEGAHADHMKWIDAVATSAHQWADENNLCSEFDQFME
FT                   EHGLPPRSREFTVEALVTITTKVSVPVSARSEEVAEDEVDGEVLARALGRRIGGFRRHG
FT                   LDLREYTVTEVQA"
FT   gene            2650..3609
FT                   /locus_tag="RHA1_ro11006"
FT   CDS_pept        2650..3609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11006"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00653"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVN3"
FT                   /protein_id="ABH00653.1"
FT                   /translation="MCADECTVVMVICQDLAMTSPQLGDLPLFVDRIGRITARAQRASE
FT                   LHDWGLHPQAADTGSSLALDDDGFIPARGGSLVQRAAMWPINCATDNVSSAGRIFTDSA
FT                   TSNQLRASSIMSLCRSALESSARAIWLISDTDRAIRRQRSIGITLAEMKQQTLFNNNEV
FT                   EHHHNGTVNLPADYASAFLDGHRSLLNDYAALQEEDHQPVRPFGKTVELAATWIDEHMP
FT                   AHDSGELAKNGMAAGSKRVYSISSGVIHGYQWIVDYGRNGDLFAMIADSFAAAVNMTEC
FT                   AIALYEAQAQRPTGRTDRKYHYPKRLAPTVREWSKLYR"
FT   gene            3727..4539
FT                   /locus_tag="RHA1_ro11007"
FT   CDS_pept        3727..4539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11007"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00654"
FT                   /db_xref="GOA:Q0RVN2"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVN2"
FT                   /protein_id="ABH00654.1"
FT                   /translation="MAEQHSRCGFYRLAVQQEIVADETADVEPRDEARTSAEKIRDLRG
FT                   ELARSARNRYQTTGRWIKRRRAILTGSITLMVLVAVCFHPQAQLGTVPTWISAFGAVAT
FT                   CVGVLLALKTYRTQKQQGLEEQANQARLINAVLMPGTQRDGKFTWWVTIENRSDKSIYG
FT                   VHVRSLRAQVAEEGPAVRLSPMAITKIGELELVTGAIPMERELKAGTSFRTQWRAIDDG
FT                   DNTSHVDGPIIQYTLTDANGRVWLIADNNEPEKIARPARPSDQRRRVV"
FT   gene            complement(4577..5314)
FT                   /locus_tag="RHA1_ro11008"
FT   CDS_pept        complement(4577..5314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11008"
FT                   /product="conserved hypothetical protein"
FT                   /note="homologs found only in other rhodococci"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11008"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00655"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVN1"
FT                   /protein_id="ABH00655.1"
FT                   /translation="MTLQIGAGMVPLTVRARMAAGVAHAVPWGISLDGLLASEIRENTK
FT                   AAARAAGTDYTPYSLDTVPEDLDLPLARCTGDGAGGWHWAATFAYPEDEVPGPHVQYWS
FT                   ARPDQQALDHMAADLPALVSERQGRYRSRVMPLPLTVCRHLVWRGVGDPVAVAELLGPI
FT                   VSIGKKRGAGNGHVLSWEVAEHPAADLWEFAHLHPDGGLGRTAPAACLRDHGEMRTGGD
FT                   GQMGLRPPYMHPARRTLVFLPAP"
FT   gene            complement(5311..6162)
FT                   /locus_tag="RHA1_ro11009"
FT   CDS_pept        complement(5311..6162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11009"
FT                   /product="conserved hypothetical protein"
FT                   /note="homologs found only in other rhodococci"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11009"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00656"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVN0"
FT                   /protein_id="ABH00656.1"
FT                   /translation="MTVSRVWEIEMTARSPISHRGELIGTTAIGRRMKILQPDGSVELV
FT                   PVISGNSFRGVLRRIGEELLRDVLGYEGKLPLAVAHTLRNGGAIVKTQAEPITGRRLHQ
FT                   LRELIPQLSVFGGAIGAAPIDGCLRVGHVVPIVTEATPILRRTYEGPIPSRFDIEALES
FT                   YSHLDDVTTGHAGTTVDPAAEGGGSGSPVMRYDIETLAPGTRFESWVQLVRGSDLDQAF
FT                   TADVLAEFTRSGWLGGRTGIGHGQIATMLASDPYGAPVVDWREIVAARRTEALETLLSL
FT                   PA"
FT   gene            complement(6159..6995)
FT                   /locus_tag="RHA1_ro11010"
FT   CDS_pept        complement(6159..6995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11010"
FT                   /product="conserved hypothetical protein"
FT                   /note="homologs found only in other rhodococci"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11010"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00657"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVM9"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00657.1"
FT                   /translation="MQPGITPAQRSSHVRTRYVHRPRRRFGRPLRSGTPVQPRARPLLR
FT                   APRRLSSATQYQRARAPGRVLGPVLGVPDRYRDAHAHPVRLHLDAVGTSPADLAQSHTA
FT                   AVAGTSQPPATGAQWTRENTTSSLGSAVMNMLGENELSVTDRWLAAVPQLPGLTDPAAQ
FT                   VAERLVLLLHYGIDWSERNWVAARRGDYWDNLLPTRIRLATYNSINLHQWWTTSAARLG
FT                   SSPRTDEQRGELAILLMCEPRPVLQVMRDQTTALTLRTRIVADAVRAARTEHGLAS"
FT   gene            complement(7090..7749)
FT                   /locus_tag="RHA1_ro11011"
FT   CDS_pept        complement(7090..7749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11011"
FT                   /product="conserved hypothetical protein"
FT                   /note="homologs found only in other rhodococci"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11011"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00658"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVM8"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00658.1"
FT                   /translation="MTIAAPVDVVWAAYTAAVGTPNVAGAPETREAGCARCGQITAVMS
FT                   PVGQVVSRRFTGYESWTNLAGRRLCEVCVWVYRHRPLRTEAHIVTRDPVTLRSADPTLL
FT                   HQVLSTTIDPDTAVIVPLRPGRKHLLPDARWGMVTVEDVHLKWQADDAARLEVMCRLRG
FT                   HGFTETMLGDDAPPYAVLCRLPADEWPQVFDDWTRLTPWRRADPWWEVGLRATRRA"
FT   gene            7774..8568
FT                   /locus_tag="RHA1_ro11012"
FT   CDS_pept        7774..8568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11012"
FT                   /product="probable phosphoadenylyl-sulfate reductase
FT                   (thioredoxin)"
FT                   /EC_number="1.8.4.8"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_function: GO:0016779 - nucleotidyltransferase activity;
FT                   GO_process: GO:0006790 - sulfur metabolism; GO_process:
FT                   GO:0008652 - amino acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11012"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00659"
FT                   /db_xref="GOA:Q0RVM7"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVM7"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00659.1"
FT                   /translation="MVNAPDPGLDLAMLRGLRAPSAKADPGAVADILTRIEAHLAAHDG
FT                   YVAFSGGKDSLIVLDLARRIEPDVPVVFFDSGLDYPETYDYLTELTHTWRLDLHRIPTD
FT                   PPLLQVLADSGHWDHSAPVGTPLDLHEVLITEPARRAHQLLGPGELWGVRADESAARRH
FT                   LYTRGGRRDGIVTRADGTTAYGPIWNWTIIDVWAHIARHQLPINPVYAKLRELGVPEQQ
FT                   HRLSHLIDGSHLDRGRLTWLRRGWPTLCEQLTDVLPRIRQLT"
FT   gene            complement(8607..9860)
FT                   /locus_tag="RHA1_ro11013"
FT   CDS_pept        complement(8607..9860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11013"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11013"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00660"
FT                   /db_xref="GOA:Q0RVM6"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVM6"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00660.1"
FT                   /translation="MRLRTLVIWGTTAWAFAVIGVFYYLLWLQTRQPYTPFGFLDDATG
FT                   DQLFNAARTSATLLGVSGLGGAALIAYRKQRSTEETHDNERVSALHERYSTAAEQLGHD
FT                   NPAIRLAGVYGLASLADDWKSAGRHGETQVCIDLLCAYLRAEHEPSDLREHDVRTAIVA
FT                   AIHSRLRSGDSGRPSWRRYRFDLTATDMKGADLSDAYLVHMTLMGVSLVRADLARSVLG
FT                   VDVRLSDSFGEQLKDSMSSKNAPPRPPRKDTVYLGPMFEGVDLTEANMWGAQLSGCVLS
FT                   HARLREADLTDADMTQADLHTAELSNARLVRAKLVGAVMCADSDRSYAKFDGANLTKAD
FT                   LKYAVIGPANFSGANLSDADLRYAYIGAADLSAADLSGADLRHTDLGAVQLTGIKHDDA
FT                   TRWPTGFDVSSLTSVDTP"
FT   gene            complement(9998..11842)
FT                   /locus_tag="RHA1_ro11014"
FT   CDS_pept        complement(9998..11842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11014"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00661"
FT                   /db_xref="InterPro:IPR025487"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVM5"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00661.1"
FT                   /translation="MKTQDCATMGCGLPAAFVTRSKPAWCTDCIDGIFRTGGLEPAEPF
FT                   TTPTAWRLTTCRTCGVRAHYRLDYVVGNNAAGTPTCRACHWTKWAANTRSHPWMEFDRT
FT                   MLELLRHYSPEQILHAHPRPGVRKFLEQRWWPHERIADHLAERGYDLVDPIGEVHDDND
FT                   PVLARCRRCHRISAARIGDFGSGCTCARNTRSSDPSRPRPGRALLSESQSQALDWWDHD
FT                   HNEATVFDTVTVLATRSCHWRCPDCGLRFEEKVNVMTSSPACRACSARRREDWHAEHTR
FT                   WRSTPVADVPELATAWADDDDPRKVMVAGGGKLRRFRCPNGHHPRIKPLRFLTSGCPHC
FT                   RGAQSATSKKWLADLLPEIAAQWHPTRNGKYTPQNVVWDSQREMWWRADCCGHEWQESV
FT                   RARDGGSRLRCPACRTILGSLAWHDPGLAAEWSATNAVTAWHVRPHASLAFVPEWVCAT
FT                   DPAHVWRAPLSSRSNGAECPDCRRAGKSRVELDHHAAAVEVFGNARSGITMTDAAYTTR
FT                   KSWTTDISVDHEGLTVVIEYDGAYWHSADAKVLVDQRKSRDLLAAGCVVVRLREDDLPS
FT                   LAIDHPRYREVRVHSTVPRPRKVMEDIRDWMRGLPAGR"
FT   gene            complement(11927..12187)
FT                   /locus_tag="RHA1_ro11015"
FT   CDS_pept        complement(11927..12187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11015"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00662"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVM4"
FT                   /protein_id="ABH00662.1"
FT                   /translation="MRGLRMGLFTDDKGRPELVVHPDIKLGRAHFRPVDDQPEGEPVET
FT                   PKQRARRELKLRLGAELRAKAASRSPRHCLGGHAMSAVQSR"
FT   gene            complement(12184..13116)
FT                   /locus_tag="RHA1_ro11016"
FT   CDS_pept        complement(12184..13116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11016"
FT                   /product="conserved hypothetical protein"
FT                   /note="homologs found only in other rhodococci"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11016"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00663"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVM3"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00663.1"
FT                   /translation="MPATLRHIWGVFDAAGGDLVAYNLSPDAPPTRLDPEAGTSTTPAS
FT                   KSAGYRPAATYDDRAQERDGARQLDRMVEDAEFTRARKDLERAFPRATVPEVSERKRRE
FT                   LPIPDSIRQPPSSRQRKVRSVNKHKAQSQLPKVGYTGVQDLVSDPDRWKTVGEALSAAR
FT                   GDAQQLDEKMRSQVQRVDRAIQTAERFNDRGHILYCAVTLPHAVPQEAANLPATLHPGS
FT                   RLDFDRHTMATHAAHELDGTLGDRDVVFEVETGRGMYLGRSDTVDDTAHLLPRGMRFEV
FT                   VSAGEGRYRRPDGSIGRRMIVQLRDITGE"
FT   gene            13190..14134
FT                   /locus_tag="RHA1_ro11017"
FT   CDS_pept        13190..14134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11017"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0008757 -
FT                   S-adenosylmethionine-dependent methyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11017"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00664"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVM2"
FT                   /protein_id="ABH00664.1"
FT                   /translation="MTKPVTRSHACCRRFRRTHTSIAKHTEMKIVPYGDGGAGGNLGTH
FT                   GRPSRTRRGTLWQTNRPSPWNRHRLRSVMAGERHHANNEGEHACLQVRSRRRRRPAPPH
FT                   TIWRCTTPSWCGGATPSSGAAPANACSRTTTPTSVAGTSTSAPEPAGTSSTPPTRPRTR
FT                   RSSCSTSTRTPCRRPPHVSPTAASPRPRTPAASSPLPADIGVFDSVAANFVLHCVPGTW
FT                   EQKGRAFGHIAKVLTEDGVFFGSTILDTGVHHTPLSRALNSLYNGPIKLFHNHGDDLDG
FT                   LHTALATAFEEVEITVVGSVAVFAAHLPRRPGS"
FT   gene            14236..14538
FT                   /locus_tag="RHA1_ro11018"
FT   CDS_pept        14236..14538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11018"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00665"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVM1"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00665.1"
FT                   /translation="MPTPEPDDQKIISLNALRQRRTDDLLSGHIPLTSLLYRRHDRIAA
FT                   NLLVTDVLTTYMRGSGIGPAGVMVMLGIADDARVRDLTAEQRGQITDAIASTSGR"
FT   gene            complement(14691..15200)
FT                   /locus_tag="RHA1_ro11019"
FT   CDS_pept        complement(14691..15200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11019"
FT                   /product="possible transcriptional regulator"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11019"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00666"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVM0"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00666.1"
FT                   /translation="MGERTLPNIAWERRIWGISSTWTTWTGKFLLSLSKMVDSPSLNSP
FT                   IGSDSASRPATAACAHWRAPARSAGTAHSSTALGLTFEALVFVTMRAADRDTIEAFEQA
FT                   VAAIPHVLQAQRLFGDPDYLLRVITRDLPGFQTLYDESLAALPGVQRLSSTLVMKSVAD
FT                   NRPLPL"
FT   gene            15297..15692
FT                   /locus_tag="RHA1_ro11020"
FT   CDS_pept        15297..15692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11020"
FT                   /product="probable lysine exporter protein, LysE family"
FT                   /note="tc: 2.A.76; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0005293 - lysine permease activity;
FT                   GO_process: GO:0006865 - amino acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11020"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00667"
FT                   /db_xref="GOA:Q0RVL9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVL9"
FT                   /protein_id="ABH00667.1"
FT                   /translation="MSFLLVLTPGADWAYAIATGLRHRTVVPAVGGLLTGHLAMTAVVA
FT                   AGVAALVTRSPLVLTALTAVGAAYLVWLGITMLVRPVAPPQAGAEQAPESWARQAVKGL
FT                   GISGLNPKVFLLFLAPTGGVSQSQPGR"
FT   gene            complement(16333..16677)
FT                   /locus_tag="RHA1_ro11021"
FT   CDS_pept        complement(16333..16677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11021"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00668"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVL8"
FT                   /protein_id="ABH00668.1"
FT                   /translation="MSMTKNMSTRRKRRTTEAATRRTDNELLAFAIRWEPFGGGDEFIL
FT                   PEFGLPPVSFYRRVLADLQSGAGPELSSRVHQRVKVLCERKIRQSWAAGVTGRRAGIVS
FT                   GGADSTLDRG"
FT   gene            complement(16674..18257)
FT                   /locus_tag="RHA1_ro11022"
FT   CDS_pept        complement(16674..18257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11022"
FT                   /product="fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="GO_function: GO:0008756 - o-succinylbenzoate-CoA
FT                   ligase activity; GO_process: GO:0009234 - menaquinone
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11022"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00669"
FT                   /db_xref="GOA:Q0RVL7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVL7"
FT                   /protein_id="ABH00669.1"
FT                   /translation="MLAASAARFPEEKYQMLESTLVGTPTTIGSMLIQAAERYGTREAL
FT                   SEGNTTLSYARTLELAQKCAVSIVERGVKPGDRVAIALPNGLHHAVSYFGTQLAGAIAV
FT                   VVNTRLSAPEIAHVLSDSGASLVVSDSSFAERLTSDADVVDPQVLLTERPPHADHTPLP
FT                   GLSRSADDTAQLLYTSGTTGRPKGAAQTHANLLFNAATVREQFELTPNDRTLIVAPMFH
FT                   ASGLNSQLIGFLSAGASCVLAPEFKAAVTLATLAERRITIFAGVATMLQLMLTRPEIDS
FT                   LDLSALRLFAMGGSPVPESLPAQAISKMPNIAFANIWGMTEATSIVTFVKGDDYLARPW
FT                   SSGRAVPGTELGVTTEDGTVADLREHVGELCIRGPVVAAGYWNNPEATADTFREGWLHT
FT                   GDVGSIDTDGYVHVLDRLKNMIIRGGENIYSIEVESVLAAHPAVADVGVVGVPDDIFGE
FT                   RVRAVVSISPGQRLTSDDLRAYAARHLADYKVPAEILFIHELPRNPSGKLVKGALAQLP
FT                   ATSHGEADVS"
FT   gene            complement(18263..19051)
FT                   /gene="fabG2"
FT                   /locus_tag="RHA1_ro11023"
FT   CDS_pept        complement(18263..19051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG2"
FT                   /locus_tag="RHA1_ro11023"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase FabG"
FT                   /EC_number="1.1.1.100"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0004022 - alcohol dehydrogenase activity; GO_function:
FT                   GO:0004316 - 3-oxoacyl-[acyl-carrier protein] reductase
FT                   activity; GO_function: GO:0018454 - acetoacetyl-CoA
FT                   reductase activity; GO_process: GO:0042619 -
FT                   poly-hydroxybutyrate biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11023"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00670"
FT                   /db_xref="GOA:Q0RVL6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVL6"
FT                   /protein_id="ABH00670.1"
FT                   /translation="MNEQSDTANGHADWTTTPRPGARVLVTGALGGVGRALLAALDDLG
FT                   CRTVGIDRPGTEAQSIPCEQMIRADLSEPDEAARAVAEAASALGGLDALVGAAGIVDTI
FT                   HRAATFPIRDFQRDVEANLLAQFYVAQAAYPPLQTSTASSIVLFSSVAGQDGLPGQASY
FT                   AAAKAGVLGLTRSLAAEWARDGIRVNAVVPGLVATPKVLAMPESARQRLLRGVPMGRVA
FT                   ALGEVVGAVLYLLSPAAGYTTGQALRLDGGQNLNSDGLFR"
FT   gene            complement(19048..20415)
FT                   /gene="lpdA"
FT                   /locus_tag="RHA1_ro11024"
FT   CDS_pept        complement(19048..20415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="RHA1_ro11024"
FT                   /product="dihydrolipoyl dehydrogenanse"
FT                   /EC_number="1.8.1.4"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0004148 - dihydrolipoyl dehydrogenase activity;
FT                   GO_function: GO:0015036 - disulfide oxidoreductase
FT                   activity; GO_function: GO:0050660 - FAD binding;
FT                   GO_process: GO:0006096 - glycolysis; GO_process: GO:0006118
FT                   - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11024"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00671"
FT                   /db_xref="GOA:Q0RVL5"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVL5"
FT                   /protein_id="ABH00671.1"
FT                   /translation="MSDAFDLVVIGSGPGGYVSAIRGAQLGLRTAVVEGNALGGRCLNY
FT                   ACIPAKAVLRAADVLDEVRHASQFGIHVGTPRVSFDEVRARRDEVVASLTGGVRGLLKK
FT                   NGVEVKHGWARLAGDGAVTVDGETVHGRAIVLATGSVARPLPGLDFHGRVIGTEQAWAL
FT                   DALPDTIAVVGAGASGVELASAYARLGSKVRLIEASDRILPAEDADISAIVHAKLRRQG
FT                   IAISTGVTVSDTEQSTDAVSFTVDGRTEQTTWLVVAAGRSPDTDSLALDTAGVELDDRG
FT                   LIRVDERLRTTAPGIWAIGDLVRGPALAHKASEEGIIAAEDAAEHIPEPLLHNLIPRAT
FT                   FCSPSVASVGLTEEQARQQGYEVVVGTARYGAVGAGTVLGERDGLVKLVGDAKYGELLG
FT                   AHIVGAKATELIQELVTARALEAGLPEIATIIHGHPTLSEAVSEAARDAQGWMIHG"
FT   gene            complement(20408..21175)
FT                   /locus_tag="RHA1_ro11025"
FT   CDS_pept        complement(20408..21175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11025"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00672"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVL4"
FT                   /protein_id="ABH00672.1"
FT                   /translation="MTSIEQHPPAPTNRWFDPVELGQMSRPTMDRAIEAIDRGDLAEAR
FT                   NLCSAMRHEWRYLHDLMAEQLLGLVTFIQERFGENYVAEAWTSSMERGWRADVGKILNA
FT                   DRREIVKSLAATWRAHSTSGVGPHPGAFTIVEDDEKFTFTMNPCGSGQRLWRRGRYEGP
FT                   NAYGVTQEAHDWSYGREGFPLYCTHCTFMNESLPIRWYGAPLYPSDPPENFDHDPCVWY
FT                   WYKNPDDIPARHWERYGATKPAVSPATAGGTDE"
FT   gene            complement(21226..22119)
FT                   /locus_tag="RHA1_ro11026"
FT   CDS_pept        complement(21226..22119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11026"
FT                   /product="possible transposase"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0004803 - transposase activity; GO_process: GO:0006313 -
FT                   DNA transposition"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11026"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00673"
FT                   /db_xref="GOA:Q0RVL3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVL3"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00673.1"
FT                   /translation="MSRFQFVDDHCDTVPVKWLCQILEVSRSGFYRWRTSGPARAARAR
FT                   ADEELAERIRAIHADFDGTYGAPRITAELREAGIEVNHKRVERVMREHGIVGVHLRKPV
FT                   RTTVPDPDAAAVPDLIRRDFTASAPNTRYVGDITYLPVGDGEFLYLATVLDLGSRRLAG
FT                   WSIADHMRTELVTDAMRAAAACRGAAGLEGSIFHSDNGAQYASAEFADLCRELGVTRSR
FT                   GAVGTSADNAAAESLNATLKRETLQGRKRWNSAGEARAAIFRWITRYNTRRRHSTLGQI
FT                   CPIEFEQRSATLATAA"
FT   gene            complement(22116..22457)
FT                   /locus_tag="RHA1_ro11027"
FT   CDS_pept        complement(22116..22457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11027"
FT                   /product="possible transposase"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_function: GO:0004803 - transposase activity;
FT                   GO_process: GO:0006313 - DNA transposition; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent;
FT                   GO_process: GO:0006412 - protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11027"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00674"
FT                   /db_xref="GOA:Q0RVL2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVL2"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00674.1"
FT                   /translation="MAMKAYSAEFKADAVALYLSDPSHTFEGIGNDLGVSRETLRNWVR
FT                   AERKRTGTSTAELRADGAARPASRAGEVSSESVLEEENKQLKAQIRKLETEREILRKAA
FT                   KYFAGETNW"
FT   gene            complement(22513..23556)
FT                   /locus_tag="RHA1_ro11028"
FT   CDS_pept        complement(22513..23556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11028"
FT                   /product="Zn-dependent alcohol dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /note="GO_function: GO:0005488 - binding; GO_function:
FT                   GO:0016491 - oxidoreductase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11028"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00675"
FT                   /db_xref="GOA:Q0RVL1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVL1"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00675.1"
FT                   /translation="MKAAVYQRPGLIEVQDVPTPQPGPRDVLLRTRAVGICGSDLHVYR
FT                   KGLYGATTGWIMGHEFCGEAVEVGEEVRGASVGERYTGFSVEFCGQCYWCQRNQQRLCP
FT                   HLFEHYTGYGEPGAMAEYVLIRQAQLDQNLFAIPASLSDEAAALAEPLGTAAYSVRRAK
FT                   PQDGDTVVVIGGGMIGNLIVQTVKATVDAKVIVTEVSPERAELALRVGADEVIDARRPD
FT                   LIDAVRAATGRGRYMFGDSGMADVVFNAAAAPPTYAQSLDFVRSRGTVVLVGLSEEPAT
FT                   ADFSLIAYKDIRLIGAIGSSISSGIELLEQGRVQVDALVTNRIPLSEANSAFHQAADPT
FT                   SIKGVPP"
FT   gene            complement(23593..24861)
FT                   /gene="sucB"
FT                   /locus_tag="RHA1_ro11029"
FT   CDS_pept        complement(23593..24861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="RHA1_ro11029"
FT                   /product="dihydrolipoyllysine-residue succinyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="GO_component: GO:0045252 - oxoglutarate
FT                   dehydrogenase complex; GO_function: GO:0004149 -
FT                   dihydrolipoyllysine-residue succinyltransferase activity;
FT                   GO_function: GO:0005515 - protein binding; GO_process:
FT                   GO:0006099 - tricarboxylic acid cycle"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11029"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00676"
FT                   /db_xref="GOA:Q0RVL0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVL0"
FT                   /protein_id="ABH00676.1"
FT                   /translation="MSIDITLPQLGVEMKSALLAEWVRKDGDEVDGGEVIAIIETDKVS
FT                   YEIEAPTAGVLHTAADVDQEYKVGARLGAVSASRKEYLAVARGTDTHPDPPTSGTETTV
FT                   QPERRVEQPPASTAAAERSTNGIVLATPLARRVAADAGMDISTIEGSGRRGQIRRRDVE
FT                   AAQAQDPAAQDEPHPVSEPVDSPQPSDSPNHEQGKPLSAMRRTIADRMQQSLQTTAQLT
FT                   DVREVEVSALVELRNRLAAKAERIGFKVSFTDLFLKATALALREVPELNVTVQADRIIE
FT                   HDHVHLGMAVSVPDGLIVPVVRDADQLSLRAIHQRSEEAALAARERKVTAADLTGGTFT
FT                   VTNIGSYGSHFGTPVLNLPQVAILATGAILDRPVVRDGEVRAGKVVHLSLTVDHRIIDG
FT                   ELAGRFHNTMAALLAEPDRLLVG"
FT   gene            complement(24874..25869)
FT                   /locus_tag="RHA1_ro11030"
FT   CDS_pept        complement(24874..25869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11030"
FT                   /product="probable pyruvate dehydrogenase"
FT                   /EC_number="1.2.4.1"
FT                   /note="GO_function: GO:0004739 - pyruvate dehydrogenase
FT                   (acetyl-transferring) activity; GO_process: GO:0006096 -
FT                   glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11030"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00677"
FT                   /db_xref="GOA:Q0RVK9"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVK9"
FT                   /protein_id="ABH00677.1"
FT                   /translation="MNASAAPGQTLAMRWAINQALDEELERDPSVCLIGQDIGRAGGTF
FT                   GLTRGLFDKYGAMRVRDSPISEEGMADLALGAAIAGCRPVLEIMFMDFLTLTMDALVNQ
FT                   AAKTYYLSNGAIAAPMVVRTLAGAGVRVGAHHSQSLESWFTHVPGLKVAYPSTPSDAKG
FT                   MLKAAIRDDNPVIFVENKSLLGYKGAAPAEGDHVVPLGKAEVKRAGTDVTVVAYGRMVH
FT                   VVLDAAEQLAKEGIDVEVVDPRTLMPLDTDTILASVAKTSRLAIVHEATGPSGFGAEIA
FT                   ARVADEGLYYLDAPIKRIAGAFYPIPTGEAEDLLFPDVARVVDSVRDLMA"
FT   gene            complement(25866..26900)
FT                   /locus_tag="RHA1_ro11031"
FT   CDS_pept        complement(25866..26900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11031"
FT                   /product="probable pyruvate dehydrogenase"
FT                   /EC_number="1.2.4.1"
FT                   /note="GO_function: GO:0016624 - oxidoreductase activity,
FT                   acting on the aldehyde or oxo group of donors, disulfide as
FT                   acceptor; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11031"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00678"
FT                   /db_xref="GOA:Q0RVK8"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVK8"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00678.1"
FT                   /translation="MTTTSKKRPPAQQNPAADATVTERSDADLLSTYRLMVLAREFEEQ
FT                   LGAIFAAGKLGGWFHSCIGHEATGAAAAALMRETDHLVPYHRSRVSILGKGMTARDLAM
FT                   EIMGRATAPSRGRAGETHINYAPARIYGTTGVLGANIPIAAGVAYGVQQRGLDEVVVCG
FT                   FGEGTSNRGAFHEALNMAAIWDLPVIFICENNLYAEFSSSRDQMRCADVADRAAGYGIP
FT                   GVVVDGNDPGAVYTTLAAAFERARGGGGPTLVEAKTYRLNGHYEGDPQSYRDKAEVAEW
FT                   AERDPVTCYRARLLQQQNVTEEQLHTAEREAADEIRTAMTEALNAPPAGKDDIFGDIYA
FT                   GGPL"
FT   gene            complement(26897..28039)
FT                   /locus_tag="RHA1_ro11032"
FT   CDS_pept        complement(26897..28039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11032"
FT                   /product="possible isovaleryl-CoA dehydrogenase"
FT                   /note="GO_function: GO:0008470 - isovaleryl-CoA
FT                   dehydrogenase activity; GO_process: GO:0006118 - electron
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11032"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00679"
FT                   /db_xref="GOA:Q0RVK7"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVK7"
FT                   /protein_id="ABH00679.1"
FT                   /translation="MKTALESDEHRLMRETVRKFAADHVAPLAAEIDREERFPRESWEA
FT                   AAELGLLGIRAPEQFGGSDLGLTETCIAGEELSAVCMSTAVTVLHQSNLVVDRIVDHGT
FT                   PEQQARYLPGLCDGSIIGCLAITEPEAGSDAMSMRTKATRTEGGWLLNGAKTFITNGPV
FT                   ADLALVYAKTGPVEDRELALFAVDTTAPGFSKGRKLDKLGWRGSPTGELAFSDCFVPDD
FT                   AVIGGIGNGIKVLRDGLASERVLMGAQGVGLAAGALREAVRYAGERRQFGRPIGDFQLI
FT                   QAKIADMYVGIELGRALVSKTAAAIDAGDSGLTRLASACKLHGSEVAMNAALEAVQIFG
FT                   GYGYTREFPVERYLRDAKIMQIGGGTSEIQRIIIGREMLR"
FT   gene            complement(28376..29071)
FT                   /locus_tag="RHA1_ro11033"
FT   CDS_pept        complement(28376..29071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11033"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11033"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00680"
FT                   /db_xref="GOA:Q0RVK6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVK6"
FT                   /protein_id="ABH00680.1"
FT                   /translation="MVELVVDEPVSLRVRIQRVFTECVAQQGFRGTALSEVSDRLGISK
FT                   GTILHHFKSKEALLARIGEDYIDRRERELQHILSHLDGPQDRLIAVIVSITLCHRDDLA
FT                   ATRAFGREFARYADSPQLDQVRLRRHAYTERVEEVIAEAMAADVVREDDPRLVALQIFG
FT                   MCNWTWSWYRPEGSWSIEEIADRYVRTLLLGLGCDPARVEQPSVPSHVHDEVVRAAVLA
FT                   RETQSIRDH"
FT   gene            29189..31057
FT                   /locus_tag="RHA1_ro11034"
FT   CDS_pept        29189..31057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11034"
FT                   /product="possible regulator of polyketide synthase
FT                   expression"
FT                   /note="GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent; GO_process: GO:0007600 -
FT                   sensory perception"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11034"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00681"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVK5"
FT                   /protein_id="ABH00681.1"
FT                   /translation="MPRTAESGAPTFTDPCDARDPASWSRTELGDAAVIEAFHDVAGTV
FT                   TSQPGIEPVLRVAAGNACDLLAVDRCSIFLRGSNSGIFHGVAARSPGDSDIVRHLRCGV
FT                   TRDRMSQEIVATRQPVLVRDAVADGRPVRSTMVNLQVREVLGVPLVFRQQVYGLMFLDL
FT                   VGHHRGFSAIETRLVTFYADLIAGLLPVLHQVDDLHSAVRDLQMRSHESARTRRFADEI
FT                   ACASSAGTTPQQIAASASTATGRGSWFTDGAHRPIAHGGEGGNAARIGRLLNRPATIEA
FT                   LRALPDSGVLDLSTEPDGLLVAPITVDGHRRGNMSLICDGRPMTEHDKTVLRTAAHAIS
FT                   VELRVEAQSAMTTSEGRQQIARAMIEGNLDAVTHRRAALHSIPMDCQRVVCLVAQRRAS
FT                   SIRLDARDLAQAFDSVTAGPPALATPTAEGAIAVLVDLGEDSPSELAQRASTLTAAALK
FT                   LADAEDTLIAAISSPITAVDQAPRAFDESQRVLHCLRQLCPESTTILSADDLGFAGVLL
FT                   SAIDRTGADQHVHKTLGRLLSDHARDHEMLHTADVFFDHARNIRDTARALSVHENTVRY
FT                   RLSRIHQLTGLDLTGNSDHQVSCQLALLILRLRGQLSTTNPLPHYP"
FT   gene            31074..31856
FT                   /locus_tag="RHA1_ro11035"
FT   CDS_pept        31074..31856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11035"
FT                   /product="probable 3-hydroxybutyryl-CoA dehydratase"
FT                   /EC_number="4.2.1.55"
FT                   /note="GO_function: GO:0003859 - 3-hydroxybutyryl-CoA
FT                   dehydratase activity; GO_function: GO:0004300 - enoyl-CoA
FT                   hydratase activity; GO_function: GO:0016853 - isomerase
FT                   activity; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11035"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00682"
FT                   /db_xref="GOA:Q0RVK4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVK4"
FT                   /protein_id="ABH00682.1"
FT                   /translation="MPSPSSVVPELQDDITTIVLSGQAGRLPLSPAGLPDLTAALTAAE
FT                   QNPHIRCVVFTGTENTFATGADLNEIARNDADANARYNRALIEAINRIDLLPVPTIAAI
FT                   NGHALGGGLELALACDLRIAADTAMLGLPETRLGLIPGAGGTQRLPRLIGEARAMDLLL
FT                   TGRTVNASEALHLGLVNEVAPHDRLASRTQRLAATIARNAPLALRVAKAEVRAGRTLHL
FT                   FDAIDATHDALAPLLTSEDLREGLAAFRARRQARFIGR"
FT   gene            32395..33276
FT                   /locus_tag="RHA1_ro11036"
FT   CDS_pept        32395..33276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11036"
FT                   /product="possible 3-oxoacyl-(acyl-carrier-protein)
FT                   reductase"
FT                   /note="GO_function: GO:0004316 - 3-oxoacyl-[acyl-carrier
FT                   protein] reductase activity; GO_process: GO:0008152 -
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11036"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00683"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVK3"
FT                   /protein_id="ABH00683.1"
FT                   /translation="MTNEQQSATTEQPLRGKVAIVTGASRGIGADTAHLLAARGASVVC
FT                   AARTLTEGDNPLAGSLEQTVAAIQEQGGTAHPVVVNLAKDEDCRSLIEATRSVYGPVDI
FT                   LVNNAAVGFFDLVESMPSKQWLLSWRVMCHATFLLSQLALQDMLPRGSGRIVNVTSESA
FT                   IGPGRGPYADGDRIGDTLYGANKVSVERFTQGLAEEVYGRGVGVAALAPSQLVPTPGAV
FT                   FNDLVRGAKDPRAESTEFMTRAIEILLTAPLEEISGRVVYSQQLLVEYGVLGEGRGYGL
FT                   DAQLPISGFAAR"
FT   gene            complement(33444..33866)
FT                   /locus_tag="RHA1_ro11037"
FT   CDS_pept        complement(33444..33866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11037"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11037"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00684"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVK2"
FT                   /protein_id="ABH00684.1"
FT                   /translation="MLAVNRPQFDAASNCIKLGTIHHRYRYRYRAHRGTLRPAVEHRTG
FT                   ARNRVQRAVERTVPFGFLVQTLVIVWCATHGYHRDDLTVRHAAEPWYPGKTDTVFGDML
FT                   AKARCTLIAARCSVTTPDRLDPNIIRDYELACPAVA"
FT   gene            complement(33991..34410)
FT                   /locus_tag="RHA1_ro11038"
FT   CDS_pept        complement(33991..34410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11038"
FT                   /product="possible integrase"
FT                   /note="GO_component: GO:0019038 - provirus; GO_function:
FT                   GO:0003677 - DNA binding; GO_function: GO:0008907 -
FT                   integrase activity; GO_function: GO:0009009 - site-specific
FT                   recombinase activity; GO_process: GO:0006310 - DNA
FT                   recombination; GO_process: GO:0015074 - DNA integration"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11038"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00685"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVK1"
FT                   /protein_id="ABH00685.1"
FT                   /translation="MLEEKWPVLGRHVQAAGWLPVWTDLGRAPRTIDAYARGLAEYLEM
FT                   CEREGVDPVTPSRAHVGVYVRELTERPSRRGANVVSLDSGSGLANATVTQRMVPVRLFY
FT                   DHLMKEGLPESNPVGRGRFTPGRRGGGHQRGWCPG"
FT   gene            34607..35095
FT                   /locus_tag="RHA1_ro11039"
FT   CDS_pept        34607..35095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11039"
FT                   /product="possible transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11039"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00686"
FT                   /db_xref="GOA:Q0RVK0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVK0"
FT                   /protein_id="ABH00686.1"
FT                   /translation="MRQIRFSCPADIRSRPKEAELRPKMYPEEFRRKVLDLVAAGRPAA
FT                   QVAADLDIGDQTIYAWRKQELIDTGQAQGITRGEQTELAAARQRIREVETQVAILARAR
FT                   DLLQEPHSRNGGSLPSGAMAAEGLPVPPACRLLSSARSRMLRRAHPAALPSTLFGMPG"
FT   gene            complement(35272..35916)
FT                   /locus_tag="RHA1_ro11040"
FT   CDS_pept        complement(35272..35916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11040"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00687"
FT                   /db_xref="GOA:Q0RVJ9"
FT                   /db_xref="InterPro:IPR002835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0RVJ9"
FT                   /protein_id="ABH00687.1"
FT                   /translation="MSDYGEWAVIVPFRSLDVAKSRLAVSCRRDLALAFLQDTLAALTL
FT                   SNHISSVIVVSRNAALSETIGTPVIKDQGSGIDDAVEIGHRWLREHGHDGHYSVVMPDL
FT                   PALRTGDIDNFLSAASRFPRAFVADSAGTGTTCLTTQQAAILSAFGRNSAQRHTRMGYK
FT                   QIPLGLPSLRLDVDTIDDLERAARMGVGRHTQRLLISNNELHSLRFPCAPG"
FT   gene            complement(35909..38488)
FT                   /locus_tag="RHA1_ro11041"
FT   CDS_pept        complement(35909..38488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11041"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_function: GO:0005506 - iron ion binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11041"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00688"
FT                   /db_xref="GOA:Q0RVJ8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR019939"
FT                   /db_xref="InterPro:IPR019940"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVJ8"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00688.1"
FT                   /translation="MTPGRHLDIDPLPTATVPRADTAEAPHSFTMRRVLRRARDGATLN
FT                   VGEATTLLQARGDDLADLCSSAAKVRDAGLLAAGRPRAVTYSRKVFIPLTRLCRDKCHY
FT                   CTFVTVPGKLRAEGRGAYLEPDEVLEIARQGAELGCKEALFTLGDRPEDRWPEAKQWLD
FT                   ERGYDSTLDYLRAMSIRVLEETGLLPHLNPGVMSWEEISRLKPVAPSMGMMLETTSTRL
FT                   FTDKGECHYGSPDKDPAVRLRTLTDAGRLSVPFTTGILVGIGETVRERAESIMAIRKSH
FT                   KAFGHVQEVIVQNFLAKPDTAMRDAPDAGLEEFAATIAVSRLLLGPGMRIQSPPNLVSN
FT                   TECLALLGAGVDDWGGVSPLTPDHVNPERPWPNLDTLAAITAEAGFELTERTAAQPQFV
FT                   LAGSPWIDPRITGHVQALADPHTGLAKLDTKPVGLPWQEPDESWESTGRVDLNTEIDTD
FT                   GRNTETRSDLGSAFGDWETVREQVLELSGPVRVDTDVLAALRSAERDPAGCTDDEYLAL
FT                   ATAEGPGLEAMVALADALRKDAVGDEVTYVVNRNINFTNICYTGCRFCAFAQRKGDADA
FT                   FTLSTDEVADRAWEAHVAGATEVCMQGGIDPELPVTGYADLVRAVKARVPSMHVHAFSP
FT                   MEIVNGASRGGQSIRDWLTELREAGLDTIPGTAAEILDDEVRWVLTKGKLPTATWIEVV
FT                   TTAHELGLRSSSTMMYGHVDNPTHWVGHLRVLSGIQDRTGGFTEFVPLPFVHQSAPLYL
FT                   AGASRPGPTNRDNRAVHALARIMLHGRIPNIQTSWVKLGVTGTQVMLQGGANDLGGTLM
FT                   EETISRMAGSEHGSEKTVAELRAIAEGIGRPARERTTTHARRDTPRE"
FT   gene            complement(38485..38772)
FT                   /locus_tag="RHA1_ro11042"
FT   CDS_pept        complement(38485..38772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11042"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00689"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVJ7"
FT                   /protein_id="ABH00689.1"
FT                   /translation="MSSEDTAGEHRYRTTCRDPDNRSSPPATGRNGKFLPGTTVLGQCG
FT                   ISQVHANGYRTIPMIADRTSNHHVRTEALDQLLAIRRALRSVTASRKTIG"
FT   gene            complement(38871..39257)
FT                   /locus_tag="RHA1_ro11043"
FT   CDS_pept        complement(38871..39257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11043"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00690"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVJ6"
FT                   /protein_id="ABH00690.1"
FT                   /translation="MRIDRGQGRDRVDDLGVTLAVAARRMVQAGCSTWTACGNRSSTRS
FT                   ARHRGTEPFSLDIEYMAVHSPIAVNAGHRRGHRDRQHRPDRVPHTPRLAWIMHCGGHLG
FT                   HRGVMEVPPSPWPDVDTSGGHGRR"
FT   gene            complement(39536..40363)
FT                   /gene="limC3"
FT                   /locus_tag="RHA1_ro11044"
FT   CDS_pept        complement(39536..40363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="limC3"
FT                   /locus_tag="RHA1_ro11044"
FT                   /product="dichlorophenolindophenol-dependent carveol
FT                   dehydrogenase"
FT                   /EC_number="1.1.1.243"
FT                   /note="GO_function: GO:0004022 - alcohol dehydrogenase
FT                   activity; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11044"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00691"
FT                   /db_xref="GOA:Q0RVJ5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR023985"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVJ5"
FT                   /protein_id="ABH00691.1"
FT                   /translation="MLRLEGKVALVTGAARGQGRSHALRMAEEGANIIAVDLCDQISTV
FT                   PYDMSDHNDLHETGRLVEEYGRRVITAVCDVRDSDSLRSTVARCVQDLGRLDIVCANAG
FT                   IWSAGGVRDLTVDSWNDMISVNLTGVFNTAQATVEHLIAAGGGSFIATSSVFGLKGRGG
FT                   IAHYASSKHGVTGLARDMAGELAPFSIRVNSIHPGGVRTPMVENEHLFRLFRPDLDHPG
FT                   WDDVKETLSSMNALPIDSIPVQDISNLVLFLASDESRYITGTSIPVDAGFVHL"
FT   gene            40544..40795
FT                   /locus_tag="RHA1_ro11045"
FT   CDS_pept        40544..40795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11045"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00692"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVJ4"
FT                   /protein_id="ABH00692.1"
FT                   /translation="MELPPARLRRAGGNLADESISPSRLVSLAPTSWQRWGWFPVVRLA
FT                   ETGGLHEPLEEHLSVGSPNPVPQSGSIVAACSSPRTAI"
FT   gene            40925..42187
FT                   /gene="limB"
FT                   /locus_tag="RHA1_ro11046"
FT   CDS_pept        40925..42187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="limB"
FT                   /locus_tag="RHA1_ro11046"
FT                   /product="limonene 1,2-monooxygenase (NADH-dependent)"
FT                   /EC_number="1.14.-.-"
FT                   /note="GO_function: GO:0004497 - monooxygenase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11046"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00693"
FT                   /db_xref="GOA:Q0RVJ3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVJ3"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00693.1"
FT                   /translation="MFSCANIPYEALQSSADPASKTPASRTPARELNMALKFGAFMAPF
FT                   HCPVGQDPTYAIERDLSVLRHLDMLGFEEAWIGEHHSCGTELVPDPFIFIAYAAQETRH
FT                   IKLGTGVVSLPYHNPLWIADRALFTDRLLRGRFMLGLGPGSLPTDAAMIGISMAEQRGA
FT                   FEEDVDVLMAILRGESVTHETPRYRLHDARTQFAPYSDFEITVAAVATPTGPRVAAKNG
FT                   LNLMSVGATAQGGFDALALHWDVMEERAPQFGHTPDRAGWRLVGPMHLAETKEQAIEDV
FT                   RHGLDAWCHYSQHILAAPHFRAVGETFEERVDWINETGLGVIGTPDDAVRQIERLEEQS
FT                   KGFGSYLLLHHEWARHDAVLKSYELFANHVKPRFQGSTSRLQKAEDYAVSRWAELDKRQ
FT                   GDAIQAATDRHVKERAAAGRA"
FT   gene            42464..42958
FT                   /locus_tag="RHA1_ro11047"
FT   CDS_pept        42464..42958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11047"
FT                   /product="possible oxidoreductase"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11047"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00694"
FT                   /db_xref="GOA:Q0RVJ2"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVJ2"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00694.1"
FT                   /translation="MTTIESVTSSDQLRRAFGCFPSGVTAVCAEFDGVPMGLAASSFTS
FT                   VSFDPPLVSICMQHSSTTWPTLRKRPRLGLSILTEGQGEICKRLASKIGDRFAGTDWLA
FT                   TDDGSVFIHGATLWLDCTIHAEVPSGDHDIVVLRIHGLRSDPSVSPLIFHGSQFRRLTA
FT                   V"
FT   gene            42958..44025
FT                   /locus_tag="RHA1_ro11048"
FT   CDS_pept        42958..44025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11048"
FT                   /product="3,4-dihydroxy-2-butanone-4-phosphate synthase/
FT                   GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="bifunctional; GO_function: GO:0003935 - GTP
FT                   cyclohydrolase II activity; GO_function: GO:0008686 -
FT                   3,4-dihydroxy-2-butanone-4-phosphate synthase activity;
FT                   GO_process: GO:0009231 - riboflavin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11048"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00695"
FT                   /db_xref="GOA:Q0RVJ1"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVJ1"
FT                   /protein_id="ABH00695.1"
FT                   /translation="MEDESPMDSCRPDTAEQRVRNALTAIAAGRPVVVIDAADREGEGD
FT                   LIFAAALATTELVAFTVRHTSGFVCVALPGDECDRLGLPAMHHSNDDRFDTAYRITVDM
FT                   RGTGTGISAASRAATIAALASPDSLASDFVRPGHVVPLMARPGGVLDRPGLTEAAVDLT
FT                   RLAGVPAAGALCEIVSQDRPVDMARGPELERFAKEHDLVLLSIADLIHYRQRTEPQVRR
FT                   GAVTSLPTDFGRFRAVGYVGAHDGAEHMALVVDPTGGRQFEEVPVHVHTECLSGDVFRS
FT                   TACGCRQELEKAMFQFCAEGCGVVLYLRPPGGPRACGIFATERNEGVNSSAMQAVADWI
FT                   LADLASTFPAADVSA"
FT   gene            complement(44251..44886)
FT                   /locus_tag="RHA1_ro11049"
FT   CDS_pept        complement(44251..44886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11049"
FT                   /product="probable transposase"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0004803 - transposase activity; GO_process: GO:0006313 -
FT                   DNA transposition"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11049"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00696"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVJ0"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00696.1"
FT                   /translation="MQIGSYGCTPRPRSWARWRWRRCSSACRRAGTEVSLGPDGDRAIE
FT                   RHRRHPRRRLDPALCTDGNCRVGAWVVHATGVLDLSGWPDGMRVIIRKARPHPGAQLPL
FT                   PMSTGLRQTAFITNSARGELADLELRHHRRARCEVSIRTAEDTGLINLPLHGFAQNQIW
FT                   ARGRGHRRRADRGMQILALIDNVARRWEPKRPRLCLFSIAGRIARHAR"
FT   gene            complement(44953..45264)
FT                   /locus_tag="RHA1_ro11050"
FT   CDS_pept        complement(44953..45264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11050"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00697"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVI9"
FT                   /protein_id="ABH00697.1"
FT                   /translation="MYFRITADSADLVDPQDVTAFHVVCPYGLSGDDLIAAVRRADIGE
FT                   VLADGEHVMVLVSTIRLMAADRVGPGWSDAFTAMLDYAESKGWTDKDRARVRAHIERN"
FT   gene            complement(45435..45842)
FT                   /locus_tag="RHA1_ro11051"
FT   CDS_pept        complement(45435..45842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11051"
FT                   /product="possible transposase"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0004803 - transposase activity; GO_process: GO:0006313 -
FT                   DNA transposition"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11051"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00698"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVI8"
FT                   /protein_id="ABH00698.1"
FT                   /translation="MPTKGLGRRARMANEPAKHALGRPRGGLSTKIHALTDVHCCPLTH
FT                   MLARTDRGNPCLAPLLEAHRARETTAFRLLANKAYSHPRIRKQLRDAESHVPSPNAATR
FT                   SPAARPRARPAVDHPHSTSAGKGKSGKCELV"
FT   gene            complement(46000..46467)
FT                   /locus_tag="RHA1_ro11052"
FT   CDS_pept        complement(46000..46467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11052"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0005554 - molecular function
FT                   unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11052"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00699"
FT                   /db_xref="GOA:Q0RVI7"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVI7"
FT                   /protein_id="ABH00699.1"
FT                   /translation="MLEAVNRAYLNLVEHSWPVYKRMLALHTVVYRASGGRIGHRFLHL
FT                   KQTLLIDHVGARSGTHRTSGLVYAKDGANLILVASKGGHPRNPDWFHNLRANPDTTVQV
FT                   GTERRTVHARVAQQDERERLWALAIDVHPGFAAYQARTDREIPLVVLEPRP"
FT   gene            complement(46582..47391)
FT                   /locus_tag="RHA1_ro11053"
FT   CDS_pept        complement(46582..47391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11053"
FT                   /product="possible N-acyl homoserine lactonase"
FT                   /note="GO_function: GO:0016787 - hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11053"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00700"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVI6"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00700.1"
FT                   /translation="MGNKLSGLNLGYVTVHEQSLLNNVPEYVGESYCTPAIAYIIDTPE
FT                   GRILWETGFSERALDEWPTEWLDVVDLSKLTPEMCIESSLRARGLGPEDFRYVIQAHLH
FT                   SDHAGGLRVFEEAGVEILVHEDEYNFVTSLAGDESFYCRADWEFLDRKKPTLLSGSEIE
FT                   IAHGVTVMHSPGHTPGQLSMRLDLPSTGSVLLTSDALYTHESCPGKSEPQMGWDTEQWR
FT                   DSARDLIEVAKKHESLLFPGHDETGIRFYGERRELVEIAFDENQTYA"
FT   gene            complement(47515..49392)
FT                   /locus_tag="RHA1_ro11054"
FT   CDS_pept        complement(47515..49392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11054"
FT                   /product="probable transcriptional regulator"
FT                   /note="GO_function: GO:0000166 - nucleotide binding;
FT                   GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0017111 - nucleoside-triphosphatase activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11054"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00701"
FT                   /db_xref="GOA:Q0RVI5"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVI5"
FT                   /protein_id="ABH00701.1"
FT                   /translation="MDLRDWRRRSRQIYRGACRYIVCLPHGYHLAIYAGGIGVRNMSSS
FT                   LPVQGLDARESRQPDRRGCGSGEDSRRPLRPVIAASWQRSADYGIARDRLSDPCYRAFD
FT                   PESRLLRVARPALDCIAEELAGTRTAILLADNNATVVSVLSGGGRELRSALDQVGVEPG
FT                   MDRSEQAVGTSGIGTVLEAHQPLMIVGDEHYKESLDRFVCSGVPIFDPIGNRLVGVVNL
FT                   CSSTGENNELMMLLARRVGRSIEARLRDTSTQAQRALLDEYIRMCRTPAQAVVAFGPET
FT                   LMMNSQASAILGPGDHAVLWNWAEEWISRRNSMTGVVELTGGVTSRIRASRVLVDSVTS
FT                   GVVLSFLPDESPQPSRLLSEPRGGKWSRVWESTLERVRAAGNTSHVVALRGESGAGKAT
FT                   LAAGLLDRGVGHVEFLLPANDDEQRVVLHDVRAALHGSKTVIVRRVQNLHRSQIANLAS
FT                   YVEAATAPIVLTGAESWGSEDAFAPLLQAVDVIIDVPPLRERTADIPQLVAEIIAASDI
FT                   DCAPLRFSRDSLGALMRCSWPRNIAELCCVVNSAILNSGFNDVKLHDLPAEYRYVGPNM
FT                   QLSTLQIAERDAIATALAGNGWNKSATAKHLAIGRATLYRKMREFGIEA"
FT   gene            complement(50402..50713)
FT                   /locus_tag="RHA1_ro11055"
FT   CDS_pept        complement(50402..50713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11055"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00702"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVI4"
FT                   /protein_id="ABH00702.1"
FT                   /translation="MPIYGTLYRTAPLEVLNVQFRNTGIDDSCGRVGFRRLRIQGSGIH
FT                   EFQVRGDVGGRTSGLPVKKIIPGPDEGNEVLSVARPSAPLGTDDELRPSSTLRGGNEP"
FT   gene            50747..52201
FT                   /gene="aldH2"
FT                   /locus_tag="RHA1_ro11056"
FT   CDS_pept        50747..52201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aldH2"
FT                   /locus_tag="RHA1_ro11056"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11056"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00703"
FT                   /db_xref="GOA:Q0RVI3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVI3"
FT                   /protein_id="ABH00703.1"
FT                   /translation="MASVEARQQDHAAMIRGRRFAMLIDGELVDGATSQNVIDPATEDV
FT                   IATAPVADSAQVDQAVHAALKAFHTWQHSTFSERSTIIDRIADAIEKRREEIARIITLE
FT                   NGKPLKSAQDEVDWSLSWARHVAGCSIESTIIRDDATSRIKIRHKPIGVVAAIIPWNFP
FT                   FFQMVYKVVPALFCGNTVVVKPAPTTPLNAMVMGEILQEIIPKGVVNIVGDLGEAGPHL
FT                   TSHSDVGKVSFTGSTAAGRKVMASSAETLKRVVLELGGNDAAIVMDDADVEKVAEEIFS
FT                   WAFVNSGQVCINIKRVFVPRPLYDRFCDAFASHARAATLGHGLAPETDLGPVQNARQYE
FT                   AAKAYLELAKKDGTVIAGGNIPDVPGYFVEPTVVRDIDDASALVREETFGPVRSILSYD
FT                   DLEDAVARVNDTPYGLGNSVWGSDLDRAAAVADRLEGGTSWVNTHFSLAPDVPFGGRKQ
FT                   SGIGVEFGIQGIMEFTETHVINVSKG"
FT   gene            complement(52685..53188)
FT                   /locus_tag="RHA1_ro11057"
FT   CDS_pept        complement(52685..53188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11057"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00704"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVI2"
FT                   /protein_id="ABH00704.1"
FT                   /translation="MSFHSACRFFSHHVWDPDRFGLAVARLIVERLLPTAASIAVAVDD
FT                   HIFRRWGEESPSRVLDRRRRRPGTGYTRPRQSLDHSRDRGGSAVPRSPGVPADPVRPSG
FT                   RRGHAQRRSIEPAKAIAKQILGVGQDRNRVPRAVAFGFLAQTVIIAWYATLATTGTTSS
FT                   AAEP"
FT   gene            53502..56771
FT                   /locus_tag="RHA1_ro11058"
FT   CDS_pept        53502..56771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11058"
FT                   /product="protein kinase/ transcriptional regulator, LuxR
FT                   family"
FT                   /EC_number="2.7.11.1"
FT                   /note="bifunctional; GO_component: GO:0005622 -
FT                   intracellular; GO_function: GO:0003700 - transcription
FT                   factor activity; GO_function: GO:0004674 - protein
FT                   serine/threonine kinase activity; GO_function: GO:0004713 -
FT                   protein-tyrosine kinase activity; GO_function: GO:0005524 -
FT                   ATP binding; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent; GO_process: GO:0006468 -
FT                   protein amino acid phosphorylation; GO_process: GO:0042829
FT                   - defense response to pathogen"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11058"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00705"
FT                   /db_xref="GOA:Q0RVI1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVI1"
FT                   /protein_id="ABH00705.1"
FT                   /translation="MTDDDPFATQRDAKGSITAELAADGFEDAQEIGRGGFGVVYRCTQ
FT                   AALDRTVAIKVLTADLDEQNRERFLREQRAAGRLTGHPNVVNVLHVGVTDTGRPYIVMP
FT                   YHAQNSLDARIRRHGPLSLDEALRLGVKMAGALETAHRLGILHRDVKPGNIMLTDYGEP
FT                   ALTDFGIAHIAGGFETTAGVVTGSPAFTAPEVVTGEPPSAAADVYGLGATLFAAMTGHA
FT                   AFERRSGEQVVAQFLRITAEPVPDPRKHGIPEDVSMIIEHAMSGTPASRQSATELGQQL
FT                   RASQLLHGFPVDEMALHTDPGAVQPGTPPGPLPSSPSPLESGPPGQLPLQLTSFVGRRT
FT                   ELAEAKNLLSASRLVTLTGIGGVGKTRLALQVAAKTQRDFPDGVWLVELGDLRDGSLLE
FT                   GMAATALGLRDRSARPAHDLLIEFIAPRQLLLVLDNCEQVVNAVAKLSESLLRSCPQLR
FT                   ILATSRESLGIGAEAVLLVPPLAIPDPDHLPRTMPHNDAVALFAERGAAAVPGFELTED
FT                   NKATIARICRRLDGLPLPIELAAARLRGLTPEQILERLTDRYALLTRGSRDAPSRQQTL
FT                   RMCIDWSHNLCTPVEQRVWAQLSVFAGSCELGAAERICDRDLTAEDLLDTVTSLVDKSI
FT                   LIREESGGALRFRMLETVRYYGREKAQKAGEFPEVCFRHRDWCERMALDAEADWISSRQ
FT                   LEWIARLVREQSNLREALEFCVSDSPETGVGIVAALFPYWMSGGWLSEGLRWLDRLQIL
FT                   QILQTGPLTVERAKAVYTGCVIAGVQGDVRASTALVEKGRALVDRTTDPGIRAHIDLAV
FT                   GYLTLLTGNPSDGHSHLANAVQVYTARGDLLFQVLALIGLGLTHDMLNDTEQAIECHER
FT                   VLAITEARGESMYRTYSLWALAVAIWRHGDGARAVRLLERALQVCRSANDRLSASMCLR
FT                   ALAWIAAGDRNARRAVVLTAAADNMSRSMGSVTVFFHGHLAHQDECENETRRVMSEQTF
FT                   AAARREGEALGFDAAVTYALGEQPLPTTTATAGPTAKPTKREGEVADLIAEGLTNREIA
FT                   ARLAISPRTAQGHVEHLLSKLGFNSRAQIATWVVESQNKRS"
FT   gene            complement(56781..57200)
FT                   /locus_tag="RHA1_ro11059"
FT   CDS_pept        complement(56781..57200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11059"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00706"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVI0"
FT                   /protein_id="ABH00706.1"
FT                   /translation="MWNVKRPGGPGRQHREERRIRQLLLVPHHGSHLGACDDQDVGHPP
FT                   FGAQIILGGHEYVARQAKAAGIAFTNVGSAFTTVAAPGVGSDRRCLVAECGCRAAASGL
FT                   PAVDLPCLCFGLDLDEQQRSGFGDAVYTTAVGRPR"
FT   gene            complement(57612..58307)
FT                   /locus_tag="RHA1_ro11060"
FT   CDS_pept        complement(57612..58307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11060"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11060"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00707"
FT                   /db_xref="GOA:Q0RVH9"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVH9"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00707.1"
FT                   /translation="MSREFDVDGSTIRRDLDALVRSGQVERTHGGARPVVGTSSEIPYA
FT                   VKETERRPEKVAIAHRAAQQVADGQTIILDSGSTTYQVALELRHKTDLTIITNDLRIGK
FT                   YVATIPAVRLLVTGGELLGSVFTLVGERAVDFLSDYSADWAFLGADAIDPIAGITNTNT
FT                   LEVPLKRAIITAATRTAVVADSSKFGHRALAKVAAIDEVDLILTDSKLPSDQVEQYGDK
FT                   VARACIAHD"
FT   gene            58568..59464
FT                   /gene="gnd4"
FT                   /locus_tag="RHA1_ro11061"
FT   CDS_pept        58568..59464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd4"
FT                   /locus_tag="RHA1_ro11061"
FT                   /product="phosphogluconate dehydrogenase (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /note="GO_function: GO:0004616 - phosphogluconate
FT                   dehydrogenase (decarboxylating) activity; GO_function:
FT                   GO:0050661 - NADP binding; GO_process: GO:0009051 -
FT                   pentose-phosphate shunt, oxidative branch; GO_process:
FT                   GO:0019521 - D-gluconate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11061"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00708"
FT                   /db_xref="GOA:Q0RVH8"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVH8"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00708.1"
FT                   /translation="MQIGLIGLGRMGGNMRERVRAAGHEVVGFDADPSVSDVESLAELV
FT                   FHLSAPRLVWVMVPAGDPTRTVINELSQLLAPGDLVIEGGNSRFSDDELHSDVLREHGI
FT                   GYLDCGVSGGIWGLKEGYGLMVGGEEADVARAMPIFDALRPPGNRDESFVHAGPVGAGH
FT                   YAKMVHNGIEYGLMQAYAEGYELLAAEPRISAPDDVMGAWQQGTVVRSWLLELLVTALQ
FT                   EDPGLSSISGYTEDSGEGRWTLQEAIAHAVPVPVISAALFARFSSRQEDSPTMKAVSAL
FT                   RKQFGGHQVRIMEAMQW"
FT   gene            59458..60465
FT                   /locus_tag="RHA1_ro11062"
FT   CDS_pept        59458..60465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11062"
FT                   /product="possible F420-dependent glucose-6-phosphate
FT                   dehydrogenase"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0015948 - methanogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11062"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00709"
FT                   /db_xref="GOA:Q0RVH7"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019944"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="PDB:5LXE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0RVH7"
FT                   /protein_id="ABH00709.1"
FT                   /translation="MVIKFGYKASAEQFGPRELVELGVLAEAHGMDSATVSDHFQPWRH
FT                   EGGHAPFSLAWMTAVGERTSRLQLGTSVMTPTFRYNPAVVAQAFATMGCLYPGRIMLGV
FT                   GTGEALNEIATGFAGEWPEFKERFARLREAVALMRELWLGDRVDFEGNYYKTVGASIYD
FT                   VPEGGIPVYIAAGGPVVARYAGRSGDGFICTSGKGMELYTEKLMPAVAEGAEKADRDVA
FT                   EIDKMIEIKISYDTDPELALENTRFWAPLSLTPEQKHSIDDPIEMERAADALPIEQVAK
FT                   RWIVASDPDEAVAQIRPYLDAGLNHLVFHAPGHDQKRFLELFQRDLAPRLRGLA"
FT   gene            60462..62117
FT                   /gene="pgi1"
FT                   /locus_tag="RHA1_ro11063"
FT   CDS_pept        60462..62117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi1"
FT                   /locus_tag="RHA1_ro11063"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="GO_function: GO:0004347 - glucose-6-phosphate
FT                   isomerase activity; GO_process: GO:0006094 -
FT                   gluconeogenesis; GO_process: GO:0006096 - glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11063"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00710"
FT                   /db_xref="GOA:Q0RVH6"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0RVH6"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00710.1"
FT                   /translation="MTHIVTDTPLWKKLSDHHWEVVGTHLRELFDTDPDRGVDLIVTAA
FT                   DLYIDYSKHRVTRETMGLLVDLARAAGVERHREAMFTGAHINTSEDRAVLHTALRANPE
FT                   RELIVDGQDVVGDVHTVLRRMGEFTDRVRSGAWRGATGERIRTVVNIGIGGSDLGPAMA
FT                   YRALRHYVDGPEVRFVSNIDPADLLSNLTDLDPRTTLFVVVSKTFSTLETMTNASAARR
FT                   WITEALGEHAVPRHFVAVSTDEERVTAFGITARNIFGFWEWVGGRYSVGSAAGLSVMIA
FT                   IGRERFTEFLGGMRAIDEHFRTTPLESNAPVILGMLGVWYSSFFGADARAVLPYAHDLA
FT                   RFPAYLQQLTMESNGKSVRTDGTPVGTFTGEIFWGEPGTNGQHAFHQLLHQGTHLIPVD
FT                   FLGFAEPIEDLPTLDGIGSVHDVLTANLFAQSKVLAFGKNADEVAADGTPSALVPHKVM
FT                   SGNRPSTTILGAKLTPSTLGQLIALYEHQVFVQGIVWGIDSFDQWGVELGKTSALELGP
FT                   ALWDLDGAAYVGDSSTTGLIRTYRLARGERRCLP"
FT   gene            62105..62461
FT                   /locus_tag="RHA1_ro11064"
FT   CDS_pept        62105..62461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11064"
FT                   /product="possible transcriptional regulator, WhiB family"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11064"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00711"
FT                   /db_xref="GOA:Q0RVH5"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVH5"
FT                   /protein_id="ABH00711.1"
FT                   /translation="MSALNVCLPSPIAESWDWQLSAACRDADPAVFFHPDNERGEPRAS
FT                   RVRAAKRICLRCPVRARCLNYALDSSERHGIWGGYTEDERRTLQKRREMQSSPASIRPG
FT                   HQDCGRTLAARAIQ"
FT   gene            complement(63013..63354)
FT                   /locus_tag="RHA1_ro11065"
FT   CDS_pept        complement(63013..63354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11065"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00712"
FT                   /db_xref="GOA:Q0RVH4"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVH4"
FT                   /protein_id="ABH00712.1"
FT                   /translation="MRVSTPPFATATDGWGGLPCQAQIPNSSSIRCTAGTSPQTQEFFH
FT                   MPLLILHAVIACAILITPRRAIAWIQRILTNVAVARADARWIAMSASAQQEPSIHRASD
FT                   RHLRRSGGH"
FT   gene            63656..64102
FT                   /locus_tag="RHA1_ro11066"
FT   CDS_pept        63656..64102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11066"
FT                   /product="possible transposase"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0004803 - transposase activity; GO_process: GO:0006313 -
FT                   DNA transposition"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11066"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00713"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVH3"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00713.1"
FT                   /translation="MAAPVAFVRSDRSYRAPPVHRMGAAGVFETLHLRCSTGSKAPANW
FT                   LVGSDPGRGERPSEKGLAGPAQSIEARRDRRSTFCPIRTDPTGLDISGANTYDSTLLQP
FT                   MVSAIPAVKSRLVPRRRKPAKLRADKGHDYDIHHRWLRGQGTRA"
FT   gene            complement(64427..65719)
FT                   /locus_tag="RHA1_ro11067"
FT   CDS_pept        complement(64427..65719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11067"
FT                   /product="probable ferredoxin--NAD(+) reductase"
FT                   /EC_number="1.18.1.3"
FT                   /note="GO_function: GO:0015036 - disulfide oxidoreductase
FT                   activity; GO_process: GO:0005975 - carbohydrate metabolism;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11067"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00714"
FT                   /db_xref="GOA:Q0RVH2"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVH2"
FT                   /protein_id="ABH00714.1"
FT                   /translation="MVTVSDNDHVVIVGAGQAGGDLAANLREKAFSGRITLIGDEDSYP
FT                   YSRPPLSKAYLLGNKIRSDLLVRSDEMYGRFDIDVKLGTRVKSIDRQRKRITFGESEHL
FT                   DYDALVLATGGSPRTYPDERLNSSSNVFYMRALDQVERLRPHLTSGTRLTVIGGGYIGL
FT                   EVAAVARTLGVAVTVIEREQRLLARVTSPVMSSFFDRIHREEGVALHTGRSVSGFDFSP
FT                   DRELSRVVLDDGTIIETDVCLIGIGLQPNTALAEAAGVEVNDGIIVDSLLQTSDPSIFA
FT                   VGDVARYPCSESGGTRRLESIPNSTEQARALAQTLVGNPAPYNAIPWFWSDQYELKLQV
FT                   VGLISPSDAVVVRGDPQHDRSISVFYIRNDEVRAADVVSNPREFAMARKLVTKRAVVDP
FT                   AKLGDASFPLKDLLPVVNSSFSVGGMPAYHH"
FT   gene            complement(65751..66164)
FT                   /locus_tag="RHA1_ro11068"
FT   CDS_pept        complement(65751..66164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11068"
FT                   /product="probable ferredoxin (ThcC)"
FT                   /note="GO_function: GO:0005506 - iron ion binding;
FT                   GO_function: GO:0009055 - electron carrier activity;
FT                   GO_process: GO:0006118 - electron transport; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11068"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00715"
FT                   /db_xref="GOA:Q0RVH1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVH1"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00715.1"
FT                   /translation="MRGAAGYRPMEHINSGSTTTPNDHEERYVAVVSKVAFVSTEGKRS
FT                   EVQVPVGTSVMHAATDNLVNGVVGECGGDLSCATCHVFVEPTWWGRLPPPCADEIAMLE
FT                   ATAEEPTEYSRLSCQLVCTAETDGIVLHIPASQ"
FT   gene            complement(66164..67411)
FT                   /locus_tag="RHA1_ro11069"
FT   CDS_pept        complement(66164..67411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11069"
FT                   /product="cytochrome P450 CYP257"
FT                   /EC_number="1.14.-.-"
FT                   /note="GO_function: GO:0004497 - monooxygenase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11069"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00716"
FT                   /db_xref="GOA:Q0RVH0"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVH0"
FT                   /protein_id="ABH00716.1"
FT                   /translation="MTVRTELQGIPDLSDPETFKEGIPYEAYDQLRSLPGLPWHPAESG
FT                   TLNGGFWVVTRYDEVVEILQDPARFSSVQGSIYPLPNPTGDGPMTKHILLMDPPEHSRV
FT                   RRAAAKSFGPRIVANFESWIRDVVVETLDDALPLERFDWVYEVSRLVPSRVIAQILGIP
FT                   LEHRGYIVEATNALFESQTVNDGGASLTREFMKIGEFMTRLGEEKLRNPADDMTTVLAQ
FT                   SLESGEIDLVEYQLYTASLFAAGFETTHTTISHIGHLLATEPAIRAATTRALDEGKSAA
FT                   LVDEFLRYITPAMRFARTATQDTEFRDQAIKKGDTLLVVFSAANRDPAAFPNPNEFNPF
FT                   REDPKPLAGTGGAGLTFGAGAHRCIGHMLAKLELRILLEELHVRNIAIEMDGDAQRGAS
FT                   GLVNQLLALPVTVAVG"
FT   gene            complement(67687..67971)
FT                   /locus_tag="RHA1_ro11070"
FT   CDS_pept        complement(67687..67971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11070"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00717"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVG9"
FT                   /protein_id="ABH00717.1"
FT                   /translation="MRARVNAAGRLLGQSAAHPDPVVHLQQCEPTPVVDRLGSAPRTDD
FT                   QHSRLTIGAASIPSTSPVRTHLRVGSLCRHAVKALYRLPVSQNEAFETP"
FT   gene            68062..68928
FT                   /locus_tag="RHA1_ro11071"
FT   CDS_pept        68062..68928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11071"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="GO_function: GO:0008691 - 3-hydroxybutyryl-CoA
FT                   dehydrogenase activity; GO_process: GO:0006631 - fatty acid
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11071"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00718"
FT                   /db_xref="GOA:Q0RVG8"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVG8"
FT                   /protein_id="ABH00718.1"
FT                   /translation="MNASQISVFGAGIMGRGIAVVLADAGHRVSLYDARADVAREAAAA
FT                   HPNIEASDTIEAAVEGSSLLFEAVVENLEVKRDLFAEIERFSESTPIASNTSTFTPSEL
FT                   AKNLCEPGRLVIAHFFNPAEVVPLVEVVPSPDTRPDVVSAVTSALVAAGKTVVPLNREA
FT                   PGFVANRLQAALVREAMALVRANVATAEMIDAVVTSSLGPRWAAAGPFKVMDLGGLDTW
FT                   KALCAKLFPDLSCEISTPSELIAAVEDGRLGAKSGTGFYTHTPDEITEVLTKIHRSFGT
FT                   AAMSTPA"
FT   gene            69103..69432
FT                   /locus_tag="RHA1_ro11072"
FT   CDS_pept        69103..69432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11072"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00719"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVG7"
FT                   /protein_id="ABH00719.1"
FT                   /translation="MEPFELICCRRSPVVAPGRCAWVADHAGFSVVLVSYSTMCRRNIR
FT                   VISAGRKPGSACSRPLTPGIGTARPICHCAVAFVEERVVDLGDLLGAVDERPRGMEFEY
FT                   VFCLS"
FT   gene            70006..70272
FT                   /locus_tag="RHA1_ro11073"
FT   CDS_pept        70006..70272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11073"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00720"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVG6"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00720.1"
FT                   /translation="MVDVSARPPGNSLRTLGFRSEEPVDTCIAVAPVDEFVPRAPSIAK
FT                   LGDSNQVRGGAAATFPFSSNAPPLFLAKSPETLSRISSSVASR"
FT   gene            complement(70365..70574)
FT                   /locus_tag="RHA1_ro11074"
FT   CDS_pept        complement(70365..70574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11074"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00721"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVG5"
FT                   /protein_id="ABH00721.1"
FT                   /translation="MRMGLFTDDKGRPELVVHPDIKLGRATFRPVDDEPEPEETPKQRA
FT                   RRELKLRLGAELRAKKETGDTNPE"
FT   gene            complement(70579..71454)
FT                   /locus_tag="RHA1_ro11075"
FT   CDS_pept        complement(70579..71454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11075"
FT                   /product="conserved hypothetical protein"
FT                   /note="homologs found only in other rhodococci"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11075"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00722"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVG4"
FT                   /protein_id="ABH00722.1"
FT                   /translation="MAYNLSPDAPTARLDPEAGTSTTPASKSAGYRPAVTYDDRAQERE
FT                   GARQLDRMVEDAAFTRARKDLERAFPRATVPEVSERKRRELPVPDSIRQLPSSRQRKVR
FT                   SVNKHRAQSQLPKVGYTAVQTLVSDPDRWKTVGEALSKARGDAQQLDEKMRSQVQRVDR
FT                   AIQTAERFNDRGHILYCAVTLPHAVPQEAANLPATLHPGSRLDFDRHTMATHAAHELDG
FT                   TLGDRDVVFEVETGRGMYLGRSDTVDDTAHLLPRGMRFEVVSAGEGRYRRPDGSIGRRM
FT                   IVQLRDITEE"
FT   gene            complement(71716..74316)
FT                   /locus_tag="RHA1_ro11076"
FT   CDS_pept        complement(71716..74316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11076"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0004289 - subtilase activity;
FT                   GO_process: GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11076"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00723"
FT                   /db_xref="GOA:Q0RVG3"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR034074"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVG3"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00723.1"
FT                   /translation="MAERDKPHLFISTARAAEYRPPSRDMDTPALAPPPDRVAHGTKLR
FT                   GDLRQVEADARARRQNIDVTVDGAVEGTYVVFESFPGIELALHTLDPRQGKVHPELRSV
FT                   QEGLDSSGQVVERATVFVPDGTMKYFLDRVSAYLESAGEKKPKNSPAIDRIQEIRAASI
FT                   ESLWTDPPQEFPDPQQSVWWEVWLRRRDGQEVTRLRAYAEATGMRVGRQTLGFGERSVI
FT                   LLHGTVEQLATSVDILDDLAELRRPHDPTDFLAASDAVEQREWTDELLDRIEAADDRSP
FT                   AVCVVDSGVYWEHPLLKTSLDARDCQVADPTWPRHDTWGHGTEMAGLALFGDVGQAVAG
FT                   SETIRLTHRLESAKILPPPKPPMSDERDESESDSSEPELFGAVTADALSYVEIEQPNRR
FT                   RVYSLAVTARWQTTPPPGSRLLMFGQPSSWSATLDALAVGRRVAFEKGELTFLKQTDDP
FT                   NPRLFCVSAGNVRKDSWQDDHLTRSDIEPVEDPAQAWNVLTIGAYTRLDTMSGAPNEFD
FT                   GWSPVASRGELSPVSRTSVAFGKQWPIKPDVVLEGGNVARSPEGTEFDAPPNLQLLTTK
FT                   APIIPGMPSRPFTTTHATSAATAQAAAMAAQITAQYPSLWPETIRALIVHSAEWTQAMN
FT                   AQFAKDNKKGARVALLRRYGMGVPDLKRATRSATDALTLISEGTIHPFLSGKMREIHYH
FT                   ELPWPADILADLGDAPVKLRVTLSYFIEPNPGRRGWNRRYSYASHGLRFDIRRATESTA
FT                   DFQKRINQKALAEDETRPLSAEDTGEWFFGSRQQQAPGSLHSDIWNGSAADLAQRGVLA
FT                   VYPVTGWWKENAGKDRSSDGARYSLIVSIETPGQDVDIWTPVAQAIGVPVEIEI"
FT   gene            complement(74334..75281)
FT                   /locus_tag="RHA1_ro11077"
FT   CDS_pept        complement(74334..75281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11077"
FT                   /product="probable AAA ATPase"
FT                   /EC_number="3.6.4.6"
FT                   /note="GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0017111 - nucleoside-triphosphatase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11077"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00724"
FT                   /db_xref="GOA:Q0RVG2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVG2"
FT                   /protein_id="ABH00724.1"
FT                   /translation="MKSHAEGDNSRFYTVALQVAAGAARNGQNRFAQDLRDLVDGLRVQ
FT                   ESHRRVTPVVSVAQPRGELAQLLSVSYPDLVLSDLVLEQSVRTRLERVLLEQRQGDRLR
FT                   SHGYLPMRRLLLTGPPGTGKTMSAHVLAGELRLPLFQVRLDGLITKFMGETAAKLRLIF
FT                   DALSETRGVYLFDEIDALAGERGSANDVGEIRRVLNSFLQFLEMDQSDSLVVAATNHPQ
FT                   LLDRAMFRRFDTVIDYPLPSPDIARQVIRNRLANVPVGRLEWSKLAADTEGLSHGEIAI
FT                   ASDLAAKEVILSGAKQVTTASLRLALRERRGHVS"
FT   gene            complement(75529..76125)
FT                   /locus_tag="RHA1_ro11078"
FT   CDS_pept        complement(75529..76125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11078"
FT                   /product="possible acyl carrier protein"
FT                   /note="GO_function: GO:0000036 - acyl carrier activity;
FT                   GO_function: GO:0048037 - cofactor binding; GO_process:
FT                   GO:0006633 - fatty acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11078"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00725"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVG1"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00725.1"
FT                   /translation="MTEYNDPDAKGLEEFRRLIEESPLGTPEARALRSRIPRLRAERLA
FT                   RRLAEEDEKQTSEDCSADHLFDQQVRELLSGAASRPPRSPVQRSPGSREVVAFSAVAEI
FT                   IVAVTGIERSHLTPQTSLVEHLGIEDMSTMVEIAAQIEDAFGVTIPDDKLFGMRTLGDY
FT                   MAYLKLVAEEAIAEPADEAIADPLGADVSWWNSES"
FT   gene            complement(76118..77137)
FT                   /locus_tag="RHA1_ro11079"
FT   CDS_pept        complement(76118..77137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11079"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00726"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVG0"
FT                   /protein_id="ABH00726.1"
FT                   /translation="MTNASLDWSNGDEADDGWPPRTLHDVSSFHDDDAEGRREDDNPVD
FT                   TGDLRNHLVNDCDQGGPASTRPAATSEGPHPSVEAVTAPLDIPPEFPADDANLADNDEQ
FT                   RRNQGAIKVFDIVKADGFRGPRWDELVIELSRYALGLLNKWIKSGQIYKEAHQLGRGVP
FT                   ATSAERQLLRTDEHQRGDLAHGVVFAALKLFQQRCRNGTGWREDGGADITSYFTTTCLL
FT                   VFSNEFRRWQRDQGKWRHSECSFEPEVIQRHTEHNPHPLRRPAEPDPEHTVMNRDELAR
FT                   AFKCVHGEREMKIVRLRADGLTFKEIADALGDQTEESVRNTLRRIRRRASRTEGNSND"
FT   gene            complement(77248..77784)
FT                   /locus_tag="RHA1_ro11080"
FT   CDS_pept        complement(77248..77784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11080"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00727"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVF9"
FT                   /protein_id="ABH00727.1"
FT                   /translation="MPCGGGTGKIAAAMGDLPDRPGGLMCRRRDVAPLAVASRCLALAS
FT                   IRAVSTFTHQLGPPGKSSRWPHFGKEGRCGLRSPSPTDQLPSSMMQTTATPWRGVSSGG
FT                   AVEPIVGRCGDTIPMTIAATTRAVTRPIQRLVVEPSGVAPLPWVCPRNSVMRSPPARFD
FT                   GRNCPSTRSDMSDRQ"
FT   gene            complement(77818..78096)
FT                   /locus_tag="RHA1_ro11081"
FT   CDS_pept        complement(77818..78096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11081"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00728"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVF8"
FT                   /protein_id="ABH00728.1"
FT                   /translation="MSAEGFLAEHAHRRPSSRRRRAAQFGSPLTPGQDETVSDRTTADL
FT                   ERELAMLAYVRDRLRASEGEGFRIPTTAVDQVLDERNSLERSPWDPT"
FT   gene            78145..78678
FT                   /locus_tag="RHA1_ro11082"
FT   CDS_pept        78145..78678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11082"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00729"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVF7"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00729.1"
FT                   /translation="MRLPVALPRGLGDPVPLPSCLDSENPSADEVLPSLATVDVSADPH
FT                   LITVAARTGTPHLRRSVRRCGRGVVSRGGRVRRHGHRAHTVDAATGRPRYLPPAEPAEW
FT                   ARAIFSTVEGAHGYFLGAVDPGTSVHRRGQLAYRLYLDTDRRAIPVPRQVVTCPHYLLS
FT                   AIDGRAEITIPTTA"
FT   gene            79180..80130
FT                   /locus_tag="RHA1_ro11083"
FT   CDS_pept        79180..80130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11083"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00730"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVF6"
FT                   /protein_id="ABH00730.1"
FT                   /translation="MGTTFHGPGPWPHITRAIRVRGPRHAAIAYLGEDAPTLLPLRAGD
FT                   LLVVNASRAAVRAHVTSPIALAYYVEAGVRVLSSPNLHANVIATSRRAVIGSANASHSS
FT                   TIADEAVVITDDPEVVAAAWTFIDGIEEITEVDQAFLDNASTAWQIGRSVPIPGVGGRV
FT                   RAELDFLPARVTRMFLRHIVEYEPSVTEQQTWDTQARRHHTATAGPAATYQLEWFRLDD
FT                   RRARLRRGDVLIFVTDDNDWIYPPAVVDSDAIAIPHTHRAFGHLLLVRADLQPVSVADA
FT                   EQQLADFGHPNPRLTTDHRIISASLRAALLRLWNL"
FT   gene            80319..80870
FT                   /locus_tag="RHA1_ro11084"
FT   CDS_pept        80319..80870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11084"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00731"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVF5"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00731.1"
FT                   /translation="MSRSEMPEQSWIAAQELYDQGYTVDGARQLFGEPKTGPDGTLGWE
FT                   DDWIDRAEGRALIPVLPFLIERLRGHSEVGEAAGELVRLYEELNRRVGNDGAPDPLHHH
FT                   EISEDELVELGNDRDALKAIYGSPHRWTQEPVVEGNSVPFISQERSRFGDGARLVGRRN
FT                   LRWWLKSAVGEVANKQSENA"
FT   gene            complement(80958..81287)
FT                   /locus_tag="RHA1_ro11085"
FT   CDS_pept        complement(80958..81287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11085"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00732"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVF4"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00732.1"
FT                   /translation="MRSLRNPWYRASVRRAASAHWLTTGSRGLRGMTGEPVELSDTEAA
FT                   TVLAALVETTGGRWPAHPARIARTLRRLGIDGNTEQMATAITALVRDPDWSHRAREITS
FT                   SASDW"
FT   gene            complement(81304..81648)
FT                   /locus_tag="RHA1_ro11086"
FT   CDS_pept        complement(81304..81648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11086"
FT                   /product="possible lysyl tRNA synthetase-like protein"
FT                   /note="GO_function: GO:0004812 - aminoacyl-tRNA ligase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11086"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00733"
FT                   /db_xref="GOA:Q0RVF3"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="InterPro:IPR042261"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVF3"
FT                   /protein_id="ABH00733.1"
FT                   /translation="MARKVVVELVDDIDGTVFGEDGESITFSVNGVDYEIDLKGKHASK
FT                   FHKQIGFFIEHATRVGGRKRRSNRPVAPDAPPRRGNSKEIRAWAAEQGYEISSRGRIPA
FT                   EVEQAFQDAH"
FT   gene            complement(81880..83247)
FT                   /locus_tag="RHA1_ro11087"
FT   CDS_pept        complement(81880..83247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11087"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11087"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00734"
FT                   /db_xref="GOA:Q0RVF2"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVF2"
FT                   /protein_id="ABH00734.1"
FT                   /translation="MVAVGALGCESRSRDLPEQWPVMSETNMGRVPVGDPIPLRFDQET
FT                   KQRLEELAAGIGPRRFGALVRVAARRLLADADRVPEALAQARRASADARRFPWAERHLD
FT                   LDPATNTRLHQVAHEFHTDRSAIVRVALHRFLTGAGRFRHPVLREDTRTDLTYRTRVYL
FT                   NRSTLVRLEKLISRNGDARTAAAIRVAVRRLLDNPGDLAADLATIGTSRDLTPEALGPR
FT                   TNVHFDDDLRGQLDTLAERLDSDRAELMRLAARQLLANPRDLEKAVTEEIYRGDANRAR
FT                   LLARDTRRRQAAAADQPAHTPTRAPSPQGNPFGRRHVFRFDEDTKRRLEELADEYGPRR
FT                   VSALLRVGIRKLIAYPAAGEALAQAHRTAAPPRIARVDVALDDELLAHLDALAERLSSN
FT                   RQELVHLAATRILRFHHNIENRMLDEMFRAPNNRKHLLAKHARRERIRRRDRGSGT"
FT   gene            complement(83619..85271)
FT                   /locus_tag="RHA1_ro11088"
FT   CDS_pept        complement(83619..85271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11088"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11088"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00735"
FT                   /db_xref="GOA:Q0RVF1"
FT                   /db_xref="InterPro:IPR009970"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVF1"
FT                   /protein_id="ABH00735.1"
FT                   /translation="MSPRGRISAEIVQAFHDAQATKAQAKAAPAKKAAEEKIVAGKAPA
FT                   KKTAAKKSPAKTTGPKKASAGKSPARTAGAKSTSAEKFVATEVPAVSTAPAKSTTKDIR
FT                   EWAIGEGREVSPRGRISAEIVQAFHDAQATKAQARTVPAKKAAEEKIVAGKAPAKTTAA
FT                   KESPAKATGPKKAAGVKAAARKLPVKTAGAKSTAAEKFVATKVPAVITAPAKSTTKDIR
FT                   EWAIGEGREVSPRGRISAEIVQAFHDAQATKAQARTVPAKKAAEKKIVAGKAPAKTTAA
FT                   KKSPAKTTGPKKTAAKKAAARKSPVKTAAKTAPAKKTAAKTAPAKKTVVEKVVEKEAPA
FT                   KNAAAGKTAAGKTAGATTAAETTAGATTAAEKVVEKEAPTKNTAAKKTAAKKTAMKKTA
FT                   GAKTAAKKTAAKKTAAGKTAGATTAAEKVVEKEAPTKNTAAKKTAAKKTAMKKTAGAKT
FT                   AAKKTAAKKTAAGKTAGATTAGEKVVEKEASVKGAAAGTAPAKKTAKEIREWAIREGRE
FT                   VSFRGRISAAIVRAFHDAAARLPAVGERSGVRS"
FT   gene            85613..86089
FT                   /locus_tag="RHA1_ro11089"
FT   CDS_pept        85613..86089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11089"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00736"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVF0"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00736.1"
FT                   /translation="MVDTAESGVHGAEQGLRPTAHHQLTEDCATLPAVQHLPDSGHSGT
FT                   EPSLAKAPRRPHPQPPGEHRRGRAAAFGVCSPPAGIILFRTALTHGSPETDCGTVHTSG
FT                   DNSTQHRDDQQAPGRPPLATTVGRAPAETPPVLPPISWRQPVRRRVIPMSDRIS"
FT   gene            complement(86315..86620)
FT                   /locus_tag="RHA1_ro11090"
FT   CDS_pept        complement(86315..86620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11090"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00737"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVE9"
FT                   /protein_id="ABH00737.1"
FT                   /translation="MRHAVHSVRWRCRMPSRDDVPRDLVSAEGNRCDGGVDRGVYRFVR
FT                   GCRGNTARPGIAPDLIVRTRAVGRQVVDGTGVRRGCRGGGPAVASGTSSGSAGAPR"
FT   gene            86844..88178
FT                   /locus_tag="RHA1_ro11091"
FT   CDS_pept        86844..88178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11091"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003824 - catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11091"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00738"
FT                   /db_xref="GOA:Q0RVE8"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVE8"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00738.1"
FT                   /translation="MEPHEPHNLNPGPGPDPSRVAVVVAGAGARGAYEAGVLSVVVPFL
FT                   RAGGITPDLFIGTSAGAINATLFAAGAHLPADDQAAAALAVWRSVDIDDVFRPLMYSGP
FT                   ATIARWAGQLCGIPGIRLTSLVDTTPLARTAHRLVDWRQLAANLDDRRTSLAVVTTSAA
FT                   NNRTVVFVDRNGAAPLPPPDANRAIDYRDVRVTAEHVRASAAIPALFPAVEVSTPNDAR
FT                   GWYADGGIRLNAPLKPALSLGAHKLVVVATHPAVYPPVPNTGEEPGPPDVDDMVVRVLD
FT                   AALVDRMVEDLRTLGKINELVADGRRTGTGRHHHYVDVPYLFFGPETRGCLGTLAAEAF
FT                   DDRNRWPAGAWRMLRNPDLLLLGRLLGGDGARRGDLLSYLLFDRGFINAAICMGRRDAH
FT                   LLLAGTDQPPWLTGAPKHVPPQRISVHAAMQTHGAGIGAETTDTA"
FT   gene            complement(88557..89102)
FT                   /locus_tag="RHA1_ro11092"
FT   CDS_pept        complement(88557..89102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11092"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00739"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVE7"
FT                   /protein_id="ABH00739.1"
FT                   /translation="MTRPWGWVRAWQAVNLGHSRLPRLRRLRVGFESGVRGKLLAYNLT
FT                   PDAPPATGRRLPMTTAPRSAIRLRELDRMVEDAEFTRARNDLERAFPRTTVPEVSEHKR
FT                   RELLIPDSVRLPPSSRQRSAVRQQTPGAVIVAEGRLHRGAEPDRHRGALEHRRGSAVGR
FT                   RITFRGPDPTLESARSSC"
FT   gene            complement(89230..89400)
FT                   /locus_tag="RHA1_ro11093"
FT   CDS_pept        complement(89230..89400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11093"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00740"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVE6"
FT                   /protein_id="ABH00740.1"
FT                   /translation="MSDRTVADLERELAVLAYVRERIRVSEGDTFCIPTTAVDQVLDQL
FT                   NSLERPPCDPT"
FT   gene            91019..92164
FT                   /locus_tag="RHA1_ro11094"
FT   CDS_pept        91019..92164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11094"
FT                   /product="possible transposase (mutator type)"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0004803 - transposase activity; GO_process: GO:0006313 -
FT                   DNA transposition"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11094"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00741"
FT                   /db_xref="GOA:Q0RVE5"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVE5"
FT                   /protein_id="ABH00741.1"
FT                   /translation="MRAPRHLAGRRHRAGGWKVTVAEDGGTLAPRRPAGAGHPATGAGR
FT                   GRDRGAADRLVRDVHLDRDPGQDDDGEDARRPGLSTRRYPIGLEPVGEQVTEISTATSK
FT                   SAASRKFVAMTETALADLLSKDLSGLDLVALMIDGVHFAETCCVVALGIDMDGNKHPLA
FT                   LVEGATEIATLVTGLLVDLRERGLDVTRPMLVGLDGSKALRKAVLDVLDRPVIQRCQLH
FT                   KIRNVKDRLPERLRSSVGRKMTDSYHAASALEAEAALVALAKELDRTHPGAATSLREGL
FT                   EETLTVLRLGVPPTLARTLRSTTNAIESMISVCREYATNVKRWRDGQMALRWCAAGMVE
FT                   AGKQFRRVNGNLHLPTLRTALERHFSESVAPIVHNDQENAA"
FT   gene            complement(92402..93535)
FT                   /locus_tag="RHA1_ro11095"
FT   CDS_pept        complement(92402..93535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11095"
FT                   /product="probable transcriptional regulator"
FT                   /note="GO_function: GO:0000156 - two-component response
FT                   regulator activity; GO_function: GO:0003677 - DNA binding;
FT                   GO_function: GO:0005524 - ATP binding; GO_process:
FT                   GO:0000160 - two-component signal transduction system
FT                   (phosphorelay); GO_process: GO:0006915 - apoptosis;
FT                   GO_process: GO:0017000 - antibiotic biosynthesis;
FT                   GO_process: GO:0042829 - defense response to pathogen"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11095"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00742"
FT                   /db_xref="GOA:Q0RVE4"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVE4"
FT                   /protein_id="ABH00742.1"
FT                   /translation="MIGVAENVEAIRHRLGLHVLGAVELTIDGAPQSLGGTKPRAVLAM
FT                   LLIRRGRVVAADALAAAAWNDDPPPDYRASLHVIVSKLRKALGGADVDPKTVLATAAPG
FT                   YRLSVADDDFDLARFRALSSTGGRLAEAGQFEEASAALSHALDEWKGPVLDDLRGHSFA
FT                   DAFAATLEEELLATASARTQAEIACGRAESVISTLIDLTNEHPLREPLWAQLITALYLA
FT                   GRQSDALDACRRLRTTLADELGIDPSGPLQDLEKRILNQEPLTVTTGAMTLTLIEQQQR
FT                   VATGQLRDRAGTAIPIPPGGLRIGRKNTNDLVLSHRNVSRYHAIVVATGPRYEIRDLQS
FT                   SNGTLINGERIIDSVVLGHGDVIRIGSTEWSFEVIDP"
FT   gene            93759..94460
FT                   /locus_tag="RHA1_ro11096"
FT   CDS_pept        93759..94460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11096"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11096"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00743"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVE3"
FT                   /protein_id="ABH00743.1"
FT                   /translation="MFTRKIATAASTCITAAVVGVAALGLVGTANAMSPAAVSTVSASV
FT                   VVGDPVGAAAYWQRQHGGDCAEMAVADVVGDVTGRAPSEAEIVEVARSTPSTVEPGPIY
FT                   TGDAAGGPADADVSTGGTASEDIPALLAHYDIAAVLSHAENATAGIEELVADLAIDRKV
FT                   IVGVNAESIWGERGDRTTADHAVVVTGIDLAAGVVYLNDSGIDTGRAETISLDVFLASW
FT                   STSNFEMIITL"
FT   gene            complement(94766..95107)
FT                   /locus_tag="RHA1_ro11097"
FT   CDS_pept        complement(94766..95107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11097"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00744"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVE2"
FT                   /protein_id="ABH00744.1"
FT                   /translation="MCVGAMVAYANVEVRRPAAGGCVPPAGRTCGSYAGSRRPGAHHCH
FT                   LDAYRRDDVRMPTYFLRITMSTESLTFLPDPSCDVERGYRAESPRWARPGGEPSARTVV
FT                   VKQSSHSAA"
FT   gene            95371..97485
FT                   /locus_tag="RHA1_ro11098"
FT   CDS_pept        95371..97485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11098"
FT                   /product="ABC transporter, ATP-binding component"
FT                   /note="tc: 3.A.1; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0004176 - ATP-dependent peptidase activity;
FT                   GO_function: GO:0004252 - serine-type endopeptidase
FT                   activity; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0042626 - ATPase activity, coupled to
FT                   transmembrane movement of substances; GO_process:
FT                   GO:0006508 - proteolysis; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11098"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00745"
FT                   /db_xref="GOA:Q0RVE1"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVE1"
FT                   /protein_id="ABH00745.1"
FT                   /translation="MPVHGPTTVVLGNPSHGVVLHLRPVPSAPPPEPAPTQSEGDRSAR
FT                   PPTAVHAIEQPRIRIGRTDDNDVILDDLLVSRHHAELRFSGGSWDIVDLGSANGTYVNG
FT                   IRASQARIGEPDVIGVGHQLLRLNGDRLEEYVDTGDVSFEATDLESVTANGRVLLTGVG
FT                   FTLDQRSLLAVVGPTGAGKSTLLNALTGFRPATSGAVHYGGRDLYANYAELRHRIGFVP
FT                   QDDILHTQLTVRRALNYAARLRFPQDVSAAARQQRIDEVLGELGLTGQADQRITSLSGG
FT                   QRKRTSVALELLTKPSLLFLDEPTSGLDPGYDKSVMQTLRALADEGRSVVVVTHNVSQL
FT                   DLCDRLLVLAPGGRLAYFGPPGQALTYFRCEDFPDLFTLLEHDTVTDWAARFRQSPLYP
FT                   VYIGPRPTDASPAPPGHRSPPENPDAQQSALTQFAILCRRYLAVIAADRQYTAFLLALP
FT                   LLLSLFTHAVPGTAGLSLTEAAVQHSNEPGQLLVLLIIGGALMGCAAAVREIVKEKAIY
FT                   RREHAIGLSRNAYLASKLAVLTVITGLQGLVLGILGWAGRPGPDGAALLGSGEAEIAIA
FT                   VIAVTVTSMIIGLLISAMIDNADRGMPLLVLVVMAQLILCGGLFPLHGRVPLEQLSWLS
FT                   PSRWTYAMAASTVDLAAMPGSPGAGDPLWRHTPGVWLTDLAICGVLAVIMIVVLALLLG
FT                   RVDSRRRVDR"
FT   gene            complement(97421..97738)
FT                   /locus_tag="RHA1_ro11099"
FT   CDS_pept        complement(97421..97738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11099"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00746"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVE0"
FT                   /protein_id="ABH00746.1"
FT                   /translation="MAAAPCHGHRGCSTDRGSRRAPPLPTLPPAAEPIAAEPVWIAARW
FT                   VFTGDSQARPHLPPPRNTPVRCTGAGGGYVVIAAGGVGAFIGRHDGGNRLGRAAERVPR
FT                   S"
FT   gene            complement(97753..99669)
FT                   /locus_tag="RHA1_ro11100"
FT   CDS_pept        complement(97753..99669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11100"
FT                   /product="probable serine/threonine protein kinase"
FT                   /EC_number="2.7.1.-"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0003755 - peptidyl-prolyl cis-trans
FT                   isomerase activity; GO_function: GO:0004674 - protein
FT                   serine/threonine kinase activity; GO_function: GO:0004713 -
FT                   protein-tyrosine kinase activity; GO_function: GO:0005524 -
FT                   ATP binding; GO_function: GO:0008658 - penicillin binding;
FT                   GO_process: GO:0006457 - protein folding; GO_process:
FT                   GO:0006468 - protein amino acid phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11100"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00747"
FT                   /db_xref="GOA:Q0RVD9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVD9"
FT                   /protein_id="ABH00747.1"
FT                   /translation="MSGTAQGSRIGTQFGHYHLKRLLGKGGMGEVYEAYDLDKDRTVAL
FT                   KLLPDALADDPIFRERLRRESHAAARLQEPHVVPIHDYGEVNGVLYIDMRLVQGTDLRS
FT                   LLTRYGPLAPPRAVAIISQIAAALDAAHADKLVHRDVKPENVLVTREDFAYLVDFGIAN
FT                   TATDEKLTTLGTAVGTYDYMAPERFEGDGSEVTYRADIYSLACVLHECLTGARPYPADS
FT                   IRVKISSHLFEPPPRPSVARPGVPAGFDAIIARGMAKSPQDRYATAGDLALAAHDALSA
FT                   GDQDEAATLIEKTQGDAAEPGPPDVARRAGTPPPAHTPPPAPAPPTYVDTPPPLPYGTR
FT                   TPTPPTYGTRTPTPPPYGTRTPTPPPYGTHTPTPPPYGPVPPHEPGAPNANADTWIDSH
FT                   SPTAGHGGAGAPPGWDSTQVGPPPPPGWGGPQQSQPPRPGPSKRMWIVFAGAALVVVAA
FT                   AAGVAMWLAKPAPTPPAPAPAPVSAPPTSPEPSGQFTAADEQLMQVMPTGYGEFNCQSE
FT                   QPTPGELSSLSCQPNQATGAPSARFFLFTDLAALQSHYDDVLNETEVISCPSGGGGPGP
FT                   YSSHGEPQTVGQVACFMSADTPPVPAIAWTNEADLAIGKVFADDPNGMTPMYEWWTKQG
FT                   AFE"
FT   gene            100003..100491
FT                   /locus_tag="RHA1_ro11101"
FT   CDS_pept        100003..100491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11101"
FT                   /product="possible transcriptional regulator, MarR family"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11101"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00748"
FT                   /db_xref="GOA:Q0RVD8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVD8"
FT                   /protein_id="ABH00748.1"
FT                   /translation="MERDIRLALAVRDLVLAVERYRGHAARGHLRIGVTETVALGHLYV
FT                   NGPLTASELAAELTITSASATELVDRIEQAGYARRVPHPTDRRKRLISLSDHGRDEFSR
FT                   IYGELGEMLGEVYHPMPPADQRLIDQFITEASAAINNRVRADAKPQTSRRALDDKTTA"
FT   gene            complement(100634..102676)
FT                   /locus_tag="RHA1_ro11102"
FT   CDS_pept        complement(100634..102676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11102"
FT                   /product="probable protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0004674 - protein serine/threonine kinase
FT                   activity; GO_function: GO:0004713 - protein-tyrosine kinase
FT                   activity; GO_function: GO:0005524 - ATP binding;
FT                   GO_process: GO:0006468 - protein amino acid
FT                   phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11102"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00749"
FT                   /db_xref="GOA:Q0RVD7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR035016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVD7"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00749.1"
FT                   /translation="MWWLVRKGGGDLDRDAHEDDYSCTPEMSEAVSCDGQGGCVGMSEH
FT                   DLVPGAMFAGYTIERVLGTGGMGTVYLARHGSLPRGVAVKVLDGTADDYVRARFVREAE
FT                   HAARLEHPNIVTVYDRGCEGDRLWIAMQYVAGTDAATLLRRGPLPPDLAVHIVAEIGQA
FT                   LDFAHEHGILHRDVKPANVLLAGRPAAGGGVWRVLLTDFGIAKNLDETRRLTRTGMLVA
FT                   TLVYAAPEALVAGVELDPRADVYSLGCMLFQLLTGRLPYSGSAAAVVDAHLNQPIPRPT
FT                   VLRPSLPDAMDPVIRQALAKDRDTRFDSCGALAQAARSALSSPRPAPGPREIRTPPTPP
FT                   VPDRIRAPSPPPQVRAATPPRRVRIDTPPPHRGVEGADRPGGTRAGGQAGPVRWWRRTT
FT                   TIVVGVLAAMVVVGAGVGAVAAYLASPHPPAARTQTALAFTGLASPQGVAVDADGTVFV
FT                   ADSLNNRVLELASGATTQTVLPFSGLDDPLAVAVDARGNVYVADTGNNRVLELVAGSAT
FT                   PTTLPFTGLDEPLGVSVSDGGDVYVADGGNNRVLKLAAGSATPTTLPFTGLSRPTDVTV
FT                   SDAGDVIVPDSRNHRVLELTAGASTPTTLPFSDVHAPNAVAVSDDGEVLLTTLDSNDVF
FT                   ELESGSSAPATLPFTGLDRPAGIATGDDGHLYLSDLGNDRVLELA"
FT   gene            complement(103039..103527)
FT                   /locus_tag="RHA1_ro11103"
FT   CDS_pept        complement(103039..103527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11103"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11103"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00750"
FT                   /db_xref="InterPro:IPR007969"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVD6"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00750.1"
FT                   /translation="MVSSSVACLSVSFSGVQEFGKGSIRPVSQTFSCQFPPTKTKGTPV
FT                   MSIRITTAARTLTLAAVIGVSALGAVSVANADTASSLSGQDAVFVEGMADEGIAFSTDD
FT                   AGVGLAHHICGEFADGATFEEVAAEGLQHSSLSAYEVGYVIGGSVSVYCPQYTDQLPV"
FT   gene            complement(103577..103909)
FT                   /locus_tag="RHA1_ro11104"
FT   CDS_pept        complement(103577..103909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11104"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00751"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVD5"
FT                   /protein_id="ABH00751.1"
FT                   /translation="MMNRDHVCVGGSTSDRIKALQSLVFRWSSPARRSSSPCLQFSFGL
FT                   GCRRSGHVAIARFRLMDPHRAVSVFGDIRSVIVRIASYSSGVPVAVLEGQAHGLPPVPG
FT                   RGSYSA"
FT   gene            104331..104720
FT                   /locus_tag="RHA1_ro11105"
FT   CDS_pept        104331..104720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11105"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11105"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00752"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVD4"
FT                   /protein_id="ABH00752.1"
FT                   /translation="MHRPGRIPPTEYDVKQYAAHRADQPFAHKQHCVHQTRDGSQSPVR
FT                   GSSPRTQATPGRSGPRTGMAVPHREPPASPHNPANDLPEYGPPPLIGHGETLSPTHDYV
FT                   RPGPTSDRGGRNAGQPYQQYQYVVE"
FT   gene            105133..105291
FT                   /locus_tag="RHA1_ro11106"
FT   CDS_pept        105133..105291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11106"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00753"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVD3"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00753.1"
FT                   /translation="MTSRLAKSGARKKTDQLEEALRGFFTDHHATILKMMLDNSDRIGA
FT                   QIPHSTR"
FT   gene            105398..105829
FT                   /locus_tag="RHA1_ro11107"
FT   CDS_pept        105398..105829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11107"
FT                   /product="possible transposase"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0004803 - transposase activity; GO_process: GO:0006313 -
FT                   DNA transposition"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11107"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00754"
FT                   /db_xref="GOA:Q0RVD2"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVD2"
FT                   /protein_id="ABH00754.1"
FT                   /translation="MTRFPSAAHLVSWAKFCPQTHQSAGKSMSKGRGKGNPWLAGTLGR
FT                   IAFANSRADTFLGTRYRRLARRRGKQKAIVATGNSVLTVVYHLLSDPDAEFCDLGPGYY
FT                   ESRINKHRRARDLATQLQALTGQHIAIRDGKAVITDTAA"
FT   gene            106159..107292
FT                   /locus_tag="RHA1_ro11108"
FT   CDS_pept        106159..107292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11108"
FT                   /product="probable
FT                   2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase"
FT                   /note="GO_function: GO:0016787 - hydrolase activity;
FT                   GO_process: GO:0019439 - aromatic compound catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11108"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00755"
FT                   /db_xref="GOA:Q0RVD1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVD1"
FT                   /protein_id="ABH00755.1"
FT                   /translation="MNPSRIRRLRPVPDTEPQMLFRTIHGYRRAFRMAGDGPALLLLHG
FT                   IGDNSSTWTEIIPHLAENYTVIAPDLLGHGRSDKPRADYSVAAYANGMRDLLSTLGIDH
FT                   ATVIGHSLGGGIAMQFAYQFPQMVDRLILVSAGGITKDVHPLLRLAATPILNEALKLLR
FT                   LPGAVPAVRWVGTVLTRLHGTALRPGAALHDTPDLVRILTELPEPTACEAYLRTLRAVV
FT                   DWRGQTVTMLDRCYLTARFDEAKWRQTTQHRNRRDSSHPTRLDACRRARRGRSRRTQRH
FT                   LIRAQVTDAGHNTHPVPGVGTHAARSPVADRRHSGTDSCFSTAADGTDLRRGTGIRIPS
FT                   KPIGGEIPSLLRSDFAVREELRAGLHRTCSATASPKS"
FT   gene            complement(107329..107646)
FT                   /locus_tag="RHA1_ro11109"
FT   CDS_pept        complement(107329..107646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11109"
FT                   /product="conserved hypothetical protein"
FT                   /note="homologs found only in other rhodococci"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11109"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00756"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVD0"
FT                   /protein_id="ABH00756.1"
FT                   /translation="MARYSGSRPVDGPELTVGVRVLVRRSAGADLTGEVAEDYAAVTDP
FT                   GGGGHEWAPVHRWAVALDDGRLVFADTEDLTIDPGFQRSDPNPDPGPDSAMRTPGRHRG
FT                   E"
FT   gene            complement(107835..108482)
FT                   /locus_tag="RHA1_ro11110"
FT   CDS_pept        complement(107835..108482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11110"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00757"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVC9"
FT                   /protein_id="ABH00757.1"
FT                   /translation="MLRVHEGPCVYPRRVSAGVLTDANVLYSRTLRDWICLLAFRKSPM
FT                   FHLTWTEDILAELIYHIRKKHPHYSDAQVGGIRDRIIAVAPYGRIKGNVIDSDLAYTDD
FT                   YDAHLHAAAVQYVVTDDKRFLDFAETNDAILSYEVYTADDFLMLVNQSSPAAVREVLLE
FT                   QIDYHRRRGGAFNLPASLEAAGATHFAQVIRELMRSRAVADALARPLTATAE"
FT   gene            complement(108486..108896)
FT                   /locus_tag="RHA1_ro11111"
FT   CDS_pept        complement(108486..108896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11111"
FT                   /product="possible excisionase"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11111"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00758"
FT                   /db_xref="GOA:Q0RVC8"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVC8"
FT                   /protein_id="ABH00758.1"
FT                   /translation="MSAVVTDRAAKTTVTVTSTEVEQAGAVDPSSLESAVPAELARILT
FT                   AVVAVVAAGGTVTIGSVPSEVTTTTAAQMLDISRPTLMKLIGEGEIPAHKVGTHTRLTS
FT                   SDVIAYQERQRDAQRAAFDDLRAFEDAEGMTY"
FT   gene            109285..109623
FT                   /locus_tag="RHA1_ro11112"
FT   CDS_pept        109285..109623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11112"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00759"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVC7"
FT                   /protein_id="ABH00759.1"
FT                   /translation="MRSTKTGAEALADIAARIEAHLATHDRYFCVPRRQGFPRRPRPGP
FT                   PRRTRSAIDVRACLDCPETYDYLTVAASRNWPLPYAPYAAAFPSAVRRTTVIAALWAVH
FT                   LTAGKRGA"
FT   gene            complement(109724..110230)
FT                   /locus_tag="RHA1_ro11113"
FT   CDS_pept        complement(109724..110230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11113"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00760"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVC6"
FT                   /protein_id="ABH00760.1"
FT                   /translation="MGRRRATVNGRRRNPWWRPGRVPDMALVAKPPSIRHFPPDSVLFM
FT                   VAVALHHEPLTCGISPDWPIGHPVAIRAEIWPRFLIPYKNSAALRPVEEHRSFLTCWPS
FT                   VPDRRRSLAAQASAQGSENFLHPHSLALAEKLPGPGVAPGPDTADPISSSAVDWQVRRS
FT                   DTVNA"
FT   gene            110579..112282
FT                   /locus_tag="RHA1_ro11114"
FT   CDS_pept        110579..112282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11114"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00761"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVC5"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00761.1"
FT                   /translation="MGTSAANFLLFVAAPAWLPLSAVNDGLHNASAAYINFVATKLPFA
FT                   ENDSKTVKALKFLGGVVQPVLMPFAALWWKGTGTPLVVWEMLEKAKEHDEPAVHAPEHP
FT                   PAPAPAPTPTPSGPATAPTGPTSSLAPAGAGGLGSTAANALAPLAAVLTLAAGGLVWIQ
FT                   HQDTPSTSGPTPVVEPVQGTGNGANQPAAVPGDPGPAAVPPIPALPAPIAAQSPPNQGG
FT                   GAASDPATNGSGTAGTGGVGGAAPAGSDGGGSAPAPAMPASDPGHTGTLPGPPAPVISG
FT                   EGVVTNPDPGGAGTPPIGVGGSAGSAPAMPGSQPAPGTGGGGQVAQAPAMPGSQPAPDP
FT                   AESAPAGTGGEDYYCQSAVHSCPGGTDSFSCHTSDLSVPCEGTDPTGSGGGVPPAGSAT
FT                   EEAVTDGAGSSGYTDPGPVPPAGSATEEAVTDGAGSSGYTDPGLVPPAGSATEEAVTDG
FT                   AGSSGYTDPGPAPPAGSATEEAVTDGAGSSGYTDPGLVPPAGSATEEAVTDGAGVDVED
FT                   TGADPGTYTAPDPVGTSGSTYTDPGSTGGGTSGSTYIDPSYGSDGTGDAL"
FT   gene            complement(112597..113412)
FT                   /locus_tag="RHA1_ro11115"
FT   CDS_pept        complement(112597..113412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11115"
FT                   /product="possible general secretion pathway protein"
FT                   /note="GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0017111 - nucleoside-triphosphatase activity;
FT                   GO_process: GO:0006811 - ion transport; GO_process:
FT                   GO:0044238 - primary metabolism; GO_process: GO:0044260 -
FT                   cellular macromolecule metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11115"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00762"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVC4"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00762.1"
FT                   /translation="MSIERLQSYYGFTRMPFGRGLAPSMLHRHPGHAEAVARISWCVDQ
FT                   HALGVITGEVGAGKTVAIRAATAALDPARHVIIYLPNPSVGVRGMLHHIVTALGRVPSF
FT                   YTATLAPQAAEALAAEYAERGRTPVVVIDEAHLLDNAQMEAIRMLTNHDMDSGSPFAAL
FT                   LVGQPTLRHRLRLGVLAALDQRIAVRYALAGMSPTDSADYITHHCKIAGRTDPLFTDDA
FT                   VTLIHNAARGYPRAVNNLAVQALTAAFATKVSIVDEKSARVAVTESGHD"
FT   gene            complement(113409..114881)
FT                   /locus_tag="RHA1_ro11116"
FT   CDS_pept        complement(113409..114881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11116"
FT                   /product="probable transposase"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006313 - DNA transposition"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11116"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00763"
FT                   /db_xref="GOA:Q0RVC3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVC3"
FT                   /protein_id="ABH00763.1"
FT                   /translation="MPTDDEKRRERSHAVGLFRYQLICPALDAGLSTKARGRLVREIAS
FT                   RQHTDPFGTRVRYSRDTLDRWIRRYRAGGFEELIPTTRAGTPRTDTATLELAASLKREN
FT                   PARTVAQVQRILRASAGWAPSESTLLRHFHRLELIGPAAGNAPTVFGRSEAENPNDRWT
FT                   GDALHGPRIGGRKTYLFAFLDDHSRLITGYRFGFSEDTVRLGVALEPALAARGVPGSVY
FT                   VDNGSAFVDAWLLRACAKLGIRLVHSTPHRPQGRGKIERFFRTVREQFLVEVADTTAED
FT                   LTAAGLDHRTALLELNRLLTGWIEVEYHRRVHSETGQSPLDRWESGWSRLGRTPAMPTA
FT                   ADLTEAFLWSEYRTVTKTATVSLHGNTYQVDHALVGRKVELVFSPFDMETIEVRYRDAP
FT                   HGRAVPHNITRHVHPKARPEIPERPTPAATGIDYLALTAQTHHEQVRSDRRIGYHALYG
FT                   PTDDDNGGEQLPGQLSIDDLTDEFTHRDGRPA"
FT   gene            complement(114933..115589)
FT                   /locus_tag="RHA1_ro11117"
FT   CDS_pept        complement(114933..115589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11117"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11117"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00764"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVC2"
FT                   /protein_id="ABH00764.1"
FT                   /translation="MVTVEVDPVRVESRLSRGDMSCPSCTGGVLAGWGFARPRPVAGMA
FT                   APVRPRRARCRGCAVTHVLLPVTLLLRRAYLAELIWAALAAKARGHGHRPIAQRLGIPG
FT                   STVRGWLRVEAARADAVRSWFLAVAVTTGVDVAVPRTTESVWGDVLAAVHAAHGAITAR
FT                   FGRSAVLGAVTAAQVAVAASAGRLLSPGWPPVPASDPATPVDPAADNDDPSSSRV"
FT   gene            115816..116280
FT                   /locus_tag="RHA1_ro11118"
FT   CDS_pept        115816..116280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11118"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00765"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVC1"
FT                   /protein_id="ABH00765.1"
FT                   /translation="MRHVVRNTGSSDSPMYGPFLEGSKYCLPSPQPLLTSAGPGQRSSQ
FT                   HGTARPASRCRLKKCQGIETDCGGHTLRPMIIPQVAASRNVIGSETLQFESGDAAGGPV
FT                   AAGGGYRTNRITRCRPVAAGDAPSDGDLAVHDLLDRGTRHASVVRHKFVL"
FT   gene            116297..117391
FT                   /locus_tag="RHA1_ro11119"
FT   CDS_pept        116297..117391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11119"
FT                   /product="probable transposase"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006310 - DNA recombination;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11119"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00766"
FT                   /db_xref="GOA:Q0RVC0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVC0"
FT                   /protein_id="ABH00766.1"
FT                   /translation="MPRTGRPKAELMLTDDEREQLVRWSRRAKTPQSLALRSRIVLACA
FT                   EPGMTNKQVAADLGISANTVNKWRGRFVDRRLDGLVDEPRPGRPPSILLDRVEDVVTAT
FT                   LETSPANATHWSRTSMAKRTGLSPSTIGRIWRKFELKPHLTDGFKLSTDPQFVDKVVDV
FT                   VGLYHNPPERAVVLCVDEKSQMQALNRSQPVLPMMPGMPERRSHDYVRSGVTSLFAAFN
FT                   IADGTVISELHRRHRAVEFKKFLTAIDKAVPEELDVHLVCDNLATHKTPAVGDWLAKHP
FT                   RFHVHFTPTGSSWINQVERWFAFLTDQLLRRGVHKSVAALEKDVRNWVKTWNDDPKPFV
FT                   WHKTAEELLDSLAKYISRISDAGH"
FT   gene            complement(117388..117693)
FT                   /locus_tag="RHA1_ro11120"
FT   CDS_pept        complement(117388..117693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11120"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00767"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVB9"
FT                   /protein_id="ABH00767.1"
FT                   /translation="MTEFYTATDLAHAGYARHRLTELFGEPDTTADEDRWSRDTVEAVE
FT                   HTVLAPAARVVFAAFEPDLDTRAGMIATDLRFGWPQMEQMLARVTLRETDRGERAV"
FT   gene            complement(117690..118151)
FT                   /locus_tag="RHA1_ro11121"
FT   CDS_pept        complement(117690..118151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11121"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00768"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVB8"
FT                   /protein_id="ABH00768.1"
FT                   /translation="MTRWNVATRLEGQSASPDCQNKGADLMGEWILRGLNVAALGVLLG
FT                   WMVRNHWERRSRGKLSEQGLDHLADGRPYVTFGFHQGPIEVHTQDGDVIATLPLEPGTV
FT                   RITEATRVLTEHGWQQAGALIMSGVDTIFVPVTHRPVPKSSRPHAQGEL"
FT   gene            118431..119267
FT                   /locus_tag="RHA1_ro11122"
FT   CDS_pept        118431..119267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11122"
FT                   /product="probable DNA ligase"
FT                   /EC_number="6.5.1.1"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0003910 - DNA ligase (ATP) activity; GO_function:
FT                   GO:0005524 - ATP binding; GO_process: GO:0006260 - DNA
FT                   replication; GO_process: GO:0006281 - DNA repair;
FT                   GO_process: GO:0006310 - DNA recombination"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11122"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00769"
FT                   /db_xref="GOA:Q0RVB7"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVB7"
FT                   /protein_id="ABH00769.1"
FT                   /translation="MDPQSQRRDRLLEVAEALSTAFGGGGRIVLDGAIVVMDRGRPSFG
FT                   LLQRRLGVAHATKPLQRRIPVTYLPFDALVRNGVELLRVPYLDRRAELAELESIVEKIG
FT                   GLPIAVPPHWESQNGRVMLNAARSAQMKGIVAKRSNSIYLPGQRNRSWIKTAIRTRGTV
FT                   LAIGFVGSSRSVAALVLGGYTADGRLEQVGHVSSGLSVSARRQLREEFRSLERPTSPLP
FT                   DDPAAAPDGDGDVRWLTPVTVVEVDFRELTSRGLRHPSYKGRRLDIDPASVRVEDL"
FT   gene            complement(119542..119658)
FT                   /locus_tag="RHA1_ro11123"
FT   CDS_pept        complement(119542..119658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11123"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11123"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00770"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVB6"
FT                   /protein_id="ABH00770.1"
FT                   /translation="MAPPAPGSLQTYPVSKAVNNVRNNGAELLKPITVEEAH"
FT   gene            119957..121132
FT                   /locus_tag="RHA1_ro11124"
FT   CDS_pept        119957..121132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11124"
FT                   /product="probable transposase"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0004803 - transposase activity; GO_process: GO:0006313 -
FT                   DNA transposition"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11124"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00771"
FT                   /db_xref="GOA:Q0RVB5"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVB5"
FT                   /protein_id="ABH00771.1"
FT                   /translation="MDSNYAVYCGIDVGKGEHHAVGLTAAGKKIYDKALPNDEAKLRAS
FT                   HGSVLVVVDQPNTIGALPVTVARACSHEVGYLPGLAMRRIADLYPGQAKTDARDAFIIA
FT                   DTARTMPHTLRRVDTGDEALAELEVLIGFDDDLAGEATRVSNRIRGLLTGIHPALERVL
FT                   GPRIAHPAVLEILSRCGGPAGIRKAGKRKLTAIAVKHAPRMGTRLVGEILAALEEQTVI
FT                   VPGSTAAETILPKLADTLKETLQQRKSVAEDVEGALDDHPLSRVLTSMPGIGFRTAARI
FT                   LIEVGDGSAFASAAHLAAYAGIAPVTRKSGSSIRGEHPARSGNKKLKRALFLSAFSALH
FT                   DPTSRAYYDKKRAEKKKHNAALICLARRRCDVLYAMLKNKELYRAPLPSAA"
FT   gene            121263..121979
FT                   /locus_tag="RHA1_ro11125"
FT   CDS_pept        121263..121979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11125"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00772"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVB4"
FT                   /protein_id="ABH00772.1"
FT                   /translation="MIGAHLVAVRTGLCAQVGEFPAQTVHMLAAVLHSGLRCSGLRLGA
FT                   GLSEPSLGLGGRDPPLGVGLDALEFRACLTFPVRRVLHGGSGLGLNPRQLRVGVLRGRV
FT                   GLLPCLLICTRAGLGLTSAPFLLAPQPFRFGHFRERLGVGLIDLGGDRLDIGHRGDRLG
FT                   HRLKETAELRQTGGQLLELHTEGRPSHRHRRRHPTPISRTGTRWRSSSGGPSNRTRLRC
FT                   TKSATTLSVFGRRRKR"
FT   gene            complement(121976..122527)
FT                   /locus_tag="RHA1_ro11126"
FT   CDS_pept        complement(121976..122527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11126"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00773"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVB3"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00773.1"
FT                   /translation="MFGHRARTPSAHAKCATSSCCAGSGLDQVPQRVRVRKRDVHARRV
FT                   SMTERSDTLASDDRLEIGVRHRPDVLGGLIQRGLNCRALHRYSVLAHALPFVPNASRHR
FT                   PGVFLSEQGRDVSPQQGRPHFLIIPPVANRFPQRPRPRRARRTIGPVPTPRLPATAAAS
FT                   LRTHPGKILCLRSEHHVRTT"
FT   gene            complement(122596..122997)
FT                   /locus_tag="RHA1_ro11127"
FT   CDS_pept        complement(122596..122997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11127"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11127"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00774"
FT                   /db_xref="InterPro:IPR025447"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVB2"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00774.1"
FT                   /translation="MQGRETPSADLAARVGLLAAINPALRDALLSLAHYGATDAHAAML
FT                   LVANQVRGVARVQTLTITGMFAYLDGRGAEAGIAFDAARDVAETAPETHTGLLDMLEIA
FT                   IQDGIRPDAIARLVTIGVDIAEKLGVEFN"
FT   gene            123132..123350
FT                   /locus_tag="RHA1_ro11128"
FT   CDS_pept        123132..123350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11128"
FT                   /product="possible carbonic anhydrase"
FT                   /note="GO_function: GO:0016740 - transferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11128"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00775"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVB1"
FT                   /protein_id="ABH00775.1"
FT                   /translation="MGAIVMNHTKIGRGAIIAAGALVPEGVVIEPNSLVAGIPGKVRRT
FT                   CTPDELEQIRHNADNYVKRLAYYATKS"
FT   gene            complement(123377..123688)
FT                   /locus_tag="RHA1_ro11129"
FT   CDS_pept        complement(123377..123688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11129"
FT                   /product="possible transcriptional regulator"
FT                   /note="GO_function: GO:0003677 - DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11129"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00776"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVB0"
FT                   /protein_id="ABH00776.1"
FT                   /translation="MTAIQNGPIAEIIDGEMFVRLDPHALDIGANVRDRVALSETPDFV
FT                   ESIRDHGVLEAISAVQLADGQIVVRDGQRRTSPRKWACCVDASWRRVAPSAANLPDSH"
FT   gene            complement(123777..124145)
FT                   /locus_tag="RHA1_ro11130"
FT   CDS_pept        complement(123777..124145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11130"
FT                   /product="conserved hypothetical protein"
FT                   /note="homologs found only in other rhodococci"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11130"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00777"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVA9"
FT                   /protein_id="ABH00777.1"
FT                   /translation="MSSTADFIVNGVITSAPDVARAELAQAPLTERKAHKVYDILAICE
FT                   AADGFAEEVFADKSVVRQIALLDCRHVDRYVTLLEALGCEALAAELRDLHILEYYLHKG
FT                   TTWRRVTGFPAHDRSATG"
FT   gene            124931..126532
FT                   /locus_tag="RHA1_ro11131"
FT   CDS_pept        124931..126532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11131"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11131"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00778"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVA8"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00778.1"
FT                   /translation="MSTVRETNWKVASIRIRTDGRSPNVVVDLRSARSLDDGSIEGRSV
FT                   STFGPRRRLVRDIGITPEGSWKSRYQDVRRSGVRIVGEASGEVGSSGNSQMTRCRLDPQ
FT                   GGEVWTLSATTGVDDRGSTERGANAHRGFAKLTRSQVDFTAGGHGTSRVLSYTDEADKR
FT                   KQSQWRFVPAAPGSHASETTTVAPDGTKTVTTVTTFDNGGHKSESTITSPPKMTPGGGT
FT                   STDSTSHTTERAPSGAVATSSHHEHKEFGGGKVITTWETTTTDSNGKQTTQRGVDVLSG
FT                   ETRHGVRSTTVITTHPDGSTTIVTKTGDATTGRGRTHTTVINKNGKVVSDETVDDGDDG
FT                   DDGDDGDDGDGDDGDDGGDGDDGDDGDDGDDGGDVDDSATDEPGDDGMGWDGSDEGPPS
FT                   IVPRHKSLIDIVNDPLGPSADENDDPLAGRIAEALKHGALVIPNAADTGWGEDSGSESP
FT                   PELKPLSRGAIFIPVRTPTEDWGNWNDPRVHIAYAAQLLESVVHSGQTDLLAASRAVDV
FT                   LQGTAALVAMAFRTSQ"
FT   gene            126564..127091
FT                   /locus_tag="RHA1_ro11132"
FT   CDS_pept        126564..127091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11132"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00779"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVA7"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00779.1"
FT                   /translation="MNNEHEPSIVVSPDSSTHDIGLETFITTWFEDLRSGGGERRDLID
FT                   NIENMEMFFLMANIARRAAQPDASDEELLLFSALAVAREYFREERMEPVIAGWGGRWKY
FT                   VCDAFDHLHEVGNEEAALILVKSVLRGMQTQSEEVEQFLRSVWSNKERAKVRRMNAISL
FT                   RSSSESCGPLGC"
FT   gene            complement(127238..127576)
FT                   /locus_tag="RHA1_ro11133"
FT   CDS_pept        complement(127238..127576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11133"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11133"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00780"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVA6"
FT                   /protein_id="ABH00780.1"
FT                   /translation="MNTDGWTERWPQHPVIRTFDPPRPVRVDIGKALPLGRGGAARADY
FT                   VSMRVKSSAVCLSGLLPALQTHWFQIFDGQWCAAITVYVTDAAGSNSLELDMIVTADAI
FT                   SEPPSPSS"
FT   gene            complement(127576..128088)
FT                   /locus_tag="RHA1_ro11134"
FT   CDS_pept        complement(127576..128088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11134"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00781"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVA5"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00781.1"
FT                   /translation="MVGGRKRRLPLCRISPVPHLLQSVRFSSEDADLRGFVQEPATQAC
FT                   TPREVAAILLDGIDLVILGLAGVAVPPSRARAVVARARSKGAVLLVAEGRWDGVDLRID
FT                   SRVAGYTGLGDKYGRVTGVHLDVAAAGKGFQRRTLRVEIRSDAGSVAWRTVPETQATGP
FT                   TRLRAAL"
FT   gene            128681..130621
FT                   /locus_tag="RHA1_ro11135"
FT   CDS_pept        128681..130621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11135"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003824 - catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11135"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00782"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVA4"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00782.1"
FT                   /translation="MMAALMIATGGGFAAAQPTTTPTPSASAPATTTPAARTTEARPAE
FT                   RSATSSNATSPATPPTSSSLAPPTTEVVPPPAASSAPTTTASTESSPSAAPTPPANGKK
FT                   IPYTGKPTENPNATIIPGKMRSDREELPEGFTKEDADKAEIAEAKILAASKPRNARTAT
FT                   TATNAIAAAAPTDCMTYFPQWMYQVCGAIRVKYDSLGGPASFLLLPTSNELVNPDGYGR
FT                   RNTFQNGPIYWSAASGAHPVVNHFFAAWQRNGWEAGPLGYPTTDEIVNPDGLGRRQEFQ
FT                   NTAAIYWKLNEAYAVRGAVRDKWNTVGAEQGFLGYPSSDELGTPDGIGRFNRFANGAIY
FT                   WTAGTGAQAMSTTFFTKWGSLGYETGSLGYPIAGDLLNADNVGRRQQFQRGYIYWHPSV
FT                   GANSVHGRILEQWNTLGSEGGSMGYPVTDEQSSIPLIAPVGAVTQFFQNGSLIWSGQNN
FT                   EVLRGGWKDVASSSAAQKSSQTSEGSGMVAPMFQSPCPEGTQDYEGAQSAYNCVIRFQD
FT                   IGGTWINVRAGRGDPNGFGQLHYKTDHQVKDRWVELLLQDSYGVPTNFDAEGTGVTENP
FT                   DRYRYAQAYYVDNFRGKTSYLITFEVIADFAETNQVSDHTQFGVVTSFCSDPNDNDNII
FT                   KFCPQLPTPYL"
FT   gene            complement(130618..131127)
FT                   /locus_tag="RHA1_ro11136"
FT   CDS_pept        complement(130618..131127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11136"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00783"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVA3"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00783.1"
FT                   /translation="MPSIWVVKSEDSRTSDETGLTKIMSCVLNTNVAEAPAGVVSRLTV
FT                   EVKHLPSVTSEVDPVSLISDERSGFKAIVRHQGFPEGLRIVEGIVEEAAREQIAAYSPV
FT                   VPQFKGTIAETGFLSTFAGSIPGGIGRTLVFHRSMSDMPTDYRVYATCLRVEYHGEPNP
FT                   KASSSC"
FT   gene            complement(131203..131757)
FT                   /locus_tag="RHA1_ro11137"
FT   CDS_pept        complement(131203..131757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11137"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00784"
FT                   /db_xref="GOA:Q0RVA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVA2"
FT                   /protein_id="ABH00784.1"
FT                   /translation="MRRSQGLEMPLAAGRRGTRGGAVPDVDAGGDEGTVLLGAARCAGV
FT                   SVGVGAGGVVVVVLGVGVGVVLGCAVAIPPPVVISIDAKAPMISDFNGDARFGRGKFRY
FT                   FATLARPRYRAGYRGPRRGVRDYLPLFPPVVGGGLGFVADAGGGFICARGTRAEGYPPL
FT                   RSNAPVRESLVRVVATVRPCA"
FT   gene            complement(131937..132473)
FT                   /locus_tag="RHA1_ro11138"
FT   CDS_pept        complement(131937..132473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11138"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVA1"
FT                   /protein_id="ABH00785.1"
FT                   /translation="MELVTRMNADDDAGVPIRLVLERSRVVVQWRADGTSLVAQEDDLD
FT                   AILQRDPPSPHGIWQKPRGPGTTSSFIEADPGELGRPSWWVLYGHADPSVDVRVHIDEA
FT                   DVPDPVVHRVGGVWACEWVSYPTIAEIHRSDRDRTDRVSFERPMFMPPAPHPEVEIRQR
FT                   KRGKGSGKSVENPVD"
FT   gene            complement(132461..133288)
FT                   /locus_tag="RHA1_ro11139"
FT   CDS_pept        complement(132461..133288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11139"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00786"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RVA0"
FT                   /protein_id="ABH00786.1"
FT                   /translation="MDQWSAAGYEQSSFGYPTADQADVSGVAFEQQFQNGKLYSPKPAT
FT                   EKYADYQLQSTGADQCPLPQASRVGPWVCGALGPSAPLEAPAPPQALSDPGTWCSGTGL
FT                   GGCWTVHNDLKASYEVDLFYGRGPEHLGTGTALIVWQLAGPYTDILEARITSPDAPIGR
FT                   VTFSGALYNGAAGVVGSQIHRTQPQFENGPFMTNRPINLTNKSALTLSDFKNDDHNYAL
FT                   QVSVEFSEYPTGYFYFYARSPVSHYDDSVPDNVYRFISADNLPADREDAGWNW"
FT   gene            133336..134367
FT                   /locus_tag="RHA1_ro11140"
FT   CDS_pept        133336..134367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11140"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00787"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV99"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00787.1"
FT                   /translation="MSGAILDQWSLAGYERSRLGYPTADAANQGTLAAEQQFQNDKIYA
FT                   PNMAVPLGATGINLTLGVPTVAALSAGPVPDGVVLNGQGFSLTFQRNSLGNINVDYLRT
FT                   TAQAPAQFKLIAGLPTGYSMAVANNSVEVRSSAGTVIGRVTLPLTFGVNGLEVGTNTTL
FT                   SGNEVTINLGTSSSYPHRSFLRAVDVPYPAPESYDNLTEQERQVCRDDLPECWNTRNTG
FT                   DDAKEVSHREYPNYQTIGEQDNRVDAVRHCAWLAYMTQRADSDFANRMATAHERAYYNE
FT                   PLASAMDLYNNQTGIAVGLREEGSATGIETTCRQYGRDARQVNAVSEVGENVNENDLVF
FT                   IHE"
FT   gene            134438..135034
FT                   /locus_tag="RHA1_ro11141"
FT   CDS_pept        134438..135034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11141"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00788"
FT                   /db_xref="GOA:Q0RV98"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV98"
FT                   /protein_id="ABH00788.1"
FT                   /translation="MDETLKRADPRSPRTLLWVVTMAVTAGALMLLIVVWGQWWPSGNA
FT                   WYLPAAVAVALLLATGAVWALGSIYVLWKHRRWAWWMVTWPLLVALGVALALAARPDFE
FT                   DSRPEFEETARQLLATPGPTSLSDLKIGRFEVGRAYNTEQGDVFFTDERTTAFTTESGW
FT                   AYSPDGAPAPASRDGEFTTTHIDGPWYRYELVTTF"
FT   gene            complement(135182..135703)
FT                   /locus_tag="RHA1_ro11142"
FT   CDS_pept        complement(135182..135703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11142"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11142"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00789"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV97"
FT                   /protein_id="ABH00789.1"
FT                   /translation="MTNPMSEGRRADSIRRRQRVVKALGAAGATGTEITVSSIARAAGV
FT                   DRSFLYRHRDLLARIHTAQSCPSPTHWNGEPVTRESLKADLANTHQRIARLAAHNTQLE
FT                   RKLSELLGEAAWRESGLGAPTDIDQLQRRITMLEQHVVDLTGQLEERSQELDAARSANR
FT                   ELFTNMNKQH"
FT   gene            complement(135707..138106)
FT                   /locus_tag="RHA1_ro11143"
FT   CDS_pept        complement(135707..138106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11143"
FT                   /product="possible transposase"
FT                   /note="GO_process: GO:0006310 - DNA recombination"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11143"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00790"
FT                   /db_xref="GOA:Q0RV96"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV96"
FT                   /protein_id="ABH00790.1"
FT                   /translation="MGWSDESKVLHFPRGHPSLLWKKCVVVNCESESHAVNGLCPACRT
FT                   QWKIAGSPAVKDFADVPRARFRAYGLCAVSQCERPWTSMNSGLCEAHRSQRIKTLKVSM
FT                   ADFLKHPKVVARKSFGSCEVVACDRARSGQIPYCMNHGIQWRKVRDGADAAGLAAADEM
FT                   RFRRTTAAISYLNECTLRGLPDRVVAELIYGLQQRTGQGVKTRADQVRPLVTHLLANEY
FT                   RTLEDVLPGDLRPAVKNVWSTATTELRRLHLSPETERVKDEWDATVFGFRGTLRFTKIT
FT                   QPWLREAAKIWAYNDISRRRSKNAKAMVQNEIRFLVMLSDSLRLQRPGDHGNDPRDLSR
FT                   SDIAGFLNRLTFLHNDGSMSPYARMTAIRGVRRILATMRGLGLRRPGQPMHGLPEDFTL
FT                   DPEDVPLEGERNSEHRDLPAEVMRHVCAHLNSLEENTSREVRVAVELIIDTGRRPDEIC
FT                   QLRLDCLERDEQGKPVLVYTNIKANRLDRRLPITEPTAAVIVAQQERVRARYPNEDATQ
FT                   MKLIPALTRNPHGTRGLNDDWLTMRHRDWVVTLPDITIPIIVDIDGQHVTKMLPFDRNK
FT                   IFLYAYRHTYAQRHADAGVAIDVLSDLMDHRQFGTTQVYYRVGETRRRDAVDRLATMHF
FT                   DRHGNKIWREARALLDSEHLRRAVGEVAVPYGTCSEPSNVAAGGHDCPVRFRCVGCSHF
FT                   STDVSYLPDLQSYLADLLRSRERLRGALAADDWAKGEAMPSDEEIQRIRRLISQIGADV
FT                   DDLSDEDRSQIEQAAATVRRARNQIIGLGTPRVRQPLPDLRQDRRA"
FT   gene            complement(138208..139338)
FT                   /locus_tag="RHA1_ro11144"
FT   CDS_pept        complement(138208..139338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11144"
FT                   /product="probable integrase/recombinase, XerC and XerD
FT                   family"
FT                   /note="GO_function: GO:0003674 - molecular_function;
FT                   GO_process: GO:0006259 - DNA metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11144"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00791"
FT                   /db_xref="GOA:Q0RV95"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV95"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00791.1"
FT                   /translation="MPSGGAYWTVVDDDYAVESIADRYLRELRFGRDRAESTTKAYAEG
FT                   MSLFLRWCDRTGREWRTAARDIGLFIVWLKYTRSDGSAMLAGPDARQVRGAGRINKILV
FT                   AVRGFLAFAVVAREAPAAVLEQIYELADARDLPLAAQGESARLRYRLRARHSLHEPETA
FT                   VDRASDEEVIALFRVCRSARDRLIVLMLSRAGVRRGELVGMRRSDLHLLPDNAVHHCPI
FT                   RGAHVHVVRRENSNGAVAKSRNSRAVPIDFLLVRALDLFLLERAEQPAADECDFLLVNL
FT                   FREPLGAPMTVGAINELFEALCVRAQLARSISPHQCRHGFASNLADSGALLDEIQGLLG
FT                   HASASSATPYLHPSPDRLRDAVERVPSPRALTDGLR"
FT   gene            complement(139453..139920)
FT                   /locus_tag="RHA1_ro11145"
FT   CDS_pept        complement(139453..139920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11145"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11145"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00792"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV94"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00792.1"
FT                   /translation="MSELPIAPASNGLTKAEKLDQLRRKMAAIPARSEGTAPAMPAVML
FT                   RSVDEPTPIVATAQTTLRTLPVPSPIAGLLPRGGLARGTVASVAGTSSVLVGLLASVTA
FT                   AGSHAAVIGMPDLSLLAAVEQGADLSRIAIVPAPKDSAVEVAFSGGSQTVA"
FT   gene            complement(140121..140495)
FT                   /locus_tag="RHA1_ro11146"
FT   CDS_pept        complement(140121..140495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11146"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00793"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV93"
FT                   /protein_id="ABH00793.1"
FT                   /translation="MCIACRRRIGTATQSSGPYWVQAEWWRVYPQIAKRNRPPRTCQIR
FT                   GIPQIRTGNESPVWAVGGDLLLVAVVRVDRPSDSDDQDVAGTRNFTATLNAYFPGLSSR
FT                   DSMSAWPSSSMLRILNFETP"
FT   gene            140846..141817
FT                   /locus_tag="RHA1_ro11147"
FT   CDS_pept        140846..141817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11147"
FT                   /product="ATP-dependent DNA ligase"
FT                   /EC_number="6.5.1.1"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0003910 - DNA ligase (ATP) activity; GO_function:
FT                   GO:0005524 - ATP binding; GO_process: GO:0006260 - DNA
FT                   replication; GO_process: GO:0006281 - DNA repair;
FT                   GO_process: GO:0006310 - DNA recombination"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11147"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00794"
FT                   /db_xref="GOA:Q0RV92"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV92"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00794.1"
FT                   /translation="MRLIAPMLATAGTLPDNTDRPWSFEMKYDGCRMLASVGGGHEPVL
FT                   WTRAMNVVTPSYPEIAEALTAAFGGRGRIVLDGEVVVLDQGKPSFGLLQRRLGVAHATK
FT                   PLQRRIPVTFLPFDVLALDGDDLTKASYLERRAELAELDSTIQDVGGLPITVPPHWDNQ
FT                   SSKIMLNAAKSAGMEGVLAKRSTSLYLPGQRSRSWIKHAIRTRSSVLVIGFVGSSRSVA
FT                   ALILGAYDAEGRLVQVGSVSSGLTVSMRRQLREDFRPLERPSSPLTDPSAAAETFPGVQ
FT                   WLNPRLVVDVAYRAHTAGGLRHPSLKGRRFDVDFQSVRVEDL"
FT   gene            complement(141954..142883)
FT                   /locus_tag="RHA1_ro11148"
FT   CDS_pept        complement(141954..142883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11148"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11148"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00795"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV91"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00795.1"
FT                   /translation="MHNKGNAWKERRRLATVGAGQAESPGAAGDEEGVTAPVSMARATL
FT                   GVQLEELPRRLAELRGFLEAVTETVTSVTDVEAAAAEVDQAHAEALAKVAEADRLRGDE
FT                   ERRRRDAEARASEHQQAREEADAAAEDAYAELARIQTEAAEARAELERIQADAAERIAA
FT                   AETDASRRIGAAQEEARKAIEEIRGRTATEIAEVKASAAQQVDAAQEAAAEAQVAQTRA
FT                   ETQTAAAQTSAQEAREDVDRLRGELADLRTEVRTDREQARADHAAQLAEARQSASERVD
FT                   ALTTALRAAEQTIEELRRHPGGGGAATV"
FT   gene            143123..143827
FT                   /locus_tag="RHA1_ro11149"
FT   CDS_pept        143123..143827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11149"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00796"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV90"
FT                   /protein_id="ABH00796.1"
FT                   /translation="MRRADDPAPGVGSRLVWRFSHFCGKTVAEARPIWRRSPPPHDDQA
FT                   KQHPGRPRTPATDPHGQPQRDQRSARSDERNQPALRPGDKWRTAGQANELRHIGMTTDT
FT                   GARCRLRRKRCCTKRAAPRHFSTSRGLIADTVARMEKPIHAHHADQGKPSGDSGAPNAV
FT                   SVGKQTDELLAKAVGEALAAGMSWAQIGGRLGVPNPAAGQDVVTDQDWQEAIVAHENAR
FT                   VARHNDLEVGRR"
FT   gene            complement(143848..144237)
FT                   /locus_tag="RHA1_ro11150"
FT   CDS_pept        complement(143848..144237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11150"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00797"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV89"
FT                   /protein_id="ABH00797.1"
FT                   /translation="MSKPRSKKPKPNRRTARTTKEVARLEEFLGRADATRQERPLTGQE
FT                   EAQVAEARRMRAEILNRTPRSYRGGIKGNEGRGYRQPSGGIASTVSGGAPSVGKSDDDG
FT                   SERLPVIITPMVAEHFPPPLWSRWT"
FT   gene            144427..146163
FT                   /gene="hsdM"
FT                   /locus_tag="RHA1_ro11151"
FT   CDS_pept        144427..146163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdM"
FT                   /locus_tag="RHA1_ro11151"
FT                   /product="type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /EC_number="2.1.1.72"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0008170 - N-methyltransferase activity; GO_process:
FT                   GO:0006306 - DNA methylation"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11151"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00798"
FT                   /db_xref="GOA:Q0RV88"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV88"
FT                   /protein_id="ABH00798.1"
FT                   /translation="MSKLGNFVWGIADQLRGVYKPHQYGGVILPFTVLRRLDCILEPTR
FT                   DEVRALATKYADGALDVQVKRKTGLAFYNTSPFDFKHLLEDPEGLRANLVDYITGFSAN
FT                   IDVFERFKFENELATLDEKNRLYLVTSQFADVDLHPDVVSNAEMGDLFEHLIYKFAEAS
FT                   NEEAGEHYTPRDAIRLMVDLLFAEDNAALLEPGTVRTIYDPTAGTGGMLSVAEERLLER
FT                   NPDARLRLYGQEINDQSYAICKSDMIAKGQDVGNIKLGDTLAEDQFFDRTFDFCMSNPP
FT                   YGVDWKASQEAVKKEALAQNSRFSHGLPAVGDGQMLFLSHLASKMRPKHDGGGRAGIVL
FT                   NGSPLFNGAAESGPSKIRQWLLKSDLVEAIIALPTNMFFNTGIATYIWILDNTKRPERE
FT                   GKVQLIDATPFWSKMRKSLGAKSRELDAGARDRILALYDAYDEADPAYSKIFTSDDFGY
FT                   WTITVEQPLLDEDGMPVTDRSGNPKPDTKKRDTENIPFTYGGNTEGEAGRTATIKAYFE
FT                   AEVLPHVHDAWIDAKKTRIGYEIPFTRHFYKYVPPRPIAEIDADLEKQVAKIMELLRVV
FT                   EQ"
FT   gene            146160..147335
FT                   /gene="hsdS"
FT                   /locus_tag="RHA1_ro11152"
FT   CDS_pept        146160..147335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdS"
FT                   /locus_tag="RHA1_ro11152"
FT                   /product="type I restriction-modification system
FT                   specificity subunit"
FT                   /EC_number="3.1.21.3"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006304 - DNA modification"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11152"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00799"
FT                   /db_xref="GOA:Q0RV87"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV87"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00799.1"
FT                   /translation="MTAEPWLPEILPSGWVVAQMRRIATFRNGADYKEVEVTEGGYPVY
FT                   GSGGEFRRASQYLYDGESVLFGRKGTIDKPLLVSGRFWTVDTMFFTELTSNIEPRYLHY
FT                   YATTMPFDYYSTSTALPSMTQGELGGHRIPLPPITEQGAIADFLDRETARIDTLIREQR
FT                   RLIELLRERRIAVAEGPVVGLSWSTPLRSVTALIQTGPFGSQLKSDEYETGGTPVINPS
FT                   HLVMGRIEPDERVAVSASKASELGRHALRAGDVIAARRGELGRCAVVRAENTGFLCGTG
FT                   SALIRLRETVADPEFLALVFSSRRNRDSLSLASVGATMDNLNADIIATLRIPMPPLPEQ
FT                   RRIVESVAEATTKIDTLITETESFIDLAKERRSALITAAVTGQIDVRDEVA"
FT   gene            147322..150447
FT                   /gene="hsdR"
FT                   /locus_tag="RHA1_ro11153"
FT   CDS_pept        147322..150447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdR"
FT                   /locus_tag="RHA1_ro11153"
FT                   /product="type I site-specific modification system
FT                   restriction subunit"
FT                   /EC_number="3.1.21.3"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0004386 - helicase activity; GO_function: GO:0005524 -
FT                   ATP binding; GO_function: GO:0016787 - hydrolase activity;
FT                   GO_process: GO:0009307 - DNA restriction-modification
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11153"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00800"
FT                   /db_xref="GOA:Q0RV86"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV86"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00800.1"
FT                   /translation="MRWPEVAQHNEIEFEKEIAEYLHAHGWLYSRDDTGYDRERALFPE
FT                   DVAGWLADTQPEQLDKVVKSGSADVAKQQDQLLDRIVKILDTPLENGGGTLNLLRKGFS
FT                   HLSAKFQMCVFRPESTLNVKRNGEYAAVRLRVMRQVHFSTADNRSVDLVFFVNGLPVAT
FT                   AELKTDFTQTVTDAISQYRTSRLPKDPATGKAQPLFVSGARALVHFALSNDEVWMTTKL
FT                   AGDKTHFLPFNRGSEDGGAGNPLNPNGSRTSYLWEQVLQRDAWLNILGRLMYIKHESST
FT                   DPISGKTSKSSTLRFPRFHQWEAVSELTAAVTAEGVGKRYLIQHSAGSGKTDSIAWTAH
FT                   RMARLQVENTKVFDSVIVVTDRNVLDAQLQDAIKQIDNDQGIVVAIDRDEAARAGGSKS
FT                   GLLAKSLTDGKLIIVVTIQTFPFAMEEIRKNKGLKGKTFAVIADEAHSSQSGQVASKLK
FT                   AVLTAEELQDIEDGADVDVEAVLAAEASERAASANISFFAFTATPKGKTLELFGRAPAA
FT                   GGKPVPFHVYTMKQAIEEGYILDVLTGYHSFKLAFQIGQNATSEDEVDQSQATKEVMRW
FT                   VKLNPQTIAQKAAIIVEHFRANVAHLLDGHAKAMVVTDSRKAAVRYKLAIDDFIAKKGY
FT                   GYGTLVAFSGAVQDPESGPKDFTEATMNPGVHDLRTAFTGDAYRVMIVANKFQTGFDQP
FT                   LLCAMYVDRILSGVTAVQTLSRLNRTYRTPSGVLKSAAMTQVVDFVNEPTVIREAFEPY
FT                   FTDAFLETETDPNLVHDLAAKLDTAAIYAQAEVDQCAEGFVKGRGHSALAAAVDPGKKR
FT                   FAERYQAALIHNGGEGDKAALAELDMFRKDVGSFVRLYDFMSQIVDYGDPELEKKQIYL
FT                   RHLDRVIQPDNYTAPIDLSDVVLQRVKQVDQGKSDISLGARVGLTGVTAAGSGEKRDPK
FT                   MVAFRQVLDRLNDLFGSEDFTQSQKVSFLESLLRTLLDNDSLVQQATVNSTKQFVESPD
FT                   FDDAVTGAVADNQGAHEKMSDYFFTNAPGRSHLISDIAKWFYQVVSEENAST"
FT   gene            150662..152128
FT                   /locus_tag="RHA1_ro11154"
FT   CDS_pept        150662..152128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11154"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0000166 - nucleotide binding;
FT                   GO_function: GO:0017111 - nucleoside-triphosphatase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11154"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00801"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV85"
FT                   /protein_id="ABH00801.1"
FT                   /translation="MGHEKNVKSLAGKYDTSNRYSNFGPILQSIEISGFRGIQHLELDL
FT                   KSPITAISGLNGTGKSTIAQLMSCGYKKASTAALSRYYVKDFFPISAADPEPFSTIAKV
FT                   VFSYCVERGAEAQKVTVSRKESQWSGYKRQPERACYYVGFTQFIPKVERRDFSVYGAHE
FT                   LTLGVSTELSEEASENIAKILSLPYENLDFTEVSHKDRTMQLAMAVRRGKRYSENHMGF
FT                   GEGRVVYMVTAMESAPLQSLFVLEEPETSLHGDAQRRLARYLVDVCSRRGHQIVMTTHS
FT                   SAILSQLNRKSVIYLRRDREGGLTATTGLSTYQIDSYLQSEDRSSNGSTICVEDQFAKC
FT                   FATEILRICNADLLGGCNFITIGGGQEIPKAVELLRDAGLRAVGITDGDMNLKGEYISR
FT                   LPGTIPPERLVFGDPAVASHFDERYRLDLDEVLASIDDHHDFSLAIARHASVEANVIAT
FT                   ESCMAYVAAREPSEFDELTNFLTKTLGDRR"
FT   gene            152455..152739
FT                   /locus_tag="RHA1_ro11155"
FT   CDS_pept        152455..152739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11155"
FT                   /product="probable transposase"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0004803 - transposase activity; GO_process: GO:0006313 -
FT                   DNA transposition; GO_process: GO:0006412 - protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11155"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00802"
FT                   /db_xref="GOA:Q0RV84"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV84"
FT                   /protein_id="ABH00802.1"
FT                   /translation="MPKPYPEEFRRDVVAVARKREAPLEQIAKDFGISETCLKNWLRKA
FT                   DIENGTRPGLTRDESDELREARKRIRLLEQETEVMRRAVAYLSRDVNPK"
FT   gene            152736..153398
FT                   /locus_tag="RHA1_ro11156"
FT   CDS_pept        152736..153398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11156"
FT                   /product="possible transposase, N-terminal"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006313 - DNA transposition"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11156"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00803"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV83"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00803.1"
FT                   /translation="MMFPLVRELAADGVAVAVTCRVLGFSRQAFYKWNTDPVSRRDWDD
FT                   AHLINAALDIHAGDPEFGYRFIADELPTHGIVAGENRVHRLCSQQRIFSVVAKKRGLAR
FT                   RSGPPVHDDLVRRQFTAKQPDRLWLTDITEHWTDEGKLYLCAIKDCFSTEDRRLFDRRP
FT                   DDRGPGVCGAAKCHCAPQPGRHRRTFRSRQPVPFRNLRRIAGPQWFTRINGEGGGMW"
FT   gene            153409..153600
FT                   /locus_tag="RHA1_ro11157"
FT   CDS_pept        153409..153600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11157"
FT                   /product="possible transposase, C-terminal"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006313 - DNA transposition"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11157"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00804"
FT                   /db_xref="GOA:Q0RV82"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV82"
FT                   /protein_id="ABH00804.1"
FT                   /translation="MESFFALLQRNVLDRRHWSSREELRLAIVEWIEKTYHRRRRQRGL
FT                   GRLTPVEYETLHHTVHAA"
FT   gene            complement(153884..154210)
FT                   /locus_tag="RHA1_ro11158"
FT   CDS_pept        complement(153884..154210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11158"
FT                   /product="possible transcriptional regulator, WhiB family"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11158"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00805"
FT                   /db_xref="GOA:Q0RV81"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV81"
FT                   /protein_id="ABH00805.1"
FT                   /translation="MNGRTHQERLQLPAKLLKLPPPIVESWEWQRHAACRSVDTSLFYY
FT                   LDNERGDPRDWRLRHAKRVCRKCPVKEACLRHALEANETHGVWGGLSEEERRQLRRSSG
FT                   QQVT"
FT   gene            complement(154239..155795)
FT                   /locus_tag="RHA1_ro11159"
FT   CDS_pept        complement(154239..155795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11159"
FT                   /product="probable AMP-binding acyl-CoA synthetase"
FT                   /note="GO_function: GO:0016208 - AMP binding; GO_function:
FT                   GO:0016874 - ligase activity; GO_process: GO:0006869 -
FT                   lipid transport; GO_process: GO:0009698 - phenylpropanoid
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11159"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00806"
FT                   /db_xref="GOA:Q0RV80"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV80"
FT                   /protein_id="ABH00806.1"
FT                   /translation="MTLSNFAVLTPTQYLDRAAVTVAHRNAIIDGDLTFTYREFAERSN
FT                   RLTGVLAARGIGVGDRVAVLCTNSHIMLELHNAVPLRGAVLVPLNIRLSEPELDYILEH
FT                   SGATLLVATHEFADIAGSLAARRNIPLLQADGSDSAYETELVSAEPARVESDDDRTLLA
FT                   INYTSGTTGRPKGVMYHHRGAYLQALAMTYHMGLGPGSRYLWTLPMFHCNGWCFPWAVT
FT                   AAGGTHVCLRAVDPSEIWRHIREGATHFSAAPTVLSMIAEHAAAADGPTANPVKVSTGG
FT                   APPSPTLLRRMVKLNMQITHLYGMTETFGPAIINLWQPEWDSLGDQAAAEKQARQGVPN
FT                   VITGGARVVDSAGKDVEPDGQAIGELIIEGNNIMLGYYRDDAATAAANVDGWLRTGDLA
FT                   VMHADGYVEIRDRLKDVIISGGENIASVEVERVLDSHPAVVESAVVGIPHDRWGEVPIA
FT                   FVTVRPGTEVHEEELVEFARQHLARFKVPKKIIFANLPRTSTGKIQKNVLRNATVDVIG
FT                   Q"
FT   gene            complement(155823..156128)
FT                   /locus_tag="RHA1_ro11160"
FT   CDS_pept        complement(155823..156128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11160"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00807"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV79"
FT                   /protein_id="ABH00807.1"
FT                   /translation="MTQEGGTEGTFLVEYLYVPEIERRREEIRQDHRAYLDDSFETGTL
FT                   RFAGAVRDPVDRGVLLVEADSRGKAMQWATADPVVRAGLVRAIHVHEIGVAYPRHF"
FT   gene            complement(156125..157024)
FT                   /locus_tag="RHA1_ro11161"
FT   CDS_pept        complement(156125..157024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11161"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0016787 - hydrolase activity;
FT                   GO_process: GO:0006725 - aromatic compound metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11161"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00808"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV78"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00808.1"
FT                   /translation="MQVKPEDVAVTEVEFYSDGTRIAAELFLPPGLGVPAPAVVVAHGF
FT                   GGIKAFFVADIARAIAAAGFACVTFDYRGFGESDGPRNRLHPLEQVEDALAAAAYLRTR
FT                   DEVDPERVGVYGTSFGGGIAIAAAALDPKMRAAVCAVGISDCGHWLRSLRRNWEWIEFQ
FT                   HLLEKDRRNRLLTGVSEVVEPEVIMVRDPESEKHEQYLRENWPDRAFQLDLASADAIMA
FT                   FRSVDYAKRLGDKALLLVGVDEDGLTSYDYTVELYEAATGPKKLIELSGMTHHDIYQPQ
FT                   ERDGLMAKVVEFLKEHVA"
FT   gene            complement(157262..158167)
FT                   /gene="fabG3"
FT                   /locus_tag="RHA1_ro11162"
FT   CDS_pept        complement(157262..158167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG3"
FT                   /locus_tag="RHA1_ro11162"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0004022 - alcohol dehydrogenase activity; GO_function:
FT                   GO:0004316 - 3-oxoacyl-[acyl-carrier protein] reductase
FT                   activity; GO_function: GO:0004853 - uroporphyrinogen
FT                   decarboxylase activity; GO_function: GO:0008874 - gluconate
FT                   5-dehydrogenase activity; GO_function: GO:0018454 -
FT                   acetoacetyl-CoA reductase activity; GO_function: GO:0051287
FT                   - NAD binding; GO_process: GO:0006633 - fatty acid
FT                   biosynthesis; GO_process: GO:0006779 - porphyrin
FT                   biosynthesis; GO_process: GO:0042619 - poly-hydroxybutyrate
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11162"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00809"
FT                   /db_xref="GOA:Q0RV77"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV77"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00809.1"
FT                   /translation="MFGRVVLLCNLQVRGPLVERPAPEGSPTSTDQRRISVLSPNATIE
FT                   FDFSGCTVLVSGGTSNLGYVFASAFARAGASVGVLGGSNAAALEKAVDDLRDTGVPVSG
FT                   QLADLADAVALEGAVSRIVAELGPIDVLVNNAGVRSHHLPQDLELEEWDHTVAVNLRAP
FT                   YLLARQLMPSMMERGFGRVINVSGLNVWWASPETTHVGASKAGLLGLTTSLAAQGASRG
FT                   VTVNSIVPGFVDTPSSRATAGTGRDEIVRRLVPMGRAARMEEIVDTGLFLASDSASYIT
FT                   GQTLTVSGGASPMVAFGGGE"
FT   gene            158367..159227
FT                   /locus_tag="RHA1_ro11163"
FT   CDS_pept        158367..159227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11163"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11163"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00810"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV76"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00810.1"
FT                   /translation="MAESNSFPVTHLSWRETRREANWDLPDAEKWGLHRAHYPELVGET
FT                   FTAHMVQLPSSQSVPERTSDASVVYVGVKGELEFRIGEERIVVGPRDVLTVPNGLPHSC
FT                   ANHDFESALFVSVTTTAEEDDASALSGPHLLPWMDYRRQFRSAILPHAMEYGHHRLSAP
FT                   HTPLRSLLGHTVRIPTNQASPWHGIPRDLLFVQFSGEVEFSLAGRKCLLEPYDLMLVRA
FT                   RTPYSYANFGTEDGLFFDIGGRILVQGETSTYYESDPGWPINPEVGTYKIVTDDPAFRA
FT                   IYGSR"
FT   gene            159267..160157
FT                   /locus_tag="RHA1_ro11164"
FT   CDS_pept        159267..160157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11164"
FT                   /product="possible hybride transferase/ F420-dependent
FT                   dehydrogenase"
FT                   /note="bifunctional; GO_function: GO:0004497 -
FT                   monooxygenase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11164"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00811"
FT                   /db_xref="GOA:Q0RV75"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019921"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV75"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00811.1"
FT                   /translation="MENEQGLGLPKIGINLVPVHVGSLGAAAQTAEELGFESVWLGEHV
FT                   ITPLSDVSAAYPGKAVNFEPGSPLVEPLIALSHIAAATSTIRLGTSIVCLPLRDPLLTA
FT                   REISTLDHLSGGRIELGAGLGWMREEYEAMGRDWRTRGSRLEEFVTVITGLLAGEPFQF
FT                   SGKHFEIPPMLFGPTPLQSPHPPIHLGGQGPKALARCAALADGWIGGAKSADTVHEIVD
FT                   ELLALRRSAGLPTDDFDISVIVLHPPTVTELRNMRARGVRRVIVTPWQGNDGPPFPGIT
FT                   GDLAPLNALADELGL"
FT   gene            160283..161416
FT                   /locus_tag="RHA1_ro11165"
FT   CDS_pept        160283..161416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11165"
FT                   /product="possible hydrolase"
FT                   /note="GO_function: GO:0016787 - hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11165"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00812"
FT                   /db_xref="GOA:Q0RV74"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV74"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00812.1"
FT                   /translation="MFDGLSGSPLLAALPRRRFLQAAGALGGTVALTGCAPSVAPASPA
FT                   DGAVPADAVELTGDTEGYNTTLLLLGTGGGPTAHPGRTGVSSAVTVGGRPYLVDAGSSA
FT                   YRRMAQAGIGAKSLGGVFVTHMHSDHLADLFTIFLLNVGNYMAGAPETPTPIFGPGHIA
FT                   GAPHAEVSGMQGMLQGVLAAWAHEIDVRNAEAAKPVDYQKVVVGRDVVIPDSVRMSADN
FT                   PAPDMDPFPVFEDDRVRVTGILVPHGAALPGFAYRFDTDNGSVTFSGDTARSSNVARLA
FT                   TGTDILVHEAIDIDYYKRNGFPEDVLEHHRQTHTSPDDVGRVATEAGAKKVVLNHLAPG
FT                   DPRLVTDDEWVSRVSSTYAGPVVAGRDLTAHGVGPHS"
FT   gene            161508..162521
FT                   /locus_tag="RHA1_ro11166"
FT   CDS_pept        161508..162521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11166"
FT                   /product="probable glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0015948 - methanogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11166"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00813"
FT                   /db_xref="GOA:Q0RV73"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019944"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0RV73"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00813.1"
FT                   /translation="MTQQLKLGYKASAEQFGPRELVELAVLAEKHGMDSATVSDHFQPW
FT                   RHNGGHAPFSLSWMTAVGERTKRLQLGTSVLTPTFRYNPAVIAQAFATMGCLYPGRIML
FT                   GAGTGEALNEIATGYTGQWPEFRERYARLRESVQLMRDLWTGERTDFKGEYYSTTGASI
FT                   YDVPECGIPVYIAAGGPVVARYAGRAGDGFICTSGKGMELYTDKLMPAVSEGATKAERD
FT                   VTSIDKMIEIKISYDTDPEAALENTRFWAPLSLTQEQKHSIEDPIEMEAAADALPIEQV
FT                   AKRWIVSSDPDDAVAQVKQYIDAGLNHLVFHAPGHDQKRFLELFDRDLAPRLRALG"
FT   gene            162550..164202
FT                   /gene="pgi2"
FT                   /locus_tag="RHA1_ro11167"
FT   CDS_pept        162550..164202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi2"
FT                   /locus_tag="RHA1_ro11167"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="GO_function: GO:0004347 - glucose-6-phosphate
FT                   isomerase activity; GO_process: GO:0006094 -
FT                   gluconeogenesis; GO_process: GO:0006096 - glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11167"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00814"
FT                   /db_xref="GOA:Q0RV72"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0RV72"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00814.1"
FT                   /translation="MTATTAQLLTETTPWLRLSEHSEEIDRSHLRALFASDPDRVDEFT
FT                   VTAGDLHIDYSKHLITRRTRELLLDLARSVDVEGNRDAMLHGEHINTTENRAVLHTALR
FT                   LPRDASLSVDGQDIVTDVHETLEKMGVFTERLRDGRWRGATGKKITTVVNIGIGGSDLG
FT                   PVMVYRALRHYADAGISLRFVSNLDPADLTDNLRGLDPAATLFIVTSKTFSTLETLTNA
FT                   TAARRWLVSALGEDAVTKHFVAVSTNAQPVAEFGIAPENIFGFWDWVGGRYSVGSAIGL
FT                   SVMAAIGRERFTELLDGFHTIDEHFRTAPPESNAPLLLGMLGVWYSSFRGAQSRAVLPY
FT                   SNDLVRFPAYLQQLTMESNGKSVHTDGSPVRCDTGEIFWGEPGTNGQHAFFQLLHQGTR
FT                   LVPADFIGFAQSTDDLPTMSGTGSMHDLLMANFFAQSKVLAFGKTRKEIAAESASADLI
FT                   PHKVMPGNRPSTTILAPRLTPSTLGQLIALYEHQVFVQGVVWGIDSFDQWGVELGKVQA
FT                   LALAPAVAGEAAPCTGDTSTDALIRTYRRLRHP"
FT   gene            complement(164690..166546)
FT                   /locus_tag="RHA1_ro11168"
FT   CDS_pept        complement(164690..166546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11168"
FT                   /product="probable acid-CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /note="GO_function: GO:0004467 - long-chain-fatty-acid-CoA
FT                   ligase activity; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11168"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00815"
FT                   /db_xref="GOA:Q0RV71"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV71"
FT                   /protein_id="ABH00815.1"
FT                   /translation="MNGEGGECGVGVGAVPCRRTHTSCCAPPESTDTPAHRRPSDVSGS
FT                   GRRHLQCREILPALQVLRCALRQPEQLNQTNGRPARDAENMYRTRAINLSTYLRQTTAR
FT                   HGERCAMVEGTESITWSEFDSGVDALARELLDRGLCPGDPVLLHSPNRIQQVQSMYAVW
FT                   RAGGILAPVNFRSSPAEVAGMAATARPRLMIGHGDYREHLRAVAATGLLELGQLVIDGA
FT                   GGSDDVGAVVRRDGDRVDDARVSQDQPAWYFFTSGTSGNPKAAVLTHHTLGYIITNRLA
FT                   DLVPDTTQQDVSLVTAPLSHGAGTHLLCQVARGATSVLTLARPFDPSQVWKLVERHRVT
FT                   NMFTVPAILKLLVESPEAENRDHSSLKYVLYAGAPITMQDRERARAVIGNKLVQFYGMA
FT                   EVTGTMTVLTPAGHDVEPVDADGFGPAGYPRTGVELSIQDDRGNLLPAGQRGHICAAGL
FT                   PVFAGYLNNDAANDEAFVDGWFRTGDIGYLNTRGCLYITGRASDMYISGGHNVYPREIE
FT                   EQLSQHPAITEVAIVGVPDGKWGEIGVAVCVASDSIPPDADELAEWLSHRMARYKLPQR
FT                   FVFWPELPVSPNGKVAKKTLRELLNSGMFDAERIPTVQSVPM"
FT   gene            complement(166558..167376)
FT                   /locus_tag="RHA1_ro11169"
FT   CDS_pept        complement(166558..167376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11169"
FT                   /product="carveol dehydrogenase"
FT                   /EC_number="1.1.1.243"
FT                   /note="GO_function: GO:0004022 - alcohol dehydrogenase
FT                   activity; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11169"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00816"
FT                   /db_xref="GOA:Q0RV70"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR023985"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV70"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00816.1"
FT                   /translation="MGVGRVEGKAALITGAARGQGRAHAAKLAEEGADVVVVDVCAPLP
FT                   SVSYAAATTEDLAETVRLVEKFGRRAVSARVDVRDLAALRTTVDAAVGTLGRLDIIVAN
FT                   AGICVPRAWERVTEQIFEDTMSTNVTGVWNTVMAGAPHLIRAGGGSIILISSVAGIKAQ
FT                   PFMVPYTTSKFAVRGMAKAFAAELSAHGIRVNSVHPTGVNTPLASEEMQAELAAAIATN
FT                   PRLGNMLLNMLPVRGTDPEDVANSVLFLASDESRFVTAHELAPDAGNSEF"
FT   gene            complement(167499..168608)
FT                   /gene="adhB"
FT                   /locus_tag="RHA1_ro11170"
FT   CDS_pept        complement(167499..168608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhB"
FT                   /locus_tag="RHA1_ro11170"
FT                   /product="alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="GO_function: GO:0004022 - alcohol dehydrogenase
FT                   activity; GO_function: GO:0008270 - zinc ion binding"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11170"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00817"
FT                   /db_xref="GOA:Q0RV69"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR023921"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV69"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00817.1"
FT                   /translation="MKTKAAALTGVHRDWEVLEFDLDDPGPGEVLVQMKVAGLCHSDKH
FT                   AKFGGMTYPLVGGHEGAGVVEAVGDGVSRVSIGDHVAVSWIPSCGTCRWCASGQSNLCD
FT                   LGANMVTGELANGGFRFHRDGTDIGAMAATGTFSQFSVVDQRSVVKVDPTIPFEWVSLV
FT                   TCGVATGWGSVVNAGEVKAGDTVAVYGCGGIGSNAVRAAVGANAGLVAAIDPVESKLEF
FT                   AKQSGADFVYTSAEEAHADLWERTYGVGADVTVVTVGVVTSEVVRAAFELTRKGGTVVL
FT                   TGVSDDVMENTIELPGGILTLFQKRIVGSLYGHCNPLVDIPRLLRMAQAGKLVLDDLVT
FT                   RRYALEDINQGFDDMLAGHNIRGLIVHDH"
FT   gene            complement(168720..170357)
FT                   /locus_tag="RHA1_ro11171"
FT   CDS_pept        complement(168720..170357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11171"
FT                   /product="possible monooxygenase/ hydrolase"
FT                   /note="bifunctional; GO_function: GO:0004497 -
FT                   monooxygenase activity; GO_function: GO:0015036 - disulfide
FT                   oxidoreductase activity; GO_process: GO:0006118 - electron
FT                   transport; GO_process: GO:0006725 - aromatic compound
FT                   metabolism; GO_process: GO:0044248 - cellular catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11171"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00818"
FT                   /db_xref="GOA:Q0RV68"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV68"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00818.1"
FT                   /translation="MAETYDTPVLIIGGGPVGFATALDLAWRGCESMIVEREADGTQEF
FT                   RAKATGLDERSMEQLRRWGLHDQVLEVGFPVDFPFDTVYCTSLTGYPMGRSLNPSIREE
FT                   IPPVGSSEKRYACPQWELDKLLVESATASGLVEVRWNSAYGKITQDADGVTTEIIDAAT
FT                   GESSTIRSKYVVASDGAGSAVRRSLGIPFEGPQLDFSLNITIRIPKLELPEELARAQRY
FT                   LLIDEDGTWGVLTHIDGREIWRLTVVGAQDELDADTYDHMATVRRALGSGDIPFEVIRC
FT                   VPWRRSQSVAATYRQGRVFLAGDSAHTMSPTGGHGLNTGLGDVSDLGWILEAALSGWGG
FT                   KGLLDAYERERRPIGLRNGRKATGHYRQWVDSSNYVGVTQEGPEGDVTRKRVGDMLVEA
FT                   LKSEWHSPGTALGFRYEGSPIIVDDGTPEPADDPIDYVPTARPGHRAPHVALSDGSSIL
FT                   ALFGHGFVLLRIGAADLDTSAFESAGAAAGVPLRVEKLDEPAVAEMYERKLVLVRPDGH
FT                   VAWRGDVMPDDAAGVIDVVRGAAATGGS"
FT   gene            complement(170433..171149)
FT                   /locus_tag="RHA1_ro11172"
FT   CDS_pept        complement(170433..171149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11172"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00819"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV67"
FT                   /protein_id="ABH00819.1"
FT                   /translation="MINVLQATISRFERGTSSALRHKVRVVSRLRVRVGRSPLVDETPV
FT                   PVEVGVRVSELSPQSVPPIASASAPIRARMKLPDRWTNPRHPVRERLAIPIGTPTSSTD
FT                   RFRSTTTKTEANFQLRRRSTDIWGLPPATPKRKTSERRFSCTMPSERRHMTCLAGSTMT
FT                   SGSMERGGNFGGYARPGLQPTRDLRESDPVQKPAHRWNLDHPGGRPQQRKYAFDRVRRI
FT                   SVQATRVSRNALGADE"
FT   gene            complement(171156..172382)
FT                   /locus_tag="RHA1_ro11173"
FT   CDS_pept        complement(171156..172382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11173"
FT                   /product="multidrug resistance transporter, MFS
FT                   superfamily"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_component: GO:0019866 - organelle inner membrane;
FT                   GO_function: GO:0015520 - tetracycline:hydrogen antiporter
FT                   activity; GO_function: GO:0015559 - multidrug efflux pump
FT                   activity; GO_process: GO:0006855 - multidrug transport;
FT                   GO_process: GO:0015904 - tetracycline transport;
FT                   GO_process: GO:0046677 - response to antibiotic"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11173"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00820"
FT                   /db_xref="GOA:Q0RV66"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV66"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00820.1"
FT                   /translation="MREAITVPMLLVLALLSATSPVATGVYLPGLPSIASALGTSNIGV
FT                   QLTLTTFMVGLGLGQLLAGALSDSWGRRRLLLGGSVAFTVASAVCALAPTIGVLTVARL
FT                   IAGFSGGIGVVLARAVISDRARGIEAARLFSVMMIIGGVAPVIAPVLGGMLLGPIGWRG
FT                   TFWVLTAIGGIMTFGVATAIPETLPPETRHTGGLLVLGQNFRQVVGDRRFVGYAAAMAI
FT                   GAGAMFSYIAASPFVVQKIFGFTPTQFSLVFAFNALSLVTAMTINSRLVSRISVRRLLI
FT                   FGVGVVWVSGLGLLAVSLFSPTTPWPLLALLLTMMFGMGLTMGNAVALAQDQVPSVAGT
FT                   GSAVIGAAQFAVAAIVSPLVGLGGESTSVPMAVSIAVCGTIALTALLTLTRDRPETRLP
FT                   GFRFQKNAL"
FT   gene            complement(173094..174191)
FT                   /locus_tag="RHA1_ro11174"
FT   CDS_pept        complement(173094..174191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11174"
FT                   /product="ABC sugar transporter, permease component"
FT                   /note="tc: 3.A.1.2; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0005215 - transporter activity; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11174"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00821"
FT                   /db_xref="GOA:Q0RV65"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV65"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00821.1"
FT                   /translation="MKNQTVTNASLDVPGDSVGAKSPQSAQQQTRKNLTEILPHAAVPL
FT                   LFVATFVLFSVLSPDLFFSWTNVRIVLAAQATVLLLAVAITIPLRSGDMDLSVAAVMVM
FT                   CATVVGALYSNGVSALLSCVIAVGVGLVIGVLNAVLIVVAGLESIIVTLGMYTLVAGLT
FT                   SFVSGGNLVTTIPKSLKDFATTPFLTLPAIVWIGWLVALVVWFVFEFTPMGRYLLFVGG
FT                   NRAAATLAGLRVSRIRITALIAAAVISAIAGVLFAGSIGSVDPSSGHSYLLAPATAAFL
FT                   GTTMIHMGRFNIIGTLIGLYLLAFGITGLQLLGVQGWVSDVFNGAALIVAITFARYFEV
FT                   LNFAKVRPKKLRNSKGAHSSEPPLR"
FT   gene            complement(174200..175723)
FT                   /locus_tag="RHA1_ro11175"
FT   CDS_pept        complement(174200..175723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11175"
FT                   /product="ABC sugar transporter, ATP-binding component"
FT                   /note="tc: 3.A.1.2; GO_component: GO:0019866 - organelle
FT                   inner membrane; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0016887 - ATPase activity; GO_process:
FT                   GO:0006811 - ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11175"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00822"
FT                   /db_xref="GOA:Q0RV64"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV64"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00822.1"
FT                   /translation="MMKAAVRLVGMTKSFDGVTVLDGVEFDIAPGEVHGLIGENGSGKS
FT                   TLVKVLGGVHAPDAGSVCELWGNPLEFPVDQPQRHGIAIIHQDLALCDAMTVAENIGIS
FT                   SGFDAKLLSPYSKSRESELIRKLSEEFDLQLDPDVEVGTLAPTERTVVAILRALRLLRK
FT                   HQDGQVLVLDEPTAALPHSESERLLAIVRSLAAAGTAVLFIGHRLQEVLSVCDRISVLR
FT                   SGKLVATVQASETTDSELVRMMLGYDIGAFYPDRHVPDRKVDVLQIRGLSGGTVEGLDL
FT                   TVGRGEIVGVTGLAGMGQDEVPYLVNGHYKRESGTVTVDGVAVKSSVRFALAAGIALVP
FT                   GNRQRDSVWGDGTAIENLTLPFLPRFRRGGVVRHRAEAEFSHGELVKFGVRPLRPAQHI
FT                   TRFSGGNQQKIVLARWLQVNPKVLLLHEPTQGIDAGAKKEIYKLIRDAAENGAAIVVFS
FT                   TDIEEVANVCHRVIVMRHGRATMEIAEECLSEQQLIAASQGALDVLEQK"
FT   gene            complement(175805..176971)
FT                   /locus_tag="RHA1_ro11176"
FT   CDS_pept        complement(175805..176971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11176"
FT                   /product="ABC sugar transporter, periplasmic substrate
FT                   binding protein"
FT                   /note="tc: 3.A.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11176"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00823"
FT                   /db_xref="GOA:Q0RV63"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV63"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00823.1"
FT                   /translation="MSLSGLRRNTLRRTSLVSAALLAGALITACGSGTDTSSAAGGSPR
FT                   GSAECASQSGDLVADQLDAKAQAPYPTDALDASVVKGKNYWVVLLSAAVPTQADYAKGF
FT                   QAAAVAAGAQAQVFDGKGTAATVIQGINAAIAAKADGIITVAVDLSQIDQALADAAAAG
FT                   IPVVDGSNGNPNAPFPKGNVGHVTLDSAEVGTWQANYALKATGCDTHAVIVGTLSAPTS
FT                   LAVVDGAKNQIASLCGDDCTTEVVDVRATDLGPKLVGMLQTTLQRNPNTNVILSATNVY
FT                   DPDIKQALSALGRDIPVVSLQTEGVLAGNSDAGPLIANVVYAPATALGWFYFDGMIKAA
FT                   AGQTNFAVKIPVAMIDESNWGTDPSTPQPPRYSGYEAEFAKLWSLKND"
FT   gene            complement(177536..178987)
FT                   /locus_tag="RHA1_ro11177"
FT   CDS_pept        complement(177536..178987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11177"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /note="GO_function: GO:0004029 - aldehyde dehydrogenase
FT                   (NAD) activity; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11177"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00824"
FT                   /db_xref="GOA:Q0RV62"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV62"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00824.1"
FT                   /translation="MSLSVSSYDRLYLAGRWSDADQPTVEVRNPATGEVVTRIAVATLE
FT                   NADAAVAAATQLHEDRTWADLSFGERADRLDAIADAIERRTEELTRIYAEDQGGLVSLA
FT                   PFVIGQSVGVFRGTAKLARGMDNSPSRRSGSGSDVLIHRVPVGPVLASVPWNGPLILAA
FT                   VKVATALAAGCPVIVKVDVQTPLASFLLAEAIDEVGLPPGLISVLPAEVDVAKHLVSHP
FT                   GVKHVSFTGSTAVGKDVMRAAAENMTRLTLELGGKSAAIVLDDFDPASAPMLVPGCLAQ
FT                   TGQVCTTFSRLLVPAERFEEWKAALVHVFSSLKIGDPTDPATVVGPLVSAQQLEKTEYY
FT                   VSLAREEGTIIAGGQRPDGFDGGYWYEPTLVTDVEPDSRIAREEVFGPVTVLLPFQDLD
FT                   DAIRIANDSEYGLAAGIFTNDVDQAVKIAPHLTAGAVSINNFGANFLEPFGGFGASGIG
FT                   REGGIEGIESFLETMQIQFPMAIGF"
FT   gene            complement(179614..180258)
FT                   /locus_tag="RHA1_ro11178"
FT   CDS_pept        complement(179614..180258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11178"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11178"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00825"
FT                   /db_xref="GOA:Q0RV61"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041612"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV61"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00825.1"
FT                   /translation="MNARVGGNNRGTYAKGIRRRQEILDRTLEVVVDKGIDGTSLRAIG
FT                   EAIEVSHAALRHYFSSREELLLEVLNAHGSLSQTWELRDRSVPLIDNLAEIAKQNAAVP
FT                   GLITLYTSLLAHSVEPGNEASRDFFIERFALARQIISDRIRQGQARGEIDPDLPVDEAA
FT                   SLVSAVFDGMQIQWLLDPSVDIAAALGLIGRIFGSPTPGAPTSEDAAAQAE"
FT   gene            complement(180331..182121)
FT                   /locus_tag="RHA1_ro11179"
FT   CDS_pept        complement(180331..182121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11179"
FT                   /product="probable glutaconate CoA-transferase"
FT                   /EC_number="2.8.3.12"
FT                   /note="GO_function: GO:0008410 - CoA-transferase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11179"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00826"
FT                   /db_xref="GOA:Q0RV60"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV60"
FT                   /protein_id="ABH00826.1"
FT                   /translation="MLEVELAERFSLPASEGTSKVTDLGSAIRRHIHPGATIHVAYSDA
FT                   RPNAVLLELARAFAGTDPRFTLVTAGLVNVQHSLIELGLVERVVSSFAGENYPVARPNP
FT                   ALVRAIRDGRVTIEHWSLWSLVARLVAGALGVTHFPVKSMGGSTMGAEAGARGEYIEVQ
FT                   LDESAGPTGLVKALRPDIVLLHGAAADPHGNVVLSAPYGEGHWGSLAAKDGVIACVERI
FT                   VSTEELREMNTLTRIPGHVVRAVCEVPFGAHPYGFNSPGVPGVSSYVEDEAFVARTLTA
FT                   SRTPEDFRAWIDEWVLGVDSHQEYLEKLGSGRTAELVRAARPEGWKTRVTESWGARDPA
FT                   TPTETQVIVTARCLERAVRERGFDVVLSGVGLANLASWTGAEHLRNAGIDVELMAEIGL
FT                   YGYLPRPGEPFIFAGQNVPTNKLLTDVMGVLGTLVSGPGSKSIGVIGAGQIDKTGAINS
FT                   TYGADGGFIVGSGGANDVLSAADEVIITVAHQPGRLVDQVDYITCPGRRVRTIVTDLAV
FT                   FERLSEGHFVLTAVLPTAGDTVEEAVDAIRGITDWVFEVAEDLVAEPAPTAAELATLRV
FT                   FDPGLLFLRDRRKVLTSDHR"
FT   gene            complement(182139..182888)
FT                   /locus_tag="RHA1_ro11180"
FT   CDS_pept        complement(182139..182888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11180"
FT                   /product="probable 3-oxoacyl-[acyl-carrier-protein]
FT                   reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="GO_function: GO:0004022 - alcohol dehydrogenase
FT                   activity; GO_function: GO:0004316 - 3-oxoacyl-[acyl-carrier
FT                   protein] reductase activity; GO_function: GO:0018454 -
FT                   acetoacetyl-CoA reductase activity; GO_process: GO:0008152
FT                   - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11180"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00827"
FT                   /db_xref="GOA:Q0RV59"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV59"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00827.1"
FT                   /translation="MKCDGKIAIVVGGGSGIGRATAELFAENGAKVAVADINEEGAAET
FT                   AEILRSNGADVSVHTCDITEQPQTDALVEEVVSRFGRLDMMTSTVGWSDTTFFAQEDAK
FT                   YWRRIIDINLMGSIFLSRSAMGPMSEQKSGSIVLTSSDAGKVGTMGETVYAGAKAGVIG
FT                   FVKSLAREIARDGMRINAISPGPTDTPLLRAQSDQHVIDRMVKAVPLKRMGTASEQAAP
FT                   IVFLASDYASYITGQTLSVSGGLTMTS"
FT   gene            complement(182937..183722)
FT                   /gene="menB"
FT                   /locus_tag="RHA1_ro11181"
FT   CDS_pept        complement(182937..183722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menB"
FT                   /locus_tag="RHA1_ro11181"
FT                   /product="naphthoate synthase"
FT                   /EC_number="4.1.3.36"
FT                   /note="GO_function: GO:0008935 - naphthoate synthase
FT                   activity; GO_function: GO:0016787 - hydrolase activity;
FT                   GO_process: GO:0009234 - menaquinone biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11181"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00828"
FT                   /db_xref="GOA:Q0RV58"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV58"
FT                   /protein_id="ABH00828.1"
FT                   /translation="MQLQDVLYSAQNGVARITINRPEKYNAFREETLDDLIAAFSEAEA
FT                   DTSVGVIVLTGAGDKAFCSGGDIAWEDASDPAGAARMNRRTSNLSMIMRGCGKPIIARV
FT                   KGYAVGGGNEMQMLCDLTLASDDSIFGQSGPKMGSVPVWWGTQLLPRIVGERKAREIVM
FT                   LCEQIPAPQAVELGLINKCVPADQLDAAVDAWCERLLSLSPQALRVAKISLNYETDQLW
FT                   PSVQHGQQMINFIHGTDEFHEGTQAFLEKRAPDFAKFRK"
FT   gene            complement(183761..184591)
FT                   /locus_tag="RHA1_ro11182"
FT   CDS_pept        complement(183761..184591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11182"
FT                   /product="enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="GO_function: GO:0016829 - lyase activity;
FT                   GO_function: GO:0016853 - isomerase activity; GO_process:
FT                   GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11182"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00829"
FT                   /db_xref="GOA:Q0RV57"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV57"
FT                   /protein_id="ABH00829.1"
FT                   /translation="MNTEAGDVPTAQDTVENASVGAVRYEIDGRVAHIVLNRPSKMNAI
FT                   GRSVLGGIREAVFCAESDPAVKVIIVRGEGRAFSAGGDLDEVSALVRDSPEFDRFLDYW
FT                   HETLILLERCPLPTIAAVHGVAFAGGFEVTQACDFVVMGDETKIGDQHANFGLFPAGGS
FT                   TQRLPRLVGPRTAKWMLMTGAAIGPATALASGLVNEVVPEADVLARAKVMAAVLAGKSM
FT                   SASAAIKAAVSIGADLPLRDAIDAERQIALRHMASEDVQTGLAAFRSRATPEFD"
FT   gene            complement(184588..185751)
FT                   /locus_tag="RHA1_ro11183"
FT   CDS_pept        complement(184588..185751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11183"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="GO_function: GO:0004085 - butyryl-CoA dehydrogenase
FT                   activity; GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11183"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00830"
FT                   /db_xref="GOA:Q0RV56"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV56"
FT                   /protein_id="ABH00830.1"
FT                   /translation="MLTTDLNEELQDLAVMTRAVAVKKIGPLVEQTEQAGTFSPAIREI
FT                   LAESGFFGLVVKPEYGGAESDIRHQSIVLEEIARVYPSACTYLTAHWLATKIIALNATG
FT                   PSEAPWVKPLLEQAAAGEKLGAIAVTEPEAGSDLGNVTTRARRDGDEWVIQGTKRFITN
FT                   GGFADFYSVLARTGGPGARGLSMFFVEADRPGVRAARWEQKMGLHGSATAEMHFDEVRV
FT                   PADHLIGEADKGFTHLMRGFDEGRLGVAAMCLGISQGALDAATRYASERKQFGKEIAGY
FT                   QGVQFLIADMAIGVHSSRSLVYDAANAFVNKHPDSSRLAAMAKTYSSDVSMEVTTNAVQ
FT                   VHGGSGYVRDFPVEMFMRDAKIGQIYEGTNQILRMLIARSYFGELAR"
FT   gene            complement(185738..186154)
FT                   /locus_tag="RHA1_ro11184"
FT   CDS_pept        complement(185738..186154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11184"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11184"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00831"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV55"
FT                   /protein_id="ABH00831.1"
FT                   /translation="MSYVGEASLGQSIITENGDGSWSLAASKCPQCGDVRLPARKICPN
FT                   DSTKCESVNLSGRGEIYESVQVSMAPRGFEPPYWVGYVDLEEGVRLFSQIDCAPGENDP
FT                   SHGERVVLDVRVISSEEEPVYGPVFKRIGFNADN"
FT   gene            complement(186151..187302)
FT                   /locus_tag="RHA1_ro11185"
FT   CDS_pept        complement(186151..187302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11185"
FT                   /product="probable acetyl-CoA C-acyltransferase
FT                   (3-ketoacyl-CoA thiolase)"
FT                   /EC_number="2.3.1.16"
FT                   /note="GO_function: GO:0008415 - acyltransferase activity;
FT                   GO_process: GO:0006633 - fatty acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11185"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00832"
FT                   /db_xref="GOA:Q0RV54"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV54"
FT                   /protein_id="ABH00832.1"
FT                   /translation="MTPFGKFPTENMGSLGRDAGLSALGDANVRPHDVEMISCGSARSG
FT                   ILHSRESGVGQLVGWEIGIEGVAVYNEKAYCASGSIAFNVANMAVASGTYDVALVIGVE
FT                   QMSRRDGKGRPLTSDGMLLEGEQGFTPPAYYAMAARRHMEHYGTTREQIAAVAVKNRRA
FT                   AALNPKAQYRTPITMEDVLSAKHVVGPLHLLDCCPTGDGAAAAVIVSERGAERLGIEPG
FT                   IQIGASVIGSGFYRNQTRDMTSFGLDRSTSRQAYDVAGVGPADIDVAEVHDSFSIAEII
FT                   HYEDLGFCEPGMGGKFVESGETSLGGKIPVNTGGGLLNRGHPLGATGVAQIVELADQLL
FT                   GRAGDRQVPSAQTALAHISGGFHESDFATSGVTILKKIKEGAA"
FT   gene            complement(187411..188103)
FT                   /locus_tag="RHA1_ro11186"
FT   CDS_pept        complement(187411..188103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11186"
FT                   /product="possible transcriptional regulator, GntR family"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006350 - transcription"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11186"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00833"
FT                   /db_xref="GOA:Q0RV53"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV53"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00833.1"
FT                   /translation="MTGVRASRGSVQPVQRALLGNQIADELRRNILLGVIKPGTRLSQQ
FT                   QLCEEFGTSRMPVRDGLRALIHEGMLTTDATQHTVVAPLSRSDLLDTYLIEGTLTGIAA
FT                   ERASRNAQEADLLALTGLHEAMLDAAAQENYQKMAELNWTLHRNINRLAKSRKLLSAIK
FT                   TTSLELPRDFLVEMPEWSVKSNCEHGQILDAMRAGEHDEVGRLMTEHIVDSGRGLVAYL
FT                   ESQGLELD"
FT   gene            complement(188167..189312)
FT                   /locus_tag="RHA1_ro11187"
FT   CDS_pept        complement(188167..189312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11187"
FT                   /product="possible fatty acid-CoA racemase"
FT                   /note="GO_function: GO:0016740 - transferase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11187"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00834"
FT                   /db_xref="GOA:Q0RV52"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV52"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00834.1"
FT                   /translation="MNKADMPADAQKGALDGLKVLDLSMYLPGPYASMLLADLGADVIH
FT                   VEPPTGDLVRVIEPSVGGDSALHHWVGRNKRSCTVDLKSQEGHELFLGLVRDADVVIEG
FT                   FTPGVAARLGVGYDDCRVVNPDVVYCSISGAGHGHDGSGSPGHDINYLARSGFLDQATD
FT                   AAGSPVPIGPPIADVAAGLHAAVGILAALRHRDSGGGGQFIDVGLMGAALAMTGPQIVK
FT                   ALAPKPMPRDRDHNLGADPAYRTYRTKDGRHVVIGAFEGKFWIRLCTLLEREDLISLRH
FT                   SEPDKAASELAGIFRTHDLQHWNSLLDDANVCYSPVNRIDEVSRDPLVLARQDFEISEG
FT                   HAGLLTSMRNPIRLSATPTATRSGAPGLDEHGPTVEWMVRG"
FT   gene            complement(189305..190723)
FT                   /locus_tag="RHA1_ro11188"
FT   CDS_pept        complement(189305..190723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11188"
FT                   /product="probable synthetase/ligase"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0003995 - acyl-CoA dehydrogenase activity; GO_function:
FT                   GO:0005524 - ATP binding; GO_function: GO:0016874 - ligase
FT                   activity; GO_process: GO:0006118 - electron transport;
FT                   GO_process: GO:0006631 - fatty acid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11188"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00835"
FT                   /db_xref="GOA:Q0RV51"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV51"
FT                   /protein_id="ABH00835.1"
FT                   /translation="MHGRGVRRGDVVTLVLPNWREFFVVHSAIGLIGGVVNPLLPKVGT
FT                   PEIAHILRTAESRFVFAAADLRENSPWHRVIAAAEGLDSILGIVPVRSGTNSLADILEE
FT                   PWEQRFPLDPVVVDARERDTVTFTSGTESLPKGVVHSHQTTMFVLRAYLDKVLGLNGSD
FT                   SVFMPSPICHASGMAWGLRAAIHAGVPLILQDKWNPDTALRLIDEHRCTYTLAATPFII
FT                   DMLGAKARGAGSGETLRYVASGGAAIPRHLVAEVRENFSAELMAVFGASETYVTTATRP
FT                   GAPDDILATDGEPLPGVQVAIVDESGRELPRGEEGEIVTRGPQVFLGYLGDPDLTHRAF
FT                   RGDWYRFGDLGRIDENGMLHVTGRIKDIVIRGGENISVREVEELLINHPNVASAAVVGY
FT                   PDPRLGERCCAVVVPTAGTEVDLQELNSYLVGRGLAKYKLPERLEVFDEMPMTATGKIR
FT                   KADLRRQIAGSDDE"
FT   gene            191260..191769
FT                   /locus_tag="RHA1_ro11189"
FT   CDS_pept        191260..191769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11189"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11189"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00836"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV50"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00836.1"
FT                   /translation="MSFTVHDTANVAKILAEILGGTVEVPARPPYGPQSLFVCLWDEHG
FT                   TLIELAPTGSAWVPNDKALPIETKLDDLVQQHDYLHSFWDAAVSFDRIREICEEQGWRY
FT                   YITDQKIKIAVVWIENHRYIEFCPKEHVPAYLEIYGTAGKDKYQDYVASRVAAIKATQA
FT                   AQLNKP"
FT   gene            192353..194362
FT                   /locus_tag="RHA1_ro11190"
FT   CDS_pept        192353..194362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11190"
FT                   /product="acetate--CoA ligase"
FT                   /EC_number="6.2.1.1"
FT                   /note="GO_function: GO:0016874 - ligase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11190"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00837"
FT                   /db_xref="GOA:Q0RV49"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV49"
FT                   /experiment="2DGE; MS"
FT                   /protein_id="ABH00837.1"
FT                   /translation="MIRRYSHPVSLNADVSRDHKPTEPGVRMEMDFPQVYPSSPEFTAA
FT                   ANAGPDLQAAADEDRLAFWATQAERLHWHTPFTEVLDFSDAPVAKWFVGGELNVAYNCV
FT                   DRHVIAGNGDRVAIHFEGEPGDTRDLTYNDLLTEVSKAANTFTDLGLVAGDRVAIYMPM
FT                   IPEAIVTMLACARLGLTHSVVFAGFSASALRSRIDDAEAKLVVTVDGQWRRGQAAPLKP
FT                   AVDEAVDGAASVEHVLVVKRTGIDVEVADGRDLWWHETVDKASGTHDAQPFDAEHPLFI
FT                   LYTSGTTGKPKGIIHTSGGYLTQASYTHHNVFDHKAGQDVYWCTADIGWVTGHSYIVYG
FT                   PLSNGVTQVVYEGTPNSPDEHRHFQIIEKYGVSIYYTAPTLVRTFMKWGRDIPDAHDLT
FT                   SIRLLGSVGEPINPEAWKWFREVIGGNQAPIVDTWWQTETGAIMISPLPGITATKPGSA
FT                   MAPLPGISAKIVDDDGHELGAGGSGYLVLDKPWPAMLRGIWGDMDRYRETYWSRYPEQG
FT                   WYFAGDGAKYDDDGALWVLGRVDDVMNVSGHRISTSEVESALVGHHGVAEAAVVGAADE
FT                   TTGQGIVAFVILREGVENTGDTLIAELKAEVSREISPIAKPRQITIVPELPKTRSGKIM
FT                   RRLLKDIAEGRDLGDTSTLVDPKVFDAIGDKDGQ"
FT   gene            194544..194978
FT                   /locus_tag="RHA1_ro11191"
FT   CDS_pept        194544..194978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11191"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00838"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV48"
FT                   /protein_id="ABH00838.1"
FT                   /translation="MNSGPLGSTQLRKPEQEKVMNADHHPQHPLGPFIGSDLGIDDQVR
FT                   RYRDERRRRHQEQKNKERRDQQRRCIPSREEEIIQFAVIWAPYGVPSDEETYQRFGMST
FT                   RQFFETVRDLLHLGKCPPETQSRLTMYADPTGTLPDQNAK"
FT   gene            195235..195633
FT                   /locus_tag="RHA1_ro11192"
FT   CDS_pept        195235..195633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11192"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00839"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV47"
FT                   /protein_id="ABH00839.1"
FT                   /translation="MRVLGENVPGRASALPQLGGRSPALTSGALAMPRIRWHRTCEVTP
FT                   KLSNRTRYLSSVLGAERWGQRANDLVQLPRILGPFARCAVDVVHRGDPAETHRRSGNEG
FT                   AGPAPMTALERWSGRCHEAVCLQGLDKP"
FT   gene            complement(195928..196869)
FT                   /locus_tag="RHA1_ro11193"
FT   CDS_pept        complement(195928..196869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11193"
FT                   /product="possible resolvase, N-terminal"
FT                   /note="GO_function: GO:0000150 - recombinase activity;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006310 - DNA recombination; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11193"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00840"
FT                   /db_xref="GOA:Q0RV46"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV46"
FT                   /protein_id="ABH00840.1"
FT                   /translation="MLIGYARVSSADQNPDHQVDALRRAGVTAENIHIDHAGGAKASRP
FT                   QLDLVLQLLRADDVLVITRLDRLGRSMLHLITLGADLRERGIGLKVLEQGIDTATAEGR
FT                   AMFGMLSVLAEFQRELIVANTRDGLAAARARGRKGGRPSKLSPDQIALAQRLYDAGEHT
FT                   VAQIADMLKVPRTTVYGHLNKRAVSHPDKPATADVADPPAVVRAPRACPTCGHEPTTRA
FT                   EAAHQRADLAVTWLHPDPDHLGTLISRSHCRHCEPGQPAFDIACSVCGDGPILAGALAE
FT                   SADNGGLPESVQRWLTDAGWRTTPKLLCPDHS"
FT   gene            complement(196863..197114)
FT                   /locus_tag="RHA1_ro11194"
FT   CDS_pept        complement(196863..197114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11194"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00841"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV45"
FT                   /protein_id="ABH00841.1"
FT                   /translation="MRQYIKPPAVCRCHLTTSADSVSQFGETPYRIPRIGEPYLGLDET
FT                   GHFFDTASDRRTRYVGCVDNPCRKTMSKNPVQGIVDTC"
FT   gene            complement(197263..197664)
FT                   /locus_tag="RHA1_ro11195"
FT   CDS_pept        complement(197263..197664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11195"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00842"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV44"
FT                   /protein_id="ABH00842.1"
FT                   /translation="MVPCRRYDQAMGLGAVARALVRAAYRLVRFPFHLVDEVVLPVIFD
FT                   EEAPVRRAYGKFLLDCDGAAAYLLADDTATVHDTFLRRRSAAFQDAIARHPSSIHTESD
FT                   VVMVRHRARFRERRRATHPPGNSTTLRPR"
FT   gene            complement(197777..198412)
FT                   /locus_tag="RHA1_ro11196"
FT   CDS_pept        complement(197777..198412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11196"
FT                   /product="possible ATP-binding protease, Clp family"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0004176 - ATP-dependent peptidase activity; GO_function:
FT                   GO:0004252 - serine-type endopeptidase activity;
FT                   GO_function: GO:0004518 - nuclease activity; GO_function:
FT                   GO:0005515 - protein binding; GO_function: GO:0005524 - ATP
FT                   binding; GO_function: GO:0017111 -
FT                   nucleoside-triphosphatase activity; GO_process: GO:0006289
FT                   - nucleotide-excision repair; GO_process: GO:0006508 -
FT                   proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11196"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00843"
FT                   /db_xref="GOA:Q0RV43"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV43"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00843.1"
FT                   /translation="MQRPKPMGAKVFERFTDQARRSVVLASEAARAHHHAYLGTEHLLL
FT                   GLIGEREGAAARSLESFGVSAAILDSRLPTGHGDPARSVHIPFTRHAKRILEQSLRETS
FT                   LLGHDRIGTEQILLALIADRESTGARLLGEVLPVDFDQLRQHILRQVTEHRLTAERGLE
FT                   PTHVTNLRLTDAEHALCVAAAAAAGQPLDAWMRDRILDAARAGGASTE"
FT   gene            complement(198481..199083)
FT                   /locus_tag="RHA1_ro11197"
FT   CDS_pept        complement(198481..199083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11197"
FT                   /product="possible transcriptional regulator"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0045449 - regulation of transcription"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11197"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00844"
FT                   /db_xref="GOA:Q0RV42"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV42"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00844.1"
FT                   /translation="MVAPYSGCVPKLWNETIETHRQQVRDAICDTTAALAFEHGLRSVT
FT                   MSQIAEQTGIGRATLYKYFPDVDAILRAWHARQITAHLQHLAQVRDHTTGPGRRLGAVL
FT                   HAYALVSQQTRNHGDTDLVTFLHHDERVAGAQQQLHDMIRELIADAAEAGDVRDDISPD
FT                   ELAGYCLHALAAATRLPSETAVQRLVTVTLAGLRPPV"
FT   gene            199188..199847
FT                   /locus_tag="RHA1_ro11198"
FT   CDS_pept        199188..199847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11198"
FT                   /product="possible 3-demethylubiquinone-9
FT                   3-methyltransferase"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_component:
FT                   GO:0016021 - integral to membrane; GO_function: GO:0008757
FT                   - S-adenosylmethionine-dependent methyltransferase
FT                   activity; GO_process: GO:0046690 - response to tellurium
FT                   ion"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11198"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00845"
FT                   /db_xref="GOA:Q0RV41"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV41"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00845.1"
FT                   /translation="MVDAPRFPYPGSPPVHGPDDLYVTPPPWDIGRAQPVFVALAEGGA
FT                   IRGRVLDCGCGTGEHVLLAAGLGLDATGVDLAATALRIAEQKARDRGLTARFLHHDARR
FT                   LAELGERFDTVLDCGLFHIFDPDDRAAYVDSLRDVLVPGGRYLMLGFSDQQPGDWGPHR
FT                   LTRDEITTAFDDGWTIDSLESATLEVTLDPAGMRAWQLAATRTWPHPIERECSAPC"
FT   gene            199841..200218
FT                   /locus_tag="RHA1_ro11199"
FT   CDS_pept        199841..200218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11199"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11199"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00846"
FT                   /db_xref="InterPro:IPR014543"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV40"
FT                   /protein_id="ABH00846.1"
FT                   /translation="MLTAETQIPTDLASRYLTQLCRHATAVATAGHRFRPHAGGDTPIR
FT                   DVHPSAEASDTSGVIRFGPWGRCTLEAAATTLTVRVEAVDQEKLSRIQDIITHDLHRFG
FT                   GREHPTVTWPEPAAPGTGATT"
FT   gene            200215..200472
FT                   /locus_tag="RHA1_ro11200"
FT   CDS_pept        200215..200472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11200"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00847"
FT                   /db_xref="GOA:Q0RV39"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV39"
FT                   /protein_id="ABH00847.1"
FT                   /translation="MRYSPTGQAGVRRGHRLPVVLTIVVAVAVAVHLGLGGYLLAHTRW
FT                   TAAVATVVVVVVLVKLLAIIFGRKVIRRRRATPAPPRRTP"
FT   gene            complement(200658..202274)
FT                   /locus_tag="RHA1_ro11201"
FT   CDS_pept        complement(200658..202274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11201"
FT                   /product="possible copper-binding oxidase"
FT                   /note="GO_function: GO:0005507 - copper ion binding;
FT                   GO_function: GO:0008471 - laccase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11201"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00848"
FT                   /db_xref="GOA:Q0RV38"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV38"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00848.1"
FT                   /translation="MCKHTGRAVRENPVTPVPDNGSGLNRRAFLTAAAAGLGGLALAAC
FT                   TRGSSPPGPHPVDGNTIAAVEAARPHTGRTVDAALTPQAADIDLGGIHVRTLAYGNTVP
FT                   GPTIRANVGDEIAVALTNGLDHETSVHWHGIALRNDMDGASPASPDIGPGQSFTYRFSV
FT                   PHAGTYWAHPHVGLDTDYGLYLPVIVDDPREPGDYDAEWIVVLDDWTHGIGPSPQQIFS
FT                   NLQSSGMGPMGGPGGMGNMPGMGGMGGGSDQSGVPTSSATSNGVGTSSLLGGDTGDITY
FT                   PYYLINGRLPSAPSTFTATPGQRVRIRIINAGADTAFRIALAGHTMTVTHTDGFPVRPV
FT                   EVDALLLGMGERYDVIVTVGDGVFPLVAAADGKNAHARAVLRTGPGSPPNSGFTPRELA
FT                   GRVGTADAFVGADTVLLPQSQPEVNLAAVLGGGMMSYDWTINGRPYEQTEPLTIREGQR
FT                   ARLTFTNMTMMWHPMHLHGHTFQIVKPDGTPGPRKDTVIVLPMRTVAVDLVADNPGDWM
FT                   LHCHNAYHQESGMMTRLDYLR"
FT   gene            complement(202337..202609)
FT                   /locus_tag="RHA1_ro11202"
FT   CDS_pept        complement(202337..202609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11202"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11202"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00849"
FT                   /db_xref="GOA:Q0RV37"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV37"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00849.1"
FT                   /translation="MMWRNNGMGYGMGWGGWVLMAGLMVAFWGLVVVGVMALFRTLRTD
FT                   RNPPYDTDTRRPSADTILDERFARGEIDAEEYRIRRDQLRTGHDR"
FT   gene            202742..203500
FT                   /locus_tag="RHA1_ro11203"
FT   CDS_pept        202742..203500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11203"
FT                   /product="response regulator, two-component system"
FT                   /note="GO_function: GO:0000156 - two-component response
FT                   regulator activity; GO_function: GO:0003677 - DNA binding;
FT                   GO_function: GO:0016831 - carboxy-lyase activity;
FT                   GO_process: GO:0000160 - two-component signal transduction
FT                   system (phosphorelay); GO_process: GO:0007600 - sensory
FT                   perception"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11203"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00850"
FT                   /db_xref="GOA:Q0RV36"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV36"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00850.1"
FT                   /translation="MEIMDNTPPLSPDAAGYRALVVDDERPLAAVVASYLEREHFEVAV
FT                   AYNGVDALALAREIDPDVVVLDLGLPGMDGIEVCRQLRTFSDAYVVMLTARSAEVDTII
FT                   GLSVGADDYVTKPFSPRELVARIRAMLRRPRKAPVYETPSPDRGGEEAPRVFGALSIDV
FT                   AGREVCLGEQPVMLTRTEFDVLAVLSSRPGMAFSRRQLIEAVWGESWVGNEHLVDVHVG
FT                   HLRRKLGDDPAAPRYVTTVRGIGYRMGTGQ"
FT   gene            203497..204654
FT                   /locus_tag="RHA1_ro11204"
FT   CDS_pept        203497..204654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11204"
FT                   /product="histidine kinase"
FT                   /note="GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0000155 - two-component sensor activity; GO_function:
FT                   GO:0005524 - ATP binding; GO_process: GO:0000160 -
FT                   two-component signal transduction system (phosphorelay);
FT                   GO_process: GO:0006468 - protein amino acid
FT                   phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11204"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00851"
FT                   /db_xref="GOA:Q0RV35"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV35"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00851.1"
FT                   /translation="MTSHRDRPRTLGADPRRSRGPGLGVRLLLAQSLVLVAGAATCWVV
FT                   AVFAGPPLFREHLHRAGVPASSDEQFHAEQAYRSATAISLAVALGVASLAALVVTWYFS
FT                   RRLQRSVTEVSSAATAVADGRYDIRVTSPHLGEDFDALAEAFNRMAAGLESVETTRRQL
FT                   LGDLAHEIRTPVSVLEAYMEALEDGVETLDADTITMLRDQTRRLVRFSDDVRSLSHAEE
FT                   SRTSIEPTWVDPAALLSTTLIAAADRYAAKQVALTSNVAAHLPRLWADPERLGQVLGNL
FT                   LDNALRHTPGGGRVEVTAGQRQELLVIEVTDTGDGIAAEHLPHLFERFYRVDAARDREH
FT                   GGAGIGLAIAKALVEAHGGHITARSDGPGTGSTFTITLPLRPDQR"
FT   gene            204651..204983
FT                   /locus_tag="RHA1_ro11205"
FT   CDS_pept        204651..204983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11205"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11205"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00852"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV34"
FT                   /protein_id="ABH00852.1"
FT                   /translation="MRTDSVTAIARHRLAPVRSVPSGRSADTVYGGHEHRLRRTLIALT
FT                   PVGERPMFPFAASPPCTSWAVGAGCGGGRSGRDHRGAYSPGRGAEPSLSSSSPSRNLPD
FT                   APGRAR"
FT   gene            complement(204991..205278)
FT                   /locus_tag="RHA1_ro11206"
FT   CDS_pept        complement(204991..205278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11206"
FT                   /product="Cu(2+)-exporting ATPase"
FT                   /note="GO_function: GO:0005375 - copper ion transporter
FT                   activity; GO_function: GO:0005507 - copper ion binding;
FT                   GO_function: GO:0015097 - mercury ion transporter activity;
FT                   GO_process: GO:0006825 - copper ion transport; GO_process:
FT                   GO:0015694 - mercury ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11206"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00853"
FT                   /db_xref="GOA:Q0RV33"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV33"
FT                   /protein_id="ABH00853.1"
FT                   /translation="MTPRPRGVDHPPLTAPEENTVSTTASYQVSGMTCAHCGQAVTEEL
FT                   GHLDAVTSVDIDLVPGGDSRVRVTSSRPLSLDEVRDAVDEAGYSLAEPPT"
FT   gene            complement(205275..206015)
FT                   /locus_tag="RHA1_ro11207"
FT   CDS_pept        complement(205275..206015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11207"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0000155 - two-component sensor
FT                   activity; GO_process: GO:0000160 - two-component signal
FT                   transduction system (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11207"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00854"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV32"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00854.1"
FT                   /translation="MKTTNLAIGAAAVAALVALTACSNSSTDQSAQSSTSASVTASTAP
FT                   ADTHNQADVTFAQQMIPHHAQAIEMSDVVLAKDGIDPRVTDLATQIKAAQGPEIEQLQG
FT                   WLTDWGQSGMPMATSGMMTPGQSMPMSVPGMNPTGENMPMSTPGMEMPGHAMPMQSSQA
FT                   PVPGAGMSGMMSAEDMTALQNAQGVDASRLFLTQMIAHHQGAIAMAQTEIDSGQYPDAV
FT                   AMARTIADTQQQEITTMQNILASL"
FT   gene            complement(206303..206611)
FT                   /locus_tag="RHA1_ro11208"
FT   CDS_pept        complement(206303..206611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11208"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11208"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00855"
FT                   /db_xref="GOA:Q0RV31"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV31"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00855.1"
FT                   /translation="MSTETPEAGHGYIQSKDAYLMRLRRIEGQARGLQRMVEEEKYCID
FT                   ILTQVSAMTKALQAVALGLLEDHISHCVVDAAATGDRDQAEAKIAEASNAIARLVRS"
FT   gene            complement(206800..206931)
FT                   /locus_tag="RHA1_ro11209"
FT   CDS_pept        complement(206800..206931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11209"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11209"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00856"
FT                   /db_xref="GOA:Q0RV30"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV30"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00856.1"
FT                   /translation="MPEEEIVVIFYETLLVLVSVLITWFSLYVLYRLITDDSRHRYR"
FT   gene            complement(206974..209412)
FT                   /locus_tag="RHA1_ro11210"
FT   CDS_pept        complement(206974..209412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11210"
FT                   /product="probable copper-exporting ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0004008 - copper-exporting ATPase activity;
FT                   GO_function: GO:0005507 - copper ion binding; GO_function:
FT                   GO:0005524 - ATP binding; GO_function: GO:0015097 - mercury
FT                   ion transporter activity; GO_process: GO:0006825 - copper
FT                   ion transport; GO_process: GO:0008152 - metabolism;
FT                   GO_process: GO:0015694 - mercury ion transport; GO_process:
FT                   GO:0015992 - proton transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11210"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00857"
FT                   /db_xref="GOA:Q0RV29"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV29"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00857.1"
FT                   /translation="MNRTTVLEVSGVHWASSTATVEATLRRRPGVTSVEANAVNQTATV
FT                   TYDPGLTSVVELSKWVRDCGYHCAGRSVPEHVCDPMSEPAAVRGEAEHAHPAPEAAAAA
FT                   GPTGHQMPAGHEAPAGRSPQEMMGHGGGHAGMSMDAMVRDMRNRFLVALVLSVPIMLWS
FT                   PMGRDMFGFMVPAPFGLRDDVFTLMLSLPVVFYSAWIFFDGAYRALRARTLDMMVLVAV
FT                   AVGAGWLYSVGVTLTGGGDVFYEAATMLTTFVLLGHWFEMRARGGANDAIRTLLELAPP
FT                   RAVVLRGGQPVEVPTAEVTAGDLLLIRPGAKIPVDGTVEDGHSEVDESMVTGESLPVTK
FT                   TPGSEVIGASINTTGTLRVRATKVGSDTVLAQIVALVQQAQNSKAPGQRLADRAAFWLV
FT                   LVALIGGIGTFLVWVLVGESVQTALLFAITVVVITCPDALGLATPTAIMVGTGLGAQRG
FT                   VLFKNATALETSARIDTVVMDKTGTLTKGEPEVTDLITDGIIEDEFLALVATVERESEH
FT                   PLAGAIVRYATDRGIPQLPLTGFENVPGHGATAQVYGRRVAVGNRKLMAAEQVDFGALM
FT                   DRRDELAATGRTAVLVAVDGHGVGVIALADAARDTSAAAVSALHDLGAEVVMLSGDNEA
FT                   TAARIAGQLGIDTVIAEVLPGDKAAKIAELQRAGKTVAMVGDGVNDAPALAQADLGIAI
FT                   GAGTDVAIETADLVLMRSDPLDVPIALRIGRGTLRKMRQNLGWAVGYNVIALPIAAGVF
FT                   EPSLGLVLRPEIAALSMSGSSVIVAVNALMLKRLALPAPPEPQLTAPLPAPEPTPTGPR
FT                   "
FT   gene            complement(209776..210228)
FT                   /locus_tag="RHA1_ro11211"
FT   CDS_pept        complement(209776..210228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11211"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11211"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00858"
FT                   /db_xref="GOA:Q0RV28"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV28"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00858.1"
FT                   /translation="MVKTIVGSAAKKRGQQAEVGHARLPRVASSSNLHQITNQGIPGGG
FT                   TLGHDRQVAARTVKPVAAESEGVAMTRRVSVNVTPAERIARIVIGVVGTVGGLLVIAGG
FT                   ASLWSVVLAVLLIAAGLDLVVTGSTGHCPLYQRLGHVPASLKGGTS"
FT   gene            210293..210577
FT                   /locus_tag="RHA1_ro11212"
FT   CDS_pept        210293..210577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11212"
FT                   /product="probable copper ion binding protein"
FT                   /note="tc: 3.A.3; GO_component: GO:0016021 - integral to
FT                   membrane; GO_function: GO:0000287 - magnesium ion binding;
FT                   GO_function: GO:0004008 - copper-exporting ATPase activity;
FT                   GO_function: GO:0005507 - copper ion binding; GO_function:
FT                   GO:0005524 - ATP binding; GO_process: GO:0006825 - copper
FT                   ion transport; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11212"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00859"
FT                   /db_xref="GOA:Q0RV27"
FT                   /db_xref="InterPro:IPR000428"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV27"
FT                   /protein_id="ABH00859.1"
FT                   /translation="MTVTTYKVEGMTCGHCVSAVRAAVGSVPGVTGVEVDLAAGTATIA
FT                   GVPIDGAVAQAISDAGYDVVAAGRNTESHDTVVGTALPLVGDAGGCCCS"
FT   gene            210763..213024
FT                   /locus_tag="RHA1_ro11213"
FT   CDS_pept        210763..213024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11213"
FT                   /product="probable copper resistance transporter, ATPase
FT                   component"
FT                   /note="tc: 3.A.3.5; GO_component: GO:0016021 - integral to
FT                   membrane; GO_function: GO:0004008 - copper-exporting ATPase
FT                   activity; GO_function: GO:0005507 - copper ion binding;
FT                   GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0008900 - hydrogen:potassium-exchanging ATPase activity;
FT                   GO_process: GO:0006825 - copper ion transport; GO_process:
FT                   GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11213"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00860"
FT                   /db_xref="GOA:Q0RV26"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV26"
FT                   /protein_id="ABH00860.1"
FT                   /translation="MTTHLTESGDREHDLELSIGGMTCASCAARIEKKLNRMDGVTATV
FT                   NYATEKAKVTFADRVAPDDLVATVEATGYTATLPVSPADAAGATTGAPAEPDEAAEWRQ
FT                   RLIVSTVLTMPVVLLSMIPALQFDNWQWLTLTLASPVVVWGALPFHRAAWANLRHGAAT
FT                   MDTLISVGVTAAYLWSLWALFFTHAGMTGMRMNFDLLTTGSTEPHIYLEVASAVTTFIL
FT                   AGRYFEARAKRQSGAALRALLDMGAKDVAVLRGGSEIRVPIGQLAVRDQFVVRPGEKIA
FT                   TDGIVTAGTSAVDASMLTGEPVPVEVGPGDSVVGATVNAGGRIVVRASRVGADTQLAQM
FT                   ARLVTEAQNGKAQVQRLADRISAVFVPIVIGLALLTLAVWLLTGNTVTAAFTAAVAVLI
FT                   IACPCALGLATPTALLVGTGRGAQLGILIKGPQILESTRRVDTIVLDKTGTITTGRMAV
FT                   ASVHATDGVSDTEVLRLAGALEHASEHPIAHAVAARAAEAGPLPAVEGFENHGGRGVSG
FT                   VVEGHAVLAGRYSWLWEQWALTAPDTLQLVVDDAETQGRTPVWIAWDGAIRAVIVVSDT
FT                   VKDTSAAAIGELRELGLSPVLLTGDNHRAAQSVANQVGIEEVISEVLPSGKVDVIKNLQ
FT                   DQGRVVAMVGDGVNDAAALAQADLGLAMGTGTDVAIEASDLTLVRGDLRAAPDAIRLAR
FT                   ATLRTIKGNLFWAFAYNVAALPLAALGLLNPLIAGAAMAFSSVFVVSNSLRLRRFTPHQ
FT                   "
FT   gene            complement(213079..214623)
FT                   /locus_tag="RHA1_ro11214"
FT   CDS_pept        complement(213079..214623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11214"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11214"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00861"
FT                   /db_xref="GOA:Q0RV25"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV25"
FT                   /protein_id="ABH00861.1"
FT                   /translation="MRSEDHLPGAPGEVALLVHRFLVDYARNPVNMLVLVLVPVVFVIV
FT                   AAGSMADAAKLLGGAGGPAVETATAGWAAGFLAGIAMFFQISAARAADRRLVSAGLPPA
FT                   RLVAARLGTGLVLGVLVAATALLALAARTGIDDPGRAIAGTLMFAVIYLAIGALVGALI
FT                   RNPVNGTVLILFVWILDVFFGPAVGSPDRIETRWFPTHFVTLWMVDIPSRHGGRIGDLG
FT                   WALVWMFSALIISTAVITTTVGVSRGSRRRSPAASGPAQFSAGLRMGLRDYRRNPVLWV
FT                   LLVVVPIVFIVLAKAMTASESGVFSLVEGGRTVMQVFWLPDVHAGTMTPIAISSLAALA
FT                   GLFVGLDARAGDRRLTLAGFPFPLLLAVRVSMIGIAAGLVTVSSLMITATVFDARQWGV
FT                   YGGGNLLMAVTYGLLGFCLGPIFGRVGGVFIAFLVPFLDIGIGQSPMLRPEPATWAHGL
FT                   PGYGAMRVLLDGGLTARFDAVGPLLGALAWVLALSALAGWLFHRAPATPVRPRLGM"
FT   gene            complement(214620..215288)
FT                   /locus_tag="RHA1_ro11215"
FT   CDS_pept        complement(214620..215288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11215"
FT                   /product="ABC transporter, ATP-binding component"
FT                   /note="tc: 3.A.1; GO_component: GO:0019866 - organelle
FT                   inner membrane; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0015087 - cobalt ion transporter activity;
FT                   GO_function: GO:0016887 - ATPase activity; GO_function:
FT                   GO:0046872 - metal ion binding; GO_process: GO:0006824 -
FT                   cobalt ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11215"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00862"
FT                   /db_xref="GOA:Q0RV24"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV24"
FT                   /protein_id="ABH00862.1"
FT                   /translation="MNRSGSAESAPVNAVLTAEGIEKSFRQGWWPARRDSRVLRGVDLV
FT                   LQPGEVVGLTGENGSGKSTLMKILVGEYRPDAGTVARSGRLGYCPQQPVVYERLTCDEH
FT                   FELFGYAYRMTPNEQRRSRRGLYAALGFERYADTRADRLSGGTLAKLNLGLAMLADPEV
FT                   LLLDEPYSGFDWDTYLRFWELVAQRRETGRSVLIISHFVTDEHRFDRIVDLRNGRAAAR
FT                   "
FT   gene            215419..215676
FT                   /locus_tag="RHA1_ro11216"
FT   CDS_pept        215419..215676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11216"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00863"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV23"
FT                   /protein_id="ABH00863.1"
FT                   /translation="MCHPFPCTTPTRLSAGLIGSLSADSSTQYRAGARAHSTGPLLQRI
FT                   FTKASPICGGTPPTLGNEPTHKRVSRHQGSSCAATEKEQS"
FT   gene            215676..216134
FT                   /locus_tag="RHA1_ro11217"
FT   CDS_pept        215676..216134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11217"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11217"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00864"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV22"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00864.1"
FT                   /translation="MAPITTSIDVDRPPGQVFAYGTDPTRFAQWQKGVVSGHMDGDAAP
FT                   RVGEKCLTTRRIGFAERPVTSELTHIDPPSTWGVHGVDGPIRAVVEVTVDPLDAGQRSR
FT                   VTIAVDFEGHGIGKVLVPLAVRPQARKEMPGNLATLKQRLEASPAQPN"
FT   gene            complement(216168..217484)
FT                   /locus_tag="RHA1_ro11218"
FT   CDS_pept        complement(216168..217484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11218"
FT                   /product="probable transporter, MFS superfamily"
FT                   /note="tc: 2.A.1; GO_component: GO:0016021 - integral to
FT                   membrane; GO_component: GO:0019866 - organelle inner
FT                   membrane; GO_function: GO:0005215 - transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11218"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00865"
FT                   /db_xref="GOA:Q0RV21"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV21"
FT                   /protein_id="ABH00865.1"
FT                   /translation="MSEDQPMSTTTPRPIRLGLGPNLAQFSLLVAVNALVGGMVGQQQT
FT                   VLPLLAENEFGLTGYTFIFTYVAAFGITKAAANYVAGTFSDRFGRKPVLLVGWLFAIPV
FT                   PLMLIAAPNWWWVVAANVLLGINQGLTWSTTVVMKIDLVGPARRGLAMGLNEAAGYGAV
FT                   AVSSLMAGYLADHYGLRPAPFLLGIAYTALALLLSGVFIRETRDYARLEAAQHTPRADG
FT                   AHDHLHADLTDRQIAIQTSFTEPALSSASQAGLVNNLNFGLSWGLFPLLFATADLGAGQ
FT                   IGVLFALYPGVWGAGQLVTGALSDRIGRKHLITTGMSLQAAALALIAASHGFTGWAAGT
FT                   VLLGAGTAMVYPTLLAVIGDVAHPAWRGRAVGIYRVWRDSGYAVGAICGGIVADLMGLH
FT                   AAVWGAAAVSAAAALAVAVRMYETHPTPLRTNKERAPKG"
FT   gene            complement(217481..218845)
FT                   /locus_tag="RHA1_ro11219"
FT   CDS_pept        complement(217481..218845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11219"
FT                   /product="possible hydrolase"
FT                   /note="GO_function: GO:0004416 - hydroxyacylglutathione
FT                   hydrolase activity; GO_function: GO:0004792 - thiosulfate
FT                   sulfurtransferase activity; GO_process: GO:0008272 -
FT                   sulfate transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11219"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00866"
FT                   /db_xref="GOA:Q0RV20"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV20"
FT                   /protein_id="ABH00866.1"
FT                   /translation="MAGIDLVPLVDEGLGNSAYLVDLGDGRALVVDVSRDLRAVHAAAA
FT                   RRGLTVAFAADTHLHADFLSGAHQLGSKSGATVLASAAGDREFPHTGLRDGDEVDLGGL
FT                   RLRALTTPGHTHEHLCFLLLDGDTEVGVFTGGSLIVGSAARTDLISPERTEALTRAQYA
FT                   SLRRLAALPGEVAVWPTHGAGSFCSAPPGTDRTSIIARERATNPLLRAPDEDAFVHQLL
FT                   GSLGSYPPYFRRLGEINRLGPPLLDRDPVLPALTVDTVRAQLAEGAALIDVRPLTRFAA
FT                   AHIPGALSIPLRPVFASWLGWLAPTDRPLIIVRDEDQDPGEIVWQAMKIGYDNLIGELG
FT                   GGIAAWRAADREVTATALTGPDAVGTNIRVLDIRQRPEYLAGHLPGAVHIELGALAGRV
FT                   DDLPREPTVVMCGHGERAMGAASLLERAGHRQLTVLAGGPDDWAAATGRTLETGA"
FT   gene            218936..219598
FT                   /locus_tag="RHA1_ro11220"
FT   CDS_pept        218936..219598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11220"
FT                   /product="possible transcriptional regulator, ArsR family"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_function: GO:0004792 - thiosulfate sulfurtransferase
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent; GO_process: GO:0008272 -
FT                   sulfate transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11220"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00867"
FT                   /db_xref="GOA:Q0RV19"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV19"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00867.1"
FT                   /translation="MGDRLAKTELFDQFARVGKALGSGKRLELLDLLAQGERTVDALAR
FT                   AAGLGLTTASAHLQTLKQANLVATRREGTKVFYRLAGADVAQLFALVRTVANDHLPDVE
FT                   AAAAAYLGPADTEQVSKDQLLERARSGTVTVLDVRPREEYRAGHIPGAVSIPLDELADH
FT                   LADLPEDQEIVAYCRGAYCVLAHDAVRLLTDHGRRAARLTEGMLEWRLAALPVDTPA"
FT   gene            complement(219633..219905)
FT                   /locus_tag="RHA1_ro11221"
FT   CDS_pept        complement(219633..219905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11221"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00868"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV18"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00868.1"
FT                   /translation="MRRQHPTRWLHRGCRGAPRRGGRPQEVAVETGIAIMIHGGPATVD
FT                   GSRLRDHCGEMRQWIADPEKTPNAAETLEALTSLGTLAALGTPGV"
FT   gene            complement(219940..220326)
FT                   /locus_tag="RHA1_ro11222"
FT   CDS_pept        complement(219940..220326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11222"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00869"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV17"
FT                   /protein_id="ABH00869.1"
FT                   /translation="MVGAQRFPQLPPRFVHCGSGRIGQVLGLRREVTVVATFGWVTVRW
FT                   RVQQGQIRRSVGVDPIRARAGRSGLSNLPYPIHRDTFDEAGLPDHSCEGAFGFEAPREG
FT                   FDGSTGLPAHFEVLPPRYLTSSTS"
FT   gene            220389..220754
FT                   /locus_tag="RHA1_ro11223"
FT   CDS_pept        220389..220754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11223"
FT                   /product="possible forkhead associated domain (FHA)"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11223"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00870"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV16"
FT                   /protein_id="ABH00870.1"
FT                   /translation="MKVTDARPLLRPPNDGIGDAPQIFVIRGPSQAKGASLAVDRDITV
FT                   LGSHPESEIVLGHGTVSRRHAEIRREGGKFILCDAGSLNGTYLNRQPVDCAGLVDGDEV
FT                   QIGVFRMLFRLPAASTN"
FT   gene            complement(221002..222171)
FT                   /locus_tag="RHA1_ro11224"
FT   CDS_pept        complement(221002..222171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11224"
FT                   /product="possible ATPase"
FT                   /note="GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0005554 - molecular function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11224"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00871"
FT                   /db_xref="GOA:Q0RV15"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV15"
FT                   /protein_id="ABH00871.1"
FT                   /translation="MSLLSRRRADAKVDPADVRTALARVEDPELHLPLEEAGMLGEVEV
FT                   DRSGVARVTVRLTTPSCPLKETLTTDVTAAVRAIAGVSGVEVAFAAMGEGERMRLAARL
FT                   RGSVPLGAHSFGPGSATQVYAVASGKGGVGKSTITANLAVALVQQGKRVGILDADVWGY
FT                   SIPHLFGVRRAPVALKGLMLPVEAFGVALMSVGFFVRDDEPVVWRGPMLHKAIEQFLDD
FT                   VYWGELDVLLIDLPPGTGDVTLSLLEFVPDAALIVVTTPQPAAQTVAQRVGRMALDSRT
FT                   PVAGVVENMSAMICSSCCESTPLFGAGGGQRLAEAIAAPLLGQVPLDIELREAGDAGVP
FT                   ALIAAPRAASATQIRQIAASLPILRRSLVGRSLPLTVRPHHAHGMSVDD"
FT   gene            complement(222168..225035)
FT                   /locus_tag="RHA1_ro11225"
FT   CDS_pept        complement(222168..225035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11225"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003674 - molecular_function"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11225"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00872"
FT                   /db_xref="GOA:Q0RV14"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV14"
FT                   /protein_id="ABH00872.1"
FT                   /translation="MTAETNRTPASPAMPGERTHERLRNFPPVENWDHHVEYDAKAHPR
FT                   KVPHEYMLVPTTCFNCESACGLLAYVDKSDMSIKRVEGNPAHPGSRGRNCAKGPATINQ
FT                   VNDPERILHPLKRVGTRGSGRWDRVSWDDALDDIAARIRAAIVEDRRDEVMYHVGRPGE
FT                   DGFAERFLLAWGIDGHNSHTNICSAGARLGYSLWGGYDRPSPDYANAKVILLISSHLEA
FT                   GHYFNPHAQRIMEGKIEGGATVVVLDPRLSNTASHADLWIAPWPGSEAAILLAVAAHLL
FT                   RTGQIDRAFIRRWVNWSTYMTHRHPEHPADDFDQFIRALTEDYAGYTFAYAAQEAQVPE
FT                   EQIAELARIVATAGRALSAHVWRAAASGNLGGWQVSRALFFLNVLTGSVGTKGGTSPNG
FT                   WDKIIAHGPNVPEGHQSWNEMIWPAEFPLSTNEMSILLPHLLADGRGKLSMYFSRVYNP
FT                   VWTNPDGFSWLKALTDESLVGCHVALTPTWSETATFADYVLPMGHSTERHDTQSYEQYA
FT                   GKWLGFRQPVTRVALEKMGRPVSDSRESNPGEVWEENEFWFELSWRIDPDGSLGIRKYF
FT                   ESPYRPGEKVTVDEYYRWVFENSVPGLPHAAAGQGLTPLQYMRKYGVFEVTRDAYRLDE
FT                   RPLSDAEIDGATPDGNGVLRKPVTLDSTPPLVGEAGAVGVVHADGSRTAGWLTPSRKLE
FT                   LFSDTMVDFGWEEYATPGYIESHVSYGSIDQANNEIVLMPTFRLPTLVHTRSGNAKYLN
FT                   EISNTHPLWMNSVDAGRFGVGTGDLVRVNTEIGYFVARVWSTEAIRPGVMGLSHHMGRW
FT                   RTSENAGSRWVMGLVDLGNDGNGVWRLRYKEGVKPFHSDDPDSDRIYWDDPGVHQNLAF
FT                   AVHPDPVSGMHCWHQKVRVERAHADDRYGDVVVDTQRSREVYRAWMDNTRPGPSRSGLR
FT                   RPEFMMRPVKPRRRAFRSPDAEERA"
FT   gene            complement(225064..226593)
FT                   /locus_tag="RHA1_ro11226"
FT   CDS_pept        complement(225064..226593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11226"
FT                   /product="probable polysulphide reductase"
FT                   /note="GO_component: GO:0019866 - organelle inner membrane;
FT                   GO_function: GO:0005489 - electron transporter activity;
FT                   GO_function: GO:0005506 - iron ion binding; GO_function:
FT                   GO:0016491 - oxidoreductase activity; GO_function:
FT                   GO:0020037 - heme binding; GO_process: GO:0006118 -
FT                   electron transport; GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11226"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00873"
FT                   /db_xref="GOA:Q0RV13"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV13"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00873.1"
FT                   /translation="MRSVRYGFAIDQRTCIGCHACTVACKTEHEVPVGQFRTWVKYVDT
FT                   GEFPDTTRSFGVMRCNHCTDAPCVKICPTQALFKRDDGIVDFDNERCIGCKSCMQACPY
FT                   DALYIDDTTHTAAKCNLCAHRIDNDMEPACVVVCPTHSIWVGDLDDPTSGIAGLISTHE
FT                   TAVRSPEQNTGPNVFYLGADRAVLDPLAAPVADTYLWAKPDAHRLATAGDLPGDRTTRA
FT                   RTTLNTAHPRPWGWRVTTYLWTKAVAAGALAIAGLAHLLGVDLGWLGDYGAPAVALLGA
FT                   TATGALLIWDLKRPERFLYIFLKSNWTSWLVWGAYALAAFAGGAVLWILAALLGIGWAQ
FT                   TVLAWLAIPFGALVAGYTGFLFGQAEGRDLWQSPLLFWHLLVQAAMVGAGALLVMAPFA
FT                   DLASGAIAFLTRAFVLSTGLHLMMLGIEYSSRHASRQASVAAHIITHGRYARLFWLGAI
FT                   APAVLAAALAAPAWTGSGSAVLLVLAGLLAQVALLDYETAYVRAGQDPPLS"
FT   gene            complement(226590..226823)
FT                   /locus_tag="RHA1_ro11227"
FT   CDS_pept        complement(226590..226823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11227"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0004792 - thiosulfate
FT                   sulfurtransferase activity; GO_process: GO:0008272 -
FT                   sulfate transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11227"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00874"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV12"
FT                   /protein_id="ABH00874.1"
FT                   /translation="MTYQIDVTIDAKGQKCPMPVLLASRAARKLASGQILLVEATDGGS
FT                   RTDIPSWAKDTGNELLERTSENGVYRYIIRKK"
FT   gene            complement(226849..227358)
FT                   /locus_tag="RHA1_ro11228"
FT   CDS_pept        complement(226849..227358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11228"
FT                   /product="possible NADH dehydrogenase"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_function:
FT                   GO:0003954 - NADH dehydrogenase activity; GO_function:
FT                   GO:0015036 - disulfide oxidoreductase activity; GO_process:
FT                   GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11228"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00875"
FT                   /db_xref="GOA:Q0RV11"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV11"
FT                   /protein_id="ABH00875.1"
FT                   /translation="MSDSPQRDDDVMPESMTIVAWSGDLDKMWPTLILGSTGAAYGMST
FT                   TIFFTFWGLFPLVRDDVRITGTNAMTKALAGMNRPGMSHMKLSKLHMAGAGPWMLKKLA
FT                   RGQNVALPMDLVQMCTELGVNLWPCEMSMELLGLRRDQLIDGVGEPVGAATALSAMSKS
FT                   QINLFI"
FT   gene            227533..228678
FT                   /locus_tag="RHA1_ro11229"
FT   CDS_pept        227533..228678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11229"
FT                   /product="possible hydroxyacylglutathione hydrolase"
FT                   /note="GO_function: GO:0004416 - hydroxyacylglutathione
FT                   hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11229"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00876"
FT                   /db_xref="GOA:Q0RV10"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV10"
FT                   /protein_id="ABH00876.1"
FT                   /translation="MADTITSMGLFREIQAGTVTEILDVRSTDDFQAGKVEGPRPVPTR
FT                   HVPVYRVMEELEEQAAATREGAVIVCGQGNGSELVAEEFEALGVRTRSLAGGTDAWNRL
FT                   LVPVEITGLPGDVRVWQFQRPAKACLSYLVGVPGGNAVIVDPTRSPEPYLELAQVHDMA
FT                   VTHVVDTHVHADHISGGPAVAARLGAEYHLPPEDAGGIVPFPNRPLKDGDQLDLGSAVV
FT                   RAMTMHLPGHTPGTTALLVSETVLLVGDTVFVRGLGRPDLTGQADELARDLFRSVHERL
FT                   RPLDPRTIIAPAHWSSSEEINTDGLVTTTLDEVFTATLLNERAIERFVEQIVSSLPAAP
FT                   QSYDTIRRVNAGQITPGDDEIEVLDVGRNQCAASTSLTGTS"
FT   gene            228675..229064
FT                   /locus_tag="RHA1_ro11230"
FT   CDS_pept        228675..229064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11230"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00877"
FT                   /db_xref="GOA:Q0RV09"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV09"
FT                   /protein_id="ABH00877.1"
FT                   /translation="MTSTPRRPARPRKTPLHEVGEHPDYRFTLANERTFLSWVRTALAL
FT                   MAAGVAVVQFVPGPTAIRHGLGFALISLGGALSAVSYTHWERNERAMRLGEQLPYSPMP
FT                   RLVAAMLALGSLAALVLIVVDLVET"
FT   gene            229074..229433
FT                   /locus_tag="RHA1_ro11231"
FT   CDS_pept        229074..229433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11231"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11231"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00878"
FT                   /db_xref="GOA:Q0RV08"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV08"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00878.1"
FT                   /translation="MTLTGRLLPHRRRKDPAVDVGLQAERTAMAWQRTALGVGGVSALL
FT                   LHLAAGRFPAAVAGLAGLSASLLLLLLSEQRYVRLVKKVAAGEPPPAPGLVRLLAAGVV
FT                   ILAVSALALLLLTDA"
FT   gene            229493..229828
FT                   /locus_tag="RHA1_ro11232"
FT   CDS_pept        229493..229828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11232"
FT                   /product="probable transcriptional regulator, ArsR family"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11232"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00879"
FT                   /db_xref="GOA:Q0RV07"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV07"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00879.1"
FT                   /translation="MDQDIAAQLQELHARVCKAIADPKRLLIINELRDRELSVGELCEA
FT                   TGLSQSNASQHLTILRERGIVTTRRVKNNVFYSLRSQKIVQAVDLLREFLAEDLADHAA
FT                   LDGAIRG"
FT   gene            230202..231692
FT                   /locus_tag="RHA1_ro11233"
FT   CDS_pept        230202..231692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11233"
FT                   /product="possible hydrolase"
FT                   /note="GO_function: GO:0004792 - thiosulfate
FT                   sulfurtransferase activity; GO_function: GO:0016787 -
FT                   hydrolase activity; GO_process: GO:0008272 - sulfate
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11233"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00880"
FT                   /db_xref="GOA:Q0RV06"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV06"
FT                   /protein_id="ABH00880.1"
FT                   /translation="MCRPRDRAYPPGYLHTHGGIWQSVHKEKDPANLEETTMILEQYYI
FT                   ECLSHASYLIGDESTGRAVVVDPRRDITEYLDDARTHGLTIDGVINTHFHADFVSGHLE
FT                   LVEATGAWIGFGEAAETDYPIRRLAHGEHISLGRVDLEILSTPGHTWESISVLIRETPD
FT                   ADPTAVLTGDSLFIGDVGRPDLVNLGDGSTTDLARAMYHTVHDTLLALPDGVTVMPAHG
FT                   AGSSCGKNLSTELTSTIGEQRRTNASAQPMSEDAFVALITDGQPAVPAYFSVDAALNKS
FT                   THPALDQHRRIPELAADQVRAELAAGTRVLDARTVDDFAAGHLRGSVNVGFDGRFAETG
FT                   GMVAEVGEPIVLITYPGEEQDAAMRLARIGSDNVIGYLNTGVDGSFPTALTDLVQTAPR
FT                   TTVTELDRLRADDAIILVDIRNPGERDFGVIPGAIPVPLAQLRSRAHELPTGKPIVVHC
FT                   AGGWRSSVAASLLRARGIEQVSDLVGGYNAWAAQQVPA"
FT   gene            231731..232108
FT                   /locus_tag="RHA1_ro11234"
FT   CDS_pept        231731..232108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11234"
FT                   /product="probable thioredoxin"
FT                   /note="GO_function: GO:0005489 - electron transporter
FT                   activity; GO_function: GO:0016853 - isomerase activity;
FT                   GO_process: GO:0006118 - electron transport; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11234"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00881"
FT                   /db_xref="GOA:Q0RV05"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV05"
FT                   /protein_id="ABH00881.1"
FT                   /translation="MTTKNLTHTDFASTIADNAIVLVDFWASWCGPCRAFAPTFEQSSR
FT                   RHPDVVHAKVNTEAEQQIASAADIRSIPTIMAFRDGVLVYSQPGALPPAALEELISQIK
FT                   ELDMAAVHDTLARRHAAAGQA"
FT   gene            232580..232957
FT                   /locus_tag="RHA1_ro11235"
FT   CDS_pept        232580..232957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11235"
FT                   /product="possible carboxymuconolactone decarboxylase"
FT                   /note="GO_function: GO:0003824 - catalytic activity;
FT                   GO_process: GO:0006725 - aromatic compound metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11235"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00882"
FT                   /db_xref="GOA:Q0RV04"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV04"
FT                   /protein_id="ABH00882.1"
FT                   /translation="MDYGKAVQQELRGPARALRQAIPQVYAGYGQLHEAALAPGALDAK
FT                   TKELIALAIAVSKQCDGCIAAHARGAAEHGSTPQEAAEAIGVAILMNGGPATVYGPRAF
FT                   AAFNEFHTDQDPGHENDPAGR"
FT   gene            complement(233565..234140)
FT                   /locus_tag="RHA1_ro11236"
FT   CDS_pept        complement(233565..234140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11236"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00883"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV03"
FT                   /protein_id="ABH00883.1"
FT                   /translation="MAGTGDVGAHRWRVPASLTTDASASSSVTTCQHLRARLQRGLVRS
FT                   VDGPRARRRPRVACSQIGQLGLTRSARRASPSCRPAYRSRRAGRRPTPLTGPGSRRRRP
FT                   RLRGGRQDDKVSWLGGCVVRSAAEESVEESGCGRGSGVALAGALLGFGHGLHDTVDVCT
FT                   AASPGGLSAVGARNWITHGGVLLGYRCS"
FT   gene            234223..234618
FT                   /locus_tag="RHA1_ro11237"
FT   CDS_pept        234223..234618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11237"
FT                   /product="possible sulfurtransferase, rhodanese related"
FT                   /note="GO_function: GO:0004792 - thiosulfate
FT                   sulfurtransferase activity; GO_function: GO:0016787 -
FT                   hydrolase activity; GO_process: GO:0008272 - sulfate
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11237"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00884"
FT                   /db_xref="GOA:Q0RV02"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV02"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00884.1"
FT                   /translation="MREIEIDEFADAWAAGAPVVDVREPWEYRNAHVPGAQLLPLGQLG
FT                   DRVTEIPAGAVVYVICASGNRSVQGARILMTAGRPAVSVAEGTSGWAAAGRPLDTGEDG
FT                   SCPTADRPAPAPVSTKMFLSDRQGDRG"
FT   gene            234615..236783
FT                   /locus_tag="RHA1_ro11238"
FT   CDS_pept        234615..236783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11238"
FT                   /product="probable membrane transport protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11238"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00885"
FT                   /db_xref="GOA:Q0RV01"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV01"
FT                   /protein_id="ABH00885.1"
FT                   /translation="MTRSTTLDGGQPTTTTTTTTTAESGVLGRIGAVMAGRSRWVFGVW
FT                   LLLLVALGAAAPSVFSSLAGAGWQANGSESVQVRQLAEQHFGGNSSAAVQVVVHSDTQT
FT                   IDNPRVQQTLSDVGTVFAGDPRFGALIAPHPGMSISPDGHTGILIAGANASTDDMVKAV
FT                   DEHKAELTALSGDGIEVYPTGASALWSDFNKANHDAMIQAELFSWPVTLAIMVLAFGSL
FT                   VAAGLPLLLTLAGLVASAGGLVLLNQFTPISVWAMNFAMMFALALGIDYALFIVARFRD
FT                   AIRHASSPRAAVAETMDTAGKAVVLSGITVLVSLSAVLLVPAPAVRTMAVGIMLAVFFV
FT                   LLASMTLLPAALGALGGKINAGSLPYAKGQTHRSPRFAAWGELLHRHPWPFAIGSLLLL
FT                   IALSVPALGLKVAMPSIEVVPTDAPVRQGYELVQAQMGEGAPGMLQIITPTAESAETAT
FT                   TAAATDGIAMVTPPLPAPDGGDYVMLHAIPTVDPSDARMGTILDTLRADLPDGALVGGA
FT                   PAENLDLQQALNDYLPLIVGIILVLGFALLLVALQAPLIAILGTVVSLLSTAAAFGVAK
FT                   LIFQDGHGAGLLGFTPQGFLDGWGPVFFFAMIFAIAMDYTVFLLATAKEHYERSGDPKI
FT                   AHVDGLAHSGRVIFAAAAVMVAVFFTFALADPLPPKEMGIILGVAVLLDAVLIRLILLP
FT                   VLLRLTGHAAWWSPAWLRKVLPKINFSH"
FT   gene            236855..237151
FT                   /locus_tag="RHA1_ro11239"
FT   CDS_pept        236855..237151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11239"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11239"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00886"
FT                   /db_xref="GOA:Q0RV00"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RV00"
FT                   /protein_id="ABH00886.1"
FT                   /translation="MGGLGKETAMVGDEDSIALVLNRLRRAHGQLAGVISMIEQGRDCK
FT                   DVVTQLAAVSRALDKAGFKIVATGLRECLTGETEEGKEPMTEAELEKLFLALA"
FT   gene            237192..237446
FT                   /locus_tag="RHA1_ro11240"
FT   CDS_pept        237192..237446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11240"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00887"
FT                   /db_xref="GOA:Q0RUZ9"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUZ9"
FT                   /protein_id="ABH00887.1"
FT                   /translation="MTMSDALPARGWTIERVVPPLAGMVVLASIALTLAFSPWWLLLTG
FT                   FVGANLLLFGAVGWCPASLLLHRLGVPRLAAPRPVPSGR"
FT   gene            237503..237916
FT                   /locus_tag="RHA1_ro11241"
FT   CDS_pept        237503..237916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11241"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11241"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00888"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUZ8"
FT                   /protein_id="ABH00888.1"
FT                   /translation="MTLALSTTLHTSFADAVDRTRQALAEQGFGVLTEIDMKATLKAKL
FT                   GEDMEDYLILGACNPPLAHRAVNVDRQIGLLLPCNVVVRADPADPGVVLIDAMNPQVMV
FT                   QVADQPGLGAVADDATAALQAAIDSLDRGAGDR"
FT   gene            237961..238734
FT                   /locus_tag="RHA1_ro11242"
FT   CDS_pept        237961..238734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11242"
FT                   /product="possible permease"
FT                   /note="GO_component: GO:0016021 - integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11242"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00889"
FT                   /db_xref="GOA:Q0RUZ7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUZ7"
FT                   /protein_id="ABH00889.1"
FT                   /translation="MDITVALALGAIIGVLLGLLGGGGSILAVPALVFGLGLDLEQAIP
FT                   ISLLVIGVASLVGAVPKIRQHQVNWRMAGVFAACGIPATFAGSAIGRLLPQSVVMIGFA
FT                   AVMVVAGIRMLMDRGDTGTACDVGDSGIDWRRCAPRSIPAGIAVGFLTGLFGVGGGFLI
FT                   IPALVLMLGLQMSVAVGTSLVIIVANSAAGLVSHLSGASIDWAITAAFAGTAIVGSLIA
FT                   GHFGTTVDTDRLQRWFAYLVFVVAAYVLIDTILLR"
FT   gene            238822..240174
FT                   /locus_tag="RHA1_ro11243"
FT   CDS_pept        238822..240174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11243"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0004416 - hydroxyacylglutathione
FT                   hydrolase activity; GO_process: GO:0008150 -
FT                   biological_process"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11243"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00890"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUZ6"
FT                   /protein_id="ABH00890.1"
FT                   /translation="MDVSIIETSGLGDRSYLVSDGAVAVVVDPQRDIDRVLDLARNRGV
FT                   RITHVLETHIHNDYVTGGLELARTTGAEYVVPEGDDVGYQRRAVGDGDIIDAGPILLQV
FT                   MHTPGHTHHHVSYVLRETTGGIRGVFTGGSMLFGTTGRTDLLGPEHTEELTHAQYHSVR
FT                   RLAGELPADTQVYPTHGFGSFCAATPATGDSSTVGEQRSTNPALTQDEQRYVDELIAGL
FT                   SEYPAYYAHMGVINIHGPAPVDLSLPTPVDPDELRRRIEDGEWVVDLRKRTAFAAGHLG
FT                   GTLGFELSDSFVTYLGWLYQWGAPLTLIGENEDQVADARRELVRIGIDDLTGAAVGELH
FT                   TLAAGTELRSYRVADFAALTKALPEQDITVLDVRQRNEYETSHIDGAINIPLHELADRL
FT                   GTLPEGEIWVHCASGYRASVAASMIDRPDRTTVLINDDYDNAIDIDITSTT"
FT   gene            240261..240620
FT                   /locus_tag="RHA1_ro11244"
FT   CDS_pept        240261..240620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11244"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00891"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUZ5"
FT                   /protein_id="ABH00891.1"
FT                   /translation="MVAPERETTATPTRGMPGIGIDLGGFAGGSARSARRMSPEGCAEV
FT                   ANRNKRCGSYENGPRSTTRARDEQPRSQQLASPCFRTVMSVTGTHLPAQAHVPFKGHRG
FT                   SRRWRRPRCASRTGL"
FT   gene            complement(240615..240839)
FT                   /locus_tag="RHA1_ro11245"
FT   CDS_pept        complement(240615..240839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11245"
FT                   /product="probable sulfate transporter"
FT                   /note="tc: 2.A.53"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11245"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00892"
FT                   /db_xref="GOA:Q0RUZ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUZ4"
FT                   /protein_id="ABH00892.1"
FT                   /translation="MTVATHNLAYGVIVGVITAMVLFARRVAHLTEVVDVAHPAEDTRV
FT                   YKVRGELFFASSDDLVYQSTTSGTRQTWS"
FT   gene            complement(240836..241270)
FT                   /locus_tag="RHA1_ro11246"
FT   CDS_pept        complement(240836..241270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11246"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00893"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUZ3"
FT                   /protein_id="ABH00893.1"
FT                   /translation="MTPPPRRRLRSSATATDSADARLASPVTVTVAAKVSGTSVHQSGD
FT                   PSVAKEPPEFGWMALAGIAAEGVSQFDVRSSLDTDTGGVGADGVVLAVLRGRWREKLHV
FT                   AVTLAAARQSPSIIQACGPSARADEPLPGEALSGRRQARR"
FT   gene            complement(241307..242398)
FT                   /locus_tag="RHA1_ro11247"
FT   CDS_pept        complement(241307..242398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11247"
FT                   /product="probable Zn-dependent oxidoreductase"
FT                   /note="GO_function: GO:0004024 - alcohol dehydrogenase
FT                   activity, zinc-dependent; GO_function: GO:0008270 - zinc
FT                   ion binding; GO_process: GO:0006113 - fermentation"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11247"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00894"
FT                   /db_xref="GOA:Q0RUZ2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUZ2"
FT                   /protein_id="ABH00894.1"
FT                   /translation="MSQTSPPPSGLLTQPLPRTMRAVVITGHGGLDVIEEREVPVPRPG
FT                   PGEVLVRVHAAGCNNTDLWTREGSYGAAEDPDVRTGWLGPLDFPRIQGADVAGRVVASG
FT                   DGAAAGPIGARVLVDPAEYDGPGLDARPADVLGSERNGGFAEYVVVPSTRAHSVDESPL
FT                   TDVELAALPIAYGTALGMLDRGAVSEGHTVLVTGASGGVGLAAVQLAHSRGARVVAVCS
FT                   SDKGEAVRSAGADAVVDRRGGQVLADAAGAAPEGYDAVVDVVAGAVLGPGLSLLRTGGR
FT                   WVVAGALGGWSVDIDVRKLYLANLSLVGSTMHTPRIFDHLVEIARRGEVRPVVAATFPL
FT                   GKVREAQAQLAQRRHVGKLIVVP"
FT   gene            complement(242719..243021)
FT                   /locus_tag="RHA1_ro11248"
FT   CDS_pept        complement(242719..243021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11248"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00895"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUZ1"
FT                   /protein_id="ABH00895.1"
FT                   /translation="MCCLLLMHRRQAAVIRIGPANWPAGQGRVNSNRANYSGETAGISK
FT                   IHWQKGRFSVTGQAASDHGVRTAPDASWLSEVGVDSRDRRSVSVSRFRVSSSEAI"
FT   gene            243545..243796
FT                   /locus_tag="RHA1_ro11249"
FT   CDS_pept        243545..243796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11249"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00896"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUZ0"
FT                   /protein_id="ABH00896.1"
FT                   /translation="MTLAYATAVKAVPPWPASTTALPHHWRYRLLRLQTRNHYLGIQTD
FT                   HDSFTHAAIYPDTVELAAQILRPANQHTPRRSRTNREK"
FT   gene            complement(243951..244346)
FT                   /locus_tag="RHA1_ro11250"
FT   CDS_pept        complement(243951..244346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11250"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00897"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUY9"
FT                   /protein_id="ABH00897.1"
FT                   /translation="MPTGCPAADDRPREKPDRARCPVIAAGPDPSSHHEDGSGGSSTLD
FT                   NVTDATRTETNDFRSLDRLFGKPNGIPAATLWKTTWSDWTSSVSLHKSGECGGLSGGRL
FT                   SEPGESEVVTPRSGMNRGTEFHARQTL"
FT   gene            244362..244631
FT                   /locus_tag="RHA1_ro11251"
FT   CDS_pept        244362..244631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11251"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00898"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUY8"
FT                   /protein_id="ABH00898.1"
FT                   /translation="MSIGQPACHVTGFTGSSPPSPSQDTHHRVTHHLCALGDDNFSYRT
FT                   AGPEIPRHCVLLCNVSRRLCPSKVVRLPASSQSPDRVIPVPSRP"
FT   gene            244665..245909
FT                   /locus_tag="RHA1_ro11252"
FT   CDS_pept        244665..245909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11252"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11252"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00899"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUY7"
FT                   /protein_id="ABH00899.1"
FT                   /translation="MADLRDAEPGADAALFAPQETTLAELIARSADLKSELVEFVQHRR
FT                   FDRQLTALLRDAADTGPLDEAILVRTLDHFALEYRLRDGGTVVERFVAQRRPPLTDDER
FT                   MMLLGWRDVVEGYFEVHPAADDDLGTAVLHNLIDDLHYPVHSNTGPEVVAALQPGMFVY
FT                   CRIVPVHPATGHWLISGHLLPFPSSSGPVLAQAAQEVLTADPSLLRRNRGLYQRAWQLQ
FT                   ADARAAFLDFFGTDLVILPPATAQEQLIEYHRHHLARIATTTEPHDTPTSPAAPHALTA
FT                   EQMGRLPEDYLDADSVGLIYDETEGLNYYQDFGQLDTMFSDPALAGDHTHIALLRAYLD
FT                   DDTVSALPLRRLAQRHPAGVDPVFRALLRRPNFSWHHDGEDLLRTRKTEYFQRETAPSF
FT                   TVTGQRLAELLYPSQ"
FT   gene            complement(245921..246484)
FT                   /locus_tag="RHA1_ro11253"
FT   CDS_pept        complement(245921..246484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11253"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11253"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUY6"
FT                   /protein_id="ABH00900.1"
FT                   /translation="MTQIADEHPAGGTRHRPGRAVPCPSRPANRSSIPGGPCSPACAPG
FT                   SSRARRGPCRHPSPDLGPAGIGQVRGARAPRTPDHRARKSALTPMLGTDTVCVFATNRS
FT                   PPDSPTGDSRHRVRRGSRGLRDIPDARGETDRRGQRVRGITESAASRVVGGRRLGVAVW
FT                   VVAGEGAPDLVPGFGWSTRSSPQG"
FT   gene            246778..247467
FT                   /locus_tag="RHA1_ro11254"
FT   CDS_pept        246778..247467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11254"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00901"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUY5"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00901.1"
FT                   /translation="MRQLRIPDDVAATRRGIVLLDTDCERVVYRASVQGDDLSLPAGDD
FT                   EIEELIGYVAADANHEPNRRRQRLDAAFTVLSEAAENPHSPPPTLVAAGDSTGHVPPRP
FT                   GPAVPGSPELDIGRVQRWCGARVPEHARHQVRLECEIAARHLTIIERRAPMERRRRTGV
FT                   DQPAHRPAPLHQGHQDLEPVLARPQSPLPRPRPAGAVAAPRTPADRTRPGPDIDLLGLT
FT                   NPTGAVR"
FT   gene            complement(247574..248371)
FT                   /locus_tag="RHA1_ro11255"
FT   CDS_pept        complement(247574..248371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11255"
FT                   /product="conserved hypothetical protein"
FT                   /note="homologs found only in other rhodococci;
FT                   GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent;
FT                   GO_process: GO:0006412 - protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11255"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00902"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUY4"
FT                   /protein_id="ABH00902.1"
FT                   /translation="MALHLPKPRTTKPAQEAVGLDGLKVSVANAATSGVEKSKQVKSGG
FT                   LAGLTSKVSVKQLRKELGNEGLRQAAIDAGRTPPSARTLRRWAQQGRIPHADVLERAQR
FT                   RAAIERLGGVDAVAAKIGRSRSAVSRYRSGETNELRADASKKLKNVKAQDIMKRAGVLR
FT                   PDGTPKKAVIRVKGGVMVRNGADEGYDYRVRTLDFANSDTPFTSEESRELAAALANDDH
FT                   ARVVALLERHATLDYPENKGFDKYSDQFGFHFDHIDSVHIDWI"
FT   gene            complement(248371..250644)
FT                   /locus_tag="RHA1_ro11256"
FT   CDS_pept        complement(248371..250644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11256"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11256"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00903"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUY3"
FT                   /protein_id="ABH00903.1"
FT                   /translation="MGGYGEGRKFPRQRPPPPDRGWTRRRRGVGETRSRCGRLRWCGNA
FT                   ECGVDGEVGTAEGTDEGSAQYPGPGLDGSPAELAGEQPSIHGDQRRGRGPAGVLRPLQR
FT                   PSGRSRRPDRRAGVMSGPWEQIPLFALPEGTLTASPDFTDDVLPDDDAASVDAGVFVAA
FT                   DQAGSEPAVAAHRESSEQRDAAEADDAPTPPSPEVDGAAVDGDEVDDDAAGSDEVAVDP
FT                   PVWETLPAGEEADGHALIVTAAGTYTPSGRELTGPVDSVEKLDKLIRWAALTPLGAPAQ
FT                   IWIVGQGACELLGWIIDPGSEDDVDDMEALRNRAAQELTAVLHATLTPLLNAGWELRGD
FT                   PGHVVHLSRSIGNFTSMVDVVIEPYVWTYWNKDFGWHNRVGDMGILGSPTAGTYLPDDD
FT                   LPAARELGRRLAWCAQHLGVLPGPTPARTGAAIVDKIKRERTRSGKGIVVTTPGSVPPL
FT                   DGPPRGDLEPAVGWTRVPDAQDLDGTGRLVSIDQRAAYLASAGMLEFGYGQPTHLTGNA
FT                   AAAAAVGEKGAPFGLWRITLPAGQALSLPEKLPLPHPHMLADQPVQTWVTTVSLDGLCS
FT                   PVADGGIGAELDDLDITEAWVYPQQGRALDKWAKILREARKAAVDTDDEATKRFLSTCY
FT                   KGYIGRMVNPDMWTATRMQHHHQPLWRASIIAHCRWRGRRVAMRIAREHGRWPVRTVTD
FT                   SWVYLLADSEDIADASEALGKMSVEKDVVLTDTLLSAFASAEDVHDVNLAIKAAFADDE
FT                   EGDL"
FT   gene            complement(250864..251136)
FT                   /locus_tag="RHA1_ro11257"
FT   CDS_pept        complement(250864..251136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11257"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00904"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUY2"
FT                   /protein_id="ABH00904.1"
FT                   /translation="MSAVADDDDQVSARRSATIHRQQKEGTVPGLIFRAGVTYDISHTR
FT                   FEATRELLVRFAEGRTTGVAMSLTHDGGAQHHLFITPGAPITLVE"
FT   gene            complement(251175..251564)
FT                   /locus_tag="RHA1_ro11258"
FT   CDS_pept        complement(251175..251564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11258"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00905"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUY1"
FT                   /protein_id="ABH00905.1"
FT                   /translation="MGGAVVGHDSWRSQHLPVLHAAGSRGGGNASASATSESPALVRCE
FT                   HHDTSGRRIMSYEAIYDGVRYPLADAAAAHRLEEAIRGIFEDNGNGGFVGFVSQNSTVR
FT                   LLITPATPVAIRGSDEPDPSVVHRW"
FT   gene            251746..252690
FT                   /locus_tag="RHA1_ro11259"
FT   CDS_pept        251746..252690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11259"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUY0"
FT                   /protein_id="ABH00906.1"
FT                   /translation="MGTTFHGPSPWPHITRAIRTRGARHAAIAYLGQDAPELLPLRAGD
FT                   LLVVNASKAAIRAHATSPAALAYYVNKGVRVLSSPTLHAKVIATNTRAVIGSANASENS
FT                   AFADDAVIITDDPEVIASVRTFIDRLDEITEVDQVFLDDAILEWEIGRAVPLPGVTGRV
FT                   RTETDFLPTPVTRMFVKHAVDYEPTRTEQQVLDEQRGRHRSRGGPAAKYQVESLRLDKP
FT                   SGVRRGDVIVFVSADDAWFYPPAVVVSDPMKIPRSGGAVLYFLRIRADLPPLPLTEAEK
FT                   LLTDLGHPGSRLRTDHYVRSPSLRTALLGLWDL"
FT   gene            253050..253445
FT                   /locus_tag="RHA1_ro11260"
FT   CDS_pept        253050..253445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11260"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00907"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUX9"
FT                   /protein_id="ABH00907.1"
FT                   /translation="MLTMPISATIRSGHENGQPAHRSGTYVTVMKLRPALPRHQSARDG
FT                   FLNRSATQRSVDTRTDTPGARSNHLSGRNGVCRHRTRLRGAIDRSHPAPIVKPCDGSKD
FT                   EVGEPAIGKAGTGCPHSARHPGSRQVT"
FT   gene            complement(254041..255387)
FT                   /locus_tag="RHA1_ro11261"
FT   CDS_pept        complement(254041..255387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11261"
FT                   /product="possible mycobacteriophage excisionase"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11261"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00908"
FT                   /db_xref="GOA:Q0RUX8"
FT                   /db_xref="InterPro:IPR021235"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUX8"
FT                   /protein_id="ABH00908.1"
FT                   /translation="MNDLSIRAARIQLRALIAALIVAIAIAVGITTGAFVLSFAVQRDL
FT                   ALQAGIPHYLTWIFPAIVDGAILGATIAIVALSKINGSATGKHFFLWLAVVVVFISVFG
FT                   NAYHAYRAGEAAARSVAAGIELGYTPLTPTGASLIAVIPPLLVLAFTHGVGILIKAIGT
FT                   AHTEYIAVVRNTRDREQRDEDITDYRTAVAESMPASERNSGEIAGLVAPSVAQVPNVAS
FT                   DSHVAHVPSVAPDSHVAHVPNVAPDPGVASDSDVAPRIAQPVASAPDVVQRFAHPDPQV
FT                   ADTATADGSSTLDDSREAAAAGPEDATDVADAVQPTEANPDDVTDVATLTEERVARNAL
FT                   EDSQEPFVLPDEAQTIENLLDFIDTCADFEPVVKETARLRIIEQHSYAEIATLTRAKAA
FT                   STAMRRFDKVAQRAVDAGFRTPPLPELEDAADGRNAATLDPQYTLVGAP"
FT   gene            complement(255545..255916)
FT                   /locus_tag="RHA1_ro11262"
FT   CDS_pept        complement(255545..255916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11262"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00909"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUX7"
FT                   /protein_id="ABH00909.1"
FT                   /translation="MSVQREPAIRRPAHPAADLPERPRVVKDPTPAAVDEQPTQLPTES
FT                   TIRSVADVPVTPVLSPAPEAASPVEKLSEQHNVRLRPSTKARLTRGVDKLRYETGDRSI
FT                   TISSVTDAALIEYLTKNGC"
FT   gene            complement(255913..256695)
FT                   /locus_tag="RHA1_ro11263"
FT   CDS_pept        complement(255913..256695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11263"
FT                   /product="possible ATPase, ParA type"
FT                   /note="GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0016491 - oxidoreductase activity; GO_function:
FT                   GO:0042242 - cobyrinic acid a,c-diamide synthase activity;
FT                   GO_process: GO:0006118 - electron transport; GO_process:
FT                   GO:0009236 - cobalamin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11263"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00910"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUX6"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00910.1"
FT                   /translation="MTRKCAICNQKGGVGKTATTLGLASAISNAGGHVLIVDVDPQGNA
FT                   TNGVGVTITDEMLTTYDLMSRTESGTAIDAVIATPWDGVDLIPADQTLANIESDGANDL
FT                   IFRLDIAFEGLDLSAYDAVLFDCPPSLGKLLFAVFCAVDGVIAVTEPTIDSVQGVTKLF
FT                   ETVENVQRRPNPNLAIDKIVLSRQRGTGEHRFRESELREVYGDLVARTTIPEYATRQDA
FT                   HSARTPIHKFTGGKSLSLQLAYTDLLNELPIKTAGATV"
FT   gene            complement(256905..257429)
FT                   /locus_tag="RHA1_ro11264"
FT   CDS_pept        complement(256905..257429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11264"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00911"
FT                   /db_xref="GOA:Q0RUX5"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUX5"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00911.1"
FT                   /translation="MTGSALVAGRESANIRSNWAIGSSLHSADSSAMATIAATRCSAAI
FT                   PAIVAIRETSATISTGARRRMSAIVAPLSMVACMSSPTCLSSLSRRSSLNRLAMQSRGC
FT                   RGACRAMSANRAMSAMLAREVWLSIVAVIAISAVVSNVAMKTSAVTVVSKSITETVDRC
FT                   ATIEVLAMFAS"
FT   gene            complement(258006..259241)
FT                   /locus_tag="RHA1_ro11265"
FT   CDS_pept        complement(258006..259241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11265"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11265"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00912"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUX4"
FT                   /protein_id="ABH00912.1"
FT                   /translation="MPKSRGRRKGGKSRPVRRAPRQLHPADLLLLDARQLLEIDDVLTA
FT                   ETWASGWLGEAWSTAALTEHEPEHLLCMQVTGRACSTPSPHSLAAVDALARVAPAADLS
FT                   MLTDTLGILAETQPLPAWHTVAAWTPTAAWRAVDVYESERVLFIDYDGPHPHTLMANIY
FT                   QVGGLMIDKLALLNAGAATTWDQLREPDEAPMPLQSVPVAEVLADLAHALRTTDMTWPR
FT                   TADEDFCDHRALAWSRCRNYLPEWPEHVGLPEQRRRQLVEDFLNDIGSDDEVSRSLAEL
FT                   FLDYGDGYIGAGPLCWSPGEVMLLLTDWLPRKAVLDADQRNALPFVLRRWLTFALTQQE
FT                   IDRQWISRVVDAVDTFLPEFHDAFDDETTWGPAKQVAAALTERGVDLTDRQAVDDGIRQ
FT                   LNAEQLAHRLLP"
FT   gene            complement(259652..260236)
FT                   /locus_tag="RHA1_ro11266"
FT   CDS_pept        complement(259652..260236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11266"
FT                   /product="conserved hypothetical protein"
FT                   /note="homologs found only in other rhodococci"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11266"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00913"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUX3"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00913.1"
FT                   /translation="MGKKNTVSRSTQRHPRVYVSRVQAPPRISRNADSIRERLRNGAKT
FT                   VVVDTAGQLIELDDKTFASAGDEWTLRFTAGSQARIHLDSPLPATAHIVATDATTVEVT
FT                   GQVHVWAYTHATVTAFDQCRVVAHNHAFIRACDHSVVWADDNVVVHAYDEATVQARDHA
FT                   ILALSDEARAVVETAVVVRGPARKNVTMRDT"
FT   gene            complement(260399..261733)
FT                   /locus_tag="RHA1_ro11267"
FT   CDS_pept        complement(260399..261733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11267"
FT                   /product="probable replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11267"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00914"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUX2"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00914.1"
FT                   /translation="MCSLFDSVLHSPKGLPVLLGTSQGNAYPDALSTVEHSDLGVSWDK
FT                   SHSPVPQTTQPATQPLQTPWIDELRQLNTDTDQRGKSWTLPVNPGQEASIPIWTSRDGW
FT                   MRQVRYAITKTAAGRAAAARHRIGVESMVAIAGAHASSADSKTGRRVTATVQNLAARAG
FT                   VSESVVKRGRRVLKALHLGFELVRGRTLTTREFQAAEVHHGGRQHRAASVWALSSPPDL
FT                   VAATPAPPQAKKRGSSHCRTHRAAKHTHPTTPTGSNPNPQARDRDPLSLSGFSPKGISC
FT                   REVITKRACARENQPSSSNQTNPRPINLQRAASTLIAAAPVIAPSGHIGAVCDVIDRAG
FT                   IDTTRWTGRDIAQALTADTVSRGELWPDTVRSPIGYLTWRLSRIDWSGLSPSEQRAAEA
FT                   AHSAQRRAERDAERERSRRAAASPEHRKALMEQIRATLAPQRQAA"
FT   gene            complement(262281..262538)
FT                   /locus_tag="RHA1_ro11268"
FT   CDS_pept        complement(262281..262538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11268"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11268"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00915"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUX1"
FT                   /protein_id="ABH00915.1"
FT                   /translation="MAQHNKGPRGQIATRAPLRHHKVYESRAAELGIPAGDYSVLILAI
FT                   THGLDIPDYISEKIRPEQLRLLEIEAAGSLHRIEQLAMGA"
FT   gene            complement(262766..263071)
FT                   /locus_tag="RHA1_ro11269"
FT   CDS_pept        complement(262766..263071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11269"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00916"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUX0"
FT                   /protein_id="ABH00916.1"
FT                   /translation="MTTVNALDFHGRQWELVPIEDVIHARNVADGVTTLTVLSEQLLAE
FT                   CGLLVISAEAPTLSVGARERLANVIDLVVTDPETASIEQIREVASLVRLLLHRHPA"
FT   gene            complement(263068..263592)
FT                   /locus_tag="RHA1_ro11270"
FT   CDS_pept        complement(263068..263592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11270"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00917"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUW9"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00917.1"
FT                   /translation="MTSLADRVYLMASGQIAPPAAEGPMEIRWNWFADLYDNPRWGLCT
FT                   IPGFTASAAHTVAELCRATSIDPTADADVIADRVTALKARWQAIDRLAAIKGGRAQSEA
FT                   ADYAWAAVAASAVDAYDYLAGIEFSGTETVSSAFWGQLVTQPANAAVVRINAATNAWAS
FT                   SRRQGATGVAA"
FT   gene            complement(263589..264008)
FT                   /locus_tag="RHA1_ro11271"
FT   CDS_pept        complement(263589..264008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11271"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00918"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUW8"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00918.1"
FT                   /translation="MDLTGFVYAGHVRLCPTSRRIAAELETRGKAPATQSHIGQGLCIG
FT                   KGSGWTVTSTKAAAWKRAMATCSVCPLLAQCEAQLEERLAAGVKVREQIMAGRLFTVTG
FT                   REIEAAEVDAFAVARGRTKKKQQKPRGGTAREVAA"
FT   gene            complement(264053..265297)
FT                   /locus_tag="RHA1_ro11272"
FT   CDS_pept        complement(264053..265297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11272"
FT                   /product="transposase"
FT                   /note="GO_function: GO:0004803 - transposase activity;
FT                   GO_process: GO:0006313 - DNA transposition"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11272"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00919"
FT                   /db_xref="GOA:Q0RUW7"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUW7"
FT                   /protein_id="ABH00919.1"
FT                   /translation="MTSAHDIDLQQILTDRLTGASPDLLRELLTMFIHTLMGAEADALC
FT                   GAGYGQRSEERTNSRNGYRHRDFDTRVGTLDVAIPKLRSGSYFPDWLLERRKRAEKALT
FT                   TVVATCYLLGVSTRRMDRLVDTLGITGLSKSQVSVMAKDLDTQVEAFRSRPLDTGPYTF
FT                   VAADALVLKVRENGRVVNVHTLVAVGVNAEGYREILGVDVTSSEDGAGWLAFFRSLVAR
FT                   GLGGVRLVTSDAHAGLVAAIGGTLPGASWQRCRTHYSTNLMAVTPKASWPWVKTLLHSV
FT                   YDQPDADSVHAQYDRIIGALSEKLPRVADHLDAARPDLLAFTAFPKQIWKQIWSNNPQE
FT                   RLNKEIRRRTDVVGIFPDRTALIRLVGAVLAEQHDEWIEGRRYLGLDVLARSRNDKPTD
FT                   SSTESTEEVTPALTA"
FT   gene            complement(265366..265764)
FT                   /locus_tag="RHA1_ro11273"
FT   CDS_pept        complement(265366..265764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11273"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00920"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUW6"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00920.1"
FT                   /translation="MNTLDGAGALRLATASSHAGREKVDGHDRVTNGPLREILARHRPN
FT                   HDHTSCTACGFTYTPDLPLCPPVADALRELSTGAVRPQDLSLGRYTSGRLRAMAREHTG
FT                   EGRCRRCGFGVASMKMVYEAVPHLTGVS"
FT   gene            266034..266465
FT                   /locus_tag="RHA1_ro11274"
FT   CDS_pept        266034..266465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11274"
FT                   /product="possible repressor protein, helix-turn-helix
FT                   family"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11274"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00921"
FT                   /db_xref="GOA:Q0RUW5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUW5"
FT                   /protein_id="ABH00921.1"
FT                   /translation="MRGFQPDQLEKARRSAGVSQRELARLARLNADTIRRWELGDSSPQ
FT                   VDLLARVTAAIGVSISDLVKVPESERYPGDWRILRGLTQPQLGAAAGVTTQIVGSVERG
FT                   EISLSDNVARKLSAALRIPESELRASYERVRTRPAGTPA"
FT   gene            complement(266758..267321)
FT                   /locus_tag="RHA1_ro11275"
FT   CDS_pept        complement(266758..267321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11275"
FT                   /product="possible intracellular septation protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11275"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00922"
FT                   /db_xref="GOA:Q0RUW4"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUW4"
FT                   /protein_id="ABH00922.1"
FT                   /translation="MWRVFYNAALVVAFMATYKAAGIFAATVVVMAGVVGEIIVTLARR
FT                   QRVDKLQWIGLCLVLVLGGSTLLFHNETFIKWRPTGVYWLIAGAFLTSLMVAKRDPVRV
FT                   IIGRWVSAPDAVWRFLSWSWFVALVAVGAVNIVVAYTMSTDTWVNWRVFVAPGSLLALA
FT                   LAQATWHRNYILTAWRAHQSEEAM"
FT   gene            complement(267350..268435)
FT                   /locus_tag="RHA1_ro11276"
FT   CDS_pept        complement(267350..268435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11276"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00923"
FT                   /db_xref="InterPro:IPR041458"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUW3"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00923.1"
FT                   /translation="MTADALVRAPAEPTHPIREWTTVFVGTGDEHLVVAEGPKHRDWRK
FT                   IGNVFREPARTAVLGLIRTCIADRELKIETFEGKVADALGPVAAAHPILTPDKSVVVAV
FT                   QIWSGDPKKNPPDRPNVGAWEWVLSSEDNPPPPQLQLDPGAIELIGMSTRHQDRSVFGP
FT                   ADLYTRSARLSDTLRHVRQIRDCQVKDRFDGTFTIRAEADVTRELRYAERCVEGPAGRR
FT                   VRGICWDAGTDEALVHESMLDAWLSTMLASTSGMYIAVGDLSYQYPYWLKWVTEHVPGL
FT                   GHGVSTGQTFALHEEDWPKIIEWVQQVRKGPVSGTVRARRGGGGWLKAEFRGFLLDPLV
FT                   SDSIGVAVISPEIETIPDETS"
FT   gene            complement(268473..269639)
FT                   /locus_tag="RHA1_ro11277"
FT   CDS_pept        complement(268473..269639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11277"
FT                   /product="cytochrome P450 CYP258"
FT                   /EC_number="1.14.-.-"
FT                   /note="GO_function: GO:0050381 - unspecific monooxygenase
FT                   activity; GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11277"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00924"
FT                   /db_xref="GOA:Q0RUW2"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUW2"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00924.1"
FT                   /translation="MLDPFAPGLSVAEADRLHERLRAAGPVVEATDADGLRVWIITRYD
FT                   DVSRLLADPGIVNVRPGGPSGSPGLPLPPALARNLLNMVPDDHRRVRALAAPAFSRRRI
FT                   GAVRQMVTARVDGLLDELDPNETGVVDLFPAYASPLPADIIAEILGVTDTDADEFRTAA
FT                   ATVMAMNPGEPTADDPRIPAMTTIVLVLMRVIAAKRKSPGDDVITDWITARDAEDRLTE
FT                   EELISLAFLTFLAGFENSVYQIANAIGILAGLDRDQLLVEIADDQLWRARVKQLVLDAA
FT                   PGSYAIRRFPIDDITVGGTRIPAGSPLYLSLRAATNDPARGERPDLAFGRGPHYCLGAD
FT                   LAVMQLDIATRHLFQRHPGLSLVKPWETLDRRHTWRTHGPTEMPVNLI"
FT   gene            269731..270786
FT                   /locus_tag="RHA1_ro11278"
FT   CDS_pept        269731..270786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11278"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11278"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00925"
FT                   /db_xref="GOA:Q0RUW1"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUW1"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00925.1"
FT                   /translation="MSAQVDTVLDENVHKADAADRRGWRRSAAVCTLLALGSCLLAVAV
FT                   LVPTYGAARLKIIPLDVQSATVSVAEDAAVLKATSVAMKGPLKTDRGVPLRIQVYVTTE
FT                   DPVSADSTTLQAAQKTVRTDWGEGLGLVSAMVDRVTIDRRSGMPLAEPVPTTQAEQGKP
FT                   PAETPREGIQYKFPFDVEKVSYPYYDGTARETHPIEYVDDDRVVEGMRLYHFQQKIGPV
FT                   NLGKSIGSVATTTLPAEKWGLPGAEPTTMDLHYSTTRDVWVEPASGAIVAVEEQPRRWL
FT                   ARSVDDPNAVTTLEAHTHFDDETINGLAQQAKDARTAILWGTRYVPALSAVVGIVLVGT
FT                   ALILARRWSRR"
FT   gene            complement(270907..271494)
FT                   /locus_tag="RHA1_ro11279"
FT   CDS_pept        complement(270907..271494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11279"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00926"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUW0"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00926.1"
FT                   /translation="MTRKSITAALITATLAVVLTACSQDESPSTTHTVPSTAAAASPFG
FT                   SEASSALIAKIHRDNATAIVETVEARSGSPDQALAALLAAEAETGWRSGLSMAPPSVDI
FT                   RDIYGWRFGYNIAADSMDAVKAATNTFMDNAATITVSADDPAVYALAVQTVDPRGYNEK
FT                   EHFYKNGETAATEYAVALPKAQSAYAELRDSQ"
FT   gene            complement(271506..272093)
FT                   /locus_tag="RHA1_ro11280"
FT   CDS_pept        complement(271506..272093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11280"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00927"
FT                   /db_xref="GOA:Q0RUV9"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUV9"
FT                   /protein_id="ABH00927.1"
FT                   /translation="MKTRKLVIVVLVVAVVGFLTYTYLFRTNHDEDSASMATSTISARS
FT                   TAAPAAPPVDVEATELQTASRAAEQAARQGLTVAFTWYPATDITQNDAYRRARNWLTAK
FT                   LADRMIVDARTERGPGVQWDEWAQQQAKVIADVSIECSGCPADTDTLVHRVATIKQTVI
FT                   SGSSTDTVKPDTTVWVILVREGDRWLIDNIRY"
FT   gene            complement(272382..275354)
FT                   /locus_tag="RHA1_ro11281"
FT   CDS_pept        complement(272382..275354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11281"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00928"
FT                   /db_xref="GOA:Q0RUV8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUV8"
FT                   /protein_id="ABH00928.1"
FT                   /translation="MTAVTTLPLRTPIAAGESLDSWIDALARRNDTSPLEVLRALGIDY
FT                   PGQSIRQLVDETDSPQLRRIEAATGLAPHRLDAATGPAVPGIERLSMNCSRFCPRCLAE
FT                   TDGRWQLSWRSSWAMACKRHRLLLHDTCAEPNCRAAPRVQIVGGATPPSAGTCIRLIDR
FT                   SRLRCGAELFTAADLPAADEVLDVQSWIDQLMASAREPGPAPAHATLTDLHLVVAWLLR
FT                   LDGTAAIAAARAINPRRHATPPPPRNGSPPNLDAALTAALLTRARVVLGDDEATAIDEL
FT                   RTLITKTPSPQRIPPPEFTDRRFASMPSRFPNRYLRAVDAHLPGAVRLRMRTVTPSASP
FT                   PRANGAVRIRMLPQLFWPDWTGRLLPVAGGFHTDLFRATLSVLLTVPGDPSQRMDTHTR
FT                   LLNPRVTAANLTVPLQGFDKLPTGSALTDVLALLCRITDHLDQHGTPIDYQRRREQIPA
FT                   ETLTWAQWRDLACSVGAHLGKHRQGRLRHAQRHLHQLLSGADLADRRHPLAFNSPADRG
FT                   TFVEFTTSMAAPLRRALHEHAESLLVNLGIDEPLTWSPPTDLADGLALPGIDTGNLDTD
FT                   KVSRLVVDENRSSREAAEVLGVRPEHVRIAMERLDQPQRQWAPHAAPAAWLREQHAAQL
FT                   FTREFFDREYIQAGRSLNDIAADTGIGRHIIARFAKQSGITLRKTRAPFHIDPAWLREQ
FT                   YCTQLRSTADIAVELGTEQMLVNNALHRHGIPVRPQGVASRTEMLITYDHLPPNIRAAV
FT                   EGTLHGWIRLHRFRITMAFPSLDTAADYLGITQSSLVRQLQLLERHAGTPLFHRSRRGT
FT                   AHQPTPHGHALLRELDNEHVHPLMTAALHGCNAPTMPDAKTLAHAMREAMTPPRKPRPL
FT                   NPFGDIAVERLRMTHTTLTLLRHLTTTDAEEFYGHGLHDCTGIHHSTLHPLLRSLEQAR
FT                   WLTSRDEDEADWLAGAPPGCGPGRRRTYYRLTPDGRRAALRELNTPRKRQNSEKPGATN
FT                   L"
FT   gene            complement(275351..276412)
FT                   /locus_tag="RHA1_ro11282"
FT   CDS_pept        complement(275351..276412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11282"
FT                   /product="possible ATP/GTP-binding protein"
FT                   /note="GO_function: GO:0000166 - nucleotide binding;
FT                   GO_function: GO:0016787 - hydrolase activity; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11282"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00929"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUV7"
FT                   /protein_id="ABH00929.1"
FT                   /translation="MSSAYSLSRKDGWRRFVDTPARTRPDTLTATALSTLGSDAREDYD
FT                   DARHDWHANFGTIATPQLKAVRDELELIVASNRQDPDRVRGAAVIDGFPGLGKTTIVNL
FT                   FGRDYHRQALRRRGPVTESGDEHIPVFRVGLTSNTTLRTLNKMICQFYGHPGADRGSAA
FT                   QLAGYALDCVLSCDSRVGIIDDIHFIDQNSRDGLAVSNHLKWLANELPVTFIYAGVGLG
FT                   ERRFFEEGLSGPSAALAQSARRWTRLEVGTFARDRHWKSLIKAVDKQLVLACGQPGQLA
FT                   GLADYLFARTGGHIGSLMTLINRGCFKAIRTGAEAMSQELLDTIRIDEASEKARHRLEA
FT                   ATRTSGERKRVRR"
FT   gene            complement(276409..278454)
FT                   /locus_tag="RHA1_ro11283"
FT   CDS_pept        complement(276409..278454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11283"
FT                   /product="possible transposase"
FT                   /note="GO_process: GO:0006310 - DNA recombination"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11283"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00930"
FT                   /db_xref="GOA:Q0RUV6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUV6"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00930.1"
FT                   /translation="MNARTVTVAVGAGLMVDGDAARVVEFDGRKVVVEYADGRYGSFAL
FT                   AEFVSRARGLEPVEEGLDPGLVLAGLSPAEREQAAARGEHVREVLTGYRSGYAEAARTG
FT                   EPRPDYAPAVGLKARCEAKAAELGVASRTVERWVAAYRDAGEAGLVNDRRRRGRGSTVD
FT                   PRWEAAVAAELAAGVSASTPTRSAVLMRAAERLEREHGVGVVALPSQATAYRRLAELVK
FT                   GTNAVSGSAKARRSIAQRPKGVYGRLRATRPGEYLILDTQDLDVFAMEPVTCRWVRAQL
FT                   TVAQDLFDRQILGLKVTPVSTKSVDVASVLFESVTGRSAGRPALGPVHGLPKHLVFTEE
FT                   NTGADAEIWCPPETLVIDRGKAFLSAHVIGVCARLGISIQPAQPRKPTDKPTVERFFRS
FT                   LRQGLIQHLPAYKGPDLHSRGEGLEEQAFLFLHELEDVIRDWIVTVYHPSDHDGIAVAE
FT                   WPNLSMSPNDMFALGIAKAGVLRIPAAPELALEFLRVVKRTIQHYGVEIDGRRYNGPAL
FT                   DGYRNATSPYGGLDAGKWPFRVNDDDVRHIYFQDPGDGQWHQLDWEHAPMLGTPFSDEA
FT                   ARYARILARRTDRFTDPAETLATLLSRWDAGEVLDRRERRMAARLAAERSGLAAAAELE
FT                   LAADPVPALSVATTSSGPPVVGDDDDDSEILDDVDDFYADALEVLE"
FT   gene            complement(278451..279344)
FT                   /locus_tag="RHA1_ro11284"
FT   CDS_pept        complement(278451..279344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11284"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11284"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00931"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUV5"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00931.1"
FT                   /translation="MIDVALLIDLSPRCRFRHFSENRSRRVCGLILGLGGWVSAMTDES
FT                   SLMWTGLAGVVPGSEVAVRFRGDDGAFVDTTLRRLPVEDVLAGRPVREFRSWQGRRHYS
FT                   GWYWSATTGGHVVYESRLELARILLAEQDRNVVAIAAQPFLLEGIDGDRKRRHVPDLLL
FT                   AHKDGALTVVDVKAAARVADPKVAAQFAWTRAVCERHDFGFEVWTGADAVLVENVRFLA
FT                   GYRRPATVATKLVPAVIDAAVVPVTISTLERRLGLSVPQWLVRPVILHLLWRSWLVTDL
FT                   SRVLGGDTLVSAEVVA"
FT   gene            complement(279378..281000)
FT                   /locus_tag="RHA1_ro11285"
FT   CDS_pept        complement(279378..281000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11285"
FT                   /product="probable peptidase"
FT                   /EC_number="3.4.-.-"
FT                   /note="GO_component: GO:0005576 - extracellular region;
FT                   GO_function: GO:0004222 - metalloendopeptidase activity;
FT                   GO_process: GO:0006508 - proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11285"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00932"
FT                   /db_xref="GOA:Q0RUV4"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUV4"
FT                   /protein_id="ABH00932.1"
FT                   /translation="MRIGGVRRTLLMSGAIGIVIGTSACSLGTPVIPRDPCRTVTIDSN
FT                   DGGERGPASTAEQTLTVSGPIRLPVEPGTATFTSGFGERWGAQHQGVDLAGPVGTKILA
FT                   ALDGNVVKAGDSGEGPGVGFENWVVIDSNVDGRPVSTVYGHMFATGIHVKPGQQVKAGD
FT                   HIADIGNAGGSTGPHLHFEYWQGGRLQGGTALDPLTVLPDIAKQNGTSSDDPNPNTTSN
FT                   SNSPIQLVAASRSTADCSGFGMAGGGELAFGIVPAEFEPWLRRAGSVCPEIDAPLLAAQ
FT                   LQQENGFRHGSTAPVSSTGALGPAQFMPGTWATWGKDYDGDGKADPNSIGDAVMSQAHF
FT                   MCALYQNVSGYIASGQASGDPIELTLAAYNAGPGAVQQYGGIPPYAQTENYVPKIMQAR
FT                   TGFTNPNARGRFIPHASGDRSQVVTAAREYLGTPYVWGGGGTGGPSGGGFDCSGLTSYA
FT                   VHAASAGKIALPRTSEQQWGVGTEIPIDQAKPGDLVFGSWGPNGPGHVGIAAGNGQMVH
FT                   APTPGEVVKEAPLQEGMKARRVM"
FT   gene            complement(280997..281833)
FT                   /locus_tag="RHA1_ro11286"
FT   CDS_pept        complement(280997..281833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11286"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11286"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00933"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUV3"
FT                   /protein_id="ABH00933.1"
FT                   /translation="MSPSGPNPVLAPIRRWVLYSRTHLALTVVGAAALLFAAGAVFGEN
FT                   PPPRAVAHQADTTVESVTPAETISYDLDEVSESLVAAKTATWAASSAPATAMAYAHAFV
FT                   DAIQSDAVWASTIGRHTADKPGEYVVAARPRTPVVITGPTVSTLADGPDGARTARVTVP
FT                   TQAGDLRITLSVDDVDGKKRWVVDTPLPTLNLSEVEKTAPTTTTATTRTSTTPTTTAAD
FT                   TTTPQPTSTPSPSSTAPQPTSDLDEPATAPNRGNDPTPIPGPIPIPDLDTPIPGGL"
FT   gene            complement(281833..284091)
FT                   /locus_tag="RHA1_ro11287"
FT   CDS_pept        complement(281833..284091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11287"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00934"
FT                   /db_xref="GOA:Q0RUV2"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUV2"
FT                   /protein_id="ABH00934.1"
FT                   /translation="MSPSQPGMRRNSDHVFRTGALQARPPERGHGVRSLLRAGRQHQMI
FT                   RLLTLRAARMDRFPFPRRFGWRTGLVGRVLVVLMLAAVSLIGLGGTVASAGGFDCQDVP
FT                   PPEFPNEVIETTFDSTSADRPTTGGTGYQTYGWAGLEWHTYDLGCGADLVKAPGAVGDT
FT                   TLGNTFLTIGKSMAAAAFWLDDQTKTGQDATKAGVTPALERFDQIVFSITEGMRFLYGQ
FT                   WVGIALVIVAAIVLWKAMKADTAGVTKTSAIAAAGLALGALMVGAPQKALQVADETFGS
FT                   LITETQDQIFTVQFGDDDGTLAAGGTDPRNVLIDKIFLPDWRKGWFGTNYDPEDTAGLG
FT                   VKLRDSLAFTYDQQHAVKDDPKAQAQLAEEKADQFREIVTDLETDYQLSYYQFQGKDSG
FT                   RTSTGFMGMIKLAMPSLLWIGASLLKLTALLAIRFAVLFAPIWVPVAIAYGGWLARVMR
FT                   MLASAYMWGVAGSVIVALYLMALVQLYVDSNGAVDGSWRLWFMALLTVVCWAIMRPFKR
FT                   MSQTFTQNSASMVNRKARSAKKSIKRKAFDAASFTVGGPAQAIAEKAAERFARRGRDGH
FT                   ADDDGAATITRPEGRALGNRRQQALTQSRADARKAQGVGRGARLGQTSDAAIERDARIA
FT                   GIAAVASRDIARGKGGVDGKDADRAVRSGAAAWKFFDQNEADSLVQESRARKELLTASV
FT                   GPRWDGGDRSAIAPMKVYTPTRGQRRADHATVSTPHRSPAKAWDADAPARTTPEDRYI"
FT   gene            complement(284088..287144)
FT                   /locus_tag="RHA1_ro11288"
FT   CDS_pept        complement(284088..287144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11288"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11288"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUV1"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00935.1"
FT                   /translation="MTLQPDNEIAALFDPNFGEPDPAIVPPGALPPSWAAAMAANRSAA
FT                   TPAPAQELAWSKAPNNSIAAPAPVAASSPAPDAAAEPTGQGKRRGKKRRRRADPEAEFT
FT                   RQAAAAKRRADRERKAVRLALVGVEGNITRTRRQSTAWFVQPPGPWNMRPVGKQRRYIQ
FT                   NEGLVVANLAEAGVTGLHRRLVRTPWPVRQWAQAHDGWADPIPDVPGALSWADYLRGQQ
FT                   HAMLWGNPTQKGRYWGVELPPRSAGAQGLDTVGQWLLPVVDWPLIGRFARLWRTWARDA
FT                   FLGEQKAIADHLATIERHLSGQGVNAKPATAAQMDYLLLRSATLGLPLDADGVISGAGD
FT                   WEESDVAALEDLTNLELTPGDGYTTVRGQVGGRDYTGYAIVLTVGRMAPLPIPEKMLPW
FT                   QVIGDPSGEPLEWSERISLKTKGQTLRSLRRLTSKIEAQFDHYTVEHDQSPPQELAEQH
FT                   ALAQRVISDIEEDHSGLSIRTEGWYRVLVVGSSPKEAKEKVALLQEMYAPRIRLEQEHG
FT                   QYQLLREFVPGEPLANIAHCRRMNVEALSAGMAAVGDRIGDRTGVVVGQTASIAPRPAV
FT                   WDLFAAHEKKHKSGLTPIVAVPGSGKTFLAGMLVYQAVRAGAYGVVLDPSGPLKKLAQL
FT                   PEFRGIAEVQALTGRTSRPGSLNPYRVIVDPRRGDPEYDSSNPDYADDADPVAAAQSQY
FT                   EADLRAAEAERISVAVSVLKMMLTPSRLEHPWTETVLQTAANMVGGDRNHNLSEVLAAI
FT                   AAIGDGKDETNVDLISCARSIHQDLAMMSKLAEARVLFPEEGTIGDGEDVDRNVRLTVL
FT                   TMPGLQLPPEGTDPAQWTPQQRMAGPLMHMAAWMANRLVYELPRYERKVLFLDENKYLE
FT                   QTGAGRTLNLRIARDSRKYKVRALVCSQLPDDYLGVDGTDDKSALTYEVIIGDLGGNAH
FT                   AIEGALKLLNLPLGEGYESLLAGLGGGGEDTLDEDTDTEHLDQARRFIVKMADDIELIR
FT                   SDWTHYVHLAHVFDALDSRATRAAIRGAA"
FT   gene            complement(287141..287539)
FT                   /locus_tag="RHA1_ro11289"
FT   CDS_pept        complement(287141..287539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11289"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00936"
FT                   /db_xref="GOA:Q0RUV0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUV0"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00936.1"
FT                   /translation="MIDNDDLLHRVDQHYLGPTGFTLPVRIRYAALGLGSAFLVTVFVI
FT                   ARAVVHVPLGFKSLVVMIVITVALTARVTKFVNADRPVRSVIRAAWNDLIAPRPPKPGQ
FT                   TVVLRIPALSRAAGSADAVTPIEGESSR"
FT   gene            complement(287584..287895)
FT                   /locus_tag="RHA1_ro11290"
FT   CDS_pept        complement(287584..287895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11290"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00937"
FT                   /db_xref="GOA:Q0RUU9"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUU9"
FT                   /protein_id="ABH00937.1"
FT                   /translation="MSLSSAVVELATTPHGTVDVLAQDTEVSTGGLRAWIGDNIIFTIL
FT                   ALIACVVLVGGLRGNLSKVFTVGGLSLVGIAFFSLASSESAATGIGNWILGLFGIRVV"
FT   gene            complement(288548..288862)
FT                   /locus_tag="RHA1_ro11291"
FT   CDS_pept        complement(288548..288862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11291"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00938"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUU8"
FT                   /protein_id="ABH00938.1"
FT                   /translation="MTETRDFPQRGVPLERSTPAGVANTALALDLQAVLPNPPSARLAP
FT                   DGRSAGHCSARSFERSAGRSPSALRAVFQRGFQCSFECSLERFAARLGEWVRVVDRAVL
FT                   "
FT   gene            288864..291068
FT                   /locus_tag="RHA1_ro11292"
FT   CDS_pept        288864..291068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11292"
FT                   /product="possible DNA translocase"
FT                   /note="GO_function: GO:0003674 - molecular_function"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11292"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00939"
FT                   /db_xref="GOA:Q0RUU7"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUU7"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00939.1"
FT                   /translation="MLKDASADGVQARHDRKAQAVSGNHDPLKDWVVSAWRDTFGDSGG
FT                   RAGQVGENGPPTRIRRFTPLSPIVVVAAGVAGSSPRLMSMAADNETVVEVLTRLHDYRV
FT                   LLVAAAALLVVVDVLRHRRHRWSQMLESMVRQGTGHLPKKVAVSFPSGWRVIRRARITL
FT                   HRGTIIRPKQLEEVSRAIEAAFPATVQSETKVRHVAHRDRIVITRESIAPDTRSVRQRT
FT                   LQSALDAASMFTDPKVSVESVDEDGIETGYRIAFEKSMNTGVKGFQFKVEEALASLAGP
FT                   HESGRNWTTDWYPEGGYLVMRLVTAMPARVDHPLELVDENLRHLPYATGAADRIMYWDV
FT                   STSSNKPHCLIVGPTGGGKTSVIRTLLTEAARRGVPFVGVDPKMIELDGLEGYPGCGAI
FT                   IYDALRAAMFVRVLHAEMMARNAYIHQMKIEGSQLPLMIAVLDEFFILSGKWQRLAKTG
FT                   DDETRALLKELDPLGAWADLAVLARSAGIRLLLGVQRPDASLFGGASGNARDNFGTRIS
FT                   LGNLSQDGALMMWGDSTVGREVDTSVKGRGIALGDDGNPVDAQMWWTPNVDRHPNKWNQ
FT                   LAEREKAIIDGLMPTEAPRFTCYSQELASFIESERALATRARRHGRAPEPIVIGATAAT
FT                   DGDTSAESPTVDAAPTGDDDFSDVIPASAVEAGQTVLVDDDHGELVPVTVDSVDVRCGA
FT                   EGDVVETVLTVGTGRVKTRITYDATGVVVLPEPDLVGAPV"
FT   gene            291157..291504
FT                   /locus_tag="RHA1_ro11293"
FT   CDS_pept        291157..291504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11293"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00940"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUU6"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00940.1"
FT                   /translation="MSRRISQSITPTTEDVAALRGPFVAKGANDPVIKSLREYFKSSVP
FT                   TWLAKLSEEQELTRDRLAEIRAASSKRRVVIEALPEGSARDKALTELETAEAVVDDMDN
FT                   ALSGASAFGVS"
FT   gene            291507..293000
FT                   /locus_tag="RHA1_ro11294"
FT   CDS_pept        291507..293000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11294"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11294"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUU5"
FT                   /protein_id="ABH00941.1"
FT                   /translation="MTPTVDVEITSKTTARATLADANVPPMNLEAHESKTLSTVVHEFL
FT                   HNMAQAQGVDVEVVYRTAKDTRFLTVGPDGKAEERAPSMPLPIITEAPPGPVVEPVSTP
FT                   RGGPVVVAAEQMAYEAAPQPVDASTPSRVGQRPTGPVTGPIKGPLDVRPQLSAPHVTPD
FT                   DSPDVVSPARKGLRGTLNTLGFKLPPKSGSSEERARRTAAVTGRYIATIGRQVDADATI
FT                   VVLNPKGGVGKTPLLLGIADTLAMYRPATSIVAFDVSDSGGGLADRAAVGADHGPDVWD
FT                   VLEHAEELTAPGVRASALGRFTIRQPTGVEIVPGYRRIAAAAIDRHACEILASVLRRHR
FT                   QLLLVDTGNNTNSSAWQWATEADVVVIPVPLRGTIPGTVAEMIDDLAGVAPEVLDRVLM
FT                   LITEGPDDDPETEFDDVENFIRGGIAPDRFVRIPYDRLLHSGRINYPQLQPKTRTALIA
FT                   AAAKVVELLSTIDPTAGGLIDTTKLHSIARPQPITRIRS"
FT   gene            293050..294264
FT                   /locus_tag="RHA1_ro11295"
FT   CDS_pept        293050..294264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11295"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11295"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00942"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUU4"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00942.1"
FT                   /translation="MPVTNRATRRHGRHRRQSATQAATVLAVITAALASGLTLTPSAVA
FT                   EPIQGGVTGDSNQEGVTGGDTQTGTTTPTPAPEPANAPATPAEPVYWVDPPAAYQNIEY
FT                   QPLPNYDYETNAYVAPEDYYVAPVQWEQLHLPTPVEPTKPFIAPRDTLRLGELHIKQPN
FT                   WVSDMDRDRTNNTMAVVQAGVSTGWRSIGVETSRADRIAAAQVGAGAAGAALGAVTAGG
FT                   AAATAGALVGGTIGGLAGMTAGNVFLPGLGWVPAGIVGTAAGAGIGAAAAGIPAAAAGA
FT                   LVGGGIAVAAVTPIAAGDKGEPKEIEVPDIDSEAVTAQTATVLTDWENSGQIGQAAASA
FT                   VQDTVESAPAIDHQARDFVAAQPGGQQIIEQVDNTLTSFFNDATPGLAANLLSGAVGGG
FT                   IPAAN"
FT   gene            294288..295001
FT                   /locus_tag="RHA1_ro11296"
FT   CDS_pept        294288..295001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11296"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11296"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00943"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUU3"
FT                   /protein_id="ABH00943.1"
FT                   /translation="MKKTTLGRSTPRHPAVLDLLGSPSTIDHPPGARTMAPGGPATPLP
FT                   PPRSPLPSPRGRRLGKNAVADIAAVAVVVAGGVAISHLRSGDSETASPAATTTPTATVA
FT                   VDENGLPILNLPEPEQTENASASDGDCRADRGDQTSGAGVIAAFNHAYYSLRNGEAARG
FT                   LATSTSSVLPGPELQKVIDAVPIGTNYCLRTAELADGVYLVDLSVMQPAQPAKRGTQTV
FT                   TTQEVDGKWYVDVFN"
FT   gene            295155..297167
FT                   /locus_tag="RHA1_ro11297"
FT   CDS_pept        295155..297167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11297"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0016787 - hydrolase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11297"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00944"
FT                   /db_xref="GOA:Q0RUU2"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUU2"
FT                   /protein_id="ABH00944.1"
FT                   /translation="MSVPVIEVPMPARRSRTRRTVALIATATVAGGGVALTAPAIVNAA
FT                   PMNCATAFNLFIPGTWETNEHADPNRPVGMLAPIAEAIKAKNGARAQVYTLPYMARAFD
FT                   NGHTYADSKANAVSKATAVLKNYTDKCPDAKITITGYSQGSDAAGDLASAIGNDQGPVD
FT                   ADRVLGVALLADPGAGTKGAATVGPKTSGQGIAGPREQGMGKLSGRVASICDPKDLYCS
FT                   IQKGANPFLGSLGSILSKTTGAADGGDGNAAVATALTSDFTGADLPGLGSNLDALGKQL
FT                   RDTGGSVDVNQIADTATALSKTLSPLAELLQSGAANSAATGNLAAALAGTPENAAAQVL
FT                   TTASHADLTGALDSVATIANTAAKLSTSGTTTLSSTDPQISQLSTTAASLGSQIAPVAT
FT                   TPADALSTASSVLSVLKPTVVVEQALNVVTGITALDIPKILHSLIVLPQKIAAGDVRGA
FT                   RDAARELNVQFAPLVKMAAAADLKWVSQILSIIPDPTGYTQIAALVTSILGNVDVIKLA
FT                   NIAGQAQEIAWAAADKLFPPPGVLPDPLGAAAQTAALIPLGLELASVAANMLTGKASKT
FT                   DPALLGKQANPVGNAITTQAQTLDLAGLAGSVSTMARSQGAEDLAAVVGEGLNAASFFA
FT                   SGAHQSYQTLVVDNAGRNAIQWVSDWLNLQITRAV"
FT   gene            297259..298404
FT                   /locus_tag="RHA1_ro11298"
FT   CDS_pept        297259..298404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11298"
FT                   /product="probable N-formylglutamate amidohydrolase"
FT                   /note="GO_function: GO:0016787 - hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11298"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00945"
FT                   /db_xref="GOA:Q0RUU1"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUU1"
FT                   /protein_id="ABH00945.1"
FT                   /translation="MQALQTTRLLPQIRRQDSPQTSPHHQRPGSLSLPAQQRPVSRRLT
FT                   PHRTQSRHHHQTPITQTDRPRPNVTTAGNRRTRETCPRAGTVYDHGSADPPQTLRTTAE
FT                   AHRLSLPRKARVNSFSILPGCPSSPVILHVPHASRTIPPQVRAQLLLDDAALDAELDEA
FT                   TDTDTDLIATLGADHARTHPWIVKNALSRLVVDPERFPDAAEPATVFGRGAVYTRACDG
FT                   RRLRDEPFADTEGLLDEYFRPYARAVAELVTDRIVACGRAVIIDVHSYPERPSGFENPA
FT                   AARPALCIGTDPLHTPDWLTSATRRAFLPLGEIAENTPYTGCYVPLNRYGHDERVSAVM
FT                   VELRRDTYLPDDGRPGKQSVAQLGTCLAALIDTATEVGADV"
FT   gene            298436..299536
FT                   /locus_tag="RHA1_ro11299"
FT   CDS_pept        298436..299536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11299"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11299"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00946"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUU0"
FT                   /protein_id="ABH00946.1"
FT                   /translation="MRNRLHRAATRLTEARRDLETHPDAVHLQHRLSKAESNHAEIQAL
FT                   YDATPGGQQDLRSAIKSEAGPARSDLERRLAAGDRLRANQIEALSRARNIGEDVRTEGA
FT                   DSNESRADDAGAQGGVLAEVPVDARTAAGAAQGDRAGLDGREDRGSRSPRLLIGGRRVD
FT                   PLAAHRRPESERADFAARGLSSPTLYELPSSDADLYRTQMLELTRNNRYASSVYVYDEG
FT                   EYAEMRILVTDDGKAGVALKDDEVVSVFSHAYGAHPNAAPSMLRQATVLGGRRLDCFDT
FT                   VLPNIYADAGFVPVARLAWNDDYAPDGWDYDTYRRYNNGRPDVVFMAHDRAAVGSLYDR
FT                   AAGEYVSDYDDGIAAAKAYRTTQTGP"
FT   gene            complement(299853..300440)
FT                   /locus_tag="RHA1_ro11300"
FT   CDS_pept        complement(299853..300440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11300"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00947"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUT9"
FT                   /protein_id="ABH00947.1"
FT                   /translation="MHTTGQRYPSASEENFRQLESMPEYDAAVEILREYLDTAVPNAAA
FT                   TQQDTWSVSCLPTTNRTAEDRRLFTVNVGAIETYYLRLLTDDDGPLLSGTVFVTQSVLE
FT                   KAAGRPVAVLKDQYDALDFVTPVHRAAGGDAVAVSWISYDISLDQFAELPLDTAARDLA
FT                   DRLTAAGPCTYARYHNPWLAQAALSLTPDLVS"
FT   gene            complement(300763..301134)
FT                   /locus_tag="RHA1_ro11301"
FT   CDS_pept        complement(300763..301134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11301"
FT                   /product="possible ATP-dependent helicase"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0005524 - ATP binding; GO_function: GO:0008026 -
FT                   ATP-dependent helicase activity; GO_process: GO:0006355 -
FT                   regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11301"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00948"
FT                   /db_xref="GOA:Q0RUT8"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUT8"
FT                   /protein_id="ABH00948.1"
FT                   /translation="MVIDESHNLTNVGTQNNELARVLAPNTEALILASATPHNGREESF
FT                   AELLRLLDPTMVAPDGTFTKQDVETLLIRRHRHHPEVAAEVGGDWAERAEPVHRLVQPS
FT                   PAEDAVAAELSLPSRPYTE"
FT   gene            complement(301169..302422)
FT                   /locus_tag="RHA1_ro11302"
FT   CDS_pept        complement(301169..302422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11302"
FT                   /product="possible ATP-dependent helicase"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0005524 - ATP binding; GO_function: GO:0008026 -
FT                   ATP-dependent helicase activity; GO_process: GO:0006355 -
FT                   regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11302"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00949"
FT                   /db_xref="GOA:Q0RUT7"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUT7"
FT                   /protein_id="ABH00949.1"
FT                   /translation="MPRYKFKWSNLPPSLLHDLCRELLDAYDQEVGAAVALQTVYGARP
FT                   TVEFVREAWPTLRESWLRTAKESRDWIVEALQEARHERGLLKGSRAQLAYLRDLRNSRT
FT                   LREIVWAELVAIGEMDRQDEQDHAGTIEKPPTQAPARPREKDTPQCRPEERDAKDAAGI
FT                   ISRNGPRLDEHTRKWVADVSTTLNSAELPVLRPAAELNVAPGSIVVVRDEEWLVTQAEQ
FT                   GSDGWLVRVRGLSELVADTTAAFYSSLDDIEVLDPAQAQVVADASAGYRNSRLWLEALL
FT                   RKTPVPYGDQSLTVSTHMLADSLAYQRTAVAKALDPQHIRPRILIADAVGLGKTLEIGM
FT                   ILSELVRRGRGERILVVTPKHVLEQMQHELWCRFALPFVRLDSAGIQKVRQKLPATRNP
FT                   FTYFKRAIISIDTLKSPR"
FT   gene            302689..302964
FT                   /locus_tag="RHA1_ro11303"
FT   CDS_pept        302689..302964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11303"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00950"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUT6"
FT                   /protein_id="ABH00950.1"
FT                   /translation="MSAFGRALGKFHTLMEETADQFTETLRQWFAFPGRLVPDAGGGRA
FT                   LAHDRGPGARGAGGDVPVRCLPVSMWQGAAFGVVQAVNTWAHHKHP"
FT   gene            303265..303498
FT                   /locus_tag="RHA1_ro11304"
FT   CDS_pept        303265..303498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11304"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11304"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00951"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUT5"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00951.1"
FT                   /translation="MHAEPVIAESAYKHGIDSEDMVHAFNNAIKAYSVDEGFAMLIGPG
FT                   RDASLIEVGYVTSSDGAHVIVHAMKARGKYLR"
FT   gene            303504..304001
FT                   /locus_tag="RHA1_ro11305"
FT   CDS_pept        303504..304001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11305"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11305"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00952"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUT4"
FT                   /protein_id="ABH00952.1"
FT                   /translation="MPRTTEEILAHADELAKRFEDYEPKQEDERDPRALAAIRTAVVAR
FT                   AKAERILTKSIEEAKADGWSWASIGTELGTSGEAARQKYGTSPTAPTKKEGVRKAASKG
FT                   KMPAKTPAKSAGKMPAKEAKKTSAATKKARKAQHQSIEDMLKNSEGRTSKRAPRKASNA
FT                   KI"
FT   gene            complement(303937..304908)
FT                   /gene="pknK2"
FT                   /locus_tag="RHA1_ro11306"
FT   CDS_pept        complement(303937..304908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknK2"
FT                   /locus_tag="RHA1_ro11306"
FT                   /product="serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_function: GO:0004674 - protein serine/threonine kinase
FT                   activity; GO_function: GO:0004713 - protein-tyrosine kinase
FT                   activity; GO_function: GO:0005524 - ATP binding;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent; GO_process: GO:0006468 - protein amino acid
FT                   phosphorylation; GO_process: GO:0042829 - defense response
FT                   to pathogen"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11306"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00953"
FT                   /db_xref="GOA:Q0RUT3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUT3"
FT                   /protein_id="ABH00953.1"
FT                   /translation="MSDIEPEGTQRDLGRRGIACELAAEGFDDAQEIGRGGFGVVYRCA
FT                   QPALERTVAIKVLTTEVDRDDRDRFVREQRAMGKLSGHPNIVPVLQVGITDAGRPFIVM
FT                   PYHSRDSFDAEVRRHGPLPWPDVLAIGVKLAGALETAHRLGILHRDVKPANILITDYGE
FT                   PQLTDFGIARVGGAFQTTTGTIAGSPAFTAPEVLDGAPSTAASDVYGLGATLFCLLTGH
FT                   AAFERRAGEGVIAQFVRITTTPTPDLREPRIGPGRRSKWAARPELPSPTRSPTGQITPP
FT                   TDTNAPHLPDAGRVGRIVVSDVRSSRLMPSSVPAWRCGPRCS"
FT   gene            complement(304978..305619)
FT                   /locus_tag="RHA1_ro11307"
FT   CDS_pept        complement(304978..305619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11307"
FT                   /product="probable 3,4-dihydroxy-2-butanone-4-phosphate
FT                   synthase/ GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="bifunctional; GO_function: GO:0003935 - GTP
FT                   cyclohydrolase II activity; GO_function: GO:0008686 -
FT                   3,4-dihydroxy-2-butanone-4-phosphate synthase activity;
FT                   GO_process: GO:0009231 - riboflavin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11307"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00954"
FT                   /db_xref="GOA:Q0RUT2"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUT2"
FT                   /protein_id="ABH00954.1"
FT                   /translation="MTIELEAPPVRRSGRPAGTAAALSETVSRLALGETIVLCDGDRTM
FT                   LAYSAATATVEQTAFVIRHTSGFLQIALPAPRCDRLLLPAAPTMFAGPPGVGYRQCIGV
FT                   DAAYGVTTGISAADRTHTARTLADLRTPPGDLTRPGHLVVVAVDPGYRGRCPVPHLALR
FT                   LADFGRNGLLFADLVDSTRPHDMADRNEAFLFADAHHLSIGMGDVWATYP"
FT   gene            complement(305632..306003)
FT                   /locus_tag="RHA1_ro11308"
FT   CDS_pept        complement(305632..306003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11308"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11308"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00955"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUT1"
FT                   /protein_id="ABH00955.1"
FT                   /translation="MSDHPTITLPPSAVVHSVTISWKDGVGPDHGVRVAAALNSYAVTV
FT                   PGLLFYHAGPDLGLRENTADFGIVALFDNRDNYVTYARDAQHQAIIAELVAPNARERIS
FT                   AQAAFSGSLPLSPSTPVNT"
FT   gene            complement(306018..307112)
FT                   /gene="macA"
FT                   /locus_tag="RHA1_ro11309"
FT   CDS_pept        complement(306018..307112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="macA"
FT                   /locus_tag="RHA1_ro11309"
FT                   /product="maleylacetate reductase"
FT                   /EC_number="1.3.1.32"
FT                   /note="GO_function: GO:0005506 - iron ion binding;
FT                   GO_function: GO:0018506 - maleylacetate reductase activity;
FT                   GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11309"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00956"
FT                   /db_xref="GOA:Q0RUT0"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUT0"
FT                   /protein_id="ABH00956.1"
FT                   /translation="MLPDPFSYTALPMRVVFGRGLEPLAAEVEHLGIRRAVIISTPGPK
FT                   PVVAAVTRIVGEAVVGVLAEAVMHVPVEVVDRCVQVSGDLDADGYIAVGGGSAIGLAKA
FT                   LALRTGLPIIAVPTTYAGSEMTPVWGITDNRIKRTGRDQAVLPRAVVYDPALSTDLPVD
FT                   ISVASGMNAIAHAVEGLYAPDRSPIVSLMAREGARALAAALPRVVDDPHDLPSRGEALY
FT                   GAWLCGAVLGTTTMSLHHKLCHVLGGTFNLPHAHTHAIVLPHVLAFNAPFAADMVVALT
FT                   DVFGDGEPWTALWNLQRSLPMPTALADIGFSATEIGEVARQVTASPYANPRPVTEDDVR
FT                   VLLQRALVGHAPHPSTDMPVPSQS"
FT   gene            complement(307102..308001)
FT                   /locus_tag="RHA1_ro11310"
FT   CDS_pept        complement(307102..308001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11310"
FT                   /product="hydroxyquinol 1,2-dioxygenase"
FT                   /EC_number="1.13.11.37"
FT                   /note="GO_function: GO:0008199 - ferric iron binding;
FT                   GO_function: GO:0018576 - catechol 1,2-dioxygenase
FT                   activity; GO_function: GO:0018581 - hydroxyquinol
FT                   1,2-dioxygenase activity; GO_process: GO:0009712 - catechol
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11310"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00957"
FT                   /db_xref="GOA:Q0RUS9"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUS9"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00957.1"
FT                   /translation="MTSTHTGDVDIATLTDEVIRSFDGTPNVRTKAIVTALVRHLHNFV
FT                   REIEPSLPEWETAIEFLTAVGKKCDPVRQEFVLLSDVLGVSMLVETINDQQAPGATDST
FT                   VLGPFHMTESPARQLGDTIDEVGAPQHLLVTGTVRSTQGEPLPHATVDVWQCNEEGFYD
FT                   VQQPDLQPAGNGRGLFTTDQQGRFWFRTVTPSHYPIPTDGPVGELLHATGRHPYRPAHI
FT                   HFIAAAPQHRPLTTHIFMPGSPYLDSDAVFAVKHSLVGDMGTADAEHAAQFGVEIGSPL
FT                   ATVDLVLAPAAPGGTDAP"
FT   gene            complement(307998..308291)
FT                   /locus_tag="RHA1_ro11311"
FT   CDS_pept        complement(307998..308291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11311"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00958"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUS8"
FT                   /protein_id="ABH00958.1"
FT                   /translation="MIYEHAYVTTDADKSAEFEEAFARAKKYLLDANGGKTVELVRSVD
FT                   HPGLYLLRVGWDSVEAHTEVFASSTNGKLLGEAIGHYFVKIPHVIHFEDTTI"
FT   gene            complement(308333..308851)
FT                   /locus_tag="RHA1_ro11312"
FT   CDS_pept        complement(308333..308851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11312"
FT                   /product="probable flavin reductase like domain"
FT                   /note="GO_function: GO:0004497 - monooxygenase activity;
FT                   GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11312"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00959"
FT                   /db_xref="GOA:Q0RUS7"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUS7"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00959.1"
FT                   /translation="MNQNTSRVAPAQIDPMMFRRSMRHVPTPVAIVATTSDGNPVGLTV
FT                   GSFTSVSLEPALVTFFVDTQSTTWPRMEDSDTFAINILGHGGGERCRSFSGKGVDRFAG
FT                   VEWTPSDNGDPILAEASVVFECVKHSSRLLGDHLQVVGEVSKLHVLREELPLVYHQGTF
FT                   LNLDHLVSA"
FT   gene            complement(308854..310077)
FT                   /locus_tag="RHA1_ro11313"
FT   CDS_pept        complement(308854..310077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11313"
FT                   /product="possible indole oxygenase"
FT                   /note="GO_function: GO:0016491 - oxidoreductase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11313"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00960"
FT                   /db_xref="GOA:Q0RUS6"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUS6"
FT                   /protein_id="ABH00960.1"
FT                   /translation="MTQTLEPTSTETADVDASRPNREVIGKATALIPLIRQYADQGSAD
FT                   RRAAPEVMAALEAEGLFKLFVPRRYGGYEENLRTAMETVAEVAKGDGSTAWAVALLNVC
FT                   TWFGTTFSQQAQDDVFGANPDAKCCGIFTPGSKAERVEGGYIVSGQWPYSSGSFAADWG
FT                   TLGIALDVEEGEDPRALALIPKDAWTIKPTWFVAGMKGSGSDTIVVEDHFVPDHRIQRF
FT                   VAMREADFATPYKSTERNSNMAFIPVAALILVGAQLGLARHAMELTLEKLPNKRVAYTR
FT                   YTAAKNSPTHQLGVAAAATKFNMAELLMQQATADIDNAAARGELPDLITRGRIRNNTGI
FT                   IAELVKDGIDILMTTNGAGSFADANVLNQIWRDAEIAGRHAYVTPEVGKEVYGRLLIGA
FT                   DDALTMDV"
FT   gene            310249..311307
FT                   /locus_tag="RHA1_ro11314"
FT   CDS_pept        310249..311307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11314"
FT                   /product="possible transcriptional regulator, AraC family"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11314"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00961"
FT                   /db_xref="GOA:Q0RUS5"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUS5"
FT                   /protein_id="ABH00961.1"
FT                   /translation="MKHNETAHTGRQQRSDAEVAAIPKIGESSILCVTNDLDEFRASLN
FT                   TVFYPADIGFVGSRTRVSSAELSAVRLNYLTIGRARFGSEARVDPGDLGTYHVNVPLEG
FT                   SVVSVCGSQQMTATPQHAAVFSPNEHTILPRWDADATQICIKIDRAGLQGELAQLLGRP
FT                   IDQRIRFDLALDLTTPAGARWLSLLNLLLSTLDDPGLVPTPGLAAHVNYLERALIAGLL
FT                   VHHTHSMSAELNAPQPVRSPHAVQKVLDQFESVPGAQYTIGDLAAIAGIGARQLQKLFQ
FT                   DQFGMPPSVYLRHLRLDGVRHDLLLGDENTTVGHTAFKWGFNHLGRFANSYEDKFGESP
FT                   SHTLRAAIRKTH"
FT   gene            311597..311917
FT                   /locus_tag="RHA1_ro11315"
FT   CDS_pept        311597..311917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11315"
FT                   /product="possible transcriptional regulator, WhiB family"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11315"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00962"
FT                   /db_xref="GOA:Q0RUS4"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUS4"
FT                   /protein_id="ABH00962.1"
FT                   /translation="MAGAREMPMEQTPRSAVTLAPTLDTWSWQLRARCRSMDTEFFFPR
FT                   VGEPHGARVRRERAAKTICSMCPVQENCREHALATGEYGVWGGTSDTDRRRTRPAPVLR
FT                   KH"
FT   gene            312026..313240
FT                   /locus_tag="RHA1_ro11316"
FT   CDS_pept        312026..313240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11316"
FT                   /product="malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /note="GO_function: GO:0004473 - malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP+) activity;
FT                   GO_function: GO:0016619 - malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) activity; GO_process:
FT                   GO:0006108 - malate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11316"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00963"
FT                   /db_xref="GOA:Q0RUS3"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUS3"
FT                   /protein_id="ABH00963.1"
FT                   /translation="MAPDTAQIETLQEPLTDEEIFSAHLGGKLAVQAVVPLASRRDLSI
FT                   AYTPGVAQVSRAIAADPQLAQQYTWTNRLVVVVSDGSAVLGLGNIGARASLPVMEGKSA
FT                   LFKQFADLNSIPLVLDTTDPDEIVETLVRLRHSFGAVNLEDIAAPRCFEIEERVIAALD
FT                   CPVMHDDQHGTAIVVLAALISAARLQNRDIQSLRTVISGAGAAGVACAKMLLARGISNV
FT                   TVTDSVGIVHSLRDDLNAYKAGLAACTNPEGRTGGLAEALVGADVFIGVSSGAVAEELI
FT                   ATMAPESIVFALSNPEPEIHPDVAINHAAIVATGRSDFPNQINNVLAFPGVFQGALDVG
FT                   ATTITEGMKLAAANAIASVVLPDIGVDHIVPSPLDPTVAPAVAAAVAEAAIAEGVAAAP
FT                   LTPSR"
FT   gene            313807..314811
FT                   /locus_tag="RHA1_ro11317"
FT   CDS_pept        313807..314811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11317"
FT                   /product="possible transcriptional regulator, AraC family"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11317"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00964"
FT                   /db_xref="GOA:Q0RUS2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUS2"
FT                   /protein_id="ABH00964.1"
FT                   /translation="MTASYISRRNHSDSKPVLLHMHSGDVDEATAAVSDVFHPHELTRV
FT                   GAVARFEADLQAVTTASMVTGQVRYNSNSDLFCPSIDGYHVNIPLSGGLVSVSRGERSL
FT                   VEESNAVVYQTGSDARILTPPNSQLNMFGMKLARAAVHTAIEDLLDRPISEPIRMHGKL
FT                   DLTGADGQAWRTLVLNTYHSQLAGSMMARPLLAEPLTYAIVAGLLSLTEHQFSEDLARP
FT                   AAVTAPATIQHAIEFINSHAMLPLTPPDIAREVGVSIRALQRGFREFVHASPMEYIRNV
FT                   RMHKAHDDLVRAQPDTDTVSVIAGRWGFYHYGRFSQDYRRMFGVSPSETLRSS"
FT   gene            complement(314826..315719)
FT                   /locus_tag="RHA1_ro11318"
FT   CDS_pept        complement(314826..315719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11318"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00965"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUS1"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00965.1"
FT                   /translation="MTTIVSGPARRIACPGEVGTVFGLTSKLRSCVSHRYPPGATNCPC
FT                   SDTVSTIPLSDEFRHARSRLHRRWCCTIPVGHTTDVSERGRSGRRANCTTNHPQPTLLG
FT                   TQDGGRHRLGTTLDDRPEMQTGCLTRRQGGAADHLWVSRSAAANWFSSSAARARCAKSL
FT                   PGFCPTVIRGWWWGSPGSPAGVSACQRSTCPAVQVKKACLCSSCRSSCAPVVRYGRGWS
FT                   DRPVGFLCAIFGSVHFRHSVMIAGVRGSRTGEPQQWTLMSRSSGGRFCPSPGHGCPLRW
FT                   PGCLPWAGPGNGLVAV"
FT   gene            315759..316730
FT                   /locus_tag="RHA1_ro11319"
FT   CDS_pept        315759..316730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11319"
FT                   /product="probable oxidoreductase"
FT                   /note="GO_function: GO:0004497 - monooxygenase activity;
FT                   GO_function: GO:0005489 - electron transporter activity;
FT                   GO_function: GO:0005506 - iron ion binding; GO_process:
FT                   GO:0006118 - electron transport; GO_process: GO:0006810 -
FT                   transport; GO_process: GO:0019439 - aromatic compound
FT                   catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11319"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00966"
FT                   /db_xref="GOA:Q0RUS0"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUS0"
FT                   /protein_id="ABH00966.1"
FT                   /translation="MSTDVSDSATVLNLIVDEVRRECDDVLTLSLIDSAGQDLPTWEAG
FT                   AHIDLHLPGNLARQYSLHSDPGDRARYEVAILRDPNSRGGSQYIHEEVRKGAMLPTSTP
FT                   RNNFPLQPADEYLFVAGGIGITPMLPMMQAAAEMNRPARLIYAGRSRTTMAFVEQLAEQ
FT                   ENVQLCVSDEGTRAHVADLLGPHLGPDVHIYSCGPERLLEAVTARAAEVGLSKQLHVER
FT                   FSGTAVDLDPDVEKSFDVELSRSGRILTVAPDQTILDAVLACGIKVANSCAEGVCGSCE
FT                   TTVLEGEVDHRDQILDEDEQAENDVMMICCSRSRTPRLILDL"
FT   gene            316809..318128
FT                   /locus_tag="RHA1_ro11320"
FT   CDS_pept        316809..318128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11320"
FT                   /product="cytochrome P450 CYP116"
FT                   /EC_number="1.14.-.-"
FT                   /note="GO_function: GO:0004497 - monooxygenase activity;
FT                   GO_function: GO:0005489 - electron transporter activity;
FT                   GO_function: GO:0005506 - iron ion binding; GO_process:
FT                   GO:0006118 - electron transport; GO_process: GO:0006810 -
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11320"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00967"
FT                   /db_xref="GOA:Q0RUR9"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUR9"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00967.1"
FT                   /translation="MTETSAEPHRSQGAGKCPVSHIAAEFNPFADDYLQDPYAVFTRAR
FT                   AEEPVFFSPSLGYWVVSRHEDVRQVFQDPAFSASISITPLKELCPAAVDELVKAEMVMG
FT                   PSLVNEDPPLHTKRRRLIQKAMISPARIEAVTPRIRALTTSYIDGFVRRGHADLVADFA
FT                   WEIPALVAFALMGVPDEDVERAKEFAGRLALFTWGYPSEEEQRKLAAGMGQYWIYAKEH
FT                   VKRRLEDPTDDYISNLIAAWRKPGNEDLFDENYLVTTMMNFLFAGHETTTNATANGLRA
FT                   LLEHRDQWAALCADPSLVPGAVEEILRFSSSVVAWRREATEDTHIGDVPIPAQAKVLVL
FT                   TGSANHDEEVFPEPERFDITRTNADEHLAFGFGRHLCLGAPLARIEMGIFLEELTRRLP
FT                   HMQLAEGQTFTYSPNTSFRGPDHLFVGWDPSQNPVPEDRP"
FT   gene            318728..319033
FT                   /locus_tag="RHA1_ro11321"
FT   CDS_pept        318728..319033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11321"
FT                   /product="possible ethyl tert-butyl ether degradation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11321"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00968"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUR8"
FT                   /protein_id="ABH00968.1"
FT                   /translation="MYTLMVLYGQPTDPEAFRTYYEDNHLPLARKLPGVRAIRHTVDIA
FT                   AADGASPFVAIFEADFDSAEDMGAALASPEGAAAQADVPNFATGGVQILHFEPNVT"
FT   gene            319352..320401
FT                   /locus_tag="RHA1_ro11322"
FT   CDS_pept        319352..320401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11322"
FT                   /product="conserved hypothetical protein"
FT                   /note="homologs found only in other rhodococci"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11322"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00969"
FT                   /db_xref="GOA:Q0RUR7"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUR7"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00969.1"
FT                   /translation="MPARRTAILAVVATIGAVLVIFPLVTGMLSKTQGVENLTGNLRSS
FT                   FEPAALTQTRADMDTVQAMSDQLQGQTLRALPSALGMSPEQFQDFMGQNFPDVASGIGQ
FT                   LNTILPKFEGLVGGLEAQASNFRSADQVPTNFLPSTVVPYLFLIPGAVLLVLAAGALVL
FT                   GREKPERGVSRAALLVSIVVGLVFIIAPLALSVPAKAKAVDDLTAAFGPVFTDQGAAEV
FT                   RSDFTVIEKMSTQLEADTVPALAGALKMDPAQFQAFMTENFPDVATGMAQLSEILPRFQ
FT                   ALVAGIEGNVDNFQQAASIPTGGQDTTMLIWWFLVPGVALIALGALGVTAGAGSRPRPA
FT                   PRERTLERV"
FT   gene            320628..321041
FT                   /locus_tag="RHA1_ro11323"
FT   CDS_pept        320628..321041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11323"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11323"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00970"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUR6"
FT                   /protein_id="ABH00970.1"
FT                   /translation="MTDALKFFSQEWCDAAHVAVNANPAVYQGFKDPATFTNRMEFGVT
FT                   GRDDLVCHLAWDRGTVVSWTPRKYDDHDLWIKVTGSLETWQQAAAGQAEGGTLLMAGQI
FT                   KFTKGPMSSAIENAGALNNFLLTWGQVPTEWAV"
FT   gene            321125..321574
FT                   /locus_tag="RHA1_ro11324"
FT   CDS_pept        321125..321574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11324"
FT                   /product="conserved hypothetical protein"
FT                   /note="homologs found only in other rhodococci"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11324"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00971"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUR5"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00971.1"
FT                   /translation="MTTVESGSYEITLYDDDANGVANILATLLEQNIQIHPDRIDIARH
FT                   ITRPVAVFSTDTDASATIIFRSDHAVICNDIVNKPAVVVWATVGQILDVSQLKMNAGGL
FT                   LPVGFFTRRGLTVLSNIVTGRLVVKGLLTHPATALRMIAMLSVAS"
FT   gene            321849..322085
FT                   /locus_tag="RHA1_ro11325"
FT   CDS_pept        321849..322085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11325"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00972"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUR4"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00972.1"
FT                   /translation="MDSYDQALLDFALQWSAYGGGDYCIFTEFGIPPVTFYERVLGMVE
FT                   KRFASGLDLPTKQHLQDHCLAKLSILQISMPTA"
FT   gene            322219..322914
FT                   /locus_tag="RHA1_ro11326"
FT   CDS_pept        322219..322914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11326"
FT                   /product="chlorite dismutase"
FT                   /note="GO_function: GO:0004325 - ferrochelatase activity;
FT                   GO_process: GO:0006783 - heme biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11326"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00973"
FT                   /db_xref="InterPro:IPR010644"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUR3"
FT                   /experiment="microarray"
FT                   /protein_id="ABH00973.1"
FT                   /translation="MARLDFDALNSEIRYLMFSVFQVEPGVLGDDREAVIKEARIFFEG
FT                   QADNGVVVRGLYDVAGLRADADFMIWTHSASIEALQATYADFRRTTALGRASKPVWSNV
FT                   ACHRPAEFNKSHIPAFLAGEDPGNYICVYPFVRSYEWYLLPDEERRKMLADHGMAARTY
FT                   KDVRANTVPSFALGDYEWILAFEAPELYRIVDLMRDLRATEARLHVREEVPFFTGPWVD
FT                   VEKLITALP"
FT   gene            complement(322981..324660)
FT                   /gene="pgi3"
FT                   /locus_tag="RHA1_ro11327"
FT   CDS_pept        complement(322981..324660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi3"
FT                   /locus_tag="RHA1_ro11327"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="GO_function: GO:0004347 - glucose-6-phosphate
FT                   isomerase activity; GO_process: GO:0006094 -
FT                   gluconeogenesis; GO_process: GO:0006096 - glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11327"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00974"
FT                   /db_xref="GOA:Q0RUR2"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0RUR2"
FT                   /protein_id="ABH00974.1"
FT                   /translation="MTAQHSDITATSAWQKLHAHRDETSALTIRELFAADTERGRELTL
FT                   TAGELYIDYSKQRVSRHTLALLVELARAAGVEERRDAMFRGERINTSEDRAVLHTALRL
FT                   PAHASLRVDGHDVVADVHRVLARMGVFSDRLRSGEWRGATGRPIMTVVNIGIGGSDLGP
FT                   HMVYRALRHYADSGISVRFISNVDPSDLVATLADLDPSTTLFIVASKTFSTLETLTNAA
FT                   NARRWVTSALGEQAVARHFVAVSTNAERVAAFGIDTENMFGFWDWVGGRYSVGSAVGLA
FT                   VMVAIGKDSFEEFLDGFHTIDRHFADTPLEDNAPAILALLGVWYSNFFGAETRAILPYS
FT                   NDLGRFPAYLQQLAMESNGKSVRADGSPIGTTTGAVFWGEPGSNGQHAFYQLLHQGTRL
FT                   VPADFIGFAEPTHDLPAADGAGSMHNILMSNLFAQSRVLAFGKTPEELTREDTAPDLIA
FT                   HKTMPGNQPSTTILAPRLTPSVLGQLIALYEHQVFVEGIIYGIGSFDQWGVELGKTQAL
FT                   ELEPALSSGNGSLPSDLDSSTASMIRWYHGVRAHGTATVGRP"
FT   gene            complement(324664..325563)
FT                   /gene="gnd5"
FT                   /locus_tag="RHA1_ro11328"
FT   CDS_pept        complement(324664..325563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd5"
FT                   /locus_tag="RHA1_ro11328"
FT                   /product="phosphogluconate dehydrogenase (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /note="GO_function: GO:0004616 - phosphogluconate
FT                   dehydrogenase (decarboxylating) activity; GO_function:
FT                   GO:0008442 - 3-hydroxyisobutyrate dehydrogenase activity;
FT                   GO_function: GO:0050661 - NADP binding; GO_process:
FT                   GO:0006573 - valine metabolism; GO_process: GO:0009051 -
FT                   pentose-phosphate shunt, oxidative branch; GO_process:
FT                   GO:0019521 - D-gluconate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11328"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00975"
FT                   /db_xref="GOA:Q0RUR1"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUR1"
FT                   /protein_id="ABH00975.1"
FT                   /translation="MQLGFVGLGRMGSNMQARLRQRGHDAIGFDPNSNTSDVPSLETLV
FT                   SSLSAPRVVWVMVPAGDATRNVIGQLSRILEPGDLVVDGGNSRFSDDRVNADVLAERGI
FT                   GYIDCGVSGGVWGRERGYALMAGGDARDIERLMPVFDALRPLGDRRDSFVHAGPTGAGH
FT                   YAKMVHNGIEYGLMQAYAEGYELLAAEDSIVDVPAVMRAWSEGTVVRSWLLDLLVEALT
FT                   DDPALATISGYTEDSGEGRWTVEEAIAHAVPVPVISAALFARFASRQDDSPAMKAVSAL
FT                   RKQFGGHAVRLAEPAAIG"
FT   gene            complement(325750..326379)
FT                   /locus_tag="RHA1_ro11329"
FT   CDS_pept        complement(325750..326379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11329"
FT                   /product="3-hexulose-6-phosphate synthase"
FT                   /note="GO_function: GO:0004590 - orotidine-5'-phosphate
FT                   decarboxylase activity; GO_function: GO:0004750 -
FT                   ribulose-phosphate 3-epimerase activity; GO_function:
FT                   GO:0004789 - thiamin-phosphate diphosphorylase activity;
FT                   GO_function: GO:0004807 - triose-phosphate isomerase
FT                   activity; GO_function: GO:0005529 - sugar binding;
FT                   GO_function: GO:0016832 - aldehyde-lyase activity;
FT                   GO_process: GO:0005975 - carbohydrate metabolism;
FT                   GO_process: GO:0006207 - 'de novo' pyrimidine base
FT                   biosynthesis; GO_process: GO:0009228 - thiamin
FT                   biosynthesis; GO_process: GO:0019647 - formaldehyde
FT                   assimilation via ribulose monophosphate cycle"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11329"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00976"
FT                   /db_xref="GOA:Q0RUR0"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUR0"
FT                   /protein_id="ABH00976.1"
FT                   /translation="MTKLQVAVDLLTTADALALTNKVAPYVDIIELGTPLIKSAGLSAI
FT                   SAIKAAHPDKEVFADLKTADAGFLEADLAFSAGADLVTVLGAAGDATIKGAVEAGKKHG
FT                   KKVVADLIGVQNRVERAREIAKLGVAFVEIHAGLDEQAQPGYSIQTLLDDGKIAGVPFS
FT                   VAGGVKVDTIAAVRDAGADVAVAGGAIYSAEDPAVAAKALKDALTK"
FT   gene            complement(326429..327010)
FT                   /locus_tag="RHA1_ro11330"
FT   CDS_pept        complement(326429..327010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11330"
FT                   /product="possible 6-phospho-3-hexuloisomerase"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_function: GO:0005529 - sugar binding;
FT                   GO_function: GO:0016853 - isomerase activity; GO_process:
FT                   GO:0005975 - carbohydrate metabolism; GO_process:
FT                   GO:0006355 - regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11330"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00977"
FT                   /db_xref="GOA:Q0RUQ9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR017552"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUQ9"
FT                   /protein_id="ABH00977.1"
FT                   /translation="MTVTVEQTRTRFSDGRRIVLDENERLLNSVAAEQWDRAGSLITSA
FT                   RAVFVIGNGRSGLAVQMAAMRLMHLGLRVHVAGEVTAPAIGDGDLLIAVSGSGTTASVV
FT                   GAADTANKVGASVLAVTTAPDSPLARRADEVLILPAADKQDHSAAITAQYAGSLFEQSV
FT                   LLAFDALFQALWHNVDQTAERLWERHANIG"
FT   gene            327158..328441
FT                   /locus_tag="RHA1_ro11331"
FT   CDS_pept        327158..328441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11331"
FT                   /product="probable transcriptional regulator, LuxR family"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0000156 - two-component response regulator
FT                   activity; GO_function: GO:0003700 - transcription factor
FT                   activity; GO_function: GO:0005524 - ATP binding;
FT                   GO_process: GO:0000160 - two-component signal transduction
FT                   system (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11331"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00978"
FT                   /db_xref="GOA:Q0RUQ8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUQ8"
FT                   /protein_id="ABH00978.1"
FT                   /translation="MEDSARLQVDPWVEMRKVITGPLPDIATRFSRFLGRWWPHDALVI
FT                   FTRECTGRPRKVAGNREIVDRVTIDELDEIKQSIEPGGVVAGIRSLGGGRRRVWAVRDS
FT                   GDTLLVLVPRPSQAGPPEPDGVAAMFGIVATSIQQQVAQASPDYLAESRAASSERARTI
FT                   AELTEVHEATLSSILGTLRSNDLDDRRSRITASETASAALIALRSAGAADRALSEEAVT
FT                   TAFARLQGELRPMLRHREVDVDYVDPPADGRPLPGEVAHAARAMVRAIVLAFGAQPVLS
FT                   RLRIAWDCDGDNVLIEVRDQGPGTIDRNALTRQLSGRLHTLRGHIDVESIDGWGSRVSL
FT                   TIPLDPPAARPGEQLLSTLNPRELEVLAHLAVGKRNKAIATELGISESTIKFHVASVLK
FT                   KLDVANRGEAGAIGIQAGIMAHETPRPA"
FT   gene            complement(328588..330135)
FT                   /gene="zwf5"
FT                   /locus_tag="RHA1_ro11332"
FT   CDS_pept        complement(328588..330135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf5"
FT                   /locus_tag="RHA1_ro11332"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="GO_function: GO:0004345 - glucose-6-phosphate
FT                   1-dehydrogenase activity; GO_process: GO:0006006 - glucose
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11332"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00979"
FT                   /db_xref="GOA:Q0RUQ7"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUQ7"
FT                   /protein_id="ABH00979.1"
FT                   /translation="MSMPQVTDPVTINPVGGQTVIPDAVSPAAGFVPSSSMVIFGITGD
FT                   LSRKKLLPAIYDLANRGLLPPSFSLVGFGRHEPDRVIETIQAAMIAGARTSFRIDTWNQ
FT                   LARNFRYVRGSFDDRSAFEILKQELAQLDMLHSAVGHSFYMSISPAHFSLVCAQLNAVG
FT                   LSQHHRGWRRIVLEKPFGNDLASSRALGATVDEVFGAGSVFRVDHYLGKETVQNILALR
FT                   FANGLFEPLWNHRHIDNVQITMAEDIGVEGRAGYYDGVGAARDVIQNHLLQLLALIAME
FT                   EPVGVDAASLSAEKVKVLSATSAVGPWTETTARGQYAATIRGETYLPGLLEEDGFNPCS
FT                   TTETYAAITAQIANRRWAGVPFYLRAGKRLTKRTTEVAVTFAAPHHLTGSAEAGPPPQN
FT                   VLVVRVQPDDGISLRIGAKTPGDGMRIQDVDLSMSFADSFGGSSPEAYERLILDVLRGD
FT                   ASLFPSQAEVDASWAIIDPVITFWAEHGRPDEYRSGSAGPSSAESIVGRTGRVWRPL"
FT   gene            330274..330774
FT                   /locus_tag="RHA1_ro11333"
FT   CDS_pept        330274..330774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11333"
FT                   /product="possible phosphate transport system protein PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11333"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00980"
FT                   /db_xref="GOA:Q0RUQ6"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUQ6"
FT                   /protein_id="ABH00980.1"
FT                   /translation="MTSRFGVLHASSATGARSSPCAPAITAASPSPALAGRLRRNSSSK
FT                   VSITASTGVPGGADLGFALTRVCSRGLSQMGRVAAELAGLAERVLRTHDPELAAEIGRR
FT                   DDELDDLHRRLLTLIEDPAWAGSVPVAVDVTLLGRFYERFGDHAVTVGRRVIFLVTGEQ
FT                   MTP"
FT   gene            complement(331041..331655)
FT                   /locus_tag="RHA1_ro11334"
FT   CDS_pept        complement(331041..331655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro11334"
FT                   /product="probable ATP-dependent Clp protease ATP-binding
FT                   subunit"
FT                   /EC_number="3.4.21.92"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0004518 - nuclease activity; GO_function: GO:0005524 -
FT                   ATP binding; GO_function: GO:0008233 - peptidase activity;
FT                   GO_function: GO:0017111 - nucleoside-triphosphatase
FT                   activity; GO_function: GO:0051082 - unfolded protein
FT                   binding; GO_process: GO:0006289 - nucleotide-excision
FT                   repair; GO_process: GO:0006457 - protein folding;
FT                   GO_process: GO:0006986 - response to unfolded protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro11334"
FT                   /db_xref="EnsemblGenomes-Tr:ABH00981"
FT                   /db_xref="GOA:Q0RUQ5"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:Q0RUQ5"
FT                   /protein_id="ABH00981.1"
FT                   /translation="MVFERFSDQARQVVVLAAAAARTHHQNSVGTEHLLIGIFDAGGPG
FT                   AAALTAWGVTAPALESKLAGDTAPAGSAPAAGHIPFTPKTKKALEASLRQTALLGHEEI
FT                   GTDHLLLALLDDPASTGAHILTDRAPLPISEMREHHQPRTGPATHPRPRPPHPHPAQRR
FT                   RIHPRPRHRPHRRPEPRNLRSTTASPTPSTPNNPNSRFSRG"
XX
SQ   Sequence 332361 BP; 58520 A; 109462 C; 106279 G; 58100 T; 0 other;
     ccgcggcgct gcccccggcg ctccgcgccg tgagacgggg cgagtcgctt cgctcccccg        60
     ccagggagcc gctgcgcggc tcgcagtggg tcgattcccg ttgccgtcga tcgagtcgct       120
     tcgctcctct gagtttcgga gattaggttc tcacctgtgc ttttagtcgt cccgttcgat       180
     ccggtccccc acaccccaac gaggctgggg aggcgagtgg gtgcgcccga cccgcctccc       240
     actcgccttc ccgcgccgct ccattgccat acccacagca tgccacccca cccccacgca       300
     actcaaaaca gtcgaaaatc tccaaacatc caaacctgtt gattaataac agattctgaa       360
     ccttacaacc tgacgtttgt acataacacg cgtaaatact gactcatcaa ccgattaccg       420
     aaacatgttg tcaatcaata actttcgaaa ccggctcaaa caggacgaac agacacccgt       480
     gcgcccgccg acaccccggc gccggcactc ccccgaacca ggtcgccggc gcccccacat       540
     cacaaaccgg ggacatgtca tcacaccagg tcacagtggg attacgcccc cgcacagcac       600
     acggcccgca ccccggggat cgggtgcggg ccgtgcacgg agagaggcga actaggctgc       660
     cgggtccagc cagggccgcc cgtcacggcc ctccacatag accccgccgg gcggaccatc       720
     gaacagcgtg agcagcaact cacgcgccgc aggagaggca ccggcgagca tctcgtcccg       780
     gtgctcggtc cagtcctccc agtcccagcc cgcaccggca tcgatgcagc tctcggcaac       840
     ctccacagcc tcaccgccca caaataccca cacgctggtc ggcccatcag gatcgcggac       900
     gatcacgacc tccaccgtca cgactgcgcc gccctcgtca ccatgtaacc gagcgactcc       960
     gccaacaggt gcaacagatc atccgccgac ggcaaggcgg cccggtccat ccgatcccga      1020
     atcgcgttgc actcgacctt gtcctcgcac acgcactcac tgttgcgggc accgtcctcg      1080
     aggccggagt ccagcccgca gccgtccacc gtcaccgggt cgagcaccca ccgatcgatg      1140
     ccgtcccagt cgcgcatcag gtacacccag atcgattcct cgatgtagtg ggtgccgcga      1200
     ttgagggcgc gctcgccctg acacatgtag acctcggcag gggtggcgat attcgtgttc      1260
     gtcgtcgttg tcatcgtggg gttgccttcc tcagtcagtg gttcacggtg ggcgcgaaca      1320
     ccgcaccggt cagcagggca tccttctggg cgtcagacag acccaccgtg gctccgttgc      1380
     cgtcgtgggc cgcgaatacc acggccccgc agaacggctg ccagatcgcc ccgtgagcgc      1440
     gcgcaatcgc cgtcgccatc agattgacct gagcatcggc ctggattgcg ccttcgtcgt      1500
     cgacccacat gtccagatcc ggcgtcagcc gcaccacgtc gaaccagcgg cacccgatcg      1560
     cggaccggat cgccgccccg gtgctctccc gcgccccgag gtcgatcacc tccaggcgcc      1620
     cgtccacacc gatccgaacc gcctgcgcgg tcaacgtgct ggcagcggtg ctcatgcctg      1680
     cacctccgtc accgtgtact cccgcaggtc cagaccgtga cggcggaacc caccgatccg      1740
     gcgacccagc gcccgcgcca gcacctcccc gtccacctcg tcctccgcga cctcctcgga      1800
     ccgggccgac accggcaccg acaccttcgt ggtgatcgtc accagggcct cgaccgtgaa      1860
     ctcccgactg cgcggcggca gcccgtgctc ctccatgaac tgatcgaact cactgcacaa      1920
     gttgttctcg tcggcccact ggtgggcaga ggtcgcgacc gcgtcgatcc acttcatgtg      1980
     atcggcatgc gccccttcga ggcgctcccg cagcgtcgcc acctcccggc gcgagatcat      2040
     caccgcagcc agcgaacccg ccacccgatc ccagaacacc ggcaccgggc gctgcaccga      2100
     cgcgaccacc acctgatccg gatggacccg gccctgccac accggcgcat ccggcgagag      2160
     cggcaccaac gccaccgaca ccagacgctt gtcctcggcg acaccgttca ccgacaacgc      2220
     cgacacgtcg atgcggtccg cgaccagcca gccagccgtc cacgcctcac cctcacgcac      2280
     ctcgacgaac accccatccg ccgggaacac cccaccggca ggggcggcta cacccgcccc      2340
     gctcgtcacg ttctcgataa ctgcaacgtc cacagacatc acaactccaa acccccggac      2400
     aacaccccgg gctcaccgga gcggaagggt ggtcagcccc ctccgccccg catcaattgg      2460
     gacaccgaaa acatagccca ccccaccgac acaaacaacc cgaaacacgc tgcacaacaa      2520
     acgaattcga gccgcaaacc gctcataaaa gcaccccgga atcaagcccc cgaacacgaa      2580
     aaacgccacc cacccatccc gtgccggggc acgggatggg tgggtcagcc aaacgaacga      2640
     aacacgggca tgtgcgccga tgagtgcaca gttgtcatgg tcatctgcca ggatctggcg      2700
     atgacgtccc ctcagctcgg agaccttccc ctgtttgttg atcgaatcgg gcgcatcacg      2760
     gcgcgagcac aacgcgccag cgagctacac gactggggac tgcatcccca ggctgccgat      2820
     accggcagca gtcttgcact agacgatgac ggcttcatcc cagcgcgggg cggcagcctc      2880
     gtccaacggg ccgccatgtg gccaatcaac tgtgcaaccg acaacgtttc cagtgccggt      2940
     cgaatcttca ccgactcggc gacgtccaat cagcttcgcg cttcctccat catgtcgctg      3000
     tgccgttcag cgctcgaatc gtccgcacgg gcaatctggc taatcagtga taccgaccgg      3060
     gccatacgcc gccaacggag catcgggatc actctcgccg agatgaagca acagacactg      3120
     ttcaacaaca acgaagtcga gcaccaccac aacggcaccg tgaatctccc ggccgattac      3180
     gccagcgcgt tcctcgacgg gcacaggtcc ctgctcaacg attacgccgc ccttcaggaa      3240
     gaagaccacc agcccgtgcg cccatttggg aagacggtcg agctagctgc cacgtggatc      3300
     gatgagcaca tgcccgccca cgactccgga gagcttgcga agaacggcat ggcagccgga      3360
     tcgaagcgcg tctacagcat cagctctggc gtgatccatg gctatcagtg gatcgtggac      3420
     tacggacgta acggtgatct gttcgccatg atcgccgaca gcttcgctgc agccgtcaat      3480
     atgactgagt gcgcgatcgc gctgtacgaa gcgcaagcgc agcgcccaac gggcaggacc      3540
     gaccggaagt accactaccc caagaggctc gcaccgacag tcagggagtg gtccaagctc      3600
     tatcgataac gccgccgcgc cgccgaccgc cactggacgt gcggcgaccg ttcactcgac      3660
     gacagttcga cgagacacct ttcctcgcac agttcgctgg caaacccggt cgttcattcg      3720
     aggtaggtgg cggagcagca cagtaggtgc gggttctatc gtttggccgt gcagcaagaa      3780
     atagtcgccg acgagaccgc agacgtagag ccgcgggacg aagctagaac aagtgccgaa      3840
     aagatccggg atcttcgcgg tgaattggcg cgatcggcgc gaaacaggta ccaaacaact      3900
     ggtcgatgga ttaaacgtcg tagggcaatc ctgacaggat caatcacact catggtgctc      3960
     gttgcagtgt gttttcatcc tcaagcacag cttggcacgg tacccacttg gatctcggcg      4020
     ttcggtgcag tggcaacgtg cgttggcgtg ttacttgcgt tgaagaccta tcggacgcag      4080
     aagcagcaag gtctcgaaga acaagctaac caggcccgat tgatcaacgc ggtcttgatg      4140
     cctggaactc aacgagatgg aaagttcacg tggtgggtga ccatcgaaaa tcgaagtgac      4200
     aaatccatct acggagtcca cgttcgttcc ttgagagcgc aagtcgccga agagggaccc      4260
     gcggttaggt tgagcccgat ggcgataacc aagattgggg aactggagtt ggtgacgggc      4320
     gccataccca tggagcggga gctgaaggct gggacaagtt tcaggactca atggagagcg      4380
     atcgacgacg gcgacaacac ttcgcacgta gacggaccaa ttattcagta cacactcacc      4440
     gatgccaacg gccgggtttg gctgatcgcc gacaacaacg agcccgagaa gattgcgagg      4500
     ccggccaggc cctcggacca acgccgccgc gttgtgtaaa agtcattctc gtcgccggtc      4560
     gccgtttcga cgcgggtcac ggtgcaggta agaagacaag agttcggcgg gccgggtgca      4620
     tgtacggcgg ccgaagcccc atctgaccgt cgccgcccgt tcgcatctca ccgtggtcgc      4680
     gcaggcaggc ggctggcgcg gtacggccga gaccgccgtc cgggtgcagg tgcgcgaact      4740
     cccacaggtc ggcggcaggg tgttcggcga cctcccacga caggacgtgc ccgttgccgg      4800
     caccgcgttt cttccctatc gagacgatgg gcccgagcag ctcggcgacc gcgaccgggt      4860
     cgccgacccc gcgccacacc aggtgccggc agaccgtcag cgggagcggc atgacgcggg      4920
     agcggtagcg gccctggcgt tcggatacca acgctggcag gtcagcggcc atgtggtcca      4980
     gggcctgttg gtcggggcgg gcggaccagt actgcacgtg cggtccgggt acctcgtcct      5040
     ccgggtaggc gaaggtcgcc gcccagtgcc acccgccggc gccgtcgccg gtgcagcggg      5100
     ccaacggcag gtccaggtcc tccgggaccg tatcgaggct gtagggggtg tagtcggtgc      5160
     cggccgcccg ggcggcggcc ttggtgttct cccggatctc cgaggcgagg agcccgtcga      5220
     ggctgatccc ccacggcacc gcgtgcgcga cacccgcggc cattctcgcc cggacggtca      5280
     gcggcaccat ccccgcgccg atctggaggg tcatgccggg agtgagagca gggtttccag      5340
     ggcctcagtg cggcgtgcgg cgacgatctc ccgccaatcg accaccggcg caccataagg      5400
     gtctgaggcg agcatggtgg cgatctggcc gtgcccgatc ccggtgcgac cgcccagcca      5460
     gcccgatcgg gtgaactcgg ccaggacgtc ggcggtgaag gcctgatcga ggtcggagcc      5520
     gcggaccagt tgcacccacg attcgaaccg cgtgccaggg gcgagagttt cgatgtcgta      5580
     gcgcatcacc ggcgatcccg acccaccacc ctcggcggcg gggtcgacgg tggtgccggc      5640
     gtggccggtg gtcacgtcgt cgaggtgtga gtacgactcg agggcctcga tgtcgaaccg      5700
     ggacgggatc ggcccctcgt aggtacggcg caggatcggc gtggcttcgg tgacgatcgg      5760
     gaccacgtgc cccacgcgca ggcagccgtc gatcggggcg gccccgatgg cgccgccgaa      5820
     cacgctcagc tgcgggatca gctcccggag ttggtgcagg cgtcggccgg tgatcggttc      5880
     cgcctgggtt ttcacgatcg cgccgccgtt acggagggtg tgcgcgaccg ccaagggcaa      5940
     cttgccctcg tagccgagga catcgcgcag cagttcctcg ccgatccggc gcagcacccc      6000
     gcggaaggag ttgccggaga tgaccgggac cagctccacc gacccgtccg gctgcaggat      6060
     tttcatgcgc cggccgatcg cggtggtgcc gatcagctcc ccgcggtgcg agatcggcga      6120
     ccgggcggtc atctcgatct cccacacccg cgacacggtc acgacgccaa cccgtgctcg      6180
     gtgcgggcgg cgcggaccgc gtcggccacg atccgggtcc gcagcgtcag cgcggtcgtc      6240
     tgatcgcgca tcacctgcag caccggccgc ggctcgcaca tgagcaggat cgccagctcg      6300
     ccgcgttgct cgtcggtgcg cgggctcgat ccgagccggg ccgcggaggt ggtccaccac      6360
     tggtgcaggt tgatgctgtt gtaggtcgcc aaccggatcc gagtgggcag caggttgtcc      6420
     cagtagtccc cgcggcgcgc agccacccag ttgcgctccg accagtcgat tccgtagtgc      6480
     agcaacagca ccaaccgctc cgccacctgc gcggccgggt cggtcagccc gggtagttgt      6540
     ggaaccgcgg ccagccagcg gtcggtcact gaaagttcgt tctcccccaa catattcatc      6600
     accgcagatc ctagagaact cgtggtgttt tctcgagtcc actgggcgcc ggtggccggg      6660
     ggctgcgacg tcccggccac cgcggcagtg tgactttgtg cgaggtccgc gggagatgtc      6720
     cctactgcat ccagatgaag gcggacaggg tgagcgtgtg catcccgata ccgatcagga      6780
     acaccaagta ctgggcccag tacgcgtccc ggagctcgtg ctcgttgata ctgcgtcgcg      6840
     ctgctgagcc gacggggagc gcgtagaagc gggcgagcgc gcggctgcac cggtgttcct      6900
     gaacgtagag ggcgaccgaa gcggcgccga gggcggtgga cataacgagt tcgaacatgg      6960
     gaactcctct gggccggggt gatgccgggt tgcatcgccc atacctcagt ggagaggttc      7020
     tccaccccca ggcgcgggca gacgcgtgtg atgccctgag ctgccgaaat aggacgtcgg      7080
     ggtggcggtt tacgcccgtc gggtggcccg caggccgacc tcccaccacg ggtccgcacg      7140
     acgccatgga gtcagtcggg tccagtcgtc gaaaacctgc ggccactcgt cggcggggag      7200
     gcggcacagt accgcgtagg gcggggcatc gtcaccaagc atggtctcgg tgaacccgtg      7260
     gccgcggagc cggcacatca cctcgaggcg ggcggcgtcg tcggcctgcc actttaggtg      7320
     gacgtcctcc acggtgacca tgccccaccg tgcgtccggg agcaggtgct tgcggccggg      7380
     ccgcagcggc acgatcaccg ccgtatccgg gtcaatcgtg gtggagagga cctggtgtag      7440
     cagtgtgggg tccgccgatc gcagcgtcac cggatctcgg gtgacgatgt gggcctcggt      7500
     gcgcagcggc cggtgccgat agacccagac gcacacttcg cacaggcggc ggccggccag      7560
     gttcgtccac gactcgtacc cggtgaaccg ccgtgatacg acctgcccga ccgggctcat      7620
     caccgcggtg atctggccgc agcgcgcgca ccccgcctcc cgggtttcgg gtgcgccggc      7680
     cacgttcggg gtcccgacgg cggcggtgta cgcggcccac accacatcga cgggggcggc      7740
     aatggtcatg ggcggcaccg taacctgccc actgtggtga acgcaccgga ccccggcctg      7800
     gacctggcga tgctccgcgg cctgcgggca ccgtcggcga aggccgaccc gggcgcggtc      7860
     gccgacatcc tgacccggat cgaggcgcac ctcgccgccc atgacgggta cgtcgcgttc      7920
     tccggtggca aggactccct gatcgtcctc gacctggccc gccgcatcga acccgatgtg      7980
     ccggtggtgt tcttcgactc cggcctcgac taccccgaaa cctacgacta cctcaccgaa      8040
     ctcacccaca cctggcgact ggaccttcac cgcatcccca ccgacccacc actactgcag      8100
     gtcctcgccg actccggcca ctgggaccac tccgcccctg tcggcacgcc cctcgatctg      8160
     catgaggtgc tgatcaccga acccgcccgc cgtgcccacc agctcctcgg ccccggcgag      8220
     ctgtggggtg tgcgggccga cgaatccgcc gcccgccggc acctctacac ccgaggtggc      8280
     cgccgcgacg gcatcgtcac ccgcgccgac ggcaccaccg cgtacgggcc gatctggaac      8340
     tggaccatca tcgacgtctg ggcacacatc gcgagacacc agctaccgat caatcccgtc      8400
     tacgccaaac tccgtgaact gggtgtcccc gaacagcagc accgcctctc ccacctcatc      8460
     gacggcagcc acctcgaccg cggccgtctc acctggctac gccgcggatg gcccactctc      8520
     tgcgagcaac tcaccgacgt ccttccccgc atccgtcaac tgacgtgacg ctctaatgtc      8580
     atcgtggcac gagcatgggc ggcgcgctat ggcgtatcga cgctggtcag ggaggacacg      8640
     tcgaatccgg tgggccaccg tgtcgcgtcg tcgtgcttga ttccggtcag ttgaactgcg      8700
     ccgagatccg tgtggcgaag atccgcgccg gaaaggtctg cggcggaaag gtctgccgcc      8760
     ccgatgtagg cgtatctcag gtcggcatcg gacaggttcg ccccggagaa gttggccggc      8820
     ccgatcacgg cgtacttcag gtctgctttg gtcaaattcg ctccgtcgaa cttggcgtag      8880
     gaacgatcgc tgtcagcgca cattacggcg ccaaccagct ttgcccgcac cagtcttgcg      8940
     ttcgacagtt ctgcggtgtg caggtccgcc tgcgtcatgt ccgcgtcggt gaggtcagct      9000
     tcccgcaggc gcgcgtggct gaggacgcag cctgacagct gagcgcccca catgttcgct      9060
     tccgtcaggt cgacaccttc gaacattggg ccgagataca cggtgtcctt gcggggcggt      9120
     cgtggagggg cattcttcga gctcatggaa tctttgagct gttccccgaa actatcgctc      9180
     aaccgcacgt caacgcccaa cactgaccgg gccaggtcag cccgtacgag cgagacaccc      9240
     atcaaggtca tgtggaccag gtaggcgtca ctcaagtccg cccccttcat atccgtcgcg      9300
     gtcaggtcga accgatagcg gcgccagctc gggcggcccg aatctccgga acgcagccga      9360
     gaatggatcg ccgcgacaat tgccgttcgc acatcgtgtt cgcggaggtc ggaaggttcg      9420
     tgctccgcac gtagataggc gcacagtagg tctatacaga cttgcgtttc gccgtgccgg      9480
     cctgccgact tccagtcgtc ggcgagtgac gcgagaccgt aaactccggc gagccgaatc      9540
     gcagggttgt cgtggccgag ctgttctgcg gccgtgctgt agcgctcgtg caacgcgctg      9600
     acacgctcgt tgtcgtgggt ttcttcggtc gaacgctgct tgcggtacgc gatcagcgcc      9660
     gcccctccga gaccggagac accgagaagc gtcgccgacg tccgcgcggc gttgaacagc      9720
     tggtcgcctg tggcatcgtc caggaatccg aacggcgtat acggctggcg cgtttgcagc      9780
     cacagcaggt aatagaagac accgatcacg gcgaacgccc aggcagtggt accccagatc      9840
     acaagcgtac gtaggcgcat gccccatatc gtgccggaca gccccgactt cggtagacgg      9900
     tggtaccacc ggccacgcct cgctcgggca tatctgacca aacatatgcg gtgaactggg      9960
     gtgatgacac gtcccctcag gccgtggcgc acgggtgtta tcggccggcc ggaagtcctc     10020
     gcatccagtc gcggatgtcc tccatgacct tgcgggggcg cggcaccgtc gagtgcaccc     10080
     gcacttcccg gtaacgggga tggtcgatcg ccagcgacgg caaatcgtct tcccgtagcc     10140
     gcaccaccac acatccggcc gcgagcagat cccggctctt tcgctgatcg acaagcacct     10200
     tcgcatccgc ggaatgccag taggcgccgt cgtactcgat cacgacggtg agcccctcgt     10260
     ggtcgacgct gatgtccgtc gtccaagact tgcgagtggt gtacgcggcg tcggtcatcg     10320
     tgattccgga gcgggcattg ccaaacacct cgacggcggc cgcatggtgg tcgagttcga     10380
     cacgcgattt gccggctcgt cgacagtccg ggcactccgc cccgttcgac cggctactca     10440
     gcggcgcgcg ccacacgtgg gcggggtcgg tggcgcagac ccattccgga acgaacgcca     10500
     gcgacgcatg cgggcgaacg tgccaggccg tgaccgcgtt ggtggcactc cattccgccg     10560
     ccagtcccgg atcgtgccag gccagcgagc cgaggatggt gcggcaggcc gggcagcgca     10620
     gccgactgcc gccgtcgcgg gcccgcaccg actcctgcca ctcgtgcccg caacagtcgg     10680
     cccgccacca catctcgcgc tgcgagtccc acaccacgtt ctgcggggtg tatttgccgt     10740
     tacgggttgg atgccactgg gcggcaattt cgggtagcag gtcagcgagc cacttcttcg     10800
     atgtcgccga ttgcgcacca cggcaatggg ggcaccccga ggtgaggaaa cgcaggggtt     10860
     tgatgcgggg atggtgaccg ttcgggcacc ggaaccggcg caacttcccg cctccggcga     10920
     ccattacctt gcgggggtcg tcatcatcgg cccacgccgt tgccaactcc ggaacgtcgg     10980
     cgaccggtgt acttctccac cgcgtgtgct cagcgtgcca atcctcgcgg cggcgggcgg     11040
     agcaggcccg gcatgccggg ctactggtca tgacgttgac cttctcctcg aaccgcagcc     11100
     cgcaatccgg gcatcgccag tggcaggagc gagtggccag gaccgtcacc gtgtcgaaga     11160
     cggtggcctc gttgtggtcg tggtcccacc aatccagtgc ctgggactgc gattccgaca     11220
     gcaatgcccg gccgggtcgg ggtctgctgg ggtcggagga ccgggtattt cgcgcacagg     11280
     tgcagcccga gccgaagtct cctatcctcg cagcgctgat ccggtgacat ctgcggcagc     11340
     gggccagtac cgggtcgttg tcgtcgtgga cctcaccgat cgggtcgacg aggtcgtagc     11400
     cgcgctcggc gagatggtcg gcgatccgtt cgtgcggcca ccatcgctgt tcgaggaatt     11460
     tacgcacccc cggccgcgga tgtgcgtgaa ggatctgctc cggggaatag tggcgcagta     11520
     actcgagcat cgtgcggtcg aactccatcc acgggtgtga gcgggtgttg gccgcccact     11580
     tcgtccaatg gcacgctcga caggtcggtg tccccgcggc attgtttccg acgacgtagt     11640
     cgagtcggta atgggcgcgc acaccacagg tccggcacgt cgtcaaccgc caggcggtcg     11700
     gcgtggtgaa cggctccgct ggttcgaggc cacccgtgcg aaagattccg tcgatgcagt     11760
     cggtgcacca cgcgggtttg cttcgggtca cgaaggcggc cggcagaccg cagcccatgg     11820
     ttgcacagtc ctgcgtcttc atcgtcgctg ccaccctgtc cgcgcacggc cccgaccccg     11880
     cccgcaccgt cctgtcacgc tcgaagtagt cggcgtcacc ggaatgttag cgggactgaa     11940
     ctgcggacat ggcatgtccc ccaaggcagt gacgtgggct acgcgaagcg gctttcgcgc     12000
     ggagctccgc gcccaggcgt agtttcagct cccgccgggc acgctgcttc ggcgtctcga     12060
     cgggttcgcc ctcgggttgg tcgtcgaccg gacggaaatg cgcgcgcccc agcttgatgt     12120
     ccggatggac caccaactcg gggcggccct tgtcgtcggt gaacagtccc atccgcaatc     12180
     ccctcattcc ccggtgatgt cccgcagctg cacgatcatc cgccggccga tactgccgtc     12240
     agggcgacgg tatcgcccct cccccgccga gaccacctca aaccgcatcc ctctcggcag     12300
     caggtgcgcg gtgtcgtcga ccgtgtccga gcggcccaga tacatacccc tgccggtttc     12360
     gacctcgaac accacatccc gatcgcccag cgttccatcg agttcgtgag cggcgtgagt     12420
     ggccatcgtg tgccggtcga aatccaggcg ggatcccgga tgcagggtcg cgggtaggtt     12480
     ggccgcctcc tgcggcaccg cgtgcgggag ggtcaccgcg cagtacagga tgtggccgcg     12540
     atcgttgaac cgttcggcgg tctgaatcgc ccggtccacc cgctggacct gggagcgcat     12600
     cttctcgtcg agttgctgcg cgtcaccgcg agccgcggac agcgcctcgc cgacggtctt     12660
     ccaccggtcc gggtcgctga ccaggtcctg cacgccggtg tagccgacct tcggcaactg     12720
     cgactgcgcc ttgtgcttgt tcaccgaccg caccttgcgc tggcgcgaac tcggcggctg     12780
     gcgaatcgaa tccgggatcg gcagctcccg gcgtttacgc tcggacacct cggggacggt     12840
     cgcgcggggg aaggcgcgct cgaggtcctt gcgggcccgg gtgaactccg cgtcctcgac     12900
     catccggtca agctgccgag caccgtcgcg ctcctgggcg cggtcgtcgt aggtggcggc     12960
     cggccgatag ccggccgact tagacgcggg cgtcgtactg gtgccggcct ctgggtccag     13020
     acgggtcgga ggcgcgtccg ggctgaggtt gtacgccacc agatcccctc ccgctgcgtc     13080
     gaacacgccc cagatatgac gaagcgtggc aggcattaat gtcccaattg acggcctgcc     13140
     acgctcggac ccgaccgcaa ggcgggtcta ccgcgggaga agcagtccgg tgaccaaacc     13200
     agtaactcgc tcccacgcgt gctgtcggcg cttccgccga acacacacca gcatagcgaa     13260
     acacactgag atgaagatcg ttccttacgg cgacggcgga gccggaggca acttgggcac     13320
     acacgggcga ccttcccgaa cacgccgcgg cacattgtgg cagacgaatc gaccgagtcc     13380
     ctggaatcgg caccgtttac gatcggtgat ggcgggggaa cgccatcacg cgaacaacga     13440
     gggggaacac gcatgtctgc aagtgaggtc acgcaggcgg agaaggccgg ccccgcccca     13500
     tacaatctgg cgctgtacga caccgtcgtg gtgcggtgga gcaacaccct cgtctggcgc     13560
     tgccccagcg aacgcctgct cgcgcactac aactcccacc tcggtggccg gcacctcgac     13620
     atcggccccg gaaccggctg gtacctccag cacgccacct acccgacccc gaacccgacg     13680
     atcgagctgc tcgacctcaa cccgaacacc ctgcagacga ccaccacacg tctcgccgac     13740
     cgcggcatca ccgcggccgc gcacaccggc agcatcctcc ccactacccg cggacatcgg     13800
     ggtgttcgac tccgtggccg cgaacttcgt gctgcactgc gtgcccggca cctgggagca     13860
     gaagggccgc gcgttcgggc acatcgccaa ggtcctgacc gaggatgggg tgttcttcgg     13920
     ctcgaccatc ctcgacaccg gagtgcacca cacccctctc agccgcgccc tgaacagcct     13980
     ctacaacggg ccgatcaaac tgttccacaa ccacggcgac gacctcgacg gtctgcacac     14040
     ggccctggcc accgcgttcg aggaggtcga gatcaccgtc gtcggctccg tcgcggtctt     14100
     cgccgcccac ctcccgcggc gtccaggcag ctgatacggc gcgcgggaac gccaggccga     14160
     acacgtcagg ccaggcgcga acacacaccc cgctgcgcat gatcccgata ctgccggccg     14220
     accgagagga accaagtgcc gacacccgaa cccgacgacc agaagatcat cagtctgaac     14280
     gccctgcggc agaggagaac cgacgaccta ctctccggcc acataccgct gacgtcgctg     14340
     ctctaccgtc ggcacgatcg gatcgccgcc aatctactcg tcactgacgt cctcaccacg     14400
     tacatgcgcg gatccgggat cgggccggcc ggggtcatgg tcatgctggg catcgccgac     14460
     gacgcccggg tccgcgacct gaccgccgag cagcgcgggc agatcaccga cgcgatcgcc     14520
     tcgacgagcg ggcggtaacc cacgagaggg gacgtgtcat ctccgctatc gtagccgcgt     14580
     gaatcgtgca actcgcgcgt gcaacgcccg cggagaaccg tagcgctcac gacgacaaca     14640
     gacttcgacg cggccggcaa aggacggacg cgccgtgccg gcttgcgaac ctacaggggc     14700
     agcggtcggt tgtcggccac gctcttcatg acgagggtag agctgagacg ctggacgccg     14760
     gggagcgcgg ccagagattc gtcgtagagc gtctggaaac cgggcaggtc gcgggtaatg     14820
     acccgcagga ggtagtcagg gtcgccgaac agtcgttgag cctgcaggac atggggaatg     14880
     gcagcgacgg cctgttcgaa tgcctcgatg gtgtcgcggt cggcggcgcg catggtgacg     14940
     aagacgagag cctcgaacgt gaggcccagt gccgtcgagc tgtgcgcggt acccgctgat     15000
     cgcgccggag ctctccagtg cgcgcaggcg gcggtggcag ggcgagatgc tgagtcggac     15060
     ccgatcggcg agttcagtga tggtgagtcg accatcttgc ttaagctcag caagaatttt     15120
     cctgtccacg tcgtccatgt ggaagaaatc ccccatatac gccgttccca ggcaatattt     15180
     ggcaacgttc tctcccccat tcttcctaat ctttctatgg aacgccgttt ggtgttccga     15240
     tagcgtgaag gatgagtgag gtcatggcga tcagtaccgt tgctgcgttc tgagcggtgt     15300
     cgtttctgct cgtgctgaca cccggggcgg attgggcgta cgcgatcgcg acggggctgc     15360
     ggcatcgcac cgtggtgccc gcggtcggag ggctgttgac ggggcacctg gcgatgaccg     15420
     ccgtcgtggc cgccggcgtc gcggccttgg tgacccggtc gccgttggtg ctcaccgcgt     15480
     tgacggcggt cggggcggcg tatctggtgt ggctgggaat caccatgctc gtccggcctg     15540
     tggcgccgcc gcaggccggg gcggagcagg caccggaatc ttgggcgcga caggcggtca     15600
     aagggctcgg gatcagcgga ctgaacccga aggtgtttct gctgtttctg gctcctaccg     15660
     ggggtgtatc gcagtcacaa ccaggtcgct gatcgaacgt ccatcacgcg tcctgcggac     15720
     tgcttcaacg ctcacggcgc gaacgcgccg tgagatcacc gggacaggga attgtgaacg     15780
     gcaagactgc cggacctgaa actagtcctt cgccttcgtt gctgcaatgc ccgcgagttt     15840
     ttccacccgc gcgtgatcct cgacgccgct caacagcgaa acaggtcggt acgtgacctg     15900
     aacgatcggt gcatgggcgg tcagtgccac cgccatcgtc cgacaccagc agcggggaca     15960
     cccaccaacc acgacatggt gaagacggcg cctgcgattc cggcgcaccg acaccgggac     16020
     gagaccgtcc gtggagaacg ccagtctcag gcgaaagctt cgtcacggag tgcgcagccg     16080
     catacaaggc cacgttaagt cgccgagttg catcgcgacg gcgacctcgt agcgctcgca     16140
     cagcttcgat acgatcgtga tgccgacgca cgaaggacga ctggccgcgg gcccgtttgt     16200
     tcctcccgcg gtgtcaccac gagctgaggg gccttgttga ctgcgtcgat gatcttggag     16260
     gagaagccct gcgagctctg aagtcttccg ttgaatctct gtgcggcata accagatcgg     16320
     gttcagagac ctctatcctc gatcgagcgt ggaatccgct cctcccgaca cgattccagc     16380
     acgtctcccg gtcacgccgg ccgcccacga ttgtcggatc tttctttcgc acagcacctt     16440
     aacgcgctgg tgcaccctgg agctgagttc aggtccggcg ccggactgta ggtcggccag     16500
     gactcttcgg tagaacgaga ctggcggcaa cccaaattcg ggaaggataa attcgtcgcc     16560
     ccctccgaac ggctcccagc ggattgcgaa cgcgagcagt tcgttgtcgg tcctcctcgt     16620
     cgcagcttcg gtggtccgcc gcttccttcg cgtgctcatg ttctttgtca tactcacgac     16680
     acgtcagcct cgccatgcga ggtagctggc aactgcgcca atgctccctt cacgagcttg     16740
     cctgatgggt tgcggggcaa ttcgtgaatg aacaaaattt cggcggggac tttgtagtcg     16800
     gcgaggtgac gggctgcgta tgcacggaga tcatcagaag ttagccgttg accaggagag     16860
     atgctgacta cagctctgac acgttccccg aaaatgtcgt ccggtacacc aaccactccc     16920
     acatctgcca ccgcagggtg tgcggccaat accgattcaa cttcgatact gtagatgttt     16980
     tcgccgccgc ggatgatcat gttcttcagc cggtcaagca catggacgta tccgtcagtg     17040
     tcgatgctgc cgacgtcgcc tgtgtgtagc catccctctc ggaacgtgtc cgcggtcgct     17100
     tccgggttgt tccagtagcc ggctgcgacg acgggaccac gtatgcaaag ttcgcctaca     17160
     tgctcgcgga ggtcggcgac cgtcccgtct tctgtggtta cgccgagttc ggtgccgggg     17220
     accgcgcggc cggaggacca cgggcgggcg agatagtcgt cgcctttgac gaaggtcacg     17280
     atcgaggtgg cttcggtcat tccccagatg ttcgcgaaag cgatgttcgg catcttgctg     17340
     attgcctgcg cgggcagaga ttcgggaacc ggcgatcctc ccatggcgaa gagcctgagt     17400
     gcactgaggt cgaggctatc tatttcgggt cgggtaagca tgagttggag catcgtggcg     17460
     acaccggcga agatggtgat gcgacgctcg gcgagcgttg ccagagtgac ggctgccttg     17520
     aattctggtg cgagcacgca cgatgcgccc gcggagagga agccgatcag ctgggagttg     17580
     agcccactgg cgtggaacat gggggcgacg atcagtgtcc ggtcgttggg ggtcagttcg     17640
     aattgctcac gaactgtggc cgcgttgaac agtaggttgg catgagtttg tgccgcacct     17700
     tttggtcgac cggtggtacc cgaggtgtag agcagctggg ctgtgtcatc ggcgctgcgg     17760
     gacaagcccg gtaagggcgt atgatcggcg tggggcggcc gttcagtaag cagtacctgc     17820
     ggatcgacga cgtctgcgtc tgaagtcagc ctttctgcga agctggagtc gctgacgaca     17880
     agcgacgcgc cgctgtcgct cagcacgtgt gctatttcgg gtgcgctcag ccgcgtattg     17940
     accacgacgg ctatcgcacc ggccagttgg gtgccgaagt acgagaccgc gtggtggagt     18000
     ccgttgggca gcgcgatcgc gacgcggtcg ccgggcttta cgccgcgttc cacaatggag     18060
     accgcgcatt tctgtgccaa ctcgagtgtc cgagcgtagc tgagcgtggt gttgccctct     18120
     gacagtgcct cgcgcgtccc gtatcgctcg gcggcctgga tgagcatgga cccgatcgtg     18180
     gtcggcgtgc cgacgagtgt tgattcgagc atctgatact tctcctctgg gaaacgcgcc     18240
     gccgaggcgg cgagcatgtg cgttagcgaa agagtccgtc gctgttgagg ttttggccgc     18300
     catcgagtcg cagcgcctgg ccggtcgtgt atccggcagc gggcgagagc agatagagca     18360
     ccgcgccgac cacttcaccc agcgcagcga cgcgtcccat gggcacgccg cggagcaggc     18420
     gttgccgtgc cgactccggc atcgcgagga ccttgggcgt ggcgacgagg ccggggacga     18480
     cggcgttgac gcgtatgcca tcgcgtgccc attccgcggc caatgagcgg gtcaatccga     18540
     gtacgccggc cttcgccgct gcataggatg cctgcccggg cagaccgtct tgtcctgcta     18600
     cggaggagaa cagcacgatg ctgctggcgg tgctggtctg taggggcggg taggcggcct     18660
     gcgccacata gaattgggcg agcaagttcg cctcgacgtc gcgttggaag tctcggatcg     18720
     ggaaggtggc agcccggtgg atcgtgtcga cgatgccagc cgcaccaacc agcgcatcga     18780
     gtccgcctag tgcggacgcg gcctcagcga cggcgcgtgc ggcttcgtcc ggttcggaca     18840
     ggtctgcgcg gatcatctgt tcgcacggaa tcgactgtgc ctctgttcca gggcgatcga     18900
     tacccactgt ccggcacccg aggtcgtcga gggcggccag cagggcccgg ccgacgccac     18960
     cgagggctcc ggtcacgagc actcgcgccc ctggccgcgg ggtagtggtc cagtccgcgt     19020
     gaccgttcgc ggtatctgac tgctcattca tccgtggatc atccatccct gggcatcgcg     19080
     ggccgcttcc gacacggcct cggacagtgt ggggtggccg tgaatgatcg tcgcgatctc     19140
     aggaagtccg gcttcgagcg cgcgtgcggt gaccagctcc tgaatcagct cggtagcctt     19200
     ggcgccaacg atgtgggcgc caagcaactc gccgtacttc gcgtcaccga cgagtttgac     19260
     aagcccgtcg cgttcgccga gcaccgtgcc cgcaccgact gcgccgtatc gggcggtgcc     19320
     caccaccacc tcgtagccct gttgccgtgc ttgctcctcg gtcagtccga cactggctac     19380
     cgaaggtgag cagaacgtgg cccggggtat gaggttgtgc agcaacggtt ctgggatgtg     19440
     ttcggcagcg tcttcggcgg cgatgattcc ttcttcggat gccttatgcg ccagagcggg     19500
     accccgaacg agatctccaa tcgcccagat tcccggggcg gtcgtccgca gtcgttcatc     19560
     gacccggatc aaaccgcgat cgtccagttc taccccggca gtgtccagag cgagagagtc     19620
     tgtgtcgggg ctgcggccgg cagccacgac cagccaggtg gtttgctcgg tgcgaccgtc     19680
     gacggtgaac gacaccgcgt cggtggactg ctcggtatca gacacggtta ccccggtgct     19740
     gatggcgatg ccctgacggc gcagtttcgc gtgcacgatc gccgagatgt cggcgtcttc     19800
     ggccggcagg atgcgatcgg aggcctcgat caggcggacc ttgcttccca agcgggcgta     19860
     ggcagacgcc agctcgacac cggatgcgcc ggcgccgacg acggcgatcg tgtcggggag     19920
     cgcgtcgagc gcccatgcct gttccgtgcc gatcacccgg ccgtggaagt cgaggccggg     19980
     caggggtcgc gcaaccgacc cggtcgcgag gacgatcgca cgcccgtgca cggtttcacc     20040
     atcgaccgtg accgcgccgt cgccggcaag ccgcgcccaa ccgtgcttga cctcgactcc     20100
     gttcttcttc agcaagcctc gcaccccgcc ggtcaagctc gcgactacct cgtcgcgtcg     20160
     tgcccgtacc tcgtcgaagg agactctggg agtgccgaca tgtatcccga actgactggc     20220
     atggcgtacc tcgtccaaca cgtcggctgc gcggagtacc gctttggccg gaatgcaggc     20280
     gtaattgagg catcgaccgc cgagggcatt gccttcaacc accgcggtgc gcagcccgag     20340
     ctgcgcccca cgaatagcgc tgacataccc gccggggccc gatccgatga ccaccaggtc     20400
     aaatgcgtca ctcatcagtg cccccagcgg ttgccggcga cacagcgggt ttggttgcgc     20460
     cgtaccgttc ccagtgccgg gccggaatgt cgtcagggtt cttgtaccag taccagacac     20520
     acggatcgtg gtcgaagttc tcgggggggt ccgaggggta caacggggcg ccgtaccacc     20580
     gtatcggcag gctctcgttc atgaacgtgc aatgcgtgca gtacaagggg aagccctcgc     20640
     gcccatacga ccagtcatgc gcttcctggg tgaccccgta ggcgttaggg ccctcgtaac     20700
     ggccgcgtcg ccacagtcgt tgcccactgc cgcatgggtt catcgtgaag gtgaacttct     20760
     catcatcctc gacgatggtg aacgcgccgg ggtggggtcc gacaccgctg gtgctgtgcg     20820
     cccgccaggt ggcggccaac gatttgacga tctcgcgtcg gtcggcattg agaatcttgc     20880
     cgacatccgc acgccagcca cgttccatgc tcgacgtcca cgcctcagcg acatagtttt     20940
     caccgaagcg ctcctggatg aaggtcacca atccgaggag ctgctcggcc atgagatcgt     21000
     gcaggtatcg ccactcgtga cgcatcgctg agcagaggtt gcgggcctcg gcgaggtccc     21060
     cgcggtcgat ggcctcgatc gcacgatcca tcgtgggtcg tgacatctgc ccgagctcga     21120
     ccgggtcgaa ccaccggttg gtcggcgctg ggggatgctg ctcgatgctc gtcacggcgt     21180
     catcaccact ttggggcgtt ccccccgaga tgtggacacc aattcctatg cagcggtggc     21240
     cagcgtagcc gatcgctgct cgaactcgat cggacagatc tgaccgaggg tggaatgcct     21300
     ccttcgcgtg ttgtagcggg tgatccagcg gaagatggcg gcgcgggcct cacccgcact     21360
     gttccagcgc ttccgcccct gcagcgtctc ccgtttcaac gtcgcgttca gcgactcggc     21420
     ggccgcgttg tccgccgacg ttccgaccgc accccgcgac cgggtcaccc ccagctcgcg     21480
     gcagaggtcg gcgaactcgg ccgatgcata ctgggctccg ttgtcggagt ggaaaattga     21540
     cccctcgagc cctgcggcgc cgcgacaggc cgccgccgcc cgcatcgcat cggtgaccaa     21600
     ctcggtacgc atgtggtcgg cgatcgacca ccccgccaac cgtcgcgagc ccaggtccaa     21660
     caccgtcgcc agatacagaa attcaccgtc accgactggg aggtaggtga tgtcgccgac     21720
     gtatcgagtg ttcggtgcgc tcgcggtgaa gtcccgccgg atcaggtccg gcaccgcggc     21780
     cgcgtccgga tcggggacgg tggtgcgcac cggtttgcgc aggtgcaccc cgacgatccc     21840
     gtgctcacgc atcacccgct cgacccgctt gtgattgacc tcgatcccgg cctcgcgcag     21900
     ttcggccgtg atgcgcgggg caccgtaggt gccatcgaag tcggcatgga tagcgcggat     21960
     ccgctcggcc agctcctcgt cggcgcgggc acgggcggcc cgggccggtc cggaggtccg     22020
     ccaccggtag aagcccgagc gggagacttc gaggatctgg cacagccact tcaccggaac     22080
     ggtgtcgcag tggtcgtcaa cgaactggaa gcggctcacc aattcgtctc gcccgcgaaa     22140
     tacttcgcgg ccttgcgcag gatctcccgc tcggtttcga gcttccggat ttgggccttg     22200
     agctgcttgt tttcttcctc caacacggac tcggacgata cctcgccggc ccgggatgcc     22260
     ggccgcgcag ccccgtcggc ccggagctcg gccgtggagg taccggtgcg tttgcgttcg     22320
     gcccgcaccc agttgcgcag ggtctcgcgg ctgactccca ggtcgttgcc gatgccctca     22380
     aaggtgtggc tcgggtcgga caggtacagc gcgacggcat cggccttgaa ctccgccgag     22440
     tacgccttca tcgccatcag tgacatctct tcctctggga ccttcacgac ccagtgttca     22500
     cgatgtcctc actcaggggg gaaccccctt gatcgatgtc gggtccgcgg cctggtggaa     22560
     cgcggagttc gcttcgctga gtgggatccg gttcgtgacc agcgcgtcga cctgcacgcg     22620
     gccctgctcg agaagttcga tcccgctact gatcgaggag ccaatggcgc cgattagccg     22680
     aatgtccttg taggcgatca gggagaagtc cgcggtcgcc ggttcctcgg aaagtccgac     22740
     caggaccaca gttcctctgc tgcgcacgaa gtccagggac tgggcatagg tgggtggggc     22800
     ggcggccgca ttgaacacga cgtcagccat accgctgtct ccgaacatgt agcggccccg     22860
     cccggtcgcg gcgcggacag cgtcgatgag atccgggcgg cgcgcatcga tgacctcatc     22920
     ggccccgacc cgaagggcca gctccgctcg ttccggtgag acctctgtga caatcacctt     22980
     cgcgtccacc gtggccttga cggtctggac gataaggttg ccgatcattc cgccaccgat     23040
     cacaacgacc gtgtccccgt cttgcggctt ggcgcgccgc accgagtagg ccgccgtgcc     23100
     aaggggctcg gcgagtgccg ctgcctcgtc gctgagcgac gcagggatcg cgaacagatt     23160
     ctgatccagt tgtgcctgcc tgatcagtac atattcggcc atcgcaccgg gctcgccgta     23220
     cccggtgtaa tgctcgaaca agtgcgggca cagacgttgc tggttgcgtt gacaccaata     23280
     gcactgaccg cagaactcta cggagaatcc tgtgtatctc tccccgacgc tggcgccgcg     23340
     gacctcttcg ccgacctcga ccgcctcgcc gcagaactcg tgccccatga tccaaccggt     23400
     cgtcgcaccg tagaggccct tgcggtagac atgcaggtcg gagccgcaga tcccgacagc     23460
     gcgagttctg agcaacacat cgcgggggcc gggctgtggt gtcggtacat cctgtacctc     23520
     gatcagaccc ggtcgctggt ataccgctgc tttcatgatc attcctcgct tgtgacgtgg     23580
     gagccgtatc ggtcagccga ccagtagccg gtcgggttcg gccagcaacg cggccatcgt     23640
     gttatggaac cggcccgcca gttcgccgtc gatgatgcgg tgatccacgg tgaggctcag     23700
     gtgtacgact ttgcccgccc tgacttcgcc gtcgcgtacc accggacggt ccaagatcgc     23760
     tcctgtcgcc aggatcgcca cttgcggaag gttgagcacc ggggtaccga aatgtgaacc     23820
     gtaggagccg atattggtga cggtgaaggt gccgccggtc agatcggcag cggtgacctt     23880
     gcgctcacgc gctgcgaggg cggcttcctc actgcgctgg tggatggcgc gcaggctcag     23940
     ctggtctgcg tctcgcacaa cggggacgat gagcccgtca ggcaccgaca cggccatgcc     24000
     caggtgcacg tggtcgtgct cgatgatgcg gtccgcctgc acggttacgt tcagctctgg     24060
     tacttcgcgc agtgccagag cggtggcttt gaggaacagg tcggtaaagg acaccttgaa     24120
     tccgatgcgc tcagctttgg ctgccaaccg atttcggagt tcgaccagtg cgctgacctc     24180
     gacctcgcgg acatcggtca gctgcgcggt ggtctgcaga ctctgctgca tacggtcagc     24240
     gatggtgcga cgcatcgctg acagcggctt cccttgttcg tggttcgggg agtcggacgg     24300
     ctgaggtgag tccaccggct ccgacaccgg gtgcggctca tcctgggcgg cggggtcctg     24360
     agcctgggcc gcttcgacgt cgcggcgacg aatctggccg cgacggccgc tgccttcgat     24420
     cgtactgatg tccatcccgg cgtcggccgc gactcgtcgc gccagtgggg tcgccagcac     24480
     gatgccgttc gtactccgct cggccgccgc ggtcgacgcc ggcggttgtt cgacacggcg     24540
     ttcaggctga acggtcgttt ccgttccgga tgtcgggggg tccgggtgtg tgtccgtacc     24600
     gcgggcgacg gccaggtatt ccttccggga agcggacacc gcaccgaggc gggcgccgac     24660
     tttgtactct tggtcgacat ccgccgcggt atgcagcacg ccagcggttg gggcctcgat     24720
     ctcgtagctg accttgtcgg tttcaatgat cgcgatcacc tcaccaccgt cgacctcatc     24780
     gccatccttg cggacccatt cggccagcag cgcggacttc atctccacgc ccaactgggg     24840
     aagggttata tcgatgctca tcgtcgagtc acctcatgcc atcagatcgc gcacggagtc     24900
     aacgactctc gcgacatcgg gaaagagcag gtcctcggcc tcgccggtgg ggatggggta     24960
     gaaagcaccg gcgatccgtt tgatgggtgc gtcgaggtag tacaggccct cgtcggccac     25020
     tctcgccgcg atctcggctc cgaagccgct gggcccggtc gcctcgtgca cgatcgccaa     25080
     gcgggaggtt ttcgccacgg atgccaggat cgtgtccgtg tccaacggca tgagggtgcg     25140
     ggggtcgacg acttcgacgt cgatcccttc cttcgcgagt tgctcggcag cgtccagcac     25200
     gacgtgcacc atccggccgt aggcgaccac ggtcacgtcc gttcctgccc gtttgacctc     25260
     ggccttgccc agcggcacca cgtggtcgcc ctctgcgggg gccgcacctt tgtagccgag     25320
     aagagatttg ttctcgacga agatcaccgg gttgtcgtcg cggatggcgg ccttcagcat     25380
     gcctttggcg tcgctgggcg tcgatgggta cgcgaccttg aggccgggga catgagtaaa     25440
     ccatgattcg aggctttgcg agtggtgcgc ccccacccgt actcccgccc cggcgagggt     25500
     gcgcaccacc atcggtgcag caatcgcacc gttggatagg tagtaggtct tcgcggcctg     25560
     attgacgaga gcgtccatcg tcaaggtcaa gaagtccatg aacatgatct cgagcacggg     25620
     tcggcagccg gcgatggcgg cgccgagggc gaggtcggcc atcccctcct cactgatcgg     25680
     gctgtcccgc actcgcattg cgccgtattt gtcgaacaat cctcgggtca ggccgaatgt     25740
     tccgcccgcg cgcccgatgt cctgtccgat caggcacacg cttgggtcgc gttcgagttc     25800
     ctcgtcgagg gcctggttga tcgcccagcg catcgcaagg gtctggcctg gtgctgcgga     25860
     cgcgttcaca gaggacctcc tgcgtagatg tcaccgaaga tgtcgtcttt gcccgccggt     25920
     ggggcgttca gtgcctctgt catggccgtc cggatttcgt cggcggcttc cctttcggcg     25980
     gtgtgcagct gctcctcggt cacgttctgt tgttgcagca ggcgcgcgcg gtagcaggtc     26040
     acgggatcac gctcagccca ctcggcgacc tccgccttgt cgcggtacga ctgggggtcg     26100
     ccttcgtagt ggccgttgag ccggtaggtt ttcgcctcta ccagggtcgg cccgccgcca     26160
     cctcgggcgc gctcgaatgc ggcggccagt gtcgtgtaca cagccccggg atcgtttccg     26220
     tcgacgacga cgccgggtat gccgtagccg gcggcgcgat cggcgacgtc tgcgcagcgc     26280
     atctggtcac gggaggagga gaattccgcg tagaggttgt tctcgcagat aaagatgaca     26340
     ggcagatccc agatggcggc catgttcaat gcttcgtgga aagcgccccg gttgctggtg     26400
     ccttcgccga agccgcagac cacgacctcg tcgaggccgc gctgctgcac cccgtatgcg     26460
     actccggcag caatggggat gttcgcgccc agcacgccgg ttgttccgta gatccgggcg     26520
     ggggcgtagt tgatgtgggt ctctcctgca cgcccgcggc tgggtgcggt ggcccgtccc     26580
     atgatctcca tcgcgagatc acgtgccgtc atgcccttac ccaggatcga cacccgagaa     26640
     cggtgatagg gcacgaggtg atctgtctcg cgcatcagcg ctgccgctgc ggcaccggtg     26700
     gcttcgtgcc cgatacagga gtggaaccag ccgcccagct tgcccgccgc gaagatcgcg     26760
     ccgagttgtt cctcgaactc gcgggcgagc accatcagcc ggtaggtcga taggaggtct     26820
     gcgtccgagc gttcggtgac ggtcgcatct gcggctggat tctgctgtgc gggaggacgc     26880
     ttcttggacg ttgttgtcat cgcagcatct ccctaccgat gatgatccgc tgaatctccg     26940
     acgtgccgcc accgatctgc atgatcttgg cgtctcgcag gtaacgctcg actgggaact     27000
     cacgtgtata gccgtatccg ccgaagatct gcacggcttc gagcgcagca ttcatggcca     27060
     cttcggatcc gtgcaatttg cacgccgagg caagcctggt cagcccggaa tctcccgcgt     27120
     cgattgcggc cgcggttttg gatacgagtg cgcgacccag ttcgattccg acgtacatgt     27180
     cggcgatctt ggcctgaatc agctggaagt cgccgatagg gcgaccgaac tgccgacgtt     27240
     cgcccgcata gcgcaccgct tcccgcagcg cgccggcggc gagtccgacc ccctgtgcac     27300
     ccatcaagac gcgctcgctc gccagcccgt cgcgcagcac cttgatgccg ttcccgatcc     27360
     caccgatcac cgcatcgtcg ggaacgaaac agtcggagaa ggccaattcg ccggtgggag     27420
     atccccgcca gccgagcttg tcgagcttgc ggcctttgga gaagccgggg gcggtggtgt     27480
     caacggcgaa cagagcgagt tcccggtcct ccaccgggcc ggtcttggca tagaccaagg     27540
     cgaggtcggc tactggaccg ttggtgatga acgtcttggc gccattgagt agccagcccc     27600
     cttcggtacg ggtggctttg gtgcgcatac tcattgcatc cgaacctgcc tccggttcgg     27660
     tgatggccag acaaccaatg atcgagccgt cacacaatcc cggcagatag cgggcctgct     27720
     gctcaggtgt gccgtgatcg acgatccgat cgaccaccag attgctctga tgaagaacag     27780
     tcacggcggt cgacatacac acggccgata actcctcacc ggcgatgcag gtctccgtca     27840
     aaccgagatc ggatcctccg aactgctccg gtgcgcggat gccaagcagt ccgagttcgg     27900
     cggcggcctc ccacgactca cgggggaatc gttcttcgcg atcaatttct gctgcgaggg     27960
     gcgcaacatg atcggcggcg aacttgcgta ccgtttcccg catcaaccgg tgctcatcgc     28020
     tttccagcgc cgttttcatt ctgcgtcctc acctcagaca agtcggaata cctgcgtgcc     28080
     tgcgttccgg aaccagaggg acgcgggcga tgagtgcagc aaagcctgga cagtcaccgt     28140
     cgatccagtc ttgacgcgcc cgtgccttgg tgaggactac tagttcgtcg gcggcacttt     28200
     cactccaggt gcggccatgg ttgacctggt aaccctcatc gtcgcgaccg ccgacgtgcg     28260
     aaaccgcacc gcgagatggc cagacgccgc gtgcgggtct tgacgtcggc ttctctcggc     28320
     tgcctcaaac cgtgcgagtg cgagttgtgg acttctccaa gcccggtccg atgtttcagt     28380
     gatcgcgtat cgactgcgtc tctctcgcga gcaccgcggc tctcacgact tcgtcgtgaa     28440
     cgtgcgaggg gacggagggt tgttccacgc gcgccggatc gcatcccagg cccagcagca     28500
     aggtgcgcac gtacctgtcg gcgatctcct cgattgacca cgacccctcg ggccgatacc     28560
     aggaccacgt ccagttgcac atgccgaaaa tctgcaacgc caccaggcgg ggatcatcct     28620
     cccgcaccac gtctgctgcc atggcttctg caatcacctc ttccacccgc tcggtgtacg     28680
     cgtgacgccg tagacggacc tggtccagct ggggcgagtc cgcgtaccga gcgaactccc     28740
     gtccgaaggc ccgggtggca gctaggtcgt cacggtggca cagcgtgatc gacacgatga     28800
     ccgcgatcag acggtcctgc gggccgtcca ggtgagaaag gatgtgctgc agctcccgct     28860
     cacgccgatc gatgtagtcc tcaccgatcc gtgcgaggag ggcctccttc gatttgaagt     28920
     ggtgcagaat cgttcccttg ctgatcccca gccggtccga gacctcactc agagcggttc     28980
     cacgaaagcc ctgctgagcg acgcattcgg taaacacccg ctgaatccgc actcgcagtg     29040
     acaccggttc gtcgactacc aattccacca tcgctgtcgt tcccctcgta cattgactga     29100
     acgggcggtc aagcctatcg ttcgaggcac ccgacttcga tatcccatgc cattggagtg     29160
     ttccgcggtg actctctcgc atttgacctt gccccggaca gccgagtccg gagcacccac     29220
     gttcaccgac ccatgcgatg cccgcgatcc ggcgtcgtgg tcgcgaacag agttaggcga     29280
     tgcagccgtg atcgaggcgt ttcacgacgt cgctggcacc gtgaccagtc aaccggggat     29340
     cgagccggtg ttgcgggtcg ctgccggcaa cgcatgcgac ctgttggccg tggaccgctg     29400
     ctcgatcttc ctacgcggat ccaattcggg catctttcat ggcgtcgccg cccggtcacc     29460
     gggtgacagc gacatagtcc gccacctgcg gtgtggcgtt accagggatc ggatgtcaca     29520
     ggaaatcgtg gcaacccggc aacctgtgct ggtacgcgac gccgtggccg acggccgtcc     29580
     ggtccgctcg accatggtca acctccaggt aagggaagtt ctcggcgtcc ccctcgtctt     29640
     tcgccagcaa gtctatgggc tgatgttcct cgacctcgtc gggcaccatc gcggattttc     29700
     cgcgatcgag actcgtcttg tgaccttcta cgccgacctc atcgccggcc tgctccccgt     29760
     tctgcaccaa gtcgacgatc tccactccgc cgtgcgtgat ctgcagatgc gttcccacga     29820
     atcggcacga acacgtcgat tcgccgacga gatcgcgtgt gcgtcgagtg ctggcacaac     29880
     cccgcaacag atcgcggcct ctgccagtac ggcgacggga cgtggcagct ggttcaccga     29940
     tggcgcacat cgtcccatcg ctcacggcgg tgagggaggt aacgccgccc ggatcggacg     30000
     gctgctgaac cgtccggcca cgatcgaggc gctgcgcgcc ttacccgact cgggtgtcct     30060
     cgacctcagc accgaaccgg acggcctgct cgtggccccc atcaccgtcg atggccatcg     30120
     gcggggcaac atgtctctca tttgcgacgg ccgccccatg accgaacacg acaagacagt     30180
     gttgcgcacc gcggcccatg ccatctccgt cgaactgcgt gtggaagcac aatctgcgat     30240
     gacgacctcc gagggccgcc agcagattgc gcgggccatg atcgagggca acctcgacgc     30300
     cgtaactcat cgccgtgccg cgctgcactc gatcccgatg gactgtcagc gggtggtgtg     30360
     cctggtggcg cagaggcggg cgtcgtcgat tcggttggac gcacgcgacc tcgctcaagc     30420
     cttcgacagt gtcaccgctg gtcctccagc gctggccact cccaccgccg agggcgcgat     30480
     cgcggtgctt gtcgatctcg gcgaagattc tccttccgaa ctcgcgcagc gcgcatccac     30540
     gctcaccgcg gccgcgctca aattggccga cgccgaggac accctgatcg cggcgatatc     30600
     gagccccatc acggccgtcg accaggcccc tcgggcgttc gacgaaagtc agcgggtact     30660
     gcactgtcta cgtcagctct gtcccgagtc aaccacgatc ctctccgcgg acgacctcgg     30720
     tttcgccggt gtcctgttgt ccgcgatcga ccggacaggc gccgaccagc acgtacacaa     30780
     aaccctcggt cggctgctgt ccgaccacgc tcgggaccat gagatgctcc acaccgccga     30840
     cgtcttcttc gatcacgcgc gcaacatccg tgacaccgcc cgggcgttgt ccgtgcacga     30900
     gaacaccgtg cgctatcgcc tctcccgaat acatcagctg actggcctcg acctcaccgg     30960
     caacagcgat catcaagtca gttgccagtt ggcgctactc atcctccgcc ttcgcgggca     31020
     actatcaacg acaaatccac tcccccacta cccctgaagg gggctccttc accgtgccat     31080
     ccccatcgag cgtcgtcccc gaactccagg acgacatcac cacgatcgtg ctgagcggcc     31140
     aagccggtcg gctgccgctc tcccccgcag gactccctga cctgacagcc gcactgacag     31200
     cggcagaaca gaacccgcac atcagatgcg tggtgttcac cggcaccgag aacaccttcg     31260
     ccaccggcgc cgacctcaac gagattgccc gcaacgacgc cgatgccaac gcccgataca     31320
     accgagcgct gatcgaagcg atcaatcgaa tcgacctcct tcccgtcccg acgattgcag     31380
     cgatcaacgg ccacgcgcta ggaggcgggc tcgaactcgc actggcctgc gatctacgca     31440
     tcgccgccga caccgcgatg ctcggcctac ccgaaacacg gctcggactc atccccgggg     31500
     cagggggaac ccaacgactc ccccggctga tcggggaagc gcgcgcgatg gacctacttc     31560
     tgaccggacg taccgtcaac gcatccgagg cgctacacct cggacttgtc aatgaagttg     31620
     ccccccacga tcgcctggcg tcgcgaactc aacgcctggc cgcaacaatt gcccgaaacg     31680
     cgcccttggc gctccgggtc gccaaggcgg aggtcagggc cgggcgcact ctccacctgt     31740
     tcgatgcgat cgacgccacc cacgatgcct tggcaccact tctgacctcc gaggatctcc     31800
     gagaggggct ggcggcgttc cgcgcacgac ggcaagcgcg cttcatcggt cgataacggg     31860
     taccaggacc cttgtcgccg aagcgccccg ccggcgtcgg gaccgttacc gggggtcggc     31920
     gcccgtgcgg ccgccgcggt gttcggcgca ccgacctgcg gcaacgcgaa tgtgccgtgg     31980
     ccacccgact atgaccctac gtaccgtaac ccggtgagcg ccgccgccgg caaggagcga     32040
     gtccgacgtc accaatcgcc ttggagatgt cgccaggctg cgataactgc gggctttggt     32100
     ctcgagcgaa gaagcttgga cgatcggccc atggaccgat taactgatct tcgccgagca     32160
     ttgatctgct gcgccgcggc catcgatcaa ccgccttccg tatccgctcg cgcccatccc     32220
     tcgttgggcg gacggtgatg aatgtgggcg cgtccagtga actgtcagga tgtcgcggcg     32280
     catcgctgta cgagcgcggc accgattccg ctcgcgcccc caagtgacca cgacgacttt     32340
     tccggagtcg accatccgaa tggtcggccg atcgaactta gaaggacgtg aactgtgaca     32400
     aacgaacaac aatcggcaac tacagagcag ccgctgcgcg gcaaggtcgc aatcgtgacc     32460
     ggggcgagca ggggaatcgg tgcggacaca gcgcatctcc tcgcagcccg gggagcatcg     32520
     gtcgtatgcg ctgcgcgcac cctcaccgaa ggtgacaacc cgcttgcagg atctctggag     32580
     cagacggtgg ccgccattca ggagcaggga ggtacggccc atccggttgt ggtcaacctc     32640
     gccaaggatg aggattgccg gtcgctgatc gaggcgaccc gatcggtgta tggccccgtc     32700
     gacatcttgg tgaacaacgc ggcggtgggg ttcttcgatc tggtggagtc gatgccatcc     32760
     aagcagtggt tgttgtcgtg gcgtgtgatg tgccatgcga catttctgct gagtcagttg     32820
     gcgctgcagg acatgctgcc gcgtggcagt ggccgcatcg tcaacgtcac ctccgagtcg     32880
     gcaattggtc caggccgtgg cccgtatgcc gacggtgacc ggatcgggga caccctttac     32940
     ggtgcgaaca aagtttcggt cgagcgattc actcaggggt tggcggaaga agtgtacggc     33000
     cgaggcgtgg gggtcgccgc gctcgctccg tctcaactgg tgcccactcc gggagccgtg     33060
     ttcaacgacc tcgtacgcgg ggccaaggac ccgcgtgccg agtcgaccga attcatgacg     33120
     cgcgcgatcg agatcctgct caccgcaccg ctggaggaga tcagtggccg tgtagtgtac     33180
     agccagcagc tgctcgtcga gtacggagtc ctgggcgaag gacgtgggta cggactggac     33240
     gcgcagctcc cgatcagcgg tttcgcggct cgatgaggcc ggccaattgg agaactcgcc     33300
     agggtcgacc ctggcggcgc actccccttt tcgttcaact tctgactcga taaggtctgc     33360
     gtcacaccgc acttaggtgt ggaaatgacc gcctggcccg taatcaatgc aagaagacgc     33420
     cgaatactac tcgactttcg cggttatgcg acggcggggc aagccagttc gtagtcgcgt     33480
     attatgttgg ggtcgagccg atctggcgta gtcacggaac atcgggcggc gatgagggtg     33540
     cagcgggcct tggcgagcat gtccccgaag acggtgtcgg tctttccggg ataccagggc     33600
     tcggcagcgt gacgaacggt caggtcgtcg cgatggtagc cgtgagtggc gcaccagacg     33660
     atgaccaggg tctggacgag gaacccgaac ggcaccgtgc gttcgaccgc gcgttgaacc     33720
     cggttgcggg cgccggttcg atgctccacc gctgggcgta gcgttccacg atgcgcccgg     33780
     taccggtacc ggtaccggtg gtgaatcgtc cctagtttga tgcagtttga tgcagcatca     33840
     aactggggac gattcacagc gagcacagct cctcacggcg cagcgcggca tcgtaggcca     33900
     gcaccacatc acccggttgc ggaccggttc cccggcggcg acggtcagga tgtcagccca     33960
     ctgccgctcg gtggggacca gggcagcttt tcaaccgggg caccaacccc gctgatgccc     34020
     gccaccgcgt cgtccgggtg tgaagcggcc ccggccaacg ggattggact cgggcaaccc     34080
     ttccttcatg aggtggtcgt agaacagccg caccggcacc atcctctgcg taaccgtggc     34140
     gttggccaga ccggagccgg aatcgagcga caccacgttc gcgcctcggc ggctgggccg     34200
     ttcggtcaac tcccgcacat agacgccgac atgcgcccgg ctcggcgtta ccgggtcgac     34260
     accctcccgt tcgcacatct ccaggtactc ggcaagcccc cgggcgtagg cgtcgatcgt     34320
     ccgaggcgcc ctaccgagat cggtccacac aggcagccac ccggccgcct gcacatgccg     34380
     gcccagcacc ggccacttct cctccaacac cagcgtgccg ctcaagccat gtcctcagtt     34440
     ccgtgatcaa caccgaggag acatgatctt cccccggcca gattccacgt agcttttgaa     34500
     acttagaatg cgcaaacgcc agatgtacgg acgcgccaac ctcgaccttc accgcaagcg     34560
     cgtgatccac accgtataac cacgccccac aacagaatca cggaaagtgc gccagatccg     34620
     cttttcatgt ccggccgaca tacgatcccg cccgaaggag gcggaactgc ggccgaagat     34680
     gtatcccgaa gagttccgac gtaaggtcct cgacctggtg gcggcaggaa ggccggccgc     34740
     tcaggtggca gccgacctcg acatcggtga ccagacgatc tacgcatggc gcaaacagga     34800
     gctgattgac accggacagg cgcagggcat cacccgaggc gaacagaccg agctggcagc     34860
     ggcacgccaa cggatccgcg aagtcgaaac tcaggtcgcg atcctcgccc gggcccgtga     34920
     tctgctgcaa gagccccact cccgaaatgg cggttcgctg ccatcgggcg ccatggccgc     34980
     ggaaggacta cccgtgccgc cggcctgccg cctgctctcc agtgcccgaa gccggatgct     35040
     acgcagggcg cacccggccg ccctccccag cacgctgttc ggcatgcctg gctagccgaa     35100
     cagatccgcg gtgtccatac cgcctcacga ggaacgggtc ccggcgtgtg catgccaaac     35160
     tgaccctcgg cctctcccgt cgctgacgtc atcgcggtcg gtcacagtca agtcgagctg     35220
     ctgatcgggt tctggggaag agccacacac gccacaaacc ttggaatcaa atcaaccagg     35280
     cgcacaaggg aaacgcagac tatggagttc gttgttgctg atcaggagtc gttgggtgtg     35340
     gcgacctacg cccatccttg cagcgcgctc cagatcgtcg atggtatcga cgtcgagacg     35400
     aagagaagga aggccgagtg ggatctgttt gtagcccatc cgggtgtgcc gctgcgccga     35460
     gtttcgaccg aacgccgaga gtatcgctgc ctgttgggtg gtcaggcatg tcgtgccggt     35520
     gcccgccgag tcggcgacaa aggcacgtgg gaatcgactg gccgcgctca aaaagttgtc     35580
     gatgtctcct gtgcggagcg ccgggaggtc tggcatgacc accgaatagt ggccgtcgtg     35640
     gccatgttcg cgcaaccacc gatgaccgat ctctactgcg tcgtcgattc cgctcccctg     35700
     gtccttgatg accggcgtcc cgattgtttc ggatagggcg gcgtttcgac tgacgacgat     35760
     cacggaggaa atgtggttgc ttagggtaag ggcggccaag gtgtcctgga gaaaggccaa     35820
     cgcgaggtca cgccggcacg agaccgcgag acgtgacttg gcgacgtcga gactcctgaa     35880
     cggcacgatg acagcccact caccatagtc actcacgcgg tgtgtcccgt cgtgcgtgtg     35940
     tcgtagtccg ctcgcgtgcc gggcggccga ttccctcggc gatggcccgc agttcggcga     36000
     cggtcttctc ggagccgtgc tccgaacccg ccatccggga gatggtctcc tccatcaacg     36060
     ttccgccgag gtcgttggcg ccgccctgca acatcacctg agtgcccgtg acccccagct     36120
     tgacccagct ggtctggatg ttcgggatcc gcccgtgcag catgatccgg gccagggcgt     36180
     ggacggcccg gttgtcacgg ttggtcgggc ccggacgcga cgcgcccgcc agatacagcg     36240
     gcgcgctctg atgcacgaag ggcagcggaa cgaactcggt gaatccgcct gtccggtcct     36300
     ggattccgga cagcacccgc agatgcccca cccagtgagt cgggttgtcg acgtgcccgt     36360
     acatcatcgt cgaactcgac cgcagaccca gctcgtgcgc cgtggtcacc acctcgatcc     36420
     aggtggcggt gggcagcttg cccttggtga gcacccagcg cacctcgtcg tcgaggattt     36480
     ccgcggccgt gccgggaatg gtgtccagac cggcctcgcg cagttccgtc agccagtccc     36540
     ggatgctctg cccgccgcgg gaggcgccgt tgacgatctc catcggggag aacgcgtgca     36600
     cgtgcatcga cggcacccgc gccttcaccg cgcgcaccag atcggcgtac ccggtgaccg     36660
     ggagttccgg gtcgatgccg ccctgcatgc agacctcggt cgcgcccgcg acgtgggcct     36720
     cccaggcgcg gtccgcgacc tcgtcggtgg acagggtgaa cgcgtccgcg tcacccttgc     36780
     gctgcgcgaa cgcgcagaag cggcagccgg tgtagcagat gttggtgaag ttgatgttcc     36840
     ggttcaccac ataggtcacc tcgtcgccga cggcgtcctt gcggagggca tccgccagcg     36900
     ccaccatcgc ctcgagcccc ggaccctcgg ccgtcgccaa cgccaggtat tcgtcgtcgg     36960
     tgcagcccgc cggatcgcgc tcggcgctgc gcagcgccgc gaggacgtcg gtgtccaccc     37020
     ggaccgggcc gctcaactcc agcacctgct cgcggacggt ctcccagtcc ccgaacgcgc     37080
     tgccgaggtc gctgcgcgtc tcggtgttgc ggccgtcggt gtcgatctcg gtgttcagat     37140
     ccacccggcc cgtcgactcc caggactcgt ccggctcctg ccacggcaac ccgaccggct     37200
     tcgtgtcgag cttggccagc ccggtgtgcg ggtccgcgag ggcctgcacg tgcccggtga     37260
     tccgcggatc gatccacggc gagccggcca gcacgaactg cggctgcgcc gccgtgcgct     37320
     cggtgagctc gaacccggcc tcggcggtga tcgcggccag ggtgtccagg ttcggccacg     37380
     gccgctccgg gttcacgtgg tccggggtca gcggcgacac gccgccccag tcgtcgacac     37440
     ccgcacccag caacgccagg cattcggtgt tcgacaccag gttgggcggt gactggatgc     37500
     gcatccccgg gccgagcagc agccgggaca cggcgatggt cgcggcgaac tcctcgagac     37560
     ccgcgtccgg ggcgtcgcgc atcgcggtgt cgggcttggc gaggaagttc tgcacgatca     37620
     cttcctgaac gtgcccgaac gccttgtgcg acttgcggat cgccatgatc gattccgccc     37680
     gttcccgcac ggtctcgccg atgcccacca ggatgcccgt cgtgaacggc acactcaacc     37740
     gcccggcgtc ggtgagcgta cgcaaccgca ccgccggatc cttgtcgggg ctgccgtagt     37800
     ggcattcgcc cttgtcggtg aacaaccggg tcgacgtcgt ctcgagcatc atgcccatcg     37860
     acggggccac cggcttgagg cgggagatct cctcccagct catcacaccc gggttcaggt     37920
     gcggcagcag cccggtctcc tcgagcaccc ggatcgacat cgcccgcagg tagtccagcg     37980
     tcgaatcgta gccgcgctcg tccagccact gcttggcctc cggccaccga tcctcgggac     38040
     ggtcaccgag ggtgaagagg gcttccttgc agcccaattc ggcgccctgc cgggcgatct     38100
     ccagcacctc gtccggttcc agatacgcgc cgcgcccctc ggcccgcaac ttgccgggca     38160
     cggtcacgaa cgtgcagtag tggcacttgt cccggcacaa ccgcgtcagc ggaatgaaca     38220
     ccttgcgcga gtacgtgacg gccctgggtc tgcccgccgc cagcaacccg gcatcccgaa     38280
     ccttcgccgc cgacgaacac aggtcggcca ggtcgtcgcc gcgggcctgc agcagggtcg     38340
     tcgcctcgcc cacgttcaga gtggcgccgt cgcgggcacg acgcagcacc cgccgcatcg     38400
     taaacgaatg cggggcttca gcggtatcag ctctcggcac ggttgcggtt ggcaagggat     38460
     cgatgtcgag atgtctccca ggcgtcatcc gatcgtcttt ctgctggcgg ttactgatcg     38520
     aagtgcacgg cggattgcta gcagctgatc cagcgcttcc gttctcacat gatgattcga     38580
     ggttctatcc gcgatcatcg gaatcgtgcg gtaaccgttg gcatggacct ggctaatgcc     38640
     acactgcccc aacaccgtgg taccgggcag aaacttgccg ttgcggccgg tcgccggagg     38700
     agaggagcga ttgtcagggt ctcggcacgt cgttcgatag cggtgctcac ctgctgtgtc     38760
     ttcggatgac acgccgatga agctgaaaat tcagggcggg cacggacgcc cagcaatgat     38820
     tcaagttcct acaccagcac cacaaccagg aacaagccga tcccggcgtg tcatcttcgc     38880
     ccatgcccac cgctggtgtc gacatccggc cacggactcg gcgggacttc catcacgccg     38940
     cggtgcccga ggtgtccgcc gcagtgcatg atccacgcta accgtggtgt gtgcggaaca     39000
     cgatcggggc ggtgctggcg atcgcggtgg ccgcgacggt ggccagcgtt caccgcgatc     39060
     ggcgaatgga ctgccatgta ctcgatatcg agcgagaacg gctcggtacc gcggtgtcgt     39120
     gccgaccgag tcgacgatct gtttccgcac gcagtccagg tgctgcagcc ggcctgcacc     39180
     atccgccggg ccgcaacggc aagagtcaca ccgaggtcgt ctacgcggtc acgtccctgt     39240
     ccgcggtcga tgcgcatctc ggacgggtcg cgacatggct acgcggacag ggacgataga     39300
     aaatcgcctc tgttggattc gggatgtcat tttcgatgag gaccgcgcag gtccgcaccc     39360
     tctgcgggcc gcaggtgatg ccaccgtcag gaacctggcg ccaagcctcc tgcgcctggc     39420
     cggacacgat aacatcgccg ccgcgatcag acaccacagt cccaaccctc aacatcctat     39480
     cgacatactc acaagcagtt gaaatgcgac attgccgggc cctggcgttt gtggttcaga     39540
     ggtgcacgaa gcctgcgtca acgggaatgg atgtcccagt gatgtaccgt gactcgtcag     39600
     aggccaagaa cagcaccagg ttcgaaatat cctgtactgg aatgctgtca ataggcaaag     39660
     cgttcatgga agaaagggtc tccttgacgt catcccaacc gggatgatcg agatcgggac     39720
     ggaataaccg gaacaggtgc tcattttcga ccatgggggt ccttacgcca cccggatgaa     39780
     tcgaattgac gcgaatacta aagggagcca attcgcctgc catatcgcgc gcgagtccag     39840
     ttacgccgtg cttcgaagat gcgtagtgtg cgataccgcc ccgccctttc aggccaaaca     39900
     cggagctggt cgcaatgaac gacccgccac cggcggcaat taggtgctcg accgtggcct     39960
     gtgcagtatt gaaaaccccg gttagattca ccgaaatcat gtcattccat gaatcaaccg     40020
     tcagatcccg aaccccgccc gcgctccaaa ttccagcgtt tgcacagaca atatcgagtc     40080
     ggccgagatc ttgaacgcac cgtgccacag tagaccgtag gctgtccgag tcgcggacgt     40140
     cacacacagc ggtgatcacc ctccgcccgt actcttcgac aagcctgccg gtttcgtgca     40200
     ggtcattatg atcggacatg tcatacggca cagtcgagat ctgatcacaa aggtcgaccg     40260
     cgataatatt tgcgccctcc tccgccattc gaagggcatg actccgccct tgcccgcgag     40320
     cagcgcctgt tacgagagcg actttacctt ccaacctgag catatggagt aaatctcctt     40380
     ccattgatgt gatgtagatc gcgccacaaa tgctaggtca tgtgccagtt cgtgaaagta     40440
     ccaatgtgag acagccggcg ctttgacttc agtccagatc cgccaggcga tttcaccgtt     40500
     cgagtctgtc gtacggcgcg aacattactg ctgggatgga taattggagt tgccacccgc     40560
     caggctgcgc cgagcagggg gcaatctcgc agatgaaagc atctcaccat cacgcttggt     40620
     gtcgttggct ccaacttcgt ggcagcggtg gggttggttc ccagtggtgc ggctggccga     40680
     gacaggtggc ctgcacgagc cgctcgagga gcatctgagc gttggttcgc cgaacccggt     40740
     ccctcagtcc ggcagcatcg tcgcagcatg ctcgtcgccg cgtacagcga tctgaatcaa     40800
     cgacggtgga tctgggcgcc gaaagcaagt gggcaagact gaagcattcc gggacggttc     40860
     cgaacgacgc tcggaacccg gcaatccttg ggggaagagt gcctcagaag aggacattcg     40920
     aaaggtgttc tcttgtgcaa atattccata tgaggcgctg caaagcagcg ccgatccagc     40980
     aagtaagact ccagcaagta ggactccagc aagggagctg aacatggcac taaagttcgg     41040
     agcgttcatg gctccgttcc actgcccggt gggccaagac cccacctacg caatcgagcg     41100
     cgacctatcc gtgctccggc acctcgatat gctcgggttc gaagaggcgt ggatcggtga     41160
     gcaccactcc tgcgggacgg agctcgtccc cgacccgttc atcttcatcg cctacgccgc     41220
     gcaggaaact cgacacatca agctcgggac cggtgtggtc tcactgccct accacaaccc     41280
     gctctggatt gctgaccgcg cgctgttcac cgatcgcctg ctgcgtggtc ggtttatgct     41340
     tggtctcggc ccgggttcgc ttccgacaga cgcggcaatg atcggcatct cgatggcaga     41400
     gcagcgcggc gcattcgagg aggacgtcga cgtcctgatg gcgattctgc gcggggaatc     41460
     ggtcacacat gagaccccgc gctaccgact gcacgacgcg cggacccagt tcgctcccta     41520
     cagcgacttc gagatcaccg tggctgcggt cgcgaccccg accggcccgc gtgtggcagc     41580
     gaagaacggg ctcaatctga tgtctgtcgg tgctaccgcg cagggcgggt tcgacgcgct     41640
     ggcactgcac tgggacgtca tggaagagcg ggccccccaa ttcgggcaca cgccagaccg     41700
     tgccggttgg cgcctggtcg gcccgatgca cctcgccgag acaaaggagc aggcaatcga     41760
     ggacgtccgg cacggcctcg acgcatggtg ccactactcc cagcacatcc tcgccgcacc     41820
     acattttcgg gcggtgggcg agactttcga ggaacgcgtc gactggatca acgagaccgg     41880
     actaggcgtg atcggcacac cggacgacgc cgtgcggcag atcgagcgct tggaggaaca     41940
     gtccaagggc ttcggttcct acctgctgct gcatcacgaa tgggctcggc acgacgcggt     42000
     gttgaagagc tatgagctgt tcgcgaacca cgtcaagccc cgcttccaag gcagtacaag     42060
     ccgactgcag aaggccgagg actacgcggt atctcgctgg gccgaactcg acaaacgtca     42120
     gggcgacgcg atccaggcgg cgacggaccg gcacgtcaag gagcgtgccg cggctgggag     42180
     ggcctgatct ctcgcccgtc gaggaatgac gtccgccgat ggttgatggc gatgaggtaa     42240
     ggactgtggc cctgatgttc ggccccaaga agaaggttct cccctgggaa gatggattcg     42300
     gtgacactgc ccgcgccttc gatgcggccg agtaaagcgt cgtggcgaat gcgtcctgtt     42360
     cagtggaagc ggtccgacgg gactgacagc ggcgcgcact tagtaggggt gagcgtcacg     42420
     cagagtaggg gtatggacgc ccctgcagga aggagagatc cagatgacaa cgatcgagtc     42480
     ggtgacgtcc agcgaccagt tgcgccgcgc cttcggatgt ttcccgtcgg gcgttactgc     42540
     tgtgtgtgcg gagttcgacg gcgtacccat ggggctggct gcgagctctt tcacatcggt     42600
     atcgttcgac cccccactgg tgtcgatctg tatgcagcat agctccacga cctggccgac     42660
     tctccggaag agaccccggc tgggtctgag cattctcacc gaggggcagg gcgagatctg     42720
     taaacgtctg gccagcaaga tcggtgaccg gtttgcgggc accgactggc ttgccaccga     42780
     cgatggcagc gtgtttatcc atggggcaac attatggctc gactgcacga tccacgccga     42840
     ggtgccatcg ggtgaccacg atatcgtggt gctgcgaatc catggtcttc gttccgaccc     42900
     ttcagtgtcc ccgttaattt tccacggcag ccagttccgc cgcctgaccg ccgtttgatg     42960
     gaagacgaga gccccatgga ttcttgtcgt cccgatactg cggagcaaag ggtccgcaac     43020
     gctctcacgg ccatcgcggc cggtaggcct gtcgtcgtaa tcgatgccgc cgaccgcgag     43080
     ggcgagggcg atttgatctt cgccgcagcc ctcgccacaa cggaactcgt cgccttcacc     43140
     gtccggcaca catccggctt cgtgtgtgtg gccctgcctg gggacgagtg tgatcggctt     43200
     gggctccccg cgatgcacca cagtaacgac gatcggttcg acaccgcgta ccgaatcacc     43260
     gtggacatgc ggggcaccgg gactggcatc tccgccgctt ccagggccgc gacgattgcc     43320
     gctctggcca gtcccgactc gctggccagc gacttcgtcc gtccggggca cgtcgtcccg     43380
     ctgatggcga ggcctggcgg cgtgctggac cggccgggcc ttacggaggc cgcggtcgac     43440
     ctcacccggc tcgctggggt gcccgccgcc ggcgcactct gcgagatcgt gtcgcaggat     43500
     cggccggtcg atatggcccg cggcccggaa ctcgaacgct tcgcgaagga gcatgatctc     43560
     gtgctcctct cgatcgcgga cctgatccac taccggcagc gcactgaacc tcaggtgcgg     43620
     aggggggcgg tgacgtcact gcccaccgac ttcggacggt tccgggccgt cggttacgtc     43680
     ggtgcgcatg acggagcgga gcacatggcg ttggttgtag atcccaccgg tggaaggcaa     43740
     ttcgaggaag tgcctgttca cgtccacacc gaatgcctca gtggagatgt cttccgctcg     43800
     accgcctgcg gatgccgcca ggagctcgaa aaggccatgt tccagttctg cgctgagggc     43860
     tgcggcgtcg tcttgtactt gcgtccaccc ggggggccgc gcgcatgcgg catattcgcg     43920
     accgagcgga acgagggcgt caactctagc gcgatgcaag ccgtggccga ttggattctt     43980
     gctgacctag cctcgacctt tcctgcggct gatgtgtcgg cctgatcggg ttcggtgctt     44040
     cggccgtgaa tccgatgaac agggcgtgag cgaacctacc gaggcggtcg ggtggcgtcg     44100
     ggatccacat gcccgaaggc cggttgccct tctatctcgt cggtcacggt ttctactgtt     44160
     caggaagggc acgggtagcg tagcgagcct gccgaggacg attacgacca tgcccgccca     44220
     gggcgcggac gcgggcagac ggaggtggtt tcatcgtgcg tggcgggcga tgcggccggc     44280
     gatcgagaac aggcacagcc gtggtcgttt gggttcccac cgccgtgcga cgttgtcgat     44340
     gagggcgaga atctgcatcc cgcggtcagc tcgacggcga tggccacgac cgcgagccca     44400
     gatctgattc tgcgcgaatc cgtgcagggg aaggttgatc aggccggtgt cctcggcggt     44460
     gcgaatgctg acctcgcagc gggcgcggcg gtggtgccgc aactccaggt cggccagttc     44520
     accgcgggcg ctgttggtga tgaacgcagt ctgccgcagc cccgtcgaca tcggtaaggg     44580
     caactgcgcg ccggggtgcg gtcttgcctt acggatgatc acccgcatcc cgtcgggcca     44640
     cccggacagg tcgagcaccc cggtcgcgtg gaccacccag gctccgacgc gacaattccc     44700
     gtcggtacac agagcggggt ccaggcgtcg gcggggatgt cgccgatgac gttcaattgc     44760
     ccgatcaccg tccggtccga ggctaacttc tgtaccggcg cgtcgacacg ccgacgagca     44820
     tcttctccat cgccatcgtg cccaggatct cggtcgaggt gtacagccgt acgagccgat     44880
     ctgcaaatcc ccggacccgt cagcccgaga gttcaagggc tggtgtccaa gtacgtcaag     44940
     acagcgccat tgttagtttc gctcgatgtg cgcgcggacc ctggcgcggt ccttgtcggt     45000
     ccaccctttg ctctcggcgt agtcgagcat cgccgtaaag gcatcggacc atccaggtcc     45060
     gacccggtcg gcggccatca ggcggatggt gctcaccagc accatgacgt gttcgccgtc     45120
     ggctagcacc tctccgatgt cggctcggcg cacggcggcg atgaggtcgt caccgcttag     45180
     tccgtagggg caaaccacgt ggaaggcggt gacatcttgc gggtcaacta gatcggccga     45240
     gtcggcggtg atgcggaagt acaattgcgt tctccatggt ttggttccag ccagcacaga     45300
     cctgagattt aatagctttg tattctacgg tgttccgatg cgcgggctta gattgcggcg     45360
     attcttgtct cagatctcga tcggtgcgag cggagctacg tgaggaatgt tcgctcattg     45420
     tcgagcggga tcgcttaaac gagttcgcac tttccggatt tgcccttgcc tgcgcttgtc     45480
     gaatgcgggt ggtcgaccgc cggccgagct cttggccttg cggcgggcga tctggtcgct     45540
     gcgttcgggg atggtacgtg agattcggcg tccctcagtt gctttcggat acgtggatgc     45600
     gagtacgcct tgtttgccag cagccggaat gctgtggtct cacgagcgcg atgagcctcc     45660
     aacaacggag ccaggcaggg gttgcccctg tctgtccggg cgagcatgtg ggttagcggg     45720
     cagcagtgca cgtcggtgag agcgtggatc ttggtgctca aaccgcctcg aggtcggccg     45780
     agtgcatgct tggcgggttc gttggccatt cttgcccttc gaccgagccc ctttgtgggc     45840
     atcggtcagt gcgccggcgg agtgctggtg ggcaggcacg atggtcgagt cgatcgagag     45900
     cagatgttcg agcgcaatgt cgtgttcggg ggctgccgca cgtgcagcgg cgaacatccg     45960
     ctcataggcg cccgaacagg acgtgtcgac gccttcggtc taaggtcgcg gctcgagcac     46020
     gacgagcggg atctcgcggt ctgtgcgcgc ttggtaggcg gcaaacccgg gatggacgtc     46080
     gatggcgagc gcccacaacc gctcccgctc gtcctgctgc gcgacgcggg cgtgcaccgt     46140
     ccgtcgctcg gtgccaacct gaacggtcgt gtccggattc gcacgcagat tgtggaacca     46200
     gtcggggttg cgtgggtgac cgcccttcga cgcgaccaat atcaggttcg cgccgtcctt     46260
     ggcatacacc agtcccgagg tccggtgtgt tccggaccgc gccccgacgt ggtcgatcag     46320
     cagagtctgc ttcaggtgca ggaagcggtg accaatccga ccgccgctgg cccggtagac     46380
     cacggtgtgg agcgctaaca tccgcttgta cacgggccac gagtgctcga ctaggttgag     46440
     gtaggcacga tttacggcct caagcataag gacctccgaa ctcaggattt gtaaggttta     46500
     gcatggtttc acaaggtgtc tcatagggtc ggcaagctct accacgtgac accgaatagg     46560
     ctggactctt gctgatgcag attatgcata ggtttggttc tcgtcgaacg cgatctcgac     46620
     tagctcgcgt cgctctccgt aaaagcggat cccagtttcg tcgtgtccgg gaaagaggag     46680
     ggattcgtgc ttcttcgcga cctcgatcag gtcacgcgcg gaatcgcgcc actgttcagt     46740
     atcccaaccc atttgcggtt cagatttgcc ggggcagctc tcgtgtgtgt acaaggcgtc     46800
     cgaagttagc aggacactgc ctgtgctggg caagtcgagt cgcatagaga gctgccccgg     46860
     cgtgtggcca gggctgtgca tcacagttac gccatgcgct atctcgattt cggaaccact     46920
     caacagtgtt ggcttctttc ggtcgagaaa ctcccaatct gcgcgacaat agaaggattc     46980
     gtcgccggct aggcttgtga cgaagttgta ctcgtcctcg tgcacgagga tctcgacacc     47040
     cgcttcctca aagactctca gcccgccagc atggtcgctg tgcaagtgcg cttgaatgac     47100
     atacctgaag tcctcaggac cgagaccacg ggcacgtagg ctggactcga tgcacatctc     47160
     cggagtcaat ttcgacagat cgaccacatc gagccactcc gtgggccact cgtccagcgc     47220
     acgttccgag aatccggtct cccagagaat tctcccttcc ggggtatcga ttatgtaagc     47280
     aattgcaggt gtgcaatacg actcccccac atactcaggc acattgttga ggagcgattg     47340
     ttcatggact gtcacgtagc ccagattgag tcccgatagc ttatttccca ttgaatccgt     47400
     ccttgatgtt ggcctgctta gaaagcggaa ctagttcgac tcggaaatca ttcgccctgg     47460
     agcgggcggg aaattgtgac gaattattca gccactcgaa tatgcatagg ctagctaagc     47520
     ttcaatgccg aactcgcgca tctttcgata tagtgttgcc cgcccgatag cgagatgctt     47580
     tgccgtggca gatttgttcc aaccatttcc ggccagtgcc gtcgcgatgg cgtcacgttc     47640
     tgctatttgc agtgttgata actgcatatt ggggccgaca taacggtact cggcgggaag     47700
     atcgtgaagc tttacgtcat tgaatcccga attcaggatg gcactgttta cgacacaaca     47760
     tagttcggct atatttctcg gccagctaca gcgcatgagt gcgccgagcg aatctcgact     47820
     gaagcgcagt ggggcgcaat cgatgtctga ggcggcaata atctcggcga cgagctgggg     47880
     tatatccgcg gtccgctcgc ggagcggcgg cacatcgata atgacatcaa ccgcctgaag     47940
     tagcggagcg aatgcatctt ccgatcccca tgattccgca ccggtgagaa caattggggc     48000
     ggtcgccgcc tccacgtagg aagcaaggtt ggcgatttgc gatcgatgca ggttctggac     48060
     ccgccggaca atcaccgtct tgctgccgtg tagggcggcg cggacgtcgt gaagcactac     48120
     tcgttgctcg tcgtcgttcg caggcaggag gaactcaacg tggccaactc ctcgatcgag     48180
     cagtccagcg gcgagcgtgg ccttgccggc gcctgactcg ccccgcaggg ccacgacgtg     48240
     gctggtgttc cccgctgctc gtacccgctc aagggtgctt tcccagactc gactccactt     48300
     accgccccgc ggttcggaca acagtcggct aggttgcggg gactcgtccg gtaggaacga     48360
     tagaacaacg cccgaagtca cgctgtccac aaggactcga gaggcacgga ttcggctggt     48420
     cactcccccg gtgagctcga ccaccccagt catagagttt cgccgggaga tccactcctc     48480
     cgcccagttc cagagcacgg catgatcccc gggcccaagg atcgcagaag cttgcgaatt     48540
     catcatgagc gtctcagggc caaaagctac tactgcctgc gccggagttc ggcacatacg     48600
     gatgtactcg tcgaggagcg cccgctgcgc ctgggttgat gtgtcgcgga gcctcgcctc     48660
     gatggagcgc cccacacgac gagccagcaa catcatcagc tcgttgtttt cccctgtgga     48720
     actacacagg ttcacgacgc cgaccagccg attcccgatc ggatcaaata tgggcacccc     48780
     cgaacatacg aatcggtcca aactttcctt ataatgctcg tctccgacaa tcatcaacgg     48840
     ctggtgcgct tctaacacgg taccgatacc gctggttcca accgcttgct ctgagcggtc     48900
     catccccggc tcgacaccga cctggtcgag cgcactacgc aattcacgac caccgccgct     48960
     gagcacggaa acgactgtgg cgttgttatc agctaaaaga attgcagttc tggttccggc     49020
     aagttcctcg gcgatgcagt caagcgctgg ccgcgctacc cggagcagtc gagactcggg     49080
     gtcgaacgca cggtagcaag gatcgctcag tcggtctcga gcgattccat agtccgctga     49140
     cctctgccac gacgctgcga tgaccggccg gagcggacgt ctggagtctt caccactacc     49200
     gcaccctcga cggtccggtt ggcgcgactc ccgcgcgtcg agcccctgca cgggcaggga     49260
     gctgctcatg ttccgcactc caattccgcc tgcatagatg gcgagatgat acccgtgcgg     49320
     taagcataca atgtatcggc atgctcctct atatatctga cgcgaccgtc gtcgccaatc     49380
     tcgtagatcc acacgtattc gttgtcgtag gccgagccat cgggcaagac accgcggagt     49440
     cgctgacgca cgaccgccgt gttcccctcg caaacaatcc ccccgacctc acggcgaacg     49500
     gatcccggct gcatcactga tgcaatcacg cggccagcga gcaacgaaac gatgagctct     49560
     cggttgcgca aaggactggc tacgagagac ggcggcggcc tcatcacgac gtcatccgac     49620
     aatagttcgc tcaggcgggt atcgtcaccg cgcaagcgtg cgtcgagcac tttctcaacg     49680
     acttctcgtg tcgatccggg ccgtgcattt cctttggacg acaaggggac accgaaactc     49740
     atttcacctc atttgttagg acaccacgat cacgccggaa attggaccgg ctgcactccc     49800
     gatagctacg ttctttggat aggcgttctg cccgcccggt agcccgcccg gtagcccgaa     49860
     ccggcgtaat gcacatcgtc cgatcaatcc gtctaccatc cagcatctac ggtatccccc     49920
     atcaaggtgt ctcgaatgtt ttaatctgag acaccggtag ctggtcgagt gccttgacag     49980
     gcgtgttgac agagactccc ggttctgtcc gatcggcctc aacaccaggg catcaccgct     50040
     cccgtactgc ggtcagcgac ggcgcccttg ggttctgaac ggttcgggag gcgtgtctca     50100
     aaacccgcga gcggcgatgt tagttcgaca agcagattgt tatgcattac tgcgttgccg     50160
     aactcggctc tttcgggtgc gctcacgatg gtgaaggagc atccctccca ggacattgac     50220
     atggcgcatg tggcgatcgg atcgttccac tttcgacgac agctcgaaga atccgaaggc     50280
     gtcgcgaacc ccccgatgcc acggatgcgc gctgctccgg tctacaacta tccggctgag     50340
     cacagggttc actatccacc atgaaaccca tcgaatctac tattgcacag tgcatttgag     50400
     atcagggttc gttcccgccg cggagggtcg acgatggcct tagctcatcg tcggtaccca     50460
     gcggcgccga cgggcgggca acgctcaaca cctcgttgcc ctcgtccggg ccggggatga     50520
     tctttttcac gggcaagccg ctcgtacgac caccaacatc tccccgaacc tggaattcgt     50580
     gaatccccga accctggatc cgaagtcgcc tgaaacctac ccgtccacac gagtcgtcga     50640
     taccggtgtt cctaaactga acattcagca cctcgagcgg agccgtacgg tacaaggtgc     50700
     cgtaaatcgg catttaaagt cagccagtaa gtggagggaa attgtgatgg catcagtcga     50760
     agcccgacag caggaccatg cggcaatgat ccgtggccgt cgatttgcca tgctcatcga     50820
     cggtgagctt gtcgacggtg cgacaagtca gaatgtcatc gatcctgcga ccgaggacgt     50880
     catcgcaacg gcgccggtag ccgactcagc acaagtggat caggctgtgc atgcggcttt     50940
     gaaggcgttt cacacgtggc agcactcgac attctccgaa cgttcgacga tcatcgatcg     51000
     tatcgcagac gccatagaaa agaggcgtga ggagatcgcc cgaattatca cgcttgagaa     51060
     cggcaagccg ctcaaatccg cacaggacga ggttgattgg tccttgtcgt gggcgcgcca     51120
     cgtcgctgga tgctcgatcg agtcgacaat catcagggat gatgctacgt cgcgtatcaa     51180
     gatacggcat aagccgattg gagtagtcgc ggccatcatt ccgtggaatt ttccgttctt     51240
     ccagatggtg tacaaggtcg ttccggcact attttgcgga aacacggtgg tcgtcaagcc     51300
     ggcgccgaca acgccactga acgcaatggt gatgggcgag atcctgcagg agatcatccc     51360
     taagggcgtc gtcaacatcg tgggtgatct cggcgaggcc ggaccccatc tgacctcaca     51420
     ctccgatgtc gggaaggtct cattcaccgg ttcgacagcg gctggccgca aggtcatggc     51480
     aagtagcgcc gagaccctca aacgcgtcgt cctcgagctc ggagggaatg acgcggcgat     51540
     tgtgatggac gacgcggacg tggagaaggt tgccgaggaa atcttctcct gggcgttcgt     51600
     aaacagcggt caagtctgca tcaacatcaa acgcgtgttc gtcccgcgcc cgctttacga     51660
     ccgcttctgt gacgccttcg ccagccacgc ccgcgcagca accctcggcc acggcctggc     51720
     cccggagact gatctcggac ccgtccagaa cgcccgccag tacgaagccg caaaggccta     51780
     tctggagctg gccaagaagg acgggacagt aatcgccggt gggaacatcc cggatgtgcc     51840
     cggctacttt gttgagccca ctgtggtccg ggacatcgac gacgccagcg ctctggtgcg     51900
     ggaggagacg ttcggcccgg tccgctccat cctgagttac gatgacctcg aggatgctgt     51960
     cgcgcgggtc aacgacaccc cgtatgggtt gggcaattcg gtttggggca gtgatctgga     52020
     ccgtgcggct gcagtggccg atcgcctgga gggcggcacc tcctgggtta acacccactt     52080
     ctcactggct cccgatgtgc catttggcgg tcgtaagcag tcaggtatcg gggtggagtt     52140
     cgggatacag ggcatcatgg agttcactga gacacatgtc atcaacgttt ccaagggttg     52200
     accggggcca gctactaggt cgacccggaa ccactgtccg tctgggaggt agctgccgtg     52260
     gactctccaa cacctgggac cacggcggcg agccacgcga tacaggcgag cggataccct     52320
     tgaaccttgg cctgacggtg cccttttccc gcaccacccg tggcagcgcg tcacgacccc     52380
     cccatgctga ggtgttcagt tctggaaagg gtctgcagca attctcccta gcaccgaccg     52440
     ggatcccacg cttcatacct gttgcttcac agcgtgattg gatccgacaa aagcgggctg     52500
     aattccgatc ggcgccgctg gactcgactt tcgcggttac ggggcggctg cgccgaagtc     52560
     tagttggtag ctgcggatca tgttggggtc gatcgtatct gggatagatt cagagaatcg     52620
     ggtggcgggg gtgcggcgga gcttggcgag catgtctcga aggcgggttc ggtcttgccg     52680
     ggtatcaggg ttcggcggcg gacgaggtcg tcccggtggt ggccaaggtg gcgtaccagg     52740
     cgatgatgac ggtctgggcg aggaacccga acgccacggc gcggggaacc cgattccggt     52800
     cctggccgac cccgagtatt tgttttgcga tggccttggc cggttcgatg ctcctccgct     52860
     gggcgtgccc tcgtcggccc gaaggccgaa caggatcggc aggcacaccg ggtgagcgtg     52920
     gaacggcaga tccaccacga tcccggctat gatccagcga ctgccgcggc cgagtgtagc     52980
     cggtccctgg gcggcgccgt cgtcggtcga gaacacgtga tgggctctct tccccccagc     53040
     ggcggaagat atggtcgtcc accgcgacgg cgatcgacgc ggcggtgggt aacagccgtt     53100
     cgacgatcaa ccgcgcgacc gcgagcccga accgatccgg atcccagaca tgatgggaga     53160
     agaaccggca cgccgagtgg aacgacacca gcgctgccat cccgaacgcc gcgagcatgc     53220
     ccaccacgtc tggtctcggc gaaaggtagt cgcattcgag ccgcaaggga taaccggcca     53280
     acgccaggtc gtcgccgtcg cggggggcgc agatcaccgc cgatgcgcag aggggaacct     53340
     tgcgtgtttg cgaccgtccg atctgccatg ggttcgtatc agagcgtcag ttgggcacct     53400
     gctgggcagt gcggcgatat cgttgggggt ggatcaccga gaaggtgagc ggtggtgcat     53460
     ttcttcgaca gtggctcgga tgagatgaat cgatgtagtt gatgaccgac gacgatccct     53520
     tcgcgacgca acgcgacgcg aagggttcga tcacggcgga gctggcggcg gacggattcg     53580
     aggacgcaca agagatcggc cgcggcggct tcggcgtcgt ctaccgctgc acccaggcgg     53640
     cgctcgaccg caccgtggca atcaaggtcc tcaccgcaga cctcgacgag cagaaccggg     53700
     aacggttcct gcgtgagcag cgcgcggcgg gcaggctgac cggacaccct aatgtcgtca     53760
     atgtcctcca cgtcggcgtc accgacaccg gtcggcccta catcgtcatg ccgtaccacg     53820
     cccagaactc actcgacgcc cggatccgcc gccacggacc tctctcgctc gacgaagcgc     53880
     tgcggctcgg ggtgaaaatg gccggcgccc tcgagaccgc ccaccgcctc ggaatcctcc     53940
     accgcgacgt caagcccgga aacataatgc tcaccgacta cggcgagccg gcactgacgg     54000
     atttcggcat cgcccacatc gccggcgggt tcgaaaccac cgccggcgtc gtgacgggtt     54060
     cgccagcctt caccgccccc gaggtagtga ccggcgaacc cccaagtgcc gctgccgatg     54120
     tttacggcct cggtgccacg ctgttcgctg cgatgaccgg tcacgctgcc ttcgaacgcc     54180
     gcagcgggga gcaggtggta gcccagttcc tgaggattac ggccgagccc gttccggacc     54240
     cacgcaagca cggcattccc gaggacgtca gcatgatcat cgaacatgcc atgtccggca     54300
     ccccggcgag ccgccaatcc gccaccgaac tcggccagca actccgagca tcccaacttc     54360
     tccatggttt cccggtcgac gagatggcac tgcacaccga tccgggagcc gtgcaaccag     54420
     gcacaccacc cgggcccttg ccgtcatcac cctcacccct ggaatcgggc ccaccaggtc     54480
     agcttccgct tcagctgact agtttcgtcg gccgccgcac ggagcttgcc gaagcgaaga     54540
     acttgctatc cgcctcacgg ctggtgacgt tgaccgggat cggcggggtg ggaaaaacgc     54600
     gcctcgcgct gcaggttgcc gccaagacac aacgcgattt ccccgacggc gtgtggctgg     54660
     tggagctggg tgacctgcgt gacgggtcac tgttggaggg tatggcggcg accgccctgg     54720
     ggttacgcga tcgttcggcc aggcccgcac acgacctgct catcgagttc atcgcccctc     54780
     ggcaactgct gctcgtgctg gacaattgcg agcaggtggt gaatgcggtg gcgaaattgt     54840
     ccgaatccct gctgcgcagc tgtcctcagc tgcggatact tgcgaccagc cgcgagtcac     54900
     tcggtatcgg cgcggaagcg gtgctcttgg ttcccccact agctataccc gatcccgatc     54960
     acctaccgag aacaatgccc cacaacgacg cggtggcatt gttcgccgaa cggggcgctg     55020
     ccgccgtgcc cgggttcgag ctcaccgagg acaacaaggc caccatcgct cgaatctgcc     55080
     ggcgactgga cgggttgccg ttgccgatcg agctggctgc cgcccggctg cggggactga     55140
     cgcccgaaca aatcctggag cggttgaccg accgctacgc cctgctgacc cgcggcagca     55200
     gggacgcacc gtcgcggcag cagacgctgc ggatgtgtat cgactggagc cacaatctgt     55260
     gtacaccggt ggaacaacgg gtgtgggcgc agctgtcggt gttcgccggc agctgcgagc     55320
     tcggagccgc agaacggatc tgcgaccgcg acctgaccgc ggaggatctc ctcgatacgg     55380
     tgacctccct ggtcgacaag tcgatcctga tccgagaaga gtcaggtggc gcgctacgct     55440
     tccgcatgct cgagacggtg cggtactacg gccgtgagaa ggcgcagaag gccggcgaat     55500
     ttcccgaggt ctgcttccgg catcgtgact ggtgtgagcg gatggcgctc gatgcggagg     55560
     ccgactggat cagttcccgg cagctcgagt ggatcgccag actcgttcgg gagcaatcga     55620
     acctgaggga agctctggaa ttctgcgtgt ccgacagtcc cgaaaccgga gtcgggatcg     55680
     tcgccgccct attcccgtac tggatgtccg gagggtggtt aagcgagggt ctacgctggc     55740
     tcgatcgcct ccagatcctc cagatcctcc agactggccc gctcaccgtc gaacgagcca     55800
     aggcggtcta caccggctgc gtcatagccg gagtgcaggg cgacgttcga gcgtcgaccg     55860
     ccctggtgga gaagggtcgc gcgctcgtgg accggactac cgaccccggc atacgcgcgc     55920
     acatcgacct cgcggtcgga tacctgacac tgctcacagg gaatccttcc gacgggcatt     55980
     cacatctagc gaatgcagtc caggtgtaca ccgcacgggg cgacctcctc ttccaggtcc     56040
     tcgctctcat tggcctcgga ttgacgcacg acatgctgaa cgacacggag caggccatcg     56100
     aatgccatga acgggtcctc gcgattaccg aggcgcgcgg tgagtcgatg tatcggacct     56160
     attcgctgtg ggcgctcgcc gttgcgatat ggcggcacgg tgacggcgca cgagcggtcc     56220
     ggctgctcga gcgagcgctg caggtgtgcc gaagcgccaa cgaccgactg agcgccagca     56280
     tgtgcttgcg agcgctggca tggattgccg ccggggaccg gaacgcccga cgcgccgtcg     56340
     tattgacagc agccgcggac aatatgagcc ggtcgatggg tagcgtgaca gtgttctttc     56400
     acggccacct ggcgcaccag gacgagtgcg aaaacgagac tcgacgagtg atgagtgagc     56460
     agacgttcgc cgcggcccgc agagaaggag aggccctcgg tttcgatgcc gccgtcacct     56520
     acgcgttggg cgagcaacca ctgcccacca cgacagctac tgctggtccg actgcgaaac     56580
     cgacaaaacg cgagggtgaa gtcgccgacc tgatcgccga ggggctcacc aacagagaga     56640
     tcgccgctcg tttagcgatc tcgccacgca ccgcgcaggg gcacgtcgaa caccttctgt     56700
     ccaaactggg attcaactca cgtgcacaga ttgccacgtg ggtggtcgaa tcgcagaaca     56760
     agcgttcctg agacccacga tcatcgcggc cgcccaacag ctgttgtata gacggcgtcg     56820
     ccgaagccgc tgcgctgctg ttcgtcgagg tcgagcccga agcacaggca gggtagatcc     56880
     accgctggca ggcctgacgc agccgcccta cagccgcatt ctgcgacaag gcatctgcga     56940
     tccgatccga ccccgggtgc ggcgaccgtg gtgaaggcag agccgacatt ggtgaatgct     57000
     atcccggccg ccttcgcctg ccgggccacg tactcgtggc cgccgaggat gatctgcgcc     57060
     ccgaacggcg gatgaccgac atcttgatcg tcacatgccc ccaggtggga tccatgatgt     57120
     ggaacgagta gtagttgacg tattcgcctc tcctctcgat gttgacgacc cggcccgccg     57180
     ggccgcttca cgttccacac cgccgccggc gccttggccg ccaggacctt cgagtacccc     57240
     ggtgcccacc tcgtgtcccg gccgtgaggt agatgacggc gcgccgctgg ccgcgcccca     57300
     ggccttgacg cggcgggcga accggtcggt catccgcaat cagatgggtg ttgtcgagtt     57360
     cctcgtgcta gcgccaacac cgcacctaac ccgcctggtt tgtgcccgag cgggtagtag     57420
     tcgttgagca caatccacgc agtcgtagcc gctgagaagg aaatcaccgt cgcgctcgct     57480
     gaactggtcg cccatctact caatgtagaa ccacaccatt cacccgcgct cggtgagccg     57540
     aaactgcccg aagggccacc gattccgggc gcagacccgg actcggcgta gcgaaccttg     57600
     gtcgctagaa gctagtcgtg ggcgatacac gcccgggcaa ctttgtcacc gtactgttcg     57660
     acctggtcgc tcgggagctt ggagtcggtg aggatcaggt cgacttcgtc gatcgcggcg     57720
     actttggcga gggcgcggtg gccgaacttt gaactatccg cgacgacggc ggtgcgagtc     57780
     gcggccgtga tgattgcccg cttgagtgga acttcgagag tgttggtatt ggtaatgcct     57840
     gcgatggggt caatggcgtc ggctccgaga aaggcccaat cggccgagta gtcggacaga     57900
     aagtccaccg cgcgttcacc gacgagtgtg aagacggagc cgagtagctc gccaccggtc     57960
     accagcaggc gtaccgcggg gatagtggcc acgtactttc cgattcggag gtcgttggtg     58020
     atgatcgtca aatccgtttt gtgacgaagc tcgagagcga cctggtatgt ggttgacccg     58080
     ctgtcgagga tgatcgtttg accatccgcc acctgctgtg ccgcgcgatg tgcgatcgcg     58140
     accttctctg gtcgtcgctc ggtctccttc accgcgtacg gaatttcgga ggaagtgccg     58200
     actacgggcc tcgcccctcc gtgggtccgt tcgacttggc cggaacgaac caacgcgtca     58260
     agatcgcgcc gaatcgtaga cccatccacg tcgaactcgc gcgacaaaac cttggcctcg     58320
     acgtagccgt cgacctggag gcgttggagt atctcaccac gtctttcagt tgcggacaac     58380
     aaaagcactc ctcagcactc gacgttgtgg acccagggcg gtctcgggag attctagctt     58440
     tcggtgcacg aatattgaca gttcgaacac tagaacggca tgattgcgtg cacttcgtgc     58500
     gcgaaaccgt gcagcgtgga tgtctaggtc ccgcgccgtt cgccaagcaa atctcgagga     58560
     gttcccgatg caaataggtt tgataggtct ggggcggatg ggcgggaaca tgcgagagcg     58620
     cgttcgggct gcgggtcatg aagtcgtcgg attcgatgcc gatccatccg tgagcgacgt     58680
     cgaatcgttg gccgagttgg tatttcacct cagcgccccg agattggtgt gggtgatggt     58740
     tcccgccggc gacccgaccc gcacggtgat caacgaactg agccagctcc tggcgccggg     58800
     ggatctcgtg attgagggcg gaaactcccg cttctccgac gatgaactgc actccgatgt     58860
     ccttcgggag catggaatcg gctacctgga ctgcggtgtg tccggtggaa tatggggctt     58920
     gaaagaaggc tacggactga tggtgggcgg tgaggaagcg gatgttgccc gtgcaatgcc     58980
     gatcttcgac gcactccgac ctcccggaaa tcgggatgag agtttcgttc atgcgggacc     59040
     agtcggtgcc ggccactatg ccaagatggt gcacaacggc atcgagtacg gcttgatgca     59100
     ggcgtacgcc gagggctatg agctcttggc cgccgaaccc aggatcagcg cccccgacga     59160
     tgtgatgggc gcgtggcagc agggcactgt cgtgcgttcc tggttgctcg aactcctggt     59220
     gactgcactc caggaggacc caggcttgag ttcgatctct gggtacaccg aggactcggg     59280
     cgagggccgc tggaccctcc aagaggccat cgcccacgcg gtcccggtgc cggtgatctc     59340
     agctgccctc ttcgcgcgat tctcatcccg acaggaggat tcgccgacga tgaaggcggt     59400
     gtcggcgctg cggaagcagt tcgggggaca tcaggttcgg atcatggagg cgatgcagtg     59460
     gtgatcaagt tcgggtacaa ggcgtccgcg gagcagttcg gtccgcggga gttggtggag     59520
     ctgggtgttc tggcggaggc gcacgggatg gattcggcga cggtgtcgga tcattttcag     59580
     ccgtggcggc acgagggcgg tcatgcgccg ttctcgctgg catggatgac ggcggtcggg     59640
     gagcgcacgt cacggttgca gttggggacg tcggtgatga cgccgacgtt ccggtacaac     59700
     ccggcggtgg tggcgcaggc gttcgcgacg atggggtgtc tgtatccggg gcggatcatg     59760
     ctcggggtgg gtaccggtga ggcgctcaac gagatcgcga caggctttgc tggggagtgg     59820
     ccggagttca aggagcggtt cgccaggctg cgggaggccg tcgccttgat gcgagaactg     59880
     tggctcggtg accgggtgga cttcgaaggc aactattaca agacggttgg agcatcgatc     59940
     tacgacgtgc ccgagggtgg gattccggtg tacatcgcgg ccggtggtcc ggtggtggcc     60000
     cggtacgccg gtcggagcgg cgacgggttc atctgcacgt ccggtaaggg catggagttg     60060
     tacacggaga agttgatgcc tgcggtcgcg gagggggcgg agaaggccga ccgtgatgtg     60120
     gcggagatcg acaagatgat cgagatcaag atttcgtacg acacggatcc ggagttggcg     60180
     ctggagaaca cgcggttctg ggcgccgttg tcgttgacac cggagcagaa gcattcgatc     60240
     gacgatccga tcgagatgga gagggcggcg gatgcgttgc cgatcgagca ggtggcgaag     60300
     cggtggatcg tggcgtcgga tccggatgag gcggtggcgc agatccgccc gtatctcgat     60360
     gccgggttga accacctcgt cttccacgct cccggccacg atcagaagcg attcctggag     60420
     ttgttccagc gggacctggc cccccggctg cgagggctcg catgacacac atcgttaccg     60480
     ataccccgct gtggaagaaa ctgtccgacc accactggga ggtcgtaggt actcacctac     60540
     gggagctgtt cgacaccgac cccgatcggg gcgtcgatct catcgtcacc gcggccgatc     60600
     tctacatcga ctacagcaaa catcgtgtca cccgtgagac gatgggcctg ctcgttgacc     60660
     tcgcccgagc cgccggagta gagcgccacc gagaggcgat gttcaccggc gcacatatca     60720
     atacctccga ggaccgggct gtcctgcaca ccgctctccg cgcgaacccc gagcgcgagc     60780
     tgatcgtcga cgggcaggac gtggtgggcg atgtgcacac ggttctgcgt cgaatgggtg     60840
     agttcaccga tcgtgtccgg tccggtgcct ggcgtggggc caccggcgag cgcatccgaa     60900
     ccgtcgtgaa catcggaatc ggcggctcgg atcttggccc ggccatggcc tatcgcgcac     60960
     tgcgccacta cgtcgacggg cccgaggtac ggttcgtctc caacatcgac cccgccgatc     61020
     tgctgtcgaa cctgaccgac ctggacccgc gcaccacact gtttgtcgtc gtctccaaga     61080
     cattctcgac cctggagacg atgaccaacg catccgccgc ccgccgctgg atcaccgagg     61140
     cactggggga gcacgcggtg ccccgccatt tcgttgcggt ctccaccgac gaagaacggg     61200
     tcacagcgtt cggcatcacc gcccgcaaca ttttcggctt ctgggaatgg gtgggcggac     61260
     gatactcggt cgggtccgcc gccgggctct cggtgatgat cgcgatcgga cgcgaacggt     61320
     tcaccgagtt cctcggcgga atgcgggcga tcgacgaaca tttccgcacc acaccactgg     61380
     aatcaaacgc gcccgtcatc ctcggcatgc tcggtgtttg gtactcgagc ttcttcggtg     61440
     ccgacgcgcg cgccgtactg ccctacgcgc acgacctggc caggtttccg gcgtacctgc     61500
     aacaactgac catggagtcg aacggcaaat cggtacgaac ggacggcacc ccggtcggta     61560
     cgttcacggg tgagatcttc tggggagaac caggcacgaa cgggcaacac gcgttccatc     61620
     agctcctgca ccagggaacg cacctgattc ccgtcgactt cctgggattc gcggagccga     61680
     tcgaggatct gcccaccctc gatggtatcg gctccgtgca cgatgttttg acggcgaacc     61740
     tgttcgcgca gtcgaaggtt ctagccttcg gaaagaacgc cgatgaagtc gccgcagacg     61800
     ggacgccttc cgcgctcgtg ccgcacaagg tgatgtccgg taacaggccg tcgacaacga     61860
     tccttggagc gaagctcaca ccgtcgaccc tcggacagtt gatcgccttg tacgaacatc     61920
     aggtcttcgt acaaggaatc gtgtggggca ttgactcgtt cgaccagtgg ggagttgagc     61980
     tcggcaaaac atccgccctg gaactgggcc ccgccctctg ggacctagat ggcgccgctt     62040
     atgtcgggga tagttccact accgggttga ttcgtaccta tcggctggcg agaggggaac     62100
     gccgttgtct gccttgaacg tgtgccttcc ctcgccgatc gccgagtcct gggattggca     62160
     actgtctgcc gcttgccggg acgccgaccc cgcggtgttt ttccatcccg ataatgaacg     62220
     tggcgagccc cgtgcaagtc gagtacgtgc agccaaacgg atctgcctcc gatgccccgt     62280
     gcgcgcccgg tgcctcaact acgcactcga ttcgagcgaa cgccacggaa tctggggtgg     62340
     ctacaccgag gatgagcgca ggacgctcca aaagcgccgt gagatgcaaa gttccccagc     62400
     ttccatccgg ccggggcatc aagactgcgg ccggacgtta gctgctcgcg caatccaata     62460
     gcgacgcggg ctgtggtctg cgaaatgcgt aaacttagct tgtctgtata cctctgccgt     62520
     tgcgtcgggc atttgtttgc tggcgttgtt cggcgcctga catcgtgacg ttccttcctc     62580
     agagctttcg agacgaagac aggcggtggc acgtgagtat cacgtgtgcc cacccgaaca     62640
     gtcggccgtt ggcggtcggc ggtcggcggt cggcggtcgg cggtcggcgg tcggcgcaca     62700
     atgaggcacc aatccgcggg tcgacgtaat gccgttccgc gaagcgttct aacggtgttt     62760
     accgacccga ggtccttgtt cgagtagacc gacgcgctgc tgtgttccga cggcggctcg     62820
     gtcaccatac tggtcgaatt gtcactggcc gccctggtcg agttgtcact ggccgccgag     62880
     catcggcgcg gtcaccgtgc cctgtgcgac gcaatcaact gcggccgaga cgatctcact     62940
     cggctgcgcc gcagctagac cagctggcga tcccgcgtga tggggcgccc ggagcacgaa     63000
     cggacgttga catcagtgcc cgcctgatcg tcgcagatgc cggtcacttg ctcgatggat     63060
     ggagggctct tgttgtgcac tcgctgacat cgctatccat ctcgcatcgg ctcgtgcgac     63120
     ggcgacattc gtaagaattc gttggatcca tgcaatggcg cggcggggtg tgatcagaat     63180
     ggcgcacgcg atcacagcgt gaaggatcag caacggcatg tggaagaact cctgggtctg     63240
     gggtgacgta ccggcggtac atcggatact tgatgaattg gggatctgag cctgacaagg     63300
     cagaccgccc caaccatctg ttgccgtcgc aaaaggcggc gtagagacgc gcacttaccc     63360
     agggaaggcc tcgtcatggg gatactcccg ttcggctccg tggaccgcct tcacgacatc     63420
     ccgccttaga ttagagcgtg tctcaggtgg atgcattgac ctgtagtgcc ctatgacgcg     63480
     tggtagatga gctgtctctg cggctggtgc cggatacgtt gtgggagatc gtcgaaccgt     63540
     tgatcccacg cttcgtcgcc cgcccacagg gaggtgggag aaccccggtc aacgatcccg     63600
     cgatctatac cgcgatctat accgcgatcg tgtccgttct gacaggtggg tgcgcatggc     63660
     ggcacctgtc gccttcgttc ggagtgaccg ttcctaccgc gcaccgccgg ttcaccgcat     63720
     gggggccgcc ggggtgttcg agacactgca tctgaggtgc tcgaccggtt cgaaggcgcc     63780
     ggcgaactgg ctggtcggca gcgatcctgg acgcggcgag cgtccgagcg aaaaagggct     63840
     cgcgggccca gcccagtcga tcgaggcaag aagggatcga agatccacgt tttgtccgat     63900
     tcgaacagat cccactggtc tcgacatttc cggagcgaac acttacgaca gcaccctgct     63960
     gcaaccgatg gtcagcgcga ttccggcggt gaagtccagg cttgttccgc gccgccgcaa     64020
     acctgcaaag cttcgcgccg acaagggcca cgactacgac atccaccatc gatggctgcg     64080
     cggacagggc acccgcgcat agcccgacgc gggatcgaga ggaacgaccg actcggcaga     64140
     tacaggtgga agatcgaacg caccatcgcc ttggctcccc ggctaccgac gcctgaccat     64200
     ctgctacgaa cgccacggcg aacacttcgc cggattcctc cacctcgccg ccgcactcac     64260
     ctgcttcgag aaactccccg catggagaca ggctcttagc cgatccgtcc agtccgaaat     64320
     ggcgcgatag tcgatcgaca ctcacggcca cgtatccccc atcaggtagc gcaacgacct     64380
     gatcagggct gtggggcgtc gtctgccgaa ttggcggaga ccgaaatcaa tgatggtacg     64440
     ccggcatccc tccaactgag aagctcgaat tcacgacagg aagcagatct ttcagcggga     64500
     atgatgcatc ccccaacttt gcggggtcca cgacggctct cttcgttacg agctttctcg     64560
     ccattgcaaa ttcacgagga tttgaaacga cgtcggctgc gcgaacttcg tcatttctga     64620
     tatagaagac cgagatactg cgatcatgtt gcgggtctcc gcgcaccacg actgcgtcac     64680
     tcggacttat taatccgaca acttgcagct tcagttcgta ctggtcggac cagaaccagg     64740
     gtattgcgtt gtacggcgca gggttaccga cgagggtctg tgccagcgca cgagcttgct     64800
     cggtgctgtt tgggatcgat tcgagcctgc gggtaccgcc cgactctgag cacggatagc     64860
     gcgctacatc tcccactgca aagatcgacg ggtcgctggt ctggagcagg gaatcgacga     64920
     tgattccatc gttgacttcg actccggcgg cctctgcaag agcggtgttc ggttgcaggc     64980
     caattccgat gaggcatacg tcagtttcga tgatggtgcc gtcatcaagc accactctgg     65040
     acagttctcg atccggactg aaatcgaatc cactgaccga tcggccggtg tgcagggcaa     65100
     ctccctcttc acggtgaatc ctgtcgaaga acgaggacat aacaggcgac gtcactcgcg     65160
     ccagtagtcg ctgctcgcgt tcgatgaccg tcaccgcaac acccaaggtt ctggccacgg     65220
     ccgctacttc caaaccgatg tacccgccgc cgatcacggt caagcgagta ccggatgtca     65280
     aatgtggacg caatcgctct acctgatcga gtgcccgcat gtagaagacg ttcgacgaac     65340
     tgttcaggcg ctcatcggga tatgtccgcg gggagcctcc ggtggccagc acgagggcgt     65400
     cgtaatcgag gtgttcgctc tcaccgaagg tgatgcgctt ccgctggcgg tcgatggact     65460
     tgacccgcgt gccgagtttc acgtcgatgt caaagcgtcc gtacatctcg tcggaccgaa     65520
     cgaggaggtc cgatctgatc ttattcccca gcaggtacgc cttcgacagg ggcgggcggc     65580
     tgtacggata tgaatcctcg tcgccgatca acgtgattct gccggagaag gccttctcgc     65640
     gaaggttagc ggccaggtcg ccgcccgctt gcccggcacc tacgatcacg acatgatcgt     65700
     tgtcgctcac tgtgaccaca tcctttagct cgttgaagtt gtgcacgggt tcattggctc     65760
     gcaggaatgt ggagaacgat tccatctgtc tcggctgtgc atacgagctg acaactcaac     65820
     cgactgtatt cggtgggctc ttctgccgtt gcttcgagca tcgctatctc gtctgcgcac     65880
     ggcggcggga gccggcccca ccacgtaggt tcgacgaaca catggcatgt ggcgcatgac     65940
     aggtcaccac cgcattctcc aacgacgccg ttgactagat tgtccgtggc ggcatgcatc     66000
     actgaagtgc cgacaggcac ctgcacctcg ctccgctttc cctcggtgct gacgaaggcc     66060
     accttcgaga cgacagccac gtatcgttcc tcatgatcgt tgggggtagt ggtcgaaccc     66120
     gaattgatat gctccatcgg cctgtaacct gctgcgccac gcattagccg accgccacgg     66180
     tcactgggag tgcaagcagc tggttcacca aaccgctggc gccgcgctgt gcgtcaccgt     66240
     ccatttcgat ggcgatattg cgcacgtgca actcctcgag caggatccgc aattcgagtt     66300
     ttgcgagcat atgtcctatg caccgatgcg cacccgcacc gaatgtcagg cctgcgcccc     66360
     cggtaccggc gagcggtttc ggatcctcgc ggaacggatt gaactcgttc ggatttggaa     66420
     acgctgcggg atcgcggttc gcggctgaaa acacgaccag aagcgtgtca cctttcttga     66480
     tagcctgatc gcggaattcg gtgtcttgtg tagcggtgcg cgcgaacctc atcgcaggag     66540
     tgatgtatct caggaactcg tcgacaagtg ccgctgactt gccttcatcg agggcacggg     66600
     tggtcgcagc cctgatcgca ggctcggtgg ctaggagatg tccgatgtgc gagattgtcg     66660
     tatgcgtcgt ctcgaagcct gcagcgaaca acgatgccgt gtacagctga tactcgacga     66720
     ggtcgatctc accgctttcc agcgactgcg cgagtacggt cgtcatgtcg tctgccggat     66780
     tgcgtaattt ctcttccccg aggcgggtca tgaactcacc aattttcatg aactctcgag     66840
     tcaaactcgc accgccatcg ttgacggtct ggctctcaaa gagagcattc gtcgcctcga     66900
     cgatatagcc gcggtgctca agcggaatcc cgaggatctg ggcgattacc cgggagggta     66960
     ccaagcgaga gacttcatag acccagtcga atcgctccag gggcaatgca tcatcaagcg     67020
     tttcgacgac cacgtcacgg atccatgact cgaagtttgc cacaatgcgg ggaccgaagg     67080
     atttggccgc cgctcggcgt acgcggctgt gctcgggcgg gtccatcaac agaatgtgtt     67140
     tggtcatcgg gccgtcaccc gtcggattcg gcaacgggta tattgatccc tgcactgagc     67200
     tgaaccgagc tgggtcttgg agtatctcga ccacctcgtc atagcgtgtg accacccaga     67260
     aacctccatt cagcgtgccc gattcggccg gatgccaggg aagaccgggc agtgagcgca     67320
     gctggtcata ggcctcatac ggtatgcctt ctttgaacgt ctcaggatcg gagagatccg     67380
     gaatcccttg cagttcagtc ctgactgtca tttcaatcct tgctgtcggt gttgctgttc     67440
     gagatgggct ttggaaagta actcaggaat atgtgccatg ccccgatctg aacaagcaac     67500
     gactgcgacg tagctgttag ggaggcagca gcaacagctt tgtcggccag tccgagtcac     67560
     ccaggtatcc ccgtcaagta ggttcccgct gggtttcgag gtcagacaga cgcttcatat     67620
     tcgaactctg atctatacga ttgaacgccg atcagttctg aacggcagca actacggtaa     67680
     accccatcaa ggtgtctcga atgcttcatt ctgagacacc ggtaaccggt agagtgcctt     67740
     gacagcgtgg cgacagagac tcccgactct cagatgagtc cggaccggcg acgtcgacgg     67800
     tattgaggct gccccaatgg tcagcctgga gtgctggtcg tcggtgcgcg gggccgagcc     67860
     gaggcggtcc accactggcg taggttcgca ctgttgtagg tgcacaaccg gatccgggtg     67920
     ggcagcagat tgtcccaata gtcgccccgc cgcgttcacc cgcgcccgca tgggcttgga     67980
     gcgggctatg atccgacgac caacacaggg gcgagttccc gcaccccgta agccatttgc     68040
     tcaaacacaa ggaattgaga tatgaacgcc agccagatct ctgtattcgg agcaggaatc     68100
     atgggccgcg gcatcgccgt agtcctcgcc gatgccggcc accgcgtgtc gctgtacgac     68160
     gcccgagccg atgtcgcgcg cgaagccgcc gccgcccacc ccaacatcga ggccagcgac     68220
     accatcgagg ccgcagtcga gggcagcagc ctgctgttcg aggcggtcgt ggagaacctg     68280
     gaggtcaagc gggacctgtt cgcggagatc gagagattca gtgagagcac cccgatcgcc     68340
     tctaacacct cgaccttcac tcccagcgag ctcgccaaga atctttgtga gcccggccgc     68400
     ctggtcatcg cgcacttttt caacccggcc gaggtcgtgc ccctcgtcga ggtggtgccc     68460
     tcgcccgaca cccggcccga tgtcgtgtcg gccgtgacct cggcgctggt ggcggcaggg     68520
     aagacggtcg tgccgttgaa ccgggaagct cccggcttcg tggccaaccg gcttcaggct     68580
     gcgctcgtgc gcgaggcgat ggccctcgta cgcgccaatg tcgccaccgc agagatgatc     68640
     gacgccgtcg tcaccagcag cctcggccca cgttgggcgg ccgcaggccc gttcaaggtc     68700
     atggacctcg gcggcctcga cacatggaaa gcgctctgcg cgaagctctt tcccgacttg     68760
     tcctgcgaga tctcgacacc gagcgagctg attgccgcgg tcgaggacgg acgcctgggc     68820
     gcgaagagcg gaaccggctt ctacacccac acacccgacg agatcaccga agtgctcacg     68880
     aagatccacc ggtccttcgg gacagcggcg atgtcgacgc ccgcctgaaa accaccccgc     68940
     gcggcgagaa ggccgcacca gccttgacac cgagcccagg aagttctctt ggccctgacg     69000
     cagacccgag cattcccgga tacatctctg tcgacgttcg ctgtcggcgg tgacgaagat     69060
     gaggacgtcg ccacggttga ggcgggcacg tcggtcgtcg aggtggaacc attcgaactg     69120
     atatgttgcc gccggtcccc ggtggtggcg ccgggtcggt gcgcctgggt ggcggaccat     69180
     gccggtttct cggttgtgct ggtttcgtat tcgacaatgt gccgcagaaa cattcgggtg     69240
     atctcggcgg gcaggaagcc ggggtcggct tgctcgcggc cgctgacccc ggggatcggc     69300
     accgcccgcc cgatctgcca ctgcgcggtg gcgtttgtcg aggaacgcgt ggtcgacctc     69360
     ggtgatctcc tcggcgccgt cgatgaacgc ccgcgcggta tggagttcga atatgtcttc     69420
     tgcctctctt gatggcacat tgaatcggaa tgggggcgtg tcgtcaccgc aggccaaggc     69480
     gctttttcgg accgagcggt ggcggttcga tgatggacct actcgttgga ggcctcgggt     69540
     tcggcggcgg ggccggccga gacgcaccac ctcggtacca ccggcaggcg gctcggtggt     69600
     cgggtcgagc aggaccgtgc ggcggccggc gaaagcgcca cccgccgagt cctggcgcga     69660
     aaatcagctt cctagctcgt gcggcgccgg tctcggtggt gggcgtcgtg gcggtcagcc     69720
     ctgggtcttc atcgtcgctg ccaccctgtc cgcgcacggc cccgaccccg cccgcaccgt     69780
     cctgtcacgc tcgaagtagt cggcgtcacc ggaatgttag cgggactgaa ctgcggacat     69840
     ggcatgtccc ccaaggcagt gacgtgggct acgcgaagct gtctgggcga ccgctcaggg     69900
     acggatttag gtcgatgccg cgcggagaat ggaagcaggc gtctcggagt cggagaatgc     69960
     ctcgtccacc acgcgtagcg cggggacgac gaccgttgcc tcgatatggt cgatgtgtcc     70020
     gcacgtccac ccggtaattc cctccggacc ctcggattcc ggtccgaaga accggtcgat     70080
     acctgcatcg ctgtagcccc agtcgatgag ttcgttccgc gtgcaccatc catcgcgaag     70140
     ctcggtgaca gtaatcaggt acgtggtggt gccgccgcca cgttcccgtt ctcgtcgaac     70200
     gcgccgccgc tgtttctagc gaaaagtccc gagaccttgt cgcggatttc gtcctcagtt     70260
     gccagccgtt gatacacgta ccactcgcct ttctagcgtt atcgcaagag gtagctatag     70320
     tcggatcact gaagatgcac aggatgagcc ggaggcagtc acccctactc ggggttggtg     70380
     tctccggttt cctttttcgc gcggagctcc gcgcccaggc gtagtttcag ctcccgccgg     70440
     gcacgctgct tcggggtctc ctccggctcg ggctcatcgt cgaccggacg gaacgtcgcc     70500
     ctccccagct tgatgtccgg atggaccacc agctcggggc gacccttgtc gtcggtgaac     70560
     agtcccatcc gcattccctc attcctcagt gatgtcccgc agctgcacga tcatccgccg     70620
     gccgatactg ccgtcagggc gacggtatcg cccctccccg gccgagacca cctcgaaccg     70680
     catccctctc ggcagcaggt gcgcggtgtc gtcgaccgtg tccgagcggc ccagatacat     70740
     acccctgccg gtttcgacct cgaacaccac atcccgatcg cccagcgttc catcgagttc     70800
     gtgagcggcg tgagtggcca tcgtgtgccg gtcgaaatcc aggcgggatc ccggatgcag     70860
     ggtcgcgggt aggttggccg cctcctgcgg caccgcgtgc gggagggtca ccgcgcagta     70920
     caggatgtgg ccgcggtcat tgaaccgttc ggcggtctga atggcccggt ccacgcgctg     70980
     gacctgggac cgcatcttct cgtcgagttg ctgcgcgtca ccgcgagcct tcgacaacgc     71040
     ctcaccgacc gtcttccacc ggtccgggtc gctgaccagg gtctgtacgg cggtgtatcc     71100
     gaccttcggc aactgcgact gcgccctgtg cttgtttacc gaccgcacct tgcgctggcg     71160
     tgaactcggc agctggcgaa tcgaatccgg aaccggcagc tcccggcgtt tacgttcgga     71220
     gacctcgggg acggtcgcac gggggaaggc acgctcgagg tccttacggg cccgggtgaa     71280
     cgcggcatcc tcgaccattc ggtccagctg ccgagccccc tcccgctcct gggcgcggtc     71340
     gtcgtaggtg acggccggcc gatagccggc cgacttcgac gcgggcgtcg tactggtgcc     71400
     ggcctctggg tccaggcggg ccgttggcgc atctgggctg aggttgtacg ccaccagatc     71460
     tcctcccgct gcgtcgaaca cgccctagat atgacgaagc gtggcaggca ttatgtccca     71520
     attgacggcc tgccacactc ggacccaacc ctggaggggt gggtcaaccg cgggggcgga     71580
     atgtaccggt gaccaaacca gcgactcgct cccacgcgca ccatcggcgg ttccgccgaa     71640
     cgctcgccag catacctaga ccacccgaaa cccacggact caaccgcggg ctcgatacct     71700
     gcgtacctgc tcgcgctaga tttcgatctc tactggcact ccgatcgctt gggcaaccgg     71760
     agtccagatg tccacatcct ggcccggggt ctcgatggac acaatgaggg aatagcgtgc     71820
     cccatcagaa cttcggtcct tcccagcgtt ttctttccac catcccgtca ccggatacac     71880
     ggcaagtaca ccgcgctgtg ccagatccgc cgcacttccg ttccagatgt cactgtgcag     71940
     cgaacctggg gcttgctgtt gcctactccc gaagaaccac tcgccagtgt cttccgctga     72000
     tagaggacgc gtctcgtctt ccgccaacgc cttctggttg atgcgcttct ggaaatccgc     72060
     tgtgctctcc gtggctcgcc gaatgtcgaa ccgaagacca tgcgatgcat agctgtaccg     72120
     tcggttccac ccccggcggc ccgggttggg ttcgatgaag tacgacagcg tcacgcgcag     72180
     tttgaccgga gcgtcaccca ggtccgcaag gatgtcggca ggccaaggca gttcgtgata     72240
     gtggatttca cgcatcttcc cgctgaggaa cgggtggatg gtgccctccg agatcagggt     72300
     cagtgcgtca gttgcgctgc gagtagccct tttcaggtca ggaacgccca tcccatagcg     72360
     gcgtagcagt gcaactctcg cacccttctt gttgtctttg gcgaattgcg cgttcattgc     72420
     ttgtgtccac tctgccgagt gcacaatgag cgctctgatc gtttccggcc acaaggacgg     72480
     atactgcgcg gtgatctgcg ctgccattgc agccgcttgc gctgtcgcag cactggttgc     72540
     gtgtgtggtg gtaaacgggc ggctgggcat cccggggatt atcggcgcct tcgtggtaag     72600
     cagttgcagg tttggtggcg cgtcgaactc ggttccctcg ggtgaccggg caacgtttcc     72660
     accctcgagg actacatccg gcttgatcgg ccactgctta ccaaaggcca ctgaggtgcg     72720
     gcttacggga gatagctcac ctctggatgc gacgggactc cagccgtcga attcgttcgg     72780
     ggcgccgctc attgtgtcga gccgggtgta tgcgccgatg gtgagcacgt tccatgcctg     72840
     agcaggatcc tcgacgggct cgatatcgct ccgggtcaaa tggtcgtctt gccagctgtc     72900
     cttccggacg tttccggccg aaacacagaa cagcctgggg ttcggatcgt cggtctgctt     72960
     gaggaaagtg agttccccct tctcgaaggc aacgcgacga ccgacagcca aagcgtcgag     73020
     cgttgccgac cacgaagacg gctgcccgaa catcagcaag cgtgagccgg gaggcggcgt     73080
     ggtctgccag cgagctgtca cagccaatga gtagacgcgg cgccggttcg gctgttcgat     73140
     ttcgacgtag ctgagagcat cagcggtgac cgcaccaaac aattccggct cgctcgaatc     73200
     agattcgctc tcgtcgcgct catcgctcat cggtggtttg ggtggtggca agatcttcgc     73260
     cgactcgaga cggtgggtta gccggatcgt ttcagaaccg gctaccgctt gtccgacgtc     73320
     accgaacagg gccaagcctg ccatctcggt cccgtgaccc caggtgtcgt ggcggggcca     73380
     cgtcgggtcg gcgacctggc agtcgcgtgc gtccagcgag gtcttcagca gtgggtgttc     73440
     ccagtagacc ccgctatcga cgacgcacac agccggcgat ctgtcgtccg ccgcctctat     73500
     ccggtcgagt agctcgtccg tccactcccg ctgttcgacg gcatcgctgg cggcgagaaa     73560
     gtcggtgggg tcgtgtggtc gtcgtagctc ggcgagatcg tcgaggatgt cgacagaggt     73620
     ggcaagttgt tcgaccgtcc cgtgcaagag aatgacggat cgctcaccaa acccgagcgt     73680
     ctgccttcca actcgcattc cggttgcctc ggcgtaggcg cgcagtcgcg tgacttcctg     73740
     cccatcacga cggcgcagcc agacctccca ccacaccgat tgctgtggat ccgggaactc     73800
     ttgcggagga tctgtccaca gactttcgat cgatgctgcc cgaatctctt ggattcgatc     73860
     gatggccgga ctgttcttcg gcttcttctc acccgccgat tcgagataag cggagacacg     73920
     gtcgaggaag tacttcatgg tgccatcggg cacgaacact gttgcccgct cgacgacttg     73980
     gccactgctg tccaatccct cttggaccga ccgcagctcc ggatgaacct tcccttgccg     74040
     agggtcgaga gtgtgcagtg ccaactcgat tccggggaag ctctcgaaaa cgacgtacgt     74100
     tccctccaca gccccgtcga cagtgacgtc gatattctgg cggcgggccc gcgcgtccgc     74160
     ctcgacttgc cgcaggtcgc cacgaagctt cgtgccgtgt gctactcggt caggtggtgg     74220
     cgcgagcgcc ggggtgtcca tgtcacgtga cggcggacgg tactccgctg cgcgtgcggt     74280
     ggaaatgaac aagtgcggct tgtcgcgctc tgccatgtca tccttagatt aagttagctc     74340
     acatgcccgc ggcgctcgcg aagcgccaac cgcagacttg cggtagtcac ctgcttggcg     74400
     cccgagagaa tcacttcctt agcggccaaa tcgcttgcga tggctatctc gccgtggctg     74460
     agtccctcag tatctgcagc gagtttagac cattccagtc gacccaccgg cacattagcc     74520
     agccggttgc ggatcacctg gcgcgcaatg tcaggcgatg gcaagggata atcgatcacc     74580
     gtgtcgaagc gacggaacat cgcccggtcc aagagctgcg ggtgattcgt cgcggcgacg     74640
     accaggctgt ctgattgatc catctcgaga aactgcagga acgagttgag tacccgccgg     74700
     atctcgccga cgtcgtttgc cgagccccgc tcaccagcga gcgcgtcgat ctcatcgaag     74760
     agatacaccc cacgggtttc cgacagcgcg tcgaagatca gcctcaactt agcagccgtc     74820
     tcgcccatga atttggtgat caggccgtcg agacgtacct ggaacagtgg caatctcaac     74880
     tcgcccgcca gcacgtgcgc ggacatcgtc ttcccagtcc cgggaggacc agtcaacaag     74940
     agtcgccgca tcggcagata gccgtgtgac cgcaagcggt cgccttgccg ctgctccagc     75000
     aggacccgct cgaggcgagt ccgcaccgac tgttccaaga cgagatccga cagtaccaag     75060
     tccgggtagg agacgctgag caactgtgcg agttcaccgc gcggctgagc aaccgatacg     75120
     accggggtca ccctccggtg actctcctgg acacgcagac cgtccacgag atcgcgcaga     75180
     tcttgcgcga agcgattctg cccattgcgg gcggcgccgg ccgcaacttg gagcgcaacg     75240
     gtatagaacc gagagttgtc cccttctgca tggctcttca cgagcgcctt cacctgatca     75300
     gcggttgcca ccagtcacct cctttcgctc ggctcgtgtc tgcctgatta ttgcaggagc     75360
     gacccacaag gtttcacgcg ctcggcaaca taagtgcagc tagggaaagc agccggagat     75420
     ccctcgcagc cgaagcgatg cgagacccca gattggacac gccgtgcgtg ggtcttgaga     75480
     tgacctggtc aactcgcggc cgcccccttt gcccggtctg ttcagaattt aagattcgct     75540
     gttccaccat gacacgtcgg ccccaagcgg gtcggcaatt gcctcgtccg ccggttcggc     75600
     gattgcctct tccgcaacga gcttcagata ggccatgtag tcgccgagcg tgcgcatgcc     75660
     gaagagcttg tcgtcgggaa tcgtgacccc gaacgcgtcc tctatttgcg cggcaatctc     75720
     gaccattgtt gacatgtcct caatgccgag gtgctccacc aacgaggtct gcggggtgag     75780
     atgggaccgc tcgatgccag tcaccgccac gatgatctca gccacagcgg agaaggccac     75840
     aacctcccgc gagccaggac tacgttgcac aggagaccgc ggtggacggc tggctgcccc     75900
     cgacaacagt tcacggacct gctggtcgaa gaggtgatcg gccgagcagt cctccgaggt     75960
     ctgcttctcg tcttcctctg ccaaacgacg ggcgagccgc tcggcacgca acctggggat     76020
     ccggctacgc agagcacggg cttcgggcgt ccccagcgga gattcctcaa tcaggcgacg     76080
     aaactcttcc aaccccttag cgtcgggatc gttgtattca gtcattgctg ttcccctccg     76140
     tccgggaggc tctgcggcgg atacggcgca gagtgttgcg gaccgattcc tcggtctggt     76200
     cgcctagggc atccgcgatc tctttgaacg tcaagccgtc ggcgcggagc ctgactatct     76260
     tcatttcacg ttcgccgtga acgcacttaa aagcacgggc gagttcgtcg cgattcatca     76320
     ccgtgtgttc agggtcgggt tcggcgggtc ttcttagtgg gtggggattg tgttcggtat     76380
     ggcgttgaat aacctcgggc tcgaagctgc actcggagtg gcgccatttc ccctggtctc     76440
     gctgccacct tctgaattcg ttgctgaaca ccagtaggca ggtcgtcgtg aagtatgacg     76500
     tgatgtcggc gccgccgtcc tctcgccatc ccgtgccgtt gcggcaccgt tgctgaaaca     76560
     gcttcaaggc ggcgaatacc acgccgtggg cgagatcacc gcgctgatgt tcgtctgtgc     76620
     gcaacagttg ccgctcggcg ctggtcgcag gaactccgcg ccctagctgg tgggcctctt     76680
     tgtagatctg ccctgacttg atccatttgt tgagtaatcc gagcgcgtac cgcgaaagct     76740
     cgatgaccag ttcgtcccat cgtgggccgc ggaacccgtc ggccttgacg atgtcgaaca     76800
     ccttgatcgc cccctggttt cgacgctgtt catcattgtc tgccaggttc gcgtcgtcag     76860
     cggggaattc ggggggtatg tcgagcggcg cggtcacggc ctccacggaa gggtgagggc     76920
     cttccgaggt tgccgctggt ctcgtggaag cgggcccgcc ctgatcgcag tcgttgacga     76980
     gatggttccg gaggtcgccg gtatcgaccg ggttgtcgtc ctccctcctg ccctccgcgt     77040
     cgtcgtcgtg gaatgagctc acatcgtgca gggttcgggg cggccagcca tcatcggcct     77100
     cgtctccgtt ggaccagtcc aaactcgcgt tcgtcaacta gcccacctcc ttctggcatc     77160
     cagatatggg ggttatatgt gcgctcaccc cgcgtcgaga ccaccgccta tatgtgattt     77220
     acatcacacc ctcttggttg ggttcaacta ttgccgatcg gacatatcac tcctggtaga     77280
     cgggcagttc cgcccgtcga atcgagcagg aggggatctc atgaccgagt tacgaggaca     77340
     gacccaaggc aatggggcaa ctccggaagg ctcgacgact aagcgttgga tgggacgggt     77400
     gaccgcgcgg gtggtcgcgg cgatcgtcat cgggatggtg tccccgcacc tcccgacgat     77460
     cggctctacc gcaccgcccg atgagactcc gcgccacggg gtcgccgtcg tctgcatcat     77520
     ggacgacggc agttgatccg tcggactggg acttcggagt ccacatctac cctctttgcc     77580
     gaagtggggc caccgggaag attttcctgg tggccccaac tgatgtgtaa aggttgaaac     77640
     ggcacggatc gaggcgagtg caaggcacct cgacgccaca gccaaaggag ccacatcacg     77700
     ccgccggcac atgagccctc ccggcctatc tggcagatcc cccatcgcgg cggcaatctt     77760
     cccagtacca ccaccacatg gcatcggcgc taatacccgg gctctgcacg ggcggaatca     77820
     tgtcggatcc cacggcgatc gttcgagact gttgcgctca tcgagaacct ggtcgacggc     77880
     cgtggtcggg atacggaagc cttcgccctc cgaagcccgg agacggtcac gtacgtaggc     77940
     gagcatggcg agttcacgtt cgaggtctgc tgtggttcgg tcgctcacgg tctcatcctg     78000
     cccgggggtg agcggtgatc cgaactgtgc cgcccggcga cgtcgagacg aaggccggcg     78060
     gtgtgcatgt tcggccaaaa atccttcagc ggacatgtcg tctccgctgg taaatggaac     78120
     atttagccgg tccgggcctc ggcggtgcga ctcccggtcg ccctgccgcg gggcctcggc     78180
     gaccccgtac ccttgccctc atgtctggac tcggaaaacc ccagcgccga cgaggtgctg     78240
     ccgtctctgg ccaccgtcga cgtctcagcg gatccgcacc tcatcacggt ggcggcgcgc     78300
     accggaacgc cacacctccg tcgcagcgtt cgacgttgcg gccgaggagt ggtttcccgc     78360
     ggcggccggg ttcgccgtca cggtcatcgt gcgcacaccg tcgacgcggc gacgggccgg     78420
     ccacgctatc tgccgccggc ggagcccgcc gagtgggcgc gcgcgatctt ctcgaccgtc     78480
     gagggcgcgc acgggtactt cctcggcgcc gtcgacccag gcaccagcgt ccatcgacgc     78540
     gggcagctcg catatcgcct ctatctcgac accgaccgcc gggcgattcc cgttcctcgg     78600
     caggtggtca cctgcccgca ttacctacta tcggccatcg acggcagagc cgagatcacc     78660
     attcccacga cggcctgacc cgacaggctg gccgggagcc ggaccacagt ctgcgggcgc     78720
     tgcttcctct ggtgtccgat ctgcaccccc tccaaagggt gcgaccttga aatcacgtcg     78780
     ctgttgctca ctcatgtggt tcctccatcc gtctcgatcc gatcccctgc gacagacagt     78840
     cagtcgccgc tgccccacaa aatcaaggac gacgcccggg ggcggaatcg agacggttga     78900
     tccacccggg gacctacggc acgtggatac acctgtgcca caagctcatt gccacttctg     78960
     aagccgacca cgacagacct caggaatctc ccgggtggga gcgcggcgac aagactacca     79020
     gcgcaccgaa gctcggggca ggggacgtgt catattcgcc gctcatcacc gcttttcgca     79080
     gagaaccggc ggcgcaattg gccgcatggt cagcaccgta cgatccgagc cctagccaat     79140
     agcgctacag cgcatcacgc ccgcgctacc gttcgacgta tggggacgac atttcacggg     79200
     ccgggtccct ggccgcacat cacccgcgcc attcgagtga gggggccacg ccacgccgcg     79260
     atcgcctatc tcggcgagga cgcgccgacg ctgctgccgt tgcgggccgg cgatctcctc     79320
     gtcgtgaacg cctcccgagc ggcggtgcgc gcgcatgtga cctcgccgat tgcgcttgcg     79380
     tactacgtcg aggccggggt ccgggtcctg tcgtcgccga acctgcacgc caacgtgatc     79440
     gccaccagtc ggcgggcggt catcggctcc gcgaatgcct cccacagctc gacgatcgcc     79500
     gatgaggccg tcgtcatcac cgacgacccg gaggtcgtgg ccgccgcctg gacgttcatc     79560
     gacggtatcg aggagatcac cgaggttgat caggcgtttc tcgacaacgc cagcaccgca     79620
     tggcagatcg gtcggtcggt gccgatcccc ggggtcggtg gccgggtgcg cgccgaactg     79680
     gatttccttc ctgcacgggt gacccggatg ttcctgcggc acatcgtcga gtacgaaccc     79740
     agcgtcaccg agcaacagac ctgggacacc caggcgcgcc ggcatcacac cgccaccgcg     79800
     gggccggcag cgacatatca gctcgaatgg ttccgcctcg acgaccggcg cgcccgcctc     79860
     aggcgtggcg atgtcctcat tttcgtcacc gacgacaatg actggattta cccgccggca     79920
     gtcgtggact cagacgccat cgcgattccg cacacgcaca gggccttcgg ccacctcttg     79980
     ctcgttcggg cggatctgca gccggtctcg gttgcggacg ccgaacaaca gctcgccgat     80040
     ttcgggcacc ccaatccccg gctgaccaca gatcaccgga tcatctccgc cagcctgcgt     80100
     gccgcgctac tccgactctg gaacctctga cctggatccg ctgacccagc ggcggatcgg     80160
     accattgagg acctgacttt cagctggcgc gactactgtc cggctgagcg acacgcccga     80220
     gcgcgtgcgg gggtccttgg agaaaccatc acctggcgga ttcactgtct tcgcgccaag     80280
     caccgcgcaa ctgtccgact gagaagctcg taacaagagt gagcaggagt gaaatgcccg     80340
     agcagtcgtg gatcgctgcc caagaactgt acgaccaggg atatacggtc gatggagcac     80400
     gtcagctctt cggggagcca aagacaggcc ccgacggaac cctcggttgg gaagacgatt     80460
     ggatcgaccg cgcagaagga agggccctca tccctgtact gcccttcctt atcgaacgtc     80520
     tgcgcggaca ttccgaggtg ggagaggctg ctggtgagct ggtcaggctc tacgaggagc     80580
     tcaatcgtcg agtaggaaat gatggtgctc ccgatccgct ccatcaccat gaaatctccg     80640
     aagatgagct ggtagagctg ggaaatgacc gcgacgccct caaggcgatc tacgggtcgc     80700
     cgcaccgttg gacacaagag cctgtggtcg agggcaattc ggttccgttc atttcgcagg     80760
     aacgaagccg gttcggagat ggtgcgcgat tggtcggaag gcggaatctc cggtggtggc     80820
     tcaagagtgc agtcggcgaa gtggcgaaca agcagagcga gaacgcctga ctagagagct     80880
     tccctgtgcc aatagccggg cccggactgc ggtcgatggg gacgtgtcgt ctccccaggt     80940
     gaatgagccg atccggctta ccagtccgat gcgctggagg tgatctctcg ggcgcggtgg     81000
     gaccagtccg ggtcgcgtac cagagcggtg atggcggtgg ccatctgctc ggtgttgccg     81060
     tcgatgccga gccggcggag cgtgcgggcg atgcgcgcgg ggtgggccgg ccaccgacca     81120
     ccggtggttt cgaccagggc agcgaggacg gtggccgcct cggtgtcgct gagttccacc     81180
     ggctcaccgg tcatgcctcg taacccgcgg ctgccggtgg tcagccaatg cgcgctcgcc     81240
     gctcggcgca ccgaggcccg gtaccaggga ttacgcagcg atcgcatcaa cgctccttcg     81300
     cgttcagtgg gcgtcctgga acgcctgctc cacctcggcg ggaatgcgcc cgcgcgagga     81360
     gatttcatag ccctgttcgg ccgcccaggc gcggatctcc ttggagttcc cccgccgcgg     81420
     cggggcgtcc ggggcgacgg gccgattcga gcgtcgtttc cggccaccga cccgggtggc     81480
     gtgctcgatg aagaatccga tctgcttgtg aaacttgctg gcgtgcttgc ctttcaaatc     81540
     aatttcgtag tccaccccgt tgacggaaaa ggtgatgctc tccccgtcct caccgaagac     81600
     ggttccgtcg atgtcgtcga ccagttcgac aactaccttg cgcgccacag ttccccgatc     81660
     tctcacattg cctgatacag caggcagaac cctactggcg gcggcggccg atcagggcaa     81720
     ccgaccccgg ggacgtgtca tctccgcagg tcacttgccg gttgtacggc gcaggagcag     81780
     acgggggtcc tattgggtgt gcacccgggt atccctcaag gggccgagcg cgaagtagat     81840
     gggcggcgga cagcccgacc caccgcccat tctcgcaggt caggtgccgc tgccgcggtc     81900
     tctccgacga atccgctcac ggcgggcatg tttggcgagc aggtgtttcc ggttgttcgg     81960
     ggcgcggaac atctcgtcga gcatccggtt ctcgatgttg tgatggaagc ggaggatgcg     82020
     tgtggccgcc agatgcacca gctcctggcg gttcgagctg agccgttcgg cgagggcgtc     82080
     gaggtgcgcg aggagttcgt cgtcgagggc gacgtcgacc cgggctatgc gtggcggggc     82140
     ggcggtgcgg tgtgcctgcg cgagggcctc cccagccgcc gggtaggcga tgagtttgcg     82200
     aattccgacg cggagcagcg cggagacccg gcggggaccg tactcgtctg ccagctcttc     82260
     caggcggcgt ttggtgtcct cgtcgaaccg gaagacgtgc cggcgcccga acgggttccc     82320
     ctgcggactc ggtgctcgag tgggcgtgtg ggccggttgg tcggcggccg cggcctgccg     82380
     gcggcgagta tcccgggcga ggagcctggc ccggttggcg tccccgcggt agatctcctc     82440
     ggtcaccgcc ttctcgaggt cccgcgggtt cgccagcagc tggcgggcgg ccaggcgcat     82500
     gagttcggct cggtcggagt cgagccgttc ggcgagggtg tcgagttggc cgcgcaggtc     82560
     gtcgtcgaag tgcacgttcg tgcgcgggcc gagggcttcc ggggtcaggt cgcgggaggt     82620
     gccgatcgtg gccaggtcgg cggcaaggtc tcccgggttg tcgaggagtc ggcggaccgc     82680
     gacccggatc gctgcggcgg tgcgggcgtc gccgttgcgg ctgatcagct tttcgaggcg     82740
     gaccagggtg gagcggttga ggtacacgcg ggtgcggtag gtcagatcgg tgcgggtgtc     82800
     ttcgcggagc accgggtggc ggaatcgtcc tgccccggtg aggaagcggt gcagtgcgac     82860
     gcggacgatc gcgctgcggt cggtatggaa ctcgtgggcg acctggtgga ggcgagtgtt     82920
     ggtggcgggg tcgaggtcga ggtgtcgctc cgcccagggg aagcggcggg cgtcggcgga     82980
     ggctcggcgg gcctgggcca gtgcttcggg cacccggtcg gcgtcggcga gaagtcgacg     83040
     cgcggccacc cgcaccagcg ccccgaagcg ccgcgggccg atgccggcgg ccaactcctc     83100
     aagccgttgc ttggtctcct ggtcgaagcg gagcgggatc ggatccccca ccggtacccg     83160
     gcccatgttc gtctcgctca tcaccggcca ttgttccggt aagtcccggg acctcgattc     83220
     gcaccccagg gcacccaccg ccaccacaat cggtcactgc gccctggcga gccggttgct     83280
     gcgaaaagca gtggcgccat gtacggagac aatacagcga tacattgcaa tgttagaagc     83340
     cctcggagga ggccgtgccg ggcccccggc ggccggccac cgcgagcggg agcattcaga     83400
     ggcagtgccg gcccggaacc tcggtgcaca ccgtcgacca gcgctcgtga acgcaacctc     83460
     ccgcaccagt cgcaccgacc gtacgcccgc gttcatgact atgacaccgg cgcgctcatc     83520
     ttcggtgagc ctggcttcga aaagacaggc aaggtccgtc cactgaacgt ccgtcggatt     83580
     gagagaaaac ccggcaaccc ggagtcggtg tgtcacgctc aagagcggac accactccgt     83640
     tcgcccacag ccggcaacct tgccgcagcg tcatggaagg cacgcacgat tgcggccgaa     83700
     atccgaccgc ggaaggacac ttcacgaccc tccctgatcg cccactctcg aatctccttg     83760
     gccgtcttct tcgccggagc cgtacccgcc gccgctccct tcaccgaagc ctccttctcg     83820
     acaaccttct ccccggccgt tgtcgccccg gccgtcttcc ccgctgctgt cttcttcgct     83880
     gctgtcttct tcgctgctgt cttcgcccct gccgtcttct tcattgccgt cttcttcgct     83940
     gccgtcttct tcgctgccgt gttcttcgtc ggagcctcct tctcgacaac cttctccgcg     84000
     gccgttgtcg ccccggccgt cttccccgct gctgtcttct tcgctgctgt cttcttcgct     84060
     gctgtcttcg cccctgccgt cttcttcatt gccgtcttct tcgctgccgt cttcttcgct     84120
     gccgtgttct tcgtcggagc ctccttctcg acaaccttct ccgcggccgt cgtcgccccg     84180
     gccgtcgtct ccgcggccgt tgtcgccccg gccgtcttcc ccgcggccgt cttccccgct     84240
     gccgcgtttt tcgccggagc ctccttctcg acaaccttct ccacgaccgt cttcttcgcc     84300
     ggagccgtct tcgcggccgt cttcttcgcc ggagccgtct tcgcggccgt cttcaccgga     84360
     gacttcctcg cagccgcctt cttcgcagcc gtcttcttcg gcccggtcgt cttcgccgga     84420
     gacttcttgg cggccgttgt cttcgccgga gccttccccg cgactatctt cttctcggcc     84480
     gccttcttcg ccggcaccgt tcttgcctga gccttcgtcg cctgagcgtc atggaaagct     84540
     tgcacgatct cggccgaaat ccgaccgcgg ggagacactt cgcgaccctc tccgatcgcc     84600
     cactctcgaa tatccttggt cgtcgacttc gccggagccg tgatcaccgc cggcaccttc     84660
     gtggcgacaa acttctccgc agccgtcgac ttcgccccag ccgtcttcac cggcaacttc     84720
     ctcgcagccg ccttcactcc ggccgccttc ttcggccctg tcgccttcgc cggcgactcc     84780
     ttcgcggccg ttgtcttcgc cggagccttc cccgcgacta tcttctcctc ggccgccttc     84840
     ttcgccggca ccgttcttgc ctgagccttc gtcgcctgag cgtcatggaa agcttgaaca     84900
     atctcggccg aaatccgacc gcggggagac acttcgcgac cctctccgat cgcccactct     84960
     cgaatatcct tggtcgtcga cttcgccgga gccgtgctca ccgccggtac ctccgtggcg     85020
     acaaacttct ccgcggacgt cgacttcgcc ccagccgtcc tcgccggcga cttccccgca     85080
     gacgccttct tcggccctgt cgtcttcgcc ggcgacttct tcgcggccgt cttcttcgcg     85140
     ggagccttcc ccgcgactat cttctcctcg gccgccttct tcgccggcgc cgcttttgcc     85200
     tgagccttcg ttgcctgagc gtcatggaaa gcttgaacaa tctcggccga aatccggccg     85260
     cggggtgaca cttcgcggcc ctctccgatc gcccactcgc ggatctcctt ggtcgccgcc     85320
     ttcgtcgaac cttcggaaat cctcggtgat accgccatcg tgctctcctt ctacgtcagg     85380
     gcaatcgtcg aacgcacaca gtaacggcag gctcgtcccg caaatgcgga agctcaccga     85440
     actaacaatt caacgtcttt aagacattgt ccatgtggac agaccacaca cgatcgtctt     85500
     cgagccctaa atcacatcgc accgagcctc atgcaggacg agcacgacgc accccgacag     85560
     ggaccattct ccaccgaaat cccgaaatcc cttcggcagc tgcggtgttg gagtggtcga     85620
     cactgccgag tccggtgttc acggtgccga gcagggtctg cgcccgacgg cccaccacca     85680
     actcaccgaa gactgcgcca cacttccggc ggtgcagcac ctcccggact ccggccacag     85740
     cggcaccgaa ccttccctcg cgaaggcccc gcgccggcca catccccagc cgcccggaga     85800
     acaccgtcgt ggccgtgccg ccgcattcgg agtgtgctca cccccagccg gcatcattct     85860
     cttccgcacc gcactcacac acggttcacc cgaaaccgac tgcggcaccg tgcacacgag     85920
     tggagacaac tcgacacaac accgcgatga tcaacaggca ccgggacggc cacccctcgc     85980
     gacaacagtg gggcgcgcgc cggccgagac accgccggtg ctccctccga tcagctggcg     86040
     tcagcccgta cgtcgccgcg ttatcccgat gtcagatcga atatcgtgaa ggagcgaggc     86100
     gagcaccatc tctcgggccc atccgtcggc atcgagcggc gccgaccgca ccattatcag     86160
     cgtcggtggt tttccgtccg ccgaccagcg tgcgcgcgag ttcagtgcat ccgtgccggc     86220
     actcgtaatg cagcccccgc gcgacgatcg tgtaggtcag aatgtcggtc gcggttcggt     86280
     gggtctgcgc gtagtcccac ccacgtgcac gccgtcagcg aggcgccccg gccgagcccg     86340
     atgatgttcc gctggccacc gcaggaccgc cacctcgaca tcctcgtcga acaccagttc     86400
     cgtcaacgac ttgtcggcca acggcccgcg tgcggacgat caggtccggt gcgatgcctg     86460
     gccgcgcagt attccctcgg caaccacgga caaaccgata tacaccgcgg tccactcccc     86520
     catcgcacct gttcccttca gcgctgacaa ggtcccgggg cacatcgtca cggctcggca     86580
     tccggcagcg ccacctaaca gaatgaactg cgtggcgcac agagtccgcc gcgcggcgag     86640
     atcggctgtg ctgagggaga aggtgttgcc ggcccgccgg gacgggtcag ggtttaaacc     86700
     tcgccccagc ggtcatcccc gacccggacg gccagaccga cacagcagag gcagccgggc     86760
     gccccactcc gtccggtgcc gcgcctcgcc gcaccgaccg tctgagcaca gaccgggcaa     86820
     tcagcacgac gaagggatcg acgatggaac cgcacgaacc gcacaacctc aatccagggc     86880
     caggccccga tccgtcccgg gtcgccgtgg tggtcgccgg tgccggagcg cgcggagcct     86940
     acgaggccgg cgttctgtcc gtcgtcgtgc cattcctgcg cgcgggcggc atcacaccgg     87000
     atctgttcat cggcaccagc gccggagcga tcaatgcgac gctgttcgcc gccggcgccc     87060
     acctgccagc cgacgaccag gccgccgccg ccctcgcggt ctggcggagc gtggacatcg     87120
     acgacgtgtt ccggccactg atgtacagcg gacccgccac gatcgcacgc tgggccggtc     87180
     agctctgcgg aataccgggg attcgcctga cgagtctggt cgacaccacg ccactggccc     87240
     ggaccgccca ccgattggtc gactggcgac agctcgcagc gaacctcgac gaccgacgga     87300
     cgtcgctggc ggtggtgacc acctcggccg ccaacaaccg gacggtggtc ttcgtcgata     87360
     ggaacggtgc cgccccgctc ccgccaccgg acgccaaccg cgcgatcgac taccgcgatg     87420
     tgcgggtcac cgccgagcac gtccgggcct ccgccgcgat tccggcactg ttccccgcgg     87480
     tcgaggtatc cacccccaac gatgcgcgag gctggtacgc ggacggtggg atccggctca     87540
     acgccccact caaaccggcg ctgtccctgg gcgcgcacaa gttggtcgtc gtcgccaccc     87600
     acccggcggt ctacccccca gtgccgaaca ccggcgagga gccgggacca ccggatgtcg     87660
     acgacatggt cgtgcgggtg ctcgatgccg ctctggtcga tcggatggtc gaggatctgc     87720
     gcaccctcgg caagatcaac gaactcgtcg ccgatggtcg ccggaccggc accggccggc     87780
     accaccacta cgtcgatgtg ccctacctgt tcttcggccc cgagacacgc ggttgcctcg     87840
     gcaccctcgc cgccgaggca ttcgacgacc ggaaccggtg gccggccggc gcatggcgca     87900
     tgcttcgcaa tccggaccta ctgctcctgg gtcgactgct cggtggcgac ggcgcccgcc     87960
     gcggagacct cctcagctac ctgctcttcg accgcggatt catcaacgcc gcaatttgta     88020
     tgggacgacg ggacgcacac ctgctcctgg caggcacaga ccagccaccc tggctcaccg     88080
     gagcgccgaa gcacgtcccg ccccagcgga tctccgtcca cgccgcaatg cagacgcacg     88140
     gcgcaggaat cggcgccgag accaccgaca ctgcctgatc ggatccttat ctgcgcgcac     88200
     cgccctacga ccgtgccacc acatgcccca tccggggacc cggcgcccgg cctgcccgct     88260
     ccgaacacaa taggggcggg aggtttgacg caggtgcgcg acgctgtctc tacagggcgg     88320
     catcacgcga cgacgtcgag cagtaggccg tgggaatttg accgcaagtt gagttccggc     88380
     gaaggacagt gacggggtcc ggtttgggac ggcggtgact tcgttcggct gcacagcgaa     88440
     ggcggcgatt ccaagcgtga ccaatgcgag tggtgcatgc tgtacggtct gcgtgcactg     88500
     gaacccgttg atcgcaaagc gcttcttcga acccttgcca ccaggcaggt tttcgctcag     88560
     cacgaggaac gagccgattc gagtgtcgga tcgggtcctc gaaaggtgat acgacggccg     88620
     acagcgcttc cccgacggtg ttccagtgct ccgcggtgtc gatcaggttc tgcaccgcgg     88680
     tgtagccgac cttcggcaac gatgactgcg cccggtgttt gttgacggac cgcactccgc     88740
     tgacgtgaac tcggcggcag gcgaaccgaa tccggaatca gcaactcccg ccgcttgtgc     88800
     tcggagacct ccgggaccgt ggtacggggg aaggcacgct cgaggtcgtt gcgggcgcgg     88860
     gtgaactcgg cgtcctcgac catccggtcc agctccctga gccgaatcgc gctcctgggc     88920
     gcggtcgtca taggaagccg tcgaccggta gccgggggcg cgtccggagt gaggttgtac     88980
     gccaacagct ttcctctcac ccctgattcg aacccaaccc tgagacggcg aaggcgtggc     89040
     aggcgtgagt gtcccaaatt gacggcctgc cacgctcgga cccaacccca ggggcgggtc     89100
     accgcgggag cgccctatac cggtgaccac accagtgact tgctcccatg cgtgttgccg     89160
     gccttccggc cgtgcgcacc tcagactacc gaaactggct ggcccagttc gaccagtact     89220
     cacccggcat cacgtcggat cgcacggcgg ccgttcaaga ctgttcagct gatcgagcac     89280
     ctgatcgacc gcggtggtcg ggatacagaa ggtgtcgccc tccgacacac ggatgcgttc     89340
     gcggacgtag gcgagcacgg cgagttcacg ctcgaggtct gccacggttc ggtcgctcac     89400
     ggtctcatcc tgccgtgaag cgagtgctca tccccactcg tgcgctcggc agcgtcgagg     89460
     aagacactgg cggtgctgca accgtgccca acgctccatc aaagggtcat gccatccccg     89520
     caggtcgaga cgccgctttc ggaccggtcg acggtcgggg gaatcgcctc ccccagcagc     89580
     tgggcccgct cgacccgcac gcgagggcac ctcaccggat tccggcgcac aatcgaaata     89640
     gaaggaggtg gaatccaact gggggtgaac catgcgaccg gaaccgcgcg caccggtacc     89700
     cacaccgatc cggtggtggc gactgtgccc gtggaaccgc aaccacctga tgcggtccag     89760
     cgaccgcgtt gaggccctcc tcgtgttggt cgccgcgatc ctggtgctgc tggcgatccc     89820
     cttcgccgcc gcatactgaa ccgcgaccca cacccgactc gaacaccaaa cccaagcccg     89880
     ggcgagcggc agcaggtgcc ggccgtactg ctcgaggaca cccaccccac acccgacacc     89940
     agcgcaggca ccctccgcac cgccggcgcc cagaacaccg cccgagcccg ctggtccaca     90000
     ccccacggag atcgcaccgc cgccgtgccc accgacaccc cacacaggcc ggacagacgg     90060
     tcaccatcag catcgacgcc gacggcaacc ccatcggccc gatttcgagc agcggggaga     90120
     acacgatcgt cgccgcggcc gccgcactcg gagtctgggc cctcgccgcc ggcaccgtcc     90180
     cgccccccac cgccctcgcc cgcacactgc tgcaccgaaa ccggatgcgg cgccggccac     90240
     acgaatggaa acaactcgag accccaccgc gataacccgc ctctcccctc gggagatcgc     90300
     gtgccgttac agcgggcgtg cggaccgccc cgccccgcac gtcgtcatcg tgtcaaagcg     90360
     ggggccgaga gcagtaccgg accggtcctc gtctcaactc tccgctgcgg gggcagcctc     90420
     gatggcacca tcgtcgacga aaaccaaagt gccgtcatcc gtcgcgacgg cccaccggcg     90480
     caccggcgcc cactcatgac cggcgctcac gcccgcctcc gcggcgtagt cgtcgaccac     90540
     cacaccgagc acccacgccg aacgcgcacc gctgcccgca cggacccgga cccgcgcacc     90600
     cggcacgatc gggccattgt tccccttcgg cgtttcgggc atggacatga ttgtggcatc     90660
     cccacccccc ggggcgtcgg ccgagcaacc cccccaccga gggtgcgtgg gcacgcgcga     90720
     cgaagcccca gccccacgaa ggcggcggta gggacctcgg atccacccct gccggcaccg     90780
     ccgcgtctgc gatgcggcgc cctaccaccc ggcgcacgca cccacgccac cccgaccctc     90840
     gcccccgaac cagggcagcc gccgtcacct cccgccgtgc ggccttccag gcagcgcccg     90900
     cgccgttccg cacacctcgg ccgcacttcc cgcatacccc gcacttcccg tacaacaaga     90960
     gcgaggaggt acatcatgcc cgggacacga cgacacaccc cgcacaccac ccccctacgt     91020
     gcgggcacca cgccacctcg ccggtcgccg ccaccgcgcc ggcggctgga aggtgaccgt     91080
     cgccgaggac ggcggcaccc tcgcccctcg gcggccggcg ggtgccggtc acccggccac     91140
     gggtgcgggc cgcggacggg accggggagc tgccgatcgg ctcgtacgag atgttcacct     91200
     cgaccgagat cctgggcaag atgacgatgg agaagatgct cgccggcctg gcctgtccac     91260
     ccgccgctac ccgatcggcc tcgaaccggt cggcgaacag gtgaccgaaa tatccacggc     91320
     gacaagtaaa tccgcggcct cccggaagtt cgtggcgatg accgagaccg ccctggccga     91380
     cctgctgtcg aaggatctgt ccgggctgga cctggtggca ctgatgatcg acggggtcca     91440
     cttcgccgaa acctgctgtg tcgtcgccct cggcatcgac atggacggca acaagcaccc     91500
     gctggctctg gtggagggcg ccaccgagat cgccaccctg gtcaccggtc tgctggtgga     91560
     cctgcgcgaa cgcggcctgg acgtcacccg tccgatgctg gtcggcctcg acgggtccaa     91620
     ggccctgcgc aaggccgtcc tcgacgtcct cgaccgtccg gtcatccaac gctgtcaact     91680
     gcacaagatt cggaacgtga aggaccgact ccccgaacgc ctccgcagca gcgtgggccg     91740
     caagatgacc gactcctacc acgccgcctc ggcgctcgag gccgaggccg cgttggtggc     91800
     gctggccaag gaactcgatc gcacccaccc cggggcggcg accagcctgc gcgaaggtct     91860
     ggaggagacc ctcacggtgc tgcgactggg cgtgccgccc acccttgccc ggacgctgcg     91920
     ctccaccacg aacgccatag agtcgatgat ctccgtgtgc cgcgagtacg ccaccaacgt     91980
     caagcggtgg cgagacggac agatggcgct gcgctggtgc gccgccggga tggtcgaggc     92040
     cggcaaacaa ttccgccgcg tcaacggcaa cctgcaccta ccaacactcc gcaccgcgct     92100
     cgaacgccac ttctccgaat ctgtcgcacc catcgtgcac aatgatcagg agaacgcagc     92160
     gtgatactca ccgggccgcc accgaagttc cacggagctc gggacatcct cacttttccg     92220
     tgtgcgaggt gctacgacaa tctaaccggt tgcgtcggcg tcagccggca caaccggacg     92280
     agcggcggtc gcctcggcaa ccaccatcgg tgcaccagga ctggcggtcc cgaacccgct     92340
     gcgtagcctg cgccacctgg cggcgacagg gtcatcgcca cagccgttgg cgcagttggc     92400
     cctacggatc gatgacctcg aacgaccatt cggtgctgcc gatgcggatg acgtcgccgt     92460
     ggccgagaac gacggagtcg atgatgcgct cgccgttgat cagcgtgccg tttgacgact     92520
     gcaggtcccg gatttcgtat cgcggcccgg tagccacgac gatcgcgtgg taccggctga     92580
     cgtttcggtg gctgagcacg agatcgttgg tgttctttcg cccgatccgc agaccaccgg     92640
     ggggaatcgg gatcgccgtg ccggcgcggt cgcggagctg accggtggcc actctctgtt     92700
     gctgctcgat caaggtcaac gtcatggcgc cggtcgtcac ggtcaacggt tcctgattca     92760
     ggattcgttt ttcgaggtct tgtagtggtc cggatgggtc gatgcccagt tcgtcagcga     92820
     gggttgtgcg tagccgccgg caggcgtcca aggcgtcgga ttgccggccg gccaggtaga     92880
     gggcggtgat cagttgggcc cacagtggct ctcgaagcgg atgctcattc gtcagatcga     92940
     tcagggtgga gattactgat tcggctcggc cacatgcaat ttcggcctgg gttcgcgccg     93000
     atgcggtcgc cagcagttcc tcttcgagag tggcggcgaa cgcatcggca aagctgtgcc     93060
     cgcggagatc gtcgaggacc ggccctttcc actcgtccag ggcgtgggac agtgcggcgc     93120
     tcgcctcctc gaattgtccg gcctcggcga gccggccccc ggtcgacgac aatgcccgaa     93180
     accgggccag gtcgaagtcg tcgtccgcca ccgacagtcg gtatcccggt gctgcggtcg     93240
     ccaatacggt cttggggtcg acgtcggcgc cgccgagggc ctttcgcagt ttggacacga     93300
     tcacgtgcag actggcccgg tagtccgggg gcggatcgtc attccacgcc gccgcggcga     93360
     gggcgtcggc cgcgaccaca cgaccgcgcc ggatgagcag catcgcgagc acagcgcgcg     93420
     gtttggtgcc ccccagggac tgcggcgctc catcgatggt caactccact gcacccagga     93480
     cgtggagacc gagccggtgc cgtattgcct cgacgttctc tgccacacca atcaccgagc     93540
     cttttcgctc cgggagcccg cgcgaggttg ttgcgtcggc atcaattatg ccgtcccgga     93600
     cgcgggatct gccaggcccg gcagcacggg gcgtcggcgt cgctcgccgg gggatgcgct     93660
     cgacggatgc gggataggga tttgatcagg atcggataag cggcggacca cacacttctt     93720
     cacgtcccca gcaagaccat gagagaaggt ccaccgtcgt gttcacccgc aagatcgcca     93780
     ccgccgcaag tacctgcatc accgccgctg ttgtcggggt ggccgctctc ggcctcgtcg     93840
     gcaccgcgaa cgcgatgagc cccgccgcgg tctcgaccgt gtcagcctcg gtggtggtcg     93900
     gcgatccagt aggagccgcc gcatactggc aacgtcagca cggtggcgac tgcgcggaga     93960
     tggcggtcgc cgatgtcgtc ggagatgtca ccggccgcgc tccctccgag gccgagatcg     94020
     tcgaggtcgc gcgcagcacc cccagcaccg tcgaaccggg cccgatctac accggcgacg     94080
     cggccggtgg acccgcggac gccgatgtca gcaccggcgg gacggcctcc gaggacattc     94140
     ccgcgttgct ggcgcactat gacatcgccg ccgtcctcag ccacgccgaa aacgcgacgg     94200
     ccggcatcga ggaactcgtc gcagatctcg cgattgaccg gaaggtcatc gtcggggtga     94260
     acgcggaaag catctggggc gaacgcggtg accggaccac cgccgatcac gccgtcgtcg     94320
     tcaccggcat cgacctcgcc gcgggagtgg tctacctcaa cgacagtggc atcgacaccg     94380
     gtcgcgccga gacgatcagc ctcgacgtgt tcctcgcctc ctggagcacc agtaacttcg     94440
     agatgatcat caccctgtag gtgctgtgct cgatgcctac cggtccggca ccgccacctg     94500
     aagccgaccg cagctcgtga tccgtcgtgg cggcgacgcc gcgccgatcc cacgggctgt     94560
     gcgcaatcat tcggacggtc cgatcgggaa gagatcgact gtgcggcgcc caccggggcg     94620
     ccctttcact gaggcttccc gagaatgccg gcgtcgtcat cgacgccggc gttctcgagg     94680
     tctgccggca tgacctgcac gcgactacca cgatcgcgca ccagtccgta tcatgagaat     94740
     gccatatgtt acggcaatct tgttgttagg cagccgagtg agatgactgt ttcacgacga     94800
     ctgttcgtgc cgagggttcc ccacccggcc gcgcccacct cggactctcg gcgcgatacc     94860
     cgcgttcgac atcgcaggaa ggatctggga gaaacgtcaa cgactcggtt gacatggtga     94920
     tacgcaggaa gtaggtcggc atgcgaacgt catcacggcg gtaggcgtcg agatgacagt     94980
     ggtgggcgcc cggacgccga gatcctgcgt acgaaccgca ggtacgaccc gcgggcggta     95040
     cgcaaccacc ggccgcgggg cgccggactt cgacgttcgc gtacgcgacc atcgcaccga     95100
     cacacatatt ctcccggcac tgcccctatg aaccccgacg actccccacc caacgggcca     95160
     ccagcactgg aagttgcggc cgacgggcac cggtggcggg cggcaccggg ccacaccttc     95220
     accatcggcc ggtccgagac cgccgatgca cagttggcca atccgcgcat ctcacgctcg     95280
     catgcggtcc tgaccacgac accgcacggc tggaccttga gcaatcacag ccgaaacggc     95340
     attttcctgg acgggcatcg ggttgatcag gtgccggtgc acggacccac gacggtcgtg     95400
     ctcgggaacc cgtcccacgg tgtggtccta caccttcgtc ccgtaccgtc ggcaccaccc     95460
     ccggaacctg cgcccacaca atcggagggc gatcgatcag cgcggccccc caccgctgtt     95520
     catgcgatcg agcagcctcg gatcaggatc ggtcgcaccg acgacaacga tgtgatcctc     95580
     gacgacctgc tggtctcccg acaccacgcg gaactgcggt tctcgggcgg gagctgggac     95640
     atcgtcgacc tcggcagcgc caacggaacc tacgttaatg gaatccgggc gtcccaggcg     95700
     cgtatcggtg agccggacgt gatcggcgtc ggtcatcaac tgctgcgtct gaacggtgac     95760
     cggctcgagg aatacgtcga caccggtgac gtgtccttcg aggccaccga cttggagtcg     95820
     gtcaccgcaa acggacgtgt cctgctcacg ggtgtggggt tcaccctgga tcaacgcagc     95880
     ctgctggcgg tggtgggacc gaccggggcc ggaaaatcca ccctgctcaa tgccctgacc     95940
     gggttccggc cggccacgag tggggccgtg cactacggtg ggcgtgatct gtacgcgaac     96000
     tacgcggaac tgcgacaccg tatcggtttc gtcccgcagg acgacattct gcacacccag     96060
     ctcacggtgc gccgtgcact gaactacgcg gcgcggctcc ggtttccgca ggacgtgtcc     96120
     gccgcggccc ggcagcagcg catcgacgag gtgctcggtg agctcgggct gaccgggcag     96180
     gcggatcagc gcatcaccag cctctcgggg ggacaacgca agcgcaccag cgtggcgttg     96240
     gagttgctga ccaaaccctc gctgctgttc ctcgacgaac cgacctccgg gctcgatccc     96300
     ggatacgaca agtcggtgat gcagacgttg cgcgccttgg ctgatgaggg ccggtcggtg     96360
     gtggttgtga cgcacaatgt ctcccaactc gacctgtgcg atcggcttct cgtcctcgcc     96420
     cccggcggcc ggctcgccta cttcggaccg cccgggcaag cgctgaccta ctttcgctgc     96480
     gaggacttcc cagacctgtt cacgctgctc gagcacgaca ccgtcaccga ttgggccgcc     96540
     cgcttccggc agtcgccgct gtacccggtg tacatcgggc cgcgcccgac cgatgcctca     96600
     cccgcacccc ctggacaccg gtccccgccc gagaacccgg acgcccaaca atccgcgctc     96660
     acccagttcg cgatcctgtg ccgccgctac ctggccgtca tcgcggccga ccgccagtac     96720
     acggccttcc tgctggcgct gccgctcctg ctcagtctgt tcacccatgc cgttcccggc     96780
     accgccgggc tctcgctcac cgaggcagcg gtccagcact cgaacgagcc cggccagcta     96840
     ctggtgctgc tgatcatcgg cggcgccctg atgggctgcg ccgcagcggt ccgcgagatc     96900
     gtcaaggaaa aggccatcta ccgacgggaa cacgcaatcg gtctgtcccg caacgcctat     96960
     ctcgcctcca agcttgcggt gctcaccgtg atcaccggtc tgcaggggct ggttctgggg     97020
     atcttgggat gggccgggcg gccggggccg gacggcgccg ccctgctggg atccggtgaa     97080
     gccgagatcg cgatcgcggt gatcgcggtg accgtcacct cgatgatcat cgggttgctc     97140
     atctcggcga tgatcgacaa cgccgaccgg ggcatgccct tgttggtgct cgtcgtcatg     97200
     gcccaactca tcctctgcgg cggcctgttc ccgctgcacg ggcgtgtgcc cctcgaacag     97260
     ctgtcctggc tctccccgtc gcggtggacc tatgcgatgg ccgcctccac cgtggacctg     97320
     gcggcgatgc cgggctctcc cggagccggc gatccgctgt ggcggcacac ccccggagtc     97380
     tggctgaccg acctcgcgat ctgcggtgtc ctcgccgtca tcatgatcgt ggtactcgct     97440
     ctgctgctcg gccgagtcga ttcccgccgt cgtgtcgacc gatgaacgcg ccgacacccc     97500
     cggcggcgat gacgacgtaa cccccgcctg ctcccgtgca ccgcaccggg gtgttcctcg     97560
     gaggcggcag gtgcggtcgg gcctgcgagt cgccggtgaa aacccaccga gcggcaatcc     97620
     ataccggctc ggcggcaatg ggttccgccg cgggcgggag ggtcggcagc ggtggcgcgc     97680
     ggcgactacc ccggtcggtc gagcacccgc ggtgcccgtg acacggcgcg gcggccacag     97740
     gccgctcccg tcctattcga atgccccctg cttggtccac cactcgtaca tgggtgtcat     97800
     gccgttcggg tcgtccgcga agacctttcc gatcgccaga tcggcttcat tcgtccaggc     97860
     gatggcgggc accggcgggg tgtcggcgga catgaaacac gctacctggc cgacggtctg     97920
     gggttcaccg tgcgaactgt acgggccggg gccgccgcca ccgctcgggc aggaaatgac     97980
     ctccgtttcg ttgaggacat cgtcgtaatg gctctgcagt gccgcgagat cggtgaacag     98040
     gaagaagcgg gcggagggtg caccggtggc ttggttcggc tggcaggaga gggaggagag     98100
     ttcacctggg gtcggctgtt ccgattggca gttgaattcg ccgtatccgg tgggcatgac     98160
     ctgcatcagc tgctcatcgg cggcggtgaa ttggccggac ggttccgggg acgtcggggg     98220
     tgcggacacc ggcgcgggag ccggtgcggg cggcgtgggt gccggtttcg cgagccacat     98280
     cgccacaccg gccgcggccg cgaccacgac gagcgcggcg ccggcgaaga cgatccacat     98340
     ccgcttggac ggacccgggc gcggcggctg gctctgctgg gggccgcccc accccggggg     98400
     tgggggtggg ccgacctgcg tgctgtccca cccggggggc gcgccggccc caccgtgccc     98460
     cgcggtcggt gagtgcgagt cgatccaggt gtcggcgttg gcattcgggg caccgggttc     98520
     gtgcggtggc acggggccgt acggcggtgg tgtcggcgtg tgggtgccgt acggcggtgg     98580
     cgtcggcgtg cgggtgccgt acggcggtgg tgtcggcgtg cgggtgccgt acgtcggagg     98640
     tgtcggcgtg cgggttccgt acggcagagg cggcggggtg tcgacgtagg tcggtggtgc     98700
     gggggcgggc ggcggcgtgt gcgccggtgg gggtgtgccg gcccgtctcg cgacatccgg     98760
     cgggcctggc tcggcggcgt cgccctgggt tttctcgatg agggtggcgg cctcgtcctg     98820
     atcgccggcg ctgagggcgt cgtgggcggc gagtgcgaga tcgccggcgg tggcgtagcg     98880
     atcctgcggg ctcttcgcca tgccgcgggc gatgatggca tcgaagcccg ccggcacgcc     98940
     ggggcgcgcc acactgggcc gcggtggtgg ctcgaacagg tgcgagctga tcttcacccg     99000
     gatgctgtcc gccggatacg gcctggcgcc ggtgaggcat tcgtgtagaa cgcaggccag     99060
     cgagtagatg tcggcgcggt aggtgacctc gctgccgtcg ccctcgaagc gttcgggggc     99120
     catgtagtcg taggtaccga cggcggttcc cagggtggtc agtttttcgt cggtggccgt     99180
     gttcgcgatg ccgaagtcga cgaggtaggc gaagtcctcc cgggtgacga ggacgttctc     99240
     cggtttcaca tcgcggtgga cgagcttgtc ggcatgggcg gcgtcgaggg cggcggcgat     99300
     ctggctgatg atggcgaccg cccgcggcgg ggccagcggc ccgtagcggg tcaacagcga     99360
     gcgcaggtcg gtgccctgca ccaggcgcat gtcgatgtac agcacgccgt tgacttcgcc     99420
     gtagtcgtgg atcggcacga catgcggttc ctgcaggcgg gcggcggcgt gcgattcgcg     99480
     gcgcagacgt tcccgaaaga tcgggtcatc ggccaaggcg tcggggagga gtttgagcgc     99540
     cacggtgcgg tccttgtcga ggtcgtacgc ctcgtagacc tcgcccatgc cgcctttgcc     99600
     gagaagcctc ttgagatggt aatgcccgaa ctgggtaccg atccgtgatc cctgcgcggt     99660
     gccgctcatc gttgcactcc cttcggcgcg atggtcgcag gcggccttcc gccggcgacc     99720
     atcgtgatcg gcaaggggaa cggggagtgc aggtcgagcg gtggcctctg tcgcctcggg     99780
     cgggccgcgc acgcgatcgg cgcaggactg gtgttgcggc gggcaggacc acggcgctgt     99840
     agaggaagct cccgcccaga ttcccctcca tcgctagatc gcctcgcgcg cgaggccgac     99900
     aaagtcgttg cgctaccacc ccgactctaa tagctcggta gccgagacac aaggaatcct     99960
     gaaggcacgg agccctggtc gatcccgggt actctgacag gcatggaacg cgatattcgc    100020
     ttggcgctgg ccgtccgcga tctggtcttg gcggtggagc ggtatcgcgg tcacgcggcg    100080
     cgcgggcacc tgcgcatcgg cgtgaccgag accgtggcac tgggccatct ctacgtcaac    100140
     ggccccctga ccgcgagcga actcgccgcc gaactgacca tcaccagtgc ctccgcgacc    100200
     gaactcgtcg accggatcga gcaggccgga tacgcccgac gggtgccgca tcccaccgac    100260
     cggcgcaagc gactcatctc gctcagcgac cacggccgcg acgaattcag tcgcatctac    100320
     ggggaactcg gcgagatgct cggcgaggtc taccacccga tgccccccgc cgatcagcgc    100380
     ctgatcgatc aattcatcac cgaggccagc gccgccatca acaaccgggt ccgggcggac    100440
     gcgaaaccgc agacctcccg acgagcgctg gacgacaaga ccacggcctg acgggcgcgc    100500
     cggtggcagg ggctctcgct ctcgtcgacc ccgcgggatc gcacccggat ggagcgcgga    100560
     tcggggtctt catgcgcggc actcgatccg agtggctccc tgcaggtcga ggggccacct    100620
     tggtcgccag gggctatgcc agttcgagca cccggtcgtt cccgaggtcg gagaggtaga    100680
     ggtgaccatc gtcgccggtg gcgattccgg cgggtcgatc gaggcccgtg aacggaagag    100740
     tggccggggc cgatgaaccg gactccagtt cgaacacgtc gttggagtcc agggtggtca    100800
     gcagcacctc gccgtcgtcg gagaccgcca ccgcgttcgg tgcgtgaacg tcactgaacg    100860
     gcagggtggt gggggtggac gctccggccg tgagctcgag gacccgatgg ttccgcgagt    100920
     cggggacgat gacatcgccc gcatcgctca cggtgacatc ggtgggccgg ctgagtccgg    100980
     tgaacggcag cgtggtggga gtggcggacc cggcggccag tttcaggacc cggttgttgc    101040
     ccccgtctgc gacatagacg tccccgccgt cgctgaccga aaccccaagg ggttcatcga    101100
     gtccggtgaa cggcagggta gtgggagtgg cggagccggc gaccagttcg aggacccggt    101160
     tattgcccgt gtccgcgacg tagacgttcc cgcgggcgtc caccgccacc gccagcgggt    101220
     cgtcgagccc gctgaagggc agcaccgtct gggtggttgc gccgctggcc agttcgagaa    101280
     cgcggttgtt taaggaatcg gcgacgaaca cggtcccgtc cgcgtcgacc gcgaccccct    101340
     gtgggctcgc caggccggtg aaggcgagcg cggtctgggt ccgggcggcc ggtgggtgcg    101400
     gcgacgcgag ataggcggcg accgcaccca cccccgcgcc cacgaccacc atcgcggcca    101460
     gcacaccgac cacgatcgtc gtcgtgcgtc gccaccagcg caccggtccg gcctgcccac    101520
     ctgcgcgggt gccgcccggc cggtctgcgc cctcgacacc ccggtggggc ggcggggtgt    101580
     cgattcgcac ccggcggggc ggggtcgccg cccggacctg aggaggaggg ctcggggcgc    101640
     ggatccggtc cggtaccggg ggtgtcggcg gggtccggat ctcccgtggt ccgggcgccg    101700
     gccgggggga cgacagggcg ctgcgcgccg cctgcgccaa cgcgccgcaa ctgtcgaacc    101760
     gggtgtcgcg gtccttcgcc aacgcctgcc ggatcaccgg atccatcgcg tcgggaagcg    101820
     agggtcgcag cacggtcggc cgcgggatcg gctggttgag atgcgcatcg accaccgcag    101880
     cggccgaccc cgagtacggg agccgaccgg tcaacaactg gaacagcatg cacccgaggg    101940
     aatacacgtc ggcgcgggga tcgagttcga cccccgccac cagagcctcg ggtgccgcat    102000
     acaccagggt ggccaccagc atgcccgtcc tggtcagacg ccgggtctcg tccaggttct    102060
     tcgcgatccc gaagtccgtc agcaacactc gccacacccc gccgccggcg gccggtcgcc    102120
     cggcgagcag cacgttggcc ggcttgacgt cgcgatgcag gatgccgtgc tcgtgcgcga    102180
     agtcgagggc ctgcccaatt tcggcgacga tgtggacggc cagatccggt ggcagcgggc    102240
     cgcgccgcag cagcgtcgcc gcgtccgttc ccgccacgta ctgcatggcg atccagagtc    102300
     ggtccccctc gcagccccgg tcatatacag tcacgatatt ggggtgctcg agtcgcgcgg    102360
     cgtgttcggc ctcgcgcacg aaccgcgccc gcacgtagtc gtcggcggtc ccatcgagaa    102420
     ctttcaccgc gaccccccgg ggcagactcc cgtgccgcgc cagatagacc gtgcccatcc    102480
     ccccggtacc gagcacccgc tcgatcgtgt atccggcgaa catcgcaccc ggcaccagat    102540
     cgtgctcgct catccccacg cacccaccct gcccatcaca ggagaccgcc tcactcattt    102600
     ccggtgtgca cgagtagtcg tcctcgtgag cgtcacggtc gaggtcaccg ccgcccttac    102660
     ggaccagcca ccacacgagc cccacctcgc ctgatgaacc gatccatggc acgcaccacg    102720
     aatggtcggc atgcccgcca cgcccgccac gcgagcagca gcggtccctc ggacgaccgg    102780
     cagaccgctc gaacgcacca ccaagtataa ctcggtatcc gagttatacg ggtgccgagg    102840
     tggatcgtcg cgcctccgaa cacccgcgat catgcgtccg ccgagaactc cgggtccgcc    102900
     ttcgcgttcg gcgtcggtgg ggcggcgtga acgagggcgc tgcccgcgtc cgggcacaga    102960
     aaccactcca cctgctctcg cggacagacc cacccgtgcc cccgcaccgc tggcggcaca    103020
     ggggcacgag gaccgcgctc agacgggcag ctggtcggtg tactgagggc agtacaccga    103080
     caccgaacca ccgatgacgt aacccacctc gtacgcggac agggacgaat gctgcagacc    103140
     ttccgcagcg acctcctcga aggtggcgcc atcagcgaat tcgccgcaga tgtgatgggc    103200
     cagcccgacc ccggcgtcgt cagtgctgaa cgcgatccct tcatcggcca tgccctcgac    103260
     gaacaccgcg tcctggccgg agagcgacga ggcggtatcg gcgttggcga ccgagacggc    103320
     accgagggca ctcaccccga tcacggcggc cagggtcagg gtgcgggcgg cggtggtgat    103380
     acgaatggac atgacaggcg ttccttttgt cttcgtcggg ggaaactgac aagagaaagt    103440
     ctgggagacc ggcctgatcg aacccttacc gaattcttga acgcccgaga atgaaaccga    103500
     caggcaggcc accgagctcg acaccatgaa tcgtcccgcg ttcgatgcac cccttccttc    103560
     tcggggcagg tgatcctcat gccgaatagc taccgcgccc aggtacggga ggaaggccgt    103620
     gcgcctggcc ctcgagcacc gccacgggta cacctgacga gtacgaggcg atccgcacga    103680
     tcaccgagcg gatatcaccg aagacggata cggcgcggtg cgggtccata aggcggaatc    103740
     gggcgatggc gacatgcccg ctgcgccggc atccgaggcc aaagctgaac tgcaggcatg    103800
     gcgaggaaga acgccgagcc ggagaagacc atcgaaatac taaagactgc aacgccttta    103860
     tccgatcgga agtgctaccc cccacacaca catgatcccg attcatcacc gaacatcgcg    103920
     atcagctgcc ggtcgcaccg atccaccggg tgcccaccga gcaccggtgc accatcgccc    103980
     cgaggacctt ctacgcctga cgcaagaccg cgatcgcggc gcgagcggaa aacctgcacg    104040
     ttgcggacga tgcccggtga cccattgcgc gaaaaaaata ttcatcacat cagggtcgca    104100
     atatacggct ctgcgcttcg caggagaccc tgttcttaaa gggactgctg ccgtcgatcg    104160
     ggacgttggc cgacgccttc gacaacgccc tcaccgagac gacggccggg cctacacgac    104220
     cgagtgcatc gctgaccact ccccgttccg cgtcgggccg ttgcgcaccg tcagcgacgt    104280
     cgaggaggcc acttcggcgt tggacacact ggtacaacac cgcccggctg atgcaccggc    104340
     ccgggcggat cccgcccacc gagtacgacg tcaagcagta cgctgcacac cgtgccgatc    104400
     aaccgttcgc acacaaacaa cactgtgtgc atcagactcg ggatggttca caatcccccg    104460
     tccgaggcag ttcgccgcgg acgcaggcga cgccgggcag aagcggccca cgcacaggta    104520
     tggccgtccc gcaccgtgaa ccccctgcct caccgcacaa cccggccaac gacctcccgg    104580
     agtacggtcc accgccgctg atcgggcacg gcgaaaccct ctcccccaca cacgactacg    104640
     tccgccccgg tccaacatcg gaccggggcg gacgtaatgc agggcagccg tatcagcaat    104700
     accaatacgt ggtcgaataa ccgtcgtcat accagcagat gtagacgtcg tcggtgtggc    104760
     gcggcgcgcc ggccgaagcc gcgttcgctg cgccgacacc accgagcacg gacaagccga    104820
     taaccgacaa caacatcgac gaacgggcaa aacggcggat gtggggggta aacatggcgg    104880
     aaactcctca aaacggggcg gaatgacaaa tccaagaatc cgcccccgcc cttaccgatc    104940
     ccttatcaac tcctgaccga tgaacccctc ctccaccgga gctcaaaccc tcaccgatcg    105000
     tgcatccctg cgcctcgacg agatgcgtga ggacctccga cgcgaactag tactacaggg    105060
     ctaatgcctg gatcttgagt cggcgcctga agtggtgtct gcgggcatcg gcttggggct    105120
     cgcgtcggaa gcatgaccag tcggctggcc aagagcggtg cacggaagaa gaccgaccag    105180
     ctcgaagagg cgctgcgcgg attcttcacc gaccaccacg cgacgattct gaagatgatg    105240
     ctcgacaaca gcgaccggat cggcgcccag atcccgcact cgacgcgctg atcgaggacg    105300
     cgatcagcct ttctcccgac aggcgacccg cctcgctgac atcgtcggcg tgaacaccgt    105360
     tgccgccgcc gagttgatcg ccgagaccgg ggtcgacatg acccgattcc catccgccgc    105420
     gcatctggtg tcgtgggcga agttctgccc gcagacccac cagtccgccg gcaagtccat    105480
     gagcaagggc cgcggaaagg gcaacccatg gctggccggc actctcggcc gcatcgcgtt    105540
     cgccaactcc cgcgccgaca ccttcctggg cacccgctat cggcgcctcg cgcgacgccg    105600
     cggcaagcag aaggcgatcg tcgccaccgg caactcggta ctcaccgtcg tctaccacct    105660
     actctcggac ccagacgccg aattctgcga cctcgggccc ggatactacg aatcccggat    105720
     caacaaacac cgccgcgccc gcgacctcgc cacccagctc caggcactca ccggccagca    105780
     catcgccatc cgcgacggca aagccgtcat caccgacacc gccgcctgac cccaaactca    105840
     acgcggcaga acaacataac ccggctcagc cgggtgcctt cggtctgccc actcatcatc    105900
     ctattttcgg gtcatacaag gactgatccg atccccgtcc gggagcaaac aacactcgac    105960
     ccgaatcgcg ccgacgtgcg tgtaacgccg cggcctccac cgcgaataac cagcgaacgc    106020
     tctcgcgccc actacggggc acgggagaaa ggcaacaacc ctcctgatgt cgacacctcg    106080
     ggtggggcgt gtcgtcacgg gtgccgaggg gtgcgcagcg aagaatcgac gtagaacgcg    106140
     acagtcgagg agggtgccat gaaccccagc cgcatacgca ggctcaggcc ggtgcccgac    106200
     accgagccgc aaatgctgtt tcgcaccatc cacggatacc ggcgcgcctt ccgcatggcc    106260
     ggtgacggcc ccgcgctgct gctgttgcac ggcatcggcg acaactcctc gacatggacc    106320
     gagatcatcc cgcacctcgc cgagaattac accgtgatcg cacccgatct cctcggccac    106380
     ggacgctccg acaaaccccg tgccgactac tccgtcgccg cctatgccaa cggcatgcgc    106440
     gatctactct cgaccctggg aatcgaccac gccaccgtga tcggacattc gctcggcggc    106500
     ggcatcgcga tgcagttcgc ctaccagttc ccacagatgg tggatcggct catcctggtt    106560
     tccgccggcg gtatcaccaa ggacgttcat ccactcctgc ggctcgcggc gacaccgatc    106620
     ctcaacgagg cactgaaatt gctgcgcctg ccgggagcgg tgcccgcggt gcgatgggtg    106680
     ggaacggtgt tgactcgact gcacggcact gccctgcgcc ccggtgcggc gctgcacgac    106740
     acaccggatc tggtgcgtat cttgaccgaa cttcccgagc ccaccgcgtg cgaggcctac    106800
     ctacgcaccc tgcgtgcggt ggtcgactgg cgcggacaga cggtgaccat gctcgaccgc    106860
     tgctatctga ccgcaagatt cgacgaggcc aaatggcggc aaactactca acatcggaac    106920
     cgtcgagaca gctctcaccc cacacgtctc gacgcgtgcc gccgtgctcg acgcggtcgg    106980
     agccgccgaa cgcagcgcca cctgattcgg gctcaggtga ccgacgccgg acacaacacc    107040
     cacccagtac ctggggtagg aacccacgcg gcacggtcac cggtcgcgga caggcgccac    107100
     tccggaaccg atagctgctt cagcacggcg gcggacggca cggacctacg gcgcggcacc    107160
     ggaatccgaa ttccgtccaa acctatcgga ggagagattc cctcgctgct gcggtcggat    107220
     ttcgctgtga gagaggagct ccgcgctggt ctccaccgga cgtgcagcgc aaccgcatcc    107280
     ccgaaatcct gaggacggaa cgcctccgcg ggcggcggat gccgccgatc attctccccg    107340
     gtggcggccg ggtgtccgca tggccgaatc cgggcccggg tccgggttcg ggtcggaacg    107400
     ctggaagccc ggatcgatgg tcaggtcttc ggtgtcggcg aagaccagcc gcccgtcgtc    107460
     gagcgcgacc gcccaccgat gcaccggcgc ccactcatgc ccgccgccgc ccgggtcggt    107520
     caccgccgca tagtcctcgg ccacctcacc ggtgagatcg gccccggcgc tcctgcggac    107580
     cagcacccgg acaccgaccg tcaactccgg gccatcgacc ggccggctgc cgctgtatcg    107640
     ggccatactg atgcacctct tcgctcggcg aaactcccga gatcgagcat aagcaccgac    107700
     cggcccggta cgcgacccga cctgcaagaa caccacccgc gcacggacgc cgccgaaacc    107760
     gtctgctgcc accacgccag cggccactat ctacgcgcaa cgcaaccatc aaatgccagg    107820
     ccggaccgta gcggtcattc agcggtggcg gtgagcggac gcgcgagcgc gtcggcgaca    107880
     gctcgactgc gcatcaattc gcggatcacc tgtgcgaaat gtgttgcccc agcagcctcc    107940
     aacgaggctg ggagattgaa cgcacctcca cgccgccggt ggtagtcgat ctgctcgagc    108000
     agcacctcac gtaccgccgc tggtgagctc tggttcacca gcatgaggaa gtcgtcggcg    108060
     gtgtacacct cgtagctgag gatcgcgtcg ttcgtctccg cgaagtcgag gaaccgtttg    108120
     tcgtcggtca cgacgtactg cacggcggcg gcgtgcaggt gggcgtcgta gtcgtcggtg    108180
     tacgcgaggt cggaatcgat gacgttgccc ttgatccggc cgtatggcgc caccgcgatg    108240
     atgcggtccc gaatcccgcc gacctgcgcg tcggagtagt gcgggtgctt cttccggatg    108300
     tgatagatca gctcagcgag gatgtcctcg gtccacgtca agtggaacat cggcgacttc    108360
     cggaaggcga gcaggcatat ccagtccctg agcgtcctcg aatagaggac gtttgcatcc    108420
     gtcagaaccc ctgcgctcac ccgacgagga taaacgcagg ggccctcgtg gacgcggagc    108480
     accggtcagt acgtcatgcc ttctgcgtct tcgaaagcgc gaaggtcgtc gaacgctgct    108540
     cgctgcgcat cacgctgccg ctcttggtaa gcgatcacat cactgctcgt caaccgagtg    108600
     tgggtgccga ctttgtgggc ggggatctcc ccctcgccga tgagcttcat cagtgtcggg    108660
     cgggagatgt ccagcatctg agccgcggtc gtggtggtga cctcactcgg caccgacccg    108720
     atcgtgacgg tgccaccagc ggcaacaacc gccaccaccg cggtaagaat ccgcgcaagc    108780
     tccgctggta ccgccgactc caggctgctg ggatcgacag cgccggcctg ctcgacctcc    108840
     gtggaagtga ccgtgacggt ggtcttcgcg gcacgatcgg tcacaacagc gctcatctca    108900
     agcacctcct atgccataaa tcgtagtgat ttgcacttat aagtgcaacc gacttcgtgt    108960
     tgacgctcct ttcccaacat ccctgccacg acctgccgaa gacggccgcc ctctggtcgg    109020
     cggggatccg gcggcgcatc tggtagggcg aggcgtcgtc tcggaggatg gcctcagcag    109080
     accctggccg cagagacttg cccatcgccg ccaatcagat cgtgtccgcc gcacaacatc    109140
     gtgccggtgg tggatcctgg gaatgggcac gccggaccac gggcaccgta tccagcacgc    109200
     cacgcaccgc taccagcatt ttggcaccca tagccatagt ccctatgaac accaccgtgc    109260
     cgagcgacgt gccccacgtc accgatgcgc tcgacgaaga ccggcgcgga agcactcgcg    109320
     gacatcgccg cccggatcga ggcgcatctc gccacccacg acaggtactt ctgcgttccc    109380
     cggcggcaag gattccctcg tcgtccccga cctggtccgc cgcgtcgaac ccgaagtgcc    109440
     attgatgttc gagcgtgcct cgactgcccc gagacctacg attacctcac tgtcgcggcc    109500
     agtaggaatt ggccactgcc gtacgctccc tatgccgctg cgttcccgtc tgcggtgcgg    109560
     cgcaccacgg tgattgcggc cctgtgggcg gtgcacctta cggcgggtaa gcgcggcgcc    109620
     tgatcccgcg gtcagtgtgg gtcgcagctc cagcacccgg agcccgagcc gctcgtcgaa    109680
     cgagtctgcc cacaacctcc gaatcgcaga tcgtcctccc tgactacgcg ttgaccgtgt    109740
     cggatcggcg cacttgccaa tcgacggcag aacttgaaat cggatcggcg gtatcagggc    109800
     ctggcgcaac ccctgggccg ggaagtttct ctgcgagcgc cagcgagtgc gggtggagaa    109860
     agttctcgga gccttgtgcc gacgcttgcg ccgccaggga ccgccgtcga tcaggaacgg    109920
     aaggccagca cgtcaaaaac gaacgatgtt cttcaacagg gcggagcgca gcggagttct    109980
     tgtagggaat cagaaatcgt ggccaaatct cagcccggat ggccactggg tggccaattg    110040
     gccaatccgg tgagattccg caggtcaggg gctcgtggtg cagcgcaacc gctaccatga    110100
     aaagaaccga atctggcggg aagtggcgga tcgatggcgg cttcgccacc agggccatgt    110160
     ctggaactct tcctggccgc caccacggat ttctccttct tccgttgacg gtcgctctgc    110220
     gacggcccat gccttcggag cggtcggcaa gtggccctcg ggtgagccca tgccccctgg    110280
     gggggtactt ccccgcaccc taggagggga taacggcgtg atcacacggg aagaggattg    110340
     agccgggaca tcacgccccc gaggacgatc agcctgttca tccttgtcca cctctcagga    110400
     cccgatctca tgaaacccac cggcctccgt gccacaactc gcccgcccac cctgcccgga    110460
     gggcagccga ccaccgacac gggcggcagg cagtgccatg tctgaccaag gacccgtacc    110520
     gtacgaaagc cttaccccgc acctcatcca cgcgatgacc ccgcatccag gggactcgat    110580
     ggggacgtcg gcggcaaatt tcctcttatt cgtcgccgcc ccggcctggc tcccattgag    110640
     cgcggtcaac gatggattgc acaatgcgag cgcggcctac atcaacttcg tcgcaaccaa    110700
     acttccattc gcggagaacg actcgaagac cgtcaaggca ttgaaattcc tgggcggtgt    110760
     ggtccaaccg gtcctgatgc cgttcgccgc gctgtggtgg aaaggcaccg gcacacccct    110820
     ggtcgtgtgg gaaatgctcg aaaaggccaa ggaacacgac gaacccgccg tgcatgctcc    110880
     cgagcacccc ccggcgccgg cgccggcacc gacaccgaca ccgagcggac ccgccaccgc    110940
     accgaccggt ccgacatcga gcctcgcccc ggccggcgcc gggggactcg gcagcaccgc    111000
     cgccaacgcc ctcgcacccc tcgcggcggt gcttacgctc gccgccggtg gcctcgtgtg    111060
     gatccagcac caagacaccc cgtcgaccag tgggccgacc cccgtcgtcg aaccggtcca    111120
     agggaccggc aatggagcga atcagcccgc cgcagttccg ggcgatcctg ggcccgccgc    111180
     ggtaccgccg attcccgccc tgcctgcgcc cattgccgcg cagtcccctc ccaaccaagg    111240
     tggaggcgcc gcgtcggatc cggccacgaa tggttccggt acggccggta ccggcggggt    111300
     cggcggggcc gcaccggcag gttctgatgg cggtgggtcc gctccggctc cggcgatgcc    111360
     cgcaagcgac cctggacata ccggaaccct tcccggacca cccgctcctg taatcagtgg    111420
     ggagggcgtc gtcacaaacc cagacccggg aggcgccgga acccctccaa ttggggtcgg    111480
     tggcagcgct ggatccgctc cggcgatgcc cggctcgcaa cccgctccgg gcaccggtgg    111540
     cggtgggcag gtcgcccagg ctccggcgat gcccggctcg cagcccgcgc cggatccggc    111600
     ggaatccgct ccggctggta ccggtgggga ggactactat tgccaaagcg ctgtccactc    111660
     gtgcccgggt ggtaccgaca gcttctcctg ccacacttct gacctttctg tcccgtgcga    111720
     gggaactgat ccgactggtt ccgggggcgg cgttccgccg gcgggttcgg cgaccgagga    111780
     agctgtgaca gacggtgcgg gttccagtgg ctatacggat ccgggtcctg ttccgccggc    111840
     gggttcggcg accgaggaag ctgtgacaga cggtgcgggt tccagtggct atacggatcc    111900
     gggtcttgtt ccgccggcgg gttcggcgac cgaggaagct gtgacagacg gtgcgggttc    111960
     cagtggctat acggatccgg gtcctgctcc gccggcgggt tcggcgaccg aggaagctgt    112020
     gacagacggt gcgggttcca gtggctatac ggatccgggt cttgttccgc cggcgggttc    112080
     ggcgaccgag gaagctgtga cagacggtgc cggtgtcgac gtcgaagata ccggggccga    112140
     tccgggcacg tacaccgctc ccgatcccgt cggtaccagc ggatccacct acaccgaccc    112200
     cggcagcacc ggcggcggca ccagcggatc cacctacatc gaccccagct acggctccga    112260
     cggcacggga gacgcattgt gactcaggtc ctttcgtgtg gtggtcctgg ggggcggcac    112320
     cagcggatcc acctacaccg acccccgtga tgccaccacc ggcgacgaca ccagcggacc    112380
     gcctggtcag taacgaccgc tggccgggcg acggttaaac ctgccgcccc ggcaatccac    112440
     taccggctgt tgtccgtcgc tgaacgtgcc gacgatggcg tcactgtcga tgccgttgat    112500
     gtcgatatga gaagggccct tcccgcggtc gcggggaggg ccttcgtcgg agtggtaagg    112560
     gaatcgtcgg cgtggtgacg tcgcgcgatc agtgactcag tcgtggccac tttcggtgac    112620
     ggcgacccgt gcggacttct cgtcgacgat ggacactttc gttgcgaacg ccgccgtcaa    112680
     cgcctgcacc gccaggttgt ttaccgcccg cggatatccg cgggccgcat tgtgaatcag    112740
     ggtgaccgcg tcgtcggtga acaacggatc cgtccggccg gcgatcttgc agtgatgggt    112800
     gatgtagtcc gccgaatctg tcgggctcat cccggccaag gcgtagcgca ccgcgatccg    112860
     ctggtccaac gcggcgagta ccccgagtcg cagccggtgc cgcaacgtcg gctgcccgac    112920
     cagcagtgcc gcgaacggtg accccgaatc catgtcgtgg ttggtcagca tccggatggc    112980
     ttccatctgc gcgttgtcga gtagatgcgc ctcgtcgatc accacgaccg gggtgcggcc    113040
     tcgctcggcg tattcggcgg ccaatgcctc ggcggcttgc ggcgccaagg tcgcggtgta    113100
     gaaactcggc acccggccca gtgcggtgac gatgtgatgc agcattcccc gcactcccac    113160
     cgacgggttc ggtaggtaga tgatcacatg ccgggctggg tccaaggccg ctgtcgcggc    113220
     gcggatggcg acggttttcc cggcgccgac ctcgccggtg atcactccta acgcgtgttg    113280
     gtccacgcac caggagatcc gggcgacggc ttcggcgtgg ccggggtgcc ggtgcagcat    113340
     cgacggtgcc aaccctcggc cgaacggcat tcgggtgaag ccgtagtagg actgcaggcg    113400
     ttcgatactc atgcgggccg cccgtcgcgg tgggtgaatt catcggtgag gtcgtcaatg    113460
     ctcaactgcc cgggaagctg ctcaccaccg ttatcgtcgt cggtgggtcc gtagagggcg    113520
     tgatacccga tccgccgatc gctgcgaacc tgctcatgat gggtctgggc cgtcaacgcc    113580
     agatagtcga tacccgtcgc agcgggcgtg ggtcgttccg gaatctcggg ccgggctttc    113640
     gggtgcacgt gccgagtgat gttgtgcggc accgcccgtc cgtgcggggc gtcgcggtag    113700
     cggacctcga tggtctccat gtcgaatggg gagaacacca actcgacctt ccgtcccacc    113760
     agggcgtgat cgacctggta ggtgttgccg tgcaacgaca ccgtcgccgt cttggtcacc    113820
     gtccgatact ccgaccatag gaacgcctcg gtcagatcgg cggccgtcgg catcgccggt    113880
     gtccgtccca gccgcgacca cccggactcc caccgatcga gtgggctctg cccggtttcc    113940
     gaatgcaccc gccggtggta ttcgacttcg atccatcccg tcagcagccg gttgagctcc    114000
     aacaacgcgg ttcggtgatc gagacccgcg gcggtgagat cctcggcggt ggtgtcggcg    114060
     acctcgacga ggaactgctc ccggacggtg cggaagaacc gctcgatctt cccgcgccct    114120
     tgcgggcggt gcggggtcga atgcaccaac cggataccga gcttcgcgca ggcccgcagc    114180
     agccacgcat cgacaaacgc cgagccgttg tcgacgtaga ccgagcccgg gacgccgcgc    114240
     gccgcgagcg ccggctccaa cgcgaccccg agacggacgg tgtcctcaga gaacccgaac    114300
     cggtagccgg tgatcaaccg ggaatgatca tccaagaatg cgaacagata cgtcttgcgg    114360
     ccaccgatcc tcggcccgtg cagcgcgtcc ccggtccacc gatcgttcgg gttctccgct    114420
     tcggaccgcc cgaacacagt cggggcgttc ccggcggcgg ggccgatcaa ctccagccgg    114480
     tggaaatggc gcagcagcgt cgattccgac ggcgcccatc ccgccgaggc ccgcagaatc    114540
     cgttgcacct gcgcgacggt gcgggccgga ttctcccgtt tcagcgacgc cgccaactcc    114600
     aaggtcgcag tgtccgtccg cggagtcccc gcccgcgtgg tgggaatcaa ctcctcgaac    114660
     ccaccggccc ggtagcggcg gatccaccga tcgagcgtgt cccgcgaata cctcacccgg    114720
     gttccgaacg ggtcggtgtg ctgccggctc gcgatctccc gcaccagccg gccccgggcc    114780
     ttcgtcgaca acccggcatc gagcgccggg cagatcaatt ggtagcggaa caacccgacc    114840
     gcatggcttc tctcacgtcg tttctcatca tcggtaggca acacgatccc cattcatcga    114900
     agaatgcgct gcccgaacct gttgccgggc agtcacaccc gcgacgatga cggatcatca    114960
     ttgtcggcgg cagggtcaac tggtgttgca ggatccgatg ccgggaccgg tggccagccg    115020
     ggcgagagca gccgaccagc actggccgcg acggcgacct gcgcggccgt caccgcgccg    115080
     aggaccgcgg accttccgaa gcgagcggtg atcgcaccgt gtgccgcgtg caccgcggcg    115140
     aggacgtcgc cccacaccga ctccgttgtc ctcggcaccg ccacatccac acccgtcgtg    115200
     accgcgaccg cgaggaacca actacgcacc gcatccgctc gggccgcctc cacccgcaac    115260
     cagccgcgga ccgtggaccc cgggatgccc aatcgctgcg cgatcgggcg gtgcccgtga    115320
     ccgcgggcct tcgccgccaa cgccgcccag atcaactccg cgagatacgc cctgcgcagc    115380
     aacaacgtca ccggcagcag gacgtgcgtc accgcacacc cccggcaccg tgcccgtcgc    115440
     ggacgcaccg gcgcagccat tccggccacc gggcggggtc gggcgaaacc ccagcccgcc    115500
     agcactccac cggtgcagga cgggcaggac atgtccccgc gcgacaggcg ggactcgacg    115560
     cggacaggat cgacctctac cgtgaccatc agtgcgcctt tcgcacgacg cacggtgccc    115620
     ccgtgagctc cgccaagaat tcagcggggg cgccgtgcac ccatcagttc ctcgtcacac    115680
     tgatggtgca gaccaccaag atcaacccca cgccgatcat tccaatcaga tcggcaacgt    115740
     cattgacgac cgcggacccg atcctcgtca tcgccagaga cgctcaacaa ccggccccac    115800
     tcgctgaggg cggtagtgcg ccatgtcgta cgaaacaccg gcagcagcga cagcccgatg    115860
     tacggcccgt tcctggaggg ctcaaagtat tgccttcctt cgccccaacc actcctgacg    115920
     tcagcgggtc caggccaacg ctcgtctcag cacggcacgg cacggcccgc atcgcgatgt    115980
     cggctgaaga aatgccaggg aattgagaca gattgcggtg gccatacctt gagaccaatg    116040
     ataatcccgc aggtcgcagc ttctcgaaat gtcatcggca gcgagaccct acagttcgaa    116100
     tcaggggacg ccgcaggcgg tccggtagcc gccggaggcg ggtaccgcac gaaccgaatc    116160
     acccgatgcc ggccggtcgc ggcgggtgac gcgccgtctg acggcgatct cgcggttcat    116220
     gacctgctcg atcgaggcac caggcacgct agtgtcgtac gccataaatt cgtgctttaa    116280
     attgatatcc tgaggcatgc ctcgaaccgg acgcccgaag gctgagttga tgttgaccga    116340
     tgacgaacgc gaacaactcg ttcgatggtc gcggcgagcg aaaaccccac agtcgttggc    116400
     actgaggtcg cggatcgtgt tggcctgcgc ggagccgggg atgacaaaca agcaagttgc    116460
     ggcagaccta gggatatccg ccaatacggt caacaaatgg cgcgggcgct tcgtcgaccg    116520
     acgcctggac ggcttggtcg atgaacctcg accgggtcgt ccgccctcga tcttgctgga    116580
     ccgggtcgaa gacgtggtta ccgcgacact ggaaacctcc ccggccaatg cgacgcactg    116640
     gtcgcgtacc tcgatggcca agcgcaccgg cctgtcaccg tcgacgatcg gccggatctg    116700
     gcgcaagttt gaactcaaac cgcatctgac cgacggtttc aagctgtcca cggatccgca    116760
     gttcgtggac aaggtcgtcg atgttgttgg tctctaccat aatccgcctg agcgtgccgt    116820
     cgtcctgtgt gtggacgaga agagccagat gcaggccttg aaccgttccc agccggtgct    116880
     gccgatgatg cccggcatgc cggaacggcg cagtcatgac tacgtccgca gcggcgtcac    116940
     cagcctgttc gcggcgttca acatcgccga cggcacggtg atctccgagc ttcatcgacg    117000
     tcaccgggcc gtggagttca agaagttcct caccgcgatc gacaaggccg tccccgagga    117060
     gttggacgtg catcttgtct gcgacaacct ggccacccac aagacgccgg cagtgggcga    117120
     ctggttggcc aagcacccac gttttcacgt ccacttcacc ccgaccgggt cctcgtggat    117180
     caatcaggtc gagcgatggt tcgcattcct gaccgatcag ctgctccgcc gtggtgtaca    117240
     caaaagcgtt gcagcactgg agaaagacgt tcgcaactgg gtcaaaacct ggaacgacga    117300
     cccgaagccg ttcgtctggc acaagaccgc cgaggagctc ctcgattccc tcgctaaata    117360
     tatctcacga atttctgacg cgggacacta gaccgcgcgt tctcccctgt ctgtttctcg    117420
     cagggttacg cgagcgagca tctgttccat ctgcggccac ccgaaccgca ggtcggtggc    117480
     gatcatccct gcacgggtgt cgagatccgg ttcgaacgcg gcgaagacga cccgagcggc    117540
     tggggcgagc accgtgtgct cgacagcctc cacggtgtcg cgcgaccagc ggtcctcgtc    117600
     ggcggtggtg tcgggttcgc cgaacagctc ggtcagccgg tggcgggcgt aaccggcgtg    117660
     tgcgaggtca gttgcggtgt agaactcggt catagctccc cctgtgcgtg cggacgtgac    117720
     gatttcggga ccggacgatg cgtgacgggc acaaagatcg tgtcgacgcc ggacatgatg    117780
     agtgctccgg cctgctgcca gccgtgctcg gtcagcacgc gggtggcctc ggtgatgcgg    117840
     accgtgcctg gctcgagcgg caaggtagcg atgacgtcgc cgtcctgggt atggacctcg    117900
     atcggcccct gatggaaccc gaaggtgacg tacggtctgc cgtcggcgag gtggtcgagg    117960
     ccctgttcgg agagtttgcc ccggctgcga cgctcccagt ggttgcgcac catccacccg    118020
     agcaggactc ccagtgcggc aacgttcagg ccccggagaa tccattcgcc catcaggtca    118080
     gctcctttgt tttggcagtc cggcgacgct gattgccctt ccagtcgggt ggcgacgttc    118140
     cagcgtgtca tcatgccctg ttcttcgcag ccttcctgca cggcagcctt cgctgcagca    118200
     gtctgcgtct cggcgcgggc ctgcgcgagc ggagccgtcc tggatgcgtt cgagttcctt    118260
     caaccgaggg tgcaggtcca gggcacaatc gcaggtgtga gtcggttgat cgcgccgatg    118320
     atcgcgacgg ccggtccgcc cccgggcgat gaccgtccgt ggagcttcga aatgaagtac    118380
     gacgggtgcc ggttgctggc ttcggtcggt ggcggccggg agccggtgct gtggacccgc    118440
     aatctcaacg tcgtgaccgc ctcctagagg tcgccgaggc cctgtcgacg gcattcggcg    118500
     gcggcggccg catcgtcctc gacggggcga tcgtggtcat ggaccggggc cgtccgtcct    118560
     tcgggctctt gcagcgcaga ctcggtgtgg cacacgcgac gaagccgctt cagcggcgga    118620
     tccccgtgac gtatctgcct tttgacgcgc tcgtccgaaa cggcgtggaa ctcctgcgag    118680
     tgccttacct ggatcggcgg gcggagctgg ccgaactgga atcgatcgtc gagaagatcg    118740
     gcgggctccc gatcgcagtg ccgccgcact gggaatccca gaatggtcgc gtcatgctga    118800
     atgcggcccg ttcggcgcag atgaagggaa tcgtcgccaa gcggtcgaac tcgatttacc    118860
     ttccggggca acggaatcga tcgtggatca agaccgcgat ccggacgagg gggacggtgc    118920
     tcgcgatcgg gttcgtcggc agcagccggt cggtggccgc gctggttctc ggcggctata    118980
     ccgccgacgg gcgactcgag caagtcgggc acgtcagcag cggcctgagc gtctccgcgc    119040
     gccgccagct ccgggaggag ttccgttcgc tcgaacgccc caccagcccc ctcccagacg    119100
     acccggcagc ggccccggac ggtgacggcg atgtccgctg gctgactccg gtcacggtgg    119160
     tcgaggtcga tttccgcgag ctcacctcgc gtgggctcag gcatccctcg tacaagggca    119220
     gacgcctcga tatcgacccc gcatcggtcc gggtcgagga cctgtagaaa tcagaggaaa    119280
     gccgccggca ccttccccgg tgtcagcggc tcctcatccc ctacgtatcc gggaacgcta    119340
     cgcactgtag gtcttacccg gggcgggggt gacagtgacg ccatatcgcc tctcggcaag    119400
     tggtcgctcg aagcgacttt tctggtgtgg tacccggggc atgcgcgcca ccgtcagccc    119460
     cttcaacagc gggaggtgtg gtcgtattcc aaccccgatg aggcgcgcca gcgcgggggc    119520
     ccgcgtgggc tcacacgctg gtcagtgggc ttcctcgacc gtgatcggct tcagcagctc    119580
     ggcgccgttg ttgcggacgt tgttcacggc cttggacacc gggtaggtct gtaggctgcc    119640
     cggtgccggt ggtgccatca gggatcgggc gtgacgagaa cgcagtgcgg cgctgattca    119700
     ggtgccgaaa ccgcggcccc gttacgttat ttacggtcct tcacagaagg gctacggtcg    119760
     ccagacccgg tatgactcct tgcccctgtc tcacgcatga tccggggggt ggtgtcgccg    119820
     ggtgtggtgg cgtcgacgga ccgctgatag ggacacggcc aaccgaagtt tgggtaggtc    119880
     cctttgtaac gtgggtgccg ggcgtcgatg ccggatcggc gaccgaccga ccggagacac    119940
     aaggggcgaa ccctgaatgg actcgaacta tgcggtgtac tgcggcatcg acgtcggcaa    120000
     aggtgagcac cacgccgtcg gactgaccgc cgccggaaag aaaatctacg acaaggccct    120060
     gccgaacgac gaagcgaagc tgcgggccag ccacggatcg gtgctggtgg tcgtcgacca    120120
     acccaatacg atcggcgccc tgccggtcac cgtggcccgc gcctgcagcc acgaggtcgg    120180
     ctacctgccc ggactggcga tgcgccgcat cgccgaccta taccccggac aagcgaaaac    120240
     agacgcccga gacgccttca tcattgccga taccgcccgc accatgccgc acaccctgcg    120300
     ccgggtcgac accggcgacg aggccctcgc cgagctcgag gtcctcatcg ggttcgacga    120360
     cgacctcgcc ggcgaggcca cccgggtcag caaccgcatc cgcggactcc tcaccggaat    120420
     ccatccagcc ctcgaacggg tcctcggccc ccgcatcgcc catccggcgg tcctcgagat    120480
     cctctcccgc tgcgggggac cggccggaat ccgcaaggcc ggcaagcgca agctcaccgc    120540
     gatcgcggtc aaacacgcgc cccgcatggg cacccgactc gtcggcgaga tccttgccgc    120600
     cctcgaagag cagaccgtaa ttgtccccgg cagcacggcc gccgagacca tcctccccaa    120660
     actcgccgac accctgaaag agactctcca gcaacggaaa tcggtcgctg aggacgtgga    120720
     gggggccctc gatgaccacc ctctttcccg agtcctgacc tcgatgcccg gcatcggttt    120780
     caggactgca gcccggatcc tgatcgaggt cggcgacggc tccgccttcg cctccgccgc    120840
     ccaccttgcc gcctacgcag gcatcgcacc ggtcacccgc aaatcgggct cctcgatccg    120900
     aggcgaacac ccggcccgat ccggcaacaa aaagctcaaa cgagcgctgt tcctctccgc    120960
     gttctccgcc ctccacgacc ccaccagtcg cgcctactac gacaaaaagc gtgccgagaa    121020
     gaaaaaacac aacgcggccc tgatctgcct cgcccgacgc cgctgcgacg tcctctacgc    121080
     catgctgaag aacaaggaac tctaccgggc accactcccc tcggcggctt gacgggaacc    121140
     atagggacac cccccggttg ccgccgtagc tcctcgatcg cctgctccgc ggcgcgcagc    121200
     gcggtggtca gcgcatcgac acggtcggcg gccgattgcc ggacctcggc cagctgtgcg    121260
     gtgtgatcgg cgcgcacctg gtcgcggtcc gtacgggcct ctgcgcgcag gtcggcgagt    121320
     tccccgcgca gacggtccac atgctcgcgg ctgtcctgca cagcggcctg cgctgcagcg    121380
     gtctgcgtct cggcgcgggt ctgagcgagc cgagcctcgg cctcggcggc cgcgatcctc    121440
     ccctcggcgt cggcctggat gcgctcgagt tccgcgcgtg cctcacgttc ccggttcgcc    121500
     gcgtcctcca cggcggcagc ggcctcggcc tgaatccgcg ccagctccgc gtaggcgtcc    121560
     tccgcggccg cgtcggcctc ctcccgtgcc tgctgatatg cactcgcgcg ggcctcggcc    121620
     tcacgtcggc gccgttcctc ctcgccccgc aaccgttccg cttcggccac tttcgcgagc    121680
     gcctcggcgt gggcctgatc gacctcggcg gcgaccgcct cgacatcggt caccgaggcg    121740
     atcgtctcgg tcatcgtctc aaggaaaccg cggagctccg ccagacggga gggcaactcc    121800
     tcgagctgca caccgagggt cgcccgagcc atcgacaccg gcgccgtcac cccaccccca    121860
     tatcccgcac cggtacgcgt tggcgatcga gctcgggcgg cccctcgaac cggacgaggt    121920
     tgcgttgcac gaagtctgcg acaaccctat ctgtgttcgg gcgacgtcgg aagcgttagg    121980
     tcgtccgcac gtggtgctcg gaacgcaagc acaaaatctt gccgggatgg gtgcgaaggg    122040
     acgcggcggc ggtcgcgggc agacgtggcg ttggtacggg cccgatcgtg cggcgcgcgc    122100
     ggcgcggtcg cgggcgttgc gggaagcgat tcgcgacggg tgggatgatg agaaagtgcg    122160
     gtcggccttg ttgcggactg acgtcccgac cttgttctga cagaaacacg cccggtcgat    122220
     gccgggaagc gttaggtacg aaggggagag catgagcgag gacagaatag cggtgcaacg    122280
     ctcggcagtt gagtccgcgt tgtatcaggc caccaagcac atctgggcgg tgacggacac    122340
     cgatctcgag gcgatcgtcg ctggcgagcg tgtcggaccg ctcggtcatg ctgacacgac    122400
     gggcgtggac gtcgcgtttc cgaacccgga ctcgctgcgg gacttgatct agaccggagc    122460
     ccgcgcaaca cgacgatgtt gcgcacttcg catgcgctga gggtgttcgg gctcgatgcc    122520
     cgaacaccct ctacgatcac cgagggcgca cccccgaacc taggccgttc gggggcgcgc    122580
     cctttgttgt gcgtgtcagt tgaactcgac gcccaacttc tccgcaatgt cgacgccgat    122640
     agtcacgaga cgggcgattg cgtcgggtcg gatgccgtcc tgaatcgcaa tttcgagcat    122700
     gtcgagcaac ccggtgtgcg tttccggcgc ggtctcggcg acgtcgcggg cggcgtcgaa    122760
     tgcgatgccc gcttccgcgc cgcgaccgtc gaggtacgcg aacatcccgg tgatggtgag    122820
     ggtctgcaca cgggcgacgc cgcgtacctg gttcgcgacc aacagcatcg ccgcgtgtgc    122880
     gtcggtggca ccgtaatggg caagggagag caacgcatcc cgcaacgccg ggttgatcgc    122940
     ggcgagcaag ccgacgcggg ctgcgagatc ggcgctcggg gtctcccggc cctgcacgac    123000
     ggcggccagt tcggtgatgg tggtgcgggg gaagtcaccc aggagccccg ctgaccatcg    123060
     gctccggcgt ctccgtcggg cacaatgccg tcctgcacgg ctgcaccatc ggcgacgacg    123120
     tcctggtcag catgggcgca atcgtaatga accacaccaa aatcggacga ggagcaatca    123180
     tcgcggccgg tgccctggtg cccgaaggcg tcgtcatcga accgaattca ctcgtcgcgg    123240
     gcatacccgg caaagttcgg cgcacatgca ctccggacga actcgagcag atacgacaca    123300
     acgccgacaa ctacgtcaag agattggcct actacgccac gaaatcctga aacggaccgt    123360
     ttcagcgtag tcgcgctcag tgagagtcag gcaagttcgc agccgacggt gcgactcgcc    123420
     gccaactcgc gtcgacacaa cacgcccact ttctagggga cgttcgcctc tgaccatcac    123480
     gaacgacgat ctgcccgtcc gcgagctgaa cggcgctgat cgcctcgagc actccgtggt    123540
     cgcggatgga ttccacgaaa tcgggcgtct cggacagggc gacccggtcg cggacgttgg    123600
     cgccgatgtc gagagcgtgc gggtcgagac ggacgaacat ttcgccgtcg atgatctcgg    123660
     cgatggggcc gttctgaatt gcagtcatgc tggtctctct cctaggattc ggatccaaga    123720
     caccgggcag gtaccaactg cccggtgtct tgtgttttcc ggtcgaaatg tctcagctag    123780
     ccggtcgcgg acctgtcgtg tgcgggaaaa ccggtcaccc ttctccacgt ggttcccttg    123840
     tggaggtagt actccaagat gtggagatca cgcagttccg ctgcgagggc ctcgcacccc    123900
     agcgcttcca gcaacgtgac gtaacggtcg acgtggcggc agtcgagaag agcgatttgc    123960
     cggaccaccg acttgtccgc gaagacttct tccgcgaacc cgtctgcggc ctcgcagata    124020
     gccaggatgt cgtacacctt gtgcgccttt cgttcggtga gtggtgcctg agccagttcg    124080
     gcacgggcga catcgggagc actggtgatg actccgttga cgatgaaatc cgctgtgctg    124140
     ctcacagtta cctccaattg ggatcaggac acctgccgcg ccctgatcgt tctttttgcc    124200
     ttgctggcaa ggagatcgga aggccagcaa gtcaaaagaa cgatgttctt cttcaacaga    124260
     gcggagcgaa gcggagcatc ctcttgaagg acaccgaagg tggccaggcc gccgggcagg    124320
     cggatcccca actgatagac gactacgtgc gaacgggaga ctggttcacc ccagacctcg    124380
     agggtctcga actctcggcc aaatctcact ggagatgacc actcggcgga cagaagccag    124440
     tgggcgagcg tcggcgagca gtacgcccac tcccccgcaa ggtgcgaccg ttctggaccg    124500
     ggctgcgggc ggcaggatca gcgcggtggt gttcgttcgt cgcagcggac gcgaaacctg    124560
     gatgatgggt ccgtgactga tgcagagcgc ttcatagtgg ctggccgtga cctagactga    124620
     tgttgccgcc atcgctcgcc ccggagtcag gctcgtgaac tgtgggcctt ctggatacga    124680
     ggggtgaacg tggatgcgaa atctgcgtag agtcgacttc agccgatatt tcccgattcg    124740
     tcagtgatac ggagaagcca tgttcaacat tgtggcaccc acatcggaat ggcttggaaa    124800
     tgctgccgtc gatggtccgc cggcgaccgt aacggcaagc gccagtgatg ttggttcgtt    124860
     cacggtacaa atcaccagcc cgagcggcga gttagtccgc ctggatttcg atgccaccgg    124920
     aacgtacagc ttgtctaccg tgcgggaaac gaattggaag gtggcatcca ttcgaattcg    124980
     tacggatggt cgatcaccga atgtcgttgt cgaccttcgg tcggcgcgct cgcttgacga    125040
     cggaagcatc gagggccggt cggtgagcac cttcggtccg cggcgtcgcc ttgtccgcga    125100
     catcggcatc acacccgagg gaagctggaa gtcgcggtat caagatgtcc gtcgaagtgg    125160
     agtccgaatc gtcggggaag cttcgggtga ggtcggctca agcggtaact cgcaaatgac    125220
     ccgctgtcgc cttgatcctc agggcggcga ggtttggacg ttatcggcaa caaccggcgt    125280
     ggatgaccgg gggtccaccg aacgcggcgc aaatgcacac cgaggtttcg cgaaactgac    125340
     cagatcgcag gttgacttca ccgctggcgg gcacggaaca tcgcgtgtcc tctcgtatac    125400
     cgacgaggcg gacaagagga aacagtctca gtggcgcttt gttcccgctg cccccggatc    125460
     ccacgcgagc gagacgacga cggttgcacc ggatggaacg aagacggtga caacggtgac    125520
     taccttcgac aacggcggtc ataagagtga gtccacaatt acgtccccgc caaagatgac    125580
     tcccggcggc gggacatcca cagacagcac ctcgcacacg acggagaggg cgccctccgg    125640
     agcagtagcc acctcgtctc atcatgagca caaggaattc gggggcggca aagtgatcac    125700
     tacatgggag acgaccacca ccgattcgaa cggaaaacaa actacgcaac ggggcgtaga    125760
     cgtcctctcg ggtgagaccc ggcacggtgt caggagcacg accgtaatca ctacgcaccc    125820
     agatggctcg acgaccatcg tgacgaaaac tggcgatgcc acgaccggtc gcggtagaac    125880
     gcacacgact gtcatcaaca agaacggcaa agtggtcagc gacgagacgg tcgacgatgg    125940
     cgacgacggt gatgacggtg atgacggtga tgatggcgac ggcgatgacg gcgatgacgg    126000
     cggtgacggc gacgatggcg acgatggcga cgatggcgac gatggcggtg acgtggacga    126060
     cagcgccacc gatgagccgg gggacgacgg aatgggttgg gatggtagcg atgaagggcc    126120
     accctcgatc gttccccggc acaaatctct catcgatatt gtgaacgacc cgctggggcc    126180
     ctcagcggac gaaaacgacg accctcttgc cgggcgcatt gccgaagccc tgaaacacgg    126240
     tgctctcgtc ataccaaatg ccgcggacac tgggtggggc gaggactcgg gtagcgaatc    126300
     accgccggaa ttgaaaccac tgtcacgtgg agcgatcttt atccctgtcc gaacgccgac    126360
     cgaagactgg ggaaattgga acgatccacg agttcacatc gcgtatgcag cacagctcct    126420
     cgagagcgtc gttcactctg gtcaaaccga cttgctggcc gcatcgcggg ccgtcgacgt    126480
     tctacagggc acagccgccc tcgtggcgat ggccttccga acatcgcagt gagtgtcggc    126540
     gacggtttcg cgtctcaggt tccgtgaaca acgagcacga gccctccatc gtcgtctcgc    126600
     cggattcgag cacgcacgat ataggcctag agaccttcat aaccacatgg ttcgaagacc    126660
     tacgctcggg tggcggtgag aggcgtgatc tcatcgacaa catcgaaaac atggagatgt    126720
     ttttcctcat ggcgaacatt gctcgccgtg ctgcccaacc tgacgcttcg gatgaggaac    126780
     ttctcctatt ctctgctctt gccgtggcac gggaatactt ccgggaggaa cgaatggagc    126840
     ccgtcatagc tggatggggc ggtaggtgga agtacgtctg cgacgccttt gatcacctgc    126900
     atgaagtagg caatgaggaa gccgccctca tactcgtcaa gtcagtgctg cgcggtatgc    126960
     agacacagtc agaggaagta gaacagtttc tccggagcgt ctggtcaaac aaggaacggg    127020
     cgaaggtgcg gcgcatgaac gctatatcgc taagatcaag cagcgagagt tgcgggccgc    127080
     taggttgcta gaccctactg ttgacgtaga tgcagtgatg ctctccatgc cgcctaatga    127140
     gcgcgatgcc gacagaccaa tgtgagtcgg tcgcgcactt cgtcgatcgg gccttcagct    127200
     actagctcgg tacgacgaca acttccggtc gacgtgctca ggagctcggg gaaggtggtt    127260
     cgctgatggc gtcggccgtg acgatcatgt cgagttcgag gctgttgctg cccgcggcgt    127320
     cggtgacgta cacggtgatc gccgcacacc attgcccgtc gaaaatttgg aaccagtgcg    127380
     tttgcagcgc cggtagcaga ccggacaggc agaccgctga gctcttcacc cgcatgctga    127440
     cgtagtcggc gcgggccgct ccgccgcgcc ccagcggcag cgccttgccg atgtccaccc    127500
     ggaccgggcg cggcgggtcg aaggtcctga tgaccgggtg ctgtggccat cgttcggtcc    127560
     agccgtcggt gttcatcaca gcgcagcccg caatcgggtg gggccggtgg cctgggtttc    127620
     ggggacggtg cgccaggcca ccgacccggc gtcactgcgg atctccacac ggagggtgcg    127680
     ccgttgaaat cccttgccgg cggccgccac atcgaggtgc accccggtga cccggccgta    127740
     cttgtcgccg agaccggtgt atccggcgac gcgggagtcg atgcgcagat ccaccccgtc    127800
     ccagcgcccc tcggccacca gcaggacggc gcccttcgac cgtgcccgcg ccaccaccgc    127860
     ccgggcccgc gacggcggca cggccacgcc cgccagcccg agaatcacca ggtcaatgcc    127920
     gtcgagcagg atcgccgcga cttctctagg ggtacaagcc tgtgtcgctg gttcttgaac    127980
     aaaaccacgc aggtcagcgt cctcggacga gaacctaaca gattgcagca ggtgtggcac    128040
     aggcgaaatg cgacacagcg gcaggcgacg ttttcggcca cccaccatcg cgatctcgaa    128100
     tcaagctgtc atttggagag cgctggtgac gtccggcaaa agtcggtgtt ccgctactga    128160
     gccgtgttcg agcctgctcg tgacgaatgt cgagccgacg gcggggcatg gagcctgcgc    128220
     atgatgacgc aggtgtcgaa caaactgacg cggtcgtagg tggtgggccg acccaaccat    128280
     caccgtcccc gtgagcatcg ctcgctagca gtcccgaagc gacaacagaa cctcgaatcc    128340
     acactgaccc agcgctgcaa tgacgtaaag cgacagaatc gcccatgcaa ttcccgtttc    128400
     gccgacacgc cgagactcgc tcggttacct atgcggtcag ctatgggtcg aacctactgc    128460
     tcagacgggt gacaaatccg tcgtgtcgaa tctgtgacag atgatgctga tgtttcctgt    128520
     gagatccctg aggcacatgg tttacgttgc gaaggagcgt cgggcccgcc gttgagaagt    128580
     cctttcacaa aagatcggat gtcagatggc caagaaagca acatcagtga attcgcagtg    128640
     tccgaaacgt gcctcgccat caaaggggtt ggtagtggca atgatggcgg cgttgatgat    128700
     cgcgacgggc ggagggttcg ccgcggcaca accgaccacc actcccacgc cgagcgccag    128760
     tgcccccgcc acgaccacac ctgccgcgcg gacgaccgag gcgaggcccg cagagcgatc    128820
     cgcgacgagc agcaacgcca catccccggc aacaccgcca acgtcatcgt ccctcgcgcc    128880
     gccgactacc gaggtcgtac cgccacccgc agccagctcc gcgccgacca ccacggcatc    128940
     cactgagtcg tccccgagtg cagctccaac gccaccggcg aacggcaaga agatcccgta    129000
     tacgggcaaa ccgaccgaga accccaacgc aaccattatt ccaggcaaaa tgcgctcgga    129060
     tcgcgaagaa ctgcccgagg gattcaccaa agaagacgcc gacaaagccg agatcgctga    129120
     ggcgaaaatt ctggcggcat cgaagccgcg caacgcacgc accgctacca cggccaccaa    129180
     cgctatagcc gcggcagccc ctacggactg catgacgtat ttcccccagt ggatgtatca    129240
     ggtctgcggt gcgatccggg tcaagtacga ttccctcggc ggtccagcca gcttcctact    129300
     gcttcccacc agcaacgaac tggtcaaccc cgacggttat gggcgtagaa atacgtttca    129360
     gaacgggccc atatactggt ctgcggccag cggcgcccac cccgtggtca accacttctt    129420
     cgccgcctgg caacgcaatg gctgggaagc cggtcccctc gggtatccga ccacggacga    129480
     aatcgtcaac cccgacggac tcggccgacg tcaggagttc cagaacaccg ccgccatcta    129540
     ttggaaactc aatgaggctt atgcggttcg gggggcagtc cgtgacaaat ggaacaccgt    129600
     tggagccgaa caggggttcc ttggttatcc atcatccgac gagctcggta cgccggatgg    129660
     aatcgggaga ttcaaccggt tcgcgaacgg cgcgatctat tggacggccg gcaccggggc    129720
     acaggcgatg tcgacgacct tcttcaccaa gtggggaagc cttggctacg agacgggctc    129780
     acttgggtac ccgatcgcgg gggatttgct gaatgcagac aatgttggcc gacgtcagca    129840
     gttccaacgg ggatatatct actggcaccc ctctgttggt gcaaattcag ttcatggccg    129900
     cattctcgaa cagtggaaca cgctcggatc cgaaggtgga tcaatgggat accccgtcac    129960
     cgatgagcag tcgtccattc cgctcattgc cccggtcgga gcagtaaccc agttcttcca    130020
     aaacggctct ctgatctgga gtggacagaa caacgaggta cttcggggtg gatggaaaga    130080
     cgtggcaagc tcttctgctg cgcagaaatc ctcgcaaact tccgagggtt cgggaatggt    130140
     ggcacctatg ttccaatcgc cctgcccgga aggaacccag gattacgagg gcgctcaatc    130200
     ggcgtacaac tgcgttattc ggttccaaga tatcggtggc acgtggatca acgtccgagc    130260
     agggcgcgga gatccgaacg gattcggaca gctgcattac aagaccgatc atcaggtgaa    130320
     ggaccggtgg gtcgagttgc tgcttcaaga cagctacggg gtgccaacga atttcgacgc    130380
     tgaagggaca ggagtcaccg aaaatcctga ccgctatcgg tatgcgcagg cctactacgt    130440
     cgataatttc cgtggaaaaa ccagctacct gatcacattc gaggtgattg ccgatttcgc    130500
     tgaaacgaac caagtatccg atcacaccca gttcggcgtc gtgacatcct tctgctcaga    130560
     tcccaacgac aacgacaaca tcatcaagtt ctgcccgcaa ctacccacgc cctatctcta    130620
     gcacgacgag gacgccttcg ggttgggttc accgtggtac tcaacccgaa ggcacgtggc    130680
     gtaaacccgg taatcggtag gcatgtcgga catcgagcgg tggaaaacca gagtccgccc    130740
     tatcccccca ggtatcgacc cggcgaaggt cgatagaaag ccagtctcgg cgatggtccc    130800
     cttgaactgg gggaccacgg ggctatatgc ggcgatctgc tcacgtgccg cttcttcgac    130860
     gatcccttcg acaatacgta agccttcggg aaatccttgg tgccgcacga tagctttaaa    130920
     tccggatcgc tcatcagaaa tcaaagacac tggatcgact tcagatgtga cggaagggag    130980
     gtgtttgact tcgaccgtca aacgacttac tacgccagct ggcgcttcgg ccacattcgt    131040
     gttgagaacg caactcatga ttttagttag accagtttcg tcggaagtcc tagagtcttc    131100
     cgacttgacg acccagatcg agggcatatc agcactctac cgtggcgcag ctccccgcta    131160
     gcagatcgca aatgtacccc tacctacggg agccacctcg gactatgcac agggacgaac    131220
     ggtggccacg actcgaacca atgactcgcg gaccggcgcg ttcgaccgca aaggcggata    131280
     tccctccgcg cgtgtgccgc gcgcgcagat gaagccacct ccggcgtccg cgacaaagcc    131340
     caagccccca cccacgaccg gcgggaataa cggcaggtag tcgcgcactc cacgcctggg    131400
     gcctcgatac cctgcacggt atcgaggcct ggccagagtt gcgaaatacc tgaacttgcc    131460
     gcgcccgaaa cgcgcatcac cattgaaatc gctgatcatc ggggctttgg cgtcgatgct    131520
     gatcacgaca ggtggtggaa tcgccacggc gcaacccagc accacaccga cccccacgcc    131580
     gagcacgacc accaccacac cgccggcgcc gacacccacg gataccccgg cgcagcgtgc    131640
     agccccgagc agcactgttc cttcgtcacc gccggcatcc acgtccggaa cggcacctcc    131700
     gcgcgtgcct cggcggcctg ctgccagtgg catttcgaga ccctgcgacc tgcgcatcca    131760
     tcttgggtct cacgattatg gccaccacga tttgtctcaa cgtggtggcc tgtctttagg    131820
     ggggaccatc tttgctgccg gcagaccgct gagggaccgt gggatggttc tcggataggg    131880
     tcaagccgga ggcccccgat actcgcggga gcctccggtt gttcgcgagt tccgcgtcag    131940
     tcgacaggat tttcgactga cttcccggag cctttgccgc gttttctctg tctgatttcg    132000
     acttcagggt gtggggccgg cggcatgaac atcggtcgct cgaacgagac gcggtccgtc    132060
     cggtctcgat cggaccggtg gatctcggcg atggtcgggt agctgaccca ctcgcatgcc    132120
     cagactccgc ccacacggtg gacgacggga tcgggtacat ccgcctcgtc gatgtggact    132180
     ctcacatcca cggatgggtc cgcgtgaccg tagagcaccc accacgaggg gcgaccaagt    132240
     tctcccgggt cggcttctat gaaacttgag gtcgtgcccg ggccgcgtgg tttctgccag    132300
     ataccgtgcg gactcggagg atctcgctgg aggatcgcgt ccaggtcgtc ttcctgggct    132360
     acgaggctcg tgccatcggc gcgccattgc acgaccacgc gggaacgctc gagtacgagt    132420
     cggatgggga ccccggcgtc atcgtctgca ttcatccgtg tcaccagttc catcctgcat    132480
     cctcgcggtc cgcgggtagg ttgtcggccg atatgaatcg gtagacgtta tcagggacac    132540
     tgtcgtcgta gtgtgacact ggactccggg cgtagaagta gaagtatccg gtggggtatt    132600
     cgctgaactc gacagatacc tgcagggcat agttgtggtc gtcattcttg aagtccgaga    132660
     gcgtcagcgc cgatttgttt gtcagattga tcgggcggtt ggtcatgaag gggccatttt    132720
     cgaactgtgg ttgagtgcga tggatttgcg agccaacgac tccggcggcg ccgttgtaca    132780
     gtgccccgct aaaggtcacc ctgccgatgg gtgcgtcggg ggaggtgatc ctcgcctcga    132840
     ggatgtcggt gtaggggcct gcgagttgcc aaactatgag agcagttccg gtgccgagat    132900
     gttcgggccc gcggccgtag aacaggtcga cctcatagct cgctttgagg tcattatgaa    132960
     cggtccagca gccgccgagc cccgttccgg agcaccatgt cccgggatcg ctgagtgctt    133020
     gcggcggggc tggggcttcg agcggagctg atggccctag tgccccacac acccatggcc    133080
     caacacgcga tgcctggggc aacgggcact ggtcagctcc ggtggactgg agttggtagt    133140
     cggcgtactt ttcggtggca ggcttggggc tgtagagctt gccgttctgg aactgttgtt    133200
     cgaaagcgac gccggagacg tcggcctggt cggcagtggg atagccgaaa ctactctgct    133260
     cgtagcctgc tgctgaccat tgatccaaga tggcgccggc aactggatgc gcaccccacg    133320
     caccaagccc acccggtgag cggggccata ctcgaccagt ggtcccttgc ggggtacgag    133380
     cgcagccggc tcggctaccc cacagccgac gcggctaacc agggaactct cgcggcagag    133440
     cagcagtttc agaacgacaa gatctacgcc cccaatatgg ctgttccgct cggtgctacc    133500
     ggaatcaact tgacgctggg cgtgccgact gtggcggcgc tgtcagcagg gccagtcccc    133560
     gacggggtgg ttctgaacgg ccaaggtttc tcgctgactt tccaacggaa ttcgctcgga    133620
     aacatcaacg tcgattatct ccggacaacg gcgcaagcgc ccgctcagtt caagttgatc    133680
     gcgggtttgc cgaccggcta ctccatggcg gtagcgaaca acagcgtaga agtacggtcg    133740
     tcagcaggga ctgttatcgg cagagtgacc ttgccgttga ccttcggcgt gaatggcttg    133800
     gaggtgggca cgaatacgac cctctccgga aacgaggtga ccatcaatct cggaacatcc    133860
     tcgtcctatc cgcatcgttc gttcctccgc gcagtggacg tgccctaccc ggcgccggag    133920
     tcttacgaca acttgaccga gcaagagcga caggtctgca gagacgatct gcccgagtgt    133980
     tggaacaccc gaaacacggg tgatgacgcc aaggaggttt ctcatcgcga gtatcccaac    134040
     taccaaacca tcggcgagca ggacaatcgg gttgacgccg tacggcattg cgcatggctg    134100
     gcgtacatga cacaacgtgc cgactcagat tttgcgaacc gaatggcaac tgcgcacgaa    134160
     cgcgcgtact acaacgaacc tctcgcctcg gcaatggacc tgtacaacaa tcagacggga    134220
     atcgcagtcg gtctgcgcga agaaggaagc gctacaggaa tagaaactac ctgcaggcaa    134280
     tacggcaggg acgcccgcca ggtcaacgcg gtttcagaag taggagagaa tgtgaatgag    134340
     aacgatttgg tgtttattca cgaatagaca atcacgacga gcatgctgaa cgggcacaac    134400
     cgatctgaaa ttgaagaact agggttaggt aggggctatg gacgaaacgc tcaagagagc    134460
     ggatccacgc tcgccccgca ccctgctgtg ggtagtgacc atggcggtca ccgctggcgc    134520
     gctgatgttg ctgattgtgg tgtggggtca gtggtggccg tcaggcaacg cctggtacct    134580
     accggctgca gtggcggtgg cgctgctact tgcgaccgga gcggtatggg cgctcggctc    134640
     gatctacgtg ctgtggaagc accggcggtg ggcgtggtgg atggtgacct ggcccctcct    134700
     agtggcgctg ggtgtagcgc tggccctcgc cgctcgcccg gacttcgagg attcgcgccc    134760
     cgagttcgaa gaaactgctc gtcagctact cgccacaccg ggtcccacaa gtttgagcga    134820
     tttgaagatc gggcggttcg aagtcggccg ggcctacaac acagagcagg gcgacgtgtt    134880
     cttcaccgac gaacggacga cagcgttcac caccgagtca ggttgggctt actccccaga    134940
     cggggcgccg gcgcccgcat ctcgcgacgg cgaattcacc accacccata tcgatggacc    135000
     ttggtaccgc tatgagctcg taacaacgtt ctgacacgaa aactgaggta accgcaacgt    135060
     ggtgctgaca ggtgaggtga cccgacgatg tccgggtcgg tgatgcaccc cgggagcgcg    135120
     gatatgcgat gcctggcagt agggcgaaag cgacgcgata cccgagtgcc ctgctgaaat    135180
     gtcagtgttg tttgttcatg ttcgtgaaca gttctcggtt cgccgagcgg gccgcgtcga    135240
     gttcctggct acgttcttcg agttggccgg tgaggtcgac gacgtgctgt tcgagcatcg    135300
     tgatgcgcct ttggagttga tcgatatcag tgggggcgcc gagcccggat tctctccatg    135360
     ctgcctcgcc gagcagctcg gagagttttc gttcgagttg cgtgttgtgg gcggccagac    135420
     gagcgatgcg ttggtgggtg ttggcgaggt cggctttgag cgattcccgt gtcacgggtt    135480
     ccccgttcca gtgtgtcggg gacgggcaac tttgagcggt gtgaatccgg gcgagcaggt    135540
     ccctgtgccg gtacaggaag ctgcggtcca cgccagccgc tcgggctatc gacgagacgg    135600
     tgatctccgt tccggttgct ccggcagcgc ccagcgcctt cacgactcgt tgcctgcgcc    135660
     ggatggaatc ggcccggcgg ccctcgctca tcgggttcgt catcgctcat gctctcctgt    135720
     cctggcggag gtcgggcagt ggttgacgaa cccgtggtgt ccccagaccg atgatctggt    135780
     tgcgggctcg gcgcacggtc gccgctgctt gctcgatctg ggagcggtcc tcatcggaca    135840
     agtcgtcgac gtcggcgccg atctgcgata tcagtcggcg gatccgctga atttcctcgt    135900
     ccgacggcat cgcttcgccc tttgcccagt cgtcggcggc gagcgcaccc cgcagccgtt    135960
     cacggctgcg cagcagatcg gcgaggtacg actgcagatc cggcaggtag gacacgtcag    136020
     tggagaagtg ggagcacccg acgcagcgga aacgaacggg acagtcgtgc ccaccggcgg    136080
     ccacgttgct aggctcgctg cacgtcccgt acgggacggc gacctcaccg accgcgcggc    136140
     gtagatgttc ggagtcgagc agtgccctcg cttcacgcca gatcttgttg ccgtgccgat    136200
     cgaagtgcat ggtggcgagc ctgtcgacgg catcgcgccg ccgcgtttca ccgacacggt    136260
     agtagacctg tgtggtcccg aattggcggt gatccatcag gtcggacaag acgtcgatgg    136320
     cgacaccggc gtccgcatga cgttgggcgt aggtgtgtcg gtaggcgtag aggaagatct    136380
     tgtttcggtc gaaaggcagc atcttcgtca cgtgttgccc atcgatgtcc acgatgatgg    136440
     gaatagtgat gtcgggcagt gtgacgaccc agtcgcgatg tcgcatggtg agccagtcgt    136500
     cgttcaggcc ccgggtcccg tgcggattcc gcgtgagggc ggggatgagt ttcatctgtg    136560
     tagcgtcctc gttcgggtat cgagctcgga cacgttcttg ttgggccacg atcacggcgg    136620
     ccgtgggctc tgtgatcggt agccgtcggt cgagtctgtt ggccttgatg ttggtgtata    136680
     ccaggacagg ttttccctgt tcgtcacgtt cgagacaatc gagtcggagc tggcagatct    136740
     cgtctgggcg gcggcctgta tcgatgatca gctccaccgc tacccgcact tcccgtgaag    136800
     tattctcctc gagactgttc agatgtgcgc agacgtgccg catgacctcg gccggtagat    136860
     ctcgatgttc gctgtttcgt tcgccctcca ggggaacgtc ttccgggtcg agggtgaagt    136920
     cttcgggcag gccgtgcatc ggttgtcccg gccttcgcag gcccagccct ctcatcgtgg    136980
     ccaggatccg ccgaacccct cggatcgcgg tcatgcgggc ataaggcgac attgatccat    137040
     cgttgtgcag gaaggtcagc cggttcagga agccggcgat atcgctgcgt gagagatcac    137100
     gtggatcgtt tccgtgatcg cctggacgct gcaatcgtag gctgtccgag agcatcacga    137160
     ggaatcgaat ttcgttttgg accattgctt ttgcgttctt ggatcgtcta cgggagatgt    137220
     cgttgtaggc ccagatcttg gcggcttctc gtaaccaggg ctgcgtgatc ttcgtaaatc    137280
     gcaacgttcc cctgaatccg aaaacggtgg catcccattc gtctttgacc cgttcggtct    137340
     ccggagacag gtgcagacgc cgaagctcgg tggtcgccgt cgaccacacg ttcttcactg    137400
     ccggacgcag atcgcccggg agcacgtcct ccagtgtccg atattcgttg gccaaaaggt    137460
     gtgtcacgag aggccggacc tgatccgcac gggttttgac cccctgacct gtgcgttgct    137520
     ggagcccgta gatcagttcg gcgaccaccc ggtccggcag cccgcgcaga gtgcactcgt    137580
     tgagatacga gatcgccgca gtggtccgac ggaagcgcat ctcgtccgct gctgccaatc    137640
     cagcagcatc agctccatca cgcaccttgc gccactgaat tccatggttc atgcagtacg    137700
     gaatctgccc cgaccgcgcg cgatcgcacg cgacgacctc gcaagatccg aatgacttgc    137760
     gcgccacaac cttcgggtgt ttcagaaagt ctgccatcga aactttcaat gtcttgatgc    137820
     gctgtgaacg gtgcgcctcg cacagcccgg agttcatcga ggtccacgga cgctcacact    137880
     gcgaaacagc acacaaaccg tacgcgcgga accgagccct tggcacgtcc gcgaagtcct    137940
     tcactgccgg ggatcctgca atcttccatt gtgtcctaca agctggacac aaaccgttca    138000
     cagcgtgtga ctcggattcg caattgacca cgacacattt cttccagagg agagaagggt    138060
     gtccgcgcgg gaagtgcagc accttgctct cgtccgacca ccccatcaac tccagaaact    138120
     ccggggtgat tatcgaccac agctgagccg tgaccacctt gtctgccgcg acggcagaaa    138180
     cccgcctgat gcgcggctgc gcggccgtca ccgcaggcca tccgtcaatg ccctcggcga    138240
     cggcacccgc tcgactgcat cgcgcagccg gtccggtgat ggatgcagat acggcgtcgc    138300
     cgaggaagca gacgcatgcc cgagcaaccc ctggatctcg tcaagcaaag ccccggagtc    138360
     cgcgaggttg ctagcgaacc catgccgaca ctgatgcggt gaaatcgacc gagccaactg    138420
     cgcccgaaca cacagcgcct cgaacaactc gttgatcgca cccaccgtca tcggagctcc    138480
     caacggttcc cgaaacagat tgaccaacaa gaagtcgcac tcgtctgccg cgggctgctc    138540
     ggcgcgttcg agcaggaaca gatccagggc gcgtaccagc aggaagtcga tcggaacagc    138600
     tcttgagttc cgcgatttcg ctaccgcgcc gttcgagttc tctcgccgca ccacgtgcac    138660
     gtgcgctccc cgtatcggac agtggtgcac ggcattgtct ggaagtagat gcaggtcact    138720
     gcgccgcatc ccgaccaact ctccgcgccg cactcccgct cgtgagagca tcaacacgat    138780
     cagccgatcc cgcgcggacc ggcacacacg aaacaaggcg atgacctcct cgtcgctcgc    138840
     ccggtccacc gcagtttccg gctcgtgcaa actgtgccga gcccgcaacc ggtatctcaa    138900
     ccgcgcactc tcaccctgtg ccgccaacgg caggtcacga gcatccgcca gctcgtagat    138960
     ctgttcgagt accgccgccg gcgcttccct cgccaccacc gcgaacgcca ggaaacctcg    139020
     aactgcgacc aagatcttgt tgatccgccc cgcaccacgc acttgtcggg catccggacc    139080
     cgccaacatc gccgaaccgt cggatcgcgt gtacttcaac cagacgatga acagtccgat    139140
     atctcgtgcc gctgtgcgcc attcacgacc ggtgcgatca caccaccgca agaacagcga    139200
     cataccttcg gcatacgcct tcgtcgtcga ctccgctcga tcccgaccga atcgcaactc    139260
     gcgcagatac ctgtccgcga tcgactccac cgcgtagtcg tcatcgacca ccgtccaata    139320
     cgcgccgcct gacggcatcc gaacccgaaa agctcgcaca attgcctcca ctccatcgat    139380
     cgataaggaa ccacagagcg acacccccaa agaaccgtcg cacgagaccc acacagtgtc    139440
     tcccacgcga cgtcacgcca cagtctgaga acccccagag aacgcgacct cgaccgcgga    139500
     gtccttcggt gcgggcacga tcgcaatccg ggagaggtcc gcaccctgtt cgactgcggc    139560
     gagcagactc aaatccggca ttccgatcac ggccgcgtgt gaaccggccg cagtgaccga    139620
     ggcaaggagc ccgaccagca ccgacgacgt tccagcgacg ctggcaacgg tgccccgggc    139680
     gagtcctcca cgcggaagaa gccccgcgat cggagagggc acgggaagcg ttcgcagcgt    139740
     ggtctgagcg gtggccacaa tcggtgtcgg ttcgtcgacg gaccggagca tcaccgcagg    139800
     catggccggt gcggtgccct cggatcgggc gggaatcgcc gccatcttcc gccgcagctg    139860
     gtcgagtttc tccgctttgg tgagcccgtt cgaggcgggc gcaatgggca gttcgctcat    139920
     actcgccgcc ttcacacatc cctaacccga tccgatccac ccccagtgta gtcgaacata    139980
     ctttcgaata gggtgtaacc ttgctgatgc ctcggctcgg agggaaccca ctgaggtacg    140040
     ccgatgacct gcacttttcg gcgtctgaag cactggagga atgaccacat gacaacaggc    140100
     gacacggtga tgctccaccc tcaaggggtc tcgaagttca aaatcctcag catcgatgag    140160
     gacggccatg cactcatcga gtccctactg gacagcccag gaaaatacgc gttcagcgtc    140220
     gcggtgaagt ttctcgtccc ggcgacgtcc tgatcgtcgc tgtcagaggg acgatctact    140280
     ctgacaaccg cgacgagcaa caggtcgcca cccactgccc agaccggtga ctcgttcccg    140340
     gtcctgatct gcggtattcc gcggatttgg caggtgcgtg gcggcctgtt cctctttgcg    140400
     atctgcgggt aaacccgcca ccactcggcc tggacccaat agggcccact cgattgggta    140460
     gctgtaccga tccgcctccg gcaggcgata cacaaggcag gagggggttg cttccattca    140520
     actgagcccg tttccgacca aggagttcgc catgttggac ctgggatttt tctcttcctt    140580
     ccctcagttc accgacgcct gggtggcaat aagcatgtgg tggcagtcgc ttccattcac    140640
     ctaaccccgg aggttgatga cggtgattcc tattcccccg tacgggttgg gcggcagctg    140700
     gatggtgttg gacgccctgg ctggtgccca tagttctctg gtggaactcc tggcactgac    140760
     cctgtaccga tcgcgcgccg ccggcgacgc gctttcgtga gccttctacc tgcgtagctc    140820
     ccaggtcacg ggcacaatcg gggctatgcg gctgattgcg cccatgctgg ccacggccgg    140880
     cacgcttccg gacaacacgg accgcccgtg gagtttcgag atgaagtacg acgggtgccg    140940
     gatgctggcc tcggttggcg gcggccacga accggtgctg tggacccgcg ccatgaacgt    141000
     ggtgacaccc tcatatcccg agatcgccga agcattgacg gcagcattcg gcggccgcgg    141060
     gcgcatcgtt ctcgacggcg aggtcgtcgt actcgatcag ggcaagccgt cgttcgggct    141120
     gctccagcgc cgactggggg tcgcccatgc gacgaagccg ttgcagcggc gaatccctgt    141180
     gacattctta ccctttgacg tcctcgcgct cgacggagac gatctcacga aagcgtcata    141240
     tctggagcgg cgggcggagc tggccgagct ggattcgacc atccaggacg tcggcggcct    141300
     gcccatcacc gtccctccgc actgggacaa tcagagcagc aaaatcatgc tgaatgccgc    141360
     gaaaagtgct ggtatggaag gggttttagc caaaaggtcg acatcgctct accttccggg    141420
     ccagcgtagc cgatcctgga tcaaacacgc aatccgcact cgcagttcgg ttttggtcat    141480
     cggcttcgtc ggctcgagcc gatcggtcgc ggctctgatc ctcggggcgt acgacgccga    141540
     aggacggtta gtccaggtcg gttctgtgtc ctccggactg acggtgtcga tgcgccgaca    141600
     gctccgggag gacttccggc cgttagaacg ccctagcagc cctctcacgg acccgtcagc    141660
     ggccgcggag accttccccg gggttcagtg gctgaatcct cggctggtcg tggacgtcgc    141720
     ttacagggcg cacacggcgg gcgggctccg gcacccctca ctgaaaggcc ggcgcttcga    141780
     cgtcgatttt caatcggttc gtgtggagga cctgtagacc ggcgagagga aagccgccga    141840
     cgccttcccc ggcgtcagcg gctcctcatc gctatccggt ggtattcctg cgggtttgtc    141900
     cctgcaggcc tgcacgggcc cgtggtcatt gggcgtcctc gacggtgatt ggttcacacg    141960
     gtcgcggcgc ccccgccgcc gggatgccgc cgtagttcct cgatcgtctg ctcggcggcg    142020
     cgcagcgcgg tggtcagggc atcgacgcgt tcggaagctg attgccgagc ctcggccagt    142080
     tgtgcggcat gatcggcgcg cgcttgttcg cggtccgtgc ggacctcggt gcgcaggtcg    142140
     gcgagttcgc cgcgaagacg gtccacgtcc tcgcgggctt cctgcgcgga tgtttgcgct    142200
     gcagcggtct gcgtttcggc gcgggtctgt gcgacctgag cttcggcggc agcctcttgc    142260
     gccgcgtcaa cctgttgggc agcggaggct ttcacctccg cgatctcggt ggcggtacgg    142320
     ccgcggatct cctcgatcgc cttccgcgcc tcctcctggg cagcgccgat tcggcgtgat    142380
     gcgtcggtct ctgcggccgc gattctctcc gccgcatcgg cctggatgcg ctcgagttcc    142440
     gcgcgtgcct cggcggcctc ggtctggatc cgcgccagct ccgcgtatgc atcctccgcg    142500
     gccgcgtcgg cttcctcgcg tgcctgctga tgttcgctcg cgcgggcctc ggcatcccgg    142560
     cggcgacgtt cttcgtcgcc ccgcagccga tcggcttcgg caactttcgc gagcgcttcg    142620
     gcgtgggctt ggtcgacctc ggccgcggcc gcctcgacat cggtcaccga ggtgaccgtc    142680
     tcggtcacgg cctcaaggaa accgcggagc tccgcgagac ggcggggcag ctcctcgagc    142740
     tgcacaccga gggtggcccg tgccatcgac accggcgccg tcaccccctc ctcatcccct    142800
     gcggcccccg gtgactcggc ctgtcccgcg ccgacggtcg cgaggcgccg gcgctccttc    142860
     caggcgttgc ctttgttgtg caccgggccc ccgggatcgg cctgtccgca gtacttcgac    142920
     ggccgtcctg tcttcggatc gtcgaggctg ggccgactgc acctcccacc ggggaactcg    142980
     cacatccccc ggcgatcgcc ccgggccgcg gtgtcgttgg tcgccataac tcccgagcct    143040
     acaggtttag tatcttgcgt gtctatagtt tcgtttagtt acgcatcttt cgtcgatcgc    143100
     gtaactaaag atacccaatg agttgaggcg tgcggatgat ccggcgccgg gtgtcggttc    143160
     tcggctggtc tggcggtttt ctcacttttg tggcaagacg gtggcggagg ctcgtccgat    143220
     atggcggaga agccccccac cacacgacga ccaggcgaaa caacaccccg gacgcccccg    143280
     gaccccggct accgaccccc acggccagcc gcaacgcgac cagagatccg ccagatccga    143340
     tgagaggaat caaccggcgt tgcgtccggg ggataagtgg cgaaccgcag gtcaggccaa    143400
     cgagcttcgc cacatcggga tgacaaccga cactggggcc cggtgtcggt tgcgtcggaa    143460
     gcggtgttgc accaagcggg ccgcgccgag acatttctct accagcaggg gcttgatcgc    143520
     cgatacagtc gcgcgaatgg agaaaccaat ccatgcccac cacgcggacc aagggaagcc    143580
     gtccggggac tccggcgctc caaatgccgt ctccgtcggc aaacagacgg acgaactcct    143640
     cgccaaagcc gtgggtgagg ctctcgcggc aggcatgtca tgggcacaga tcggcgggcg    143700
     gctcggcgta ccaaatcctg ccgccggcca agacgtcgtg acagatcagg actggcagga    143760
     ggcaatagtc gcccacgaga atgctcgtgt agctcggcac aacgacctag aggtcgggcg    143820
     taggtgagca gacagtagta cgcaggctta ggtccatcgg gaccacaacg gcggcgggaa    143880
     gtgttctgcc accatcggcg tgatgatcac aggcaatcgt tcggatccat cgtcatcgct    143940
     ttttccgacg ctgggggcgc cgccggaaac cgtcgaagcg atgccgccgg acggctgcct    144000
     gtacccgcgc ccctcattgc ccttgatgcc gccacggtac gaacgcgggg tgcggttcag    144060
     aatctcggcg cgcatcctgc gggcctcggc cacttgagcc tcctcctggc ccgtgagggg    144120
     gcgctcctgg cgggtggcgt ctgcccttcc caggaactcc tccaggcggg ctacctcttt    144180
     cgtcgttcgt gcagtcctac ggttcggctt gggtttcttg cttctgggct tgctcaccgc    144240
     tatgtccctc tcaaggcaac tctgggccgc accaaagtta ccggcgtgac gtagcttccc    144300
     tctcgcttat gtgcgcacgg agctgagcca ggacggttga ctgacctcgt taaccgaccc    144360
     ccaggacaca cgtgctgtag ttagcttcga gttacacgtc tggcgcagtt ttcaaaggag    144420
     atcgggttga gcaagctggg gaacttcgtc tggggaatcg cggatcagct ccgcggcgtg    144480
     tacaagccgc atcagtacgg cggcgtgatc ctgcccttca cggtcctccg acgtctcgac    144540
     tgcatcctcg agcccacccg tgacgaggtg cgggccctgg ccacgaaata cgccgacggc    144600
     gccctggacg tgcaagtgaa gcgtaagacc ggtctggcct tctacaacac cagcccgttc    144660
     gacttcaaac acctgcttga ggatcccgag ggactgcgag caaacctggt ggactacatc    144720
     accgggttct cggccaacat cgacgtcttc gagcggttca agttcgagaa cgagctggcg    144780
     acccttgatg aaaagaaccg cctgtacctg gtgacgtcac agttcgccga tgtagacctg    144840
     cacccggacg tggtgtcgaa cgccgagatg ggcgacctgt tcgagcacct gatctacaag    144900
     ttcgcggagg cctccaatga ggaggccggc gagcactaca caccgcgcga cgcgatccgg    144960
     ctcatggtcg acctcctctt cgccgaggac aacgcggctc tgctggagcc ggggaccgtc    145020
     cggacgatct acgaccccac cgccggcaca ggcgggatgc tctccgtcgc ggaggagcgg    145080
     ctgctcgagc gtaacccgga cgcgaggctg cggctgtacg ggcaggagat caacgaccag    145140
     tcctacgcaa tctgcaagtc ggacatgatc gccaagggtc aggatgttgg caacatcaaa    145200
     ctcggcgaca ccctggccga agaccagttt ttcgaccgga ccttcgactt ctgcatgtcc    145260
     aacccgccct acggcgtcga ctggaaggca tcgcaggaag ctgtgaagaa ggaagcgctc    145320
     gcgcagaact cccgcttctc ccacgggctc cccgccgtcg gtgacggtca gatgctgttc    145380
     ctgtctcacc tcgcgtcgaa gatgcgtccg aagcatgacg gcggcggccg cgccgggatc    145440
     gtcctcaacg gctcgccgct gttcaacggc gccgcagagt ccggtccctc gaagatccga    145500
     caatggctcc tcaagtccga cctggtggag gcgatcatcg cgctgccgac gaacatgttc    145560
     ttcaacaccg gcatcgccac ctacatctgg atcctcgaca acaccaagcg ccccgagcgt    145620
     gagggcaagg tgcaactgat cgacgccaca ccgttctgga gcaagatgcg taaaagcctc    145680
     ggcgcgaaga gccgcgagct cgacgctggc gcccgtgacc ggattctcgc tctgtacgac    145740
     gcgtacgacg aggccgaccc cgcctactcg aagatcttca cctccgacga cttcggttac    145800
     tggaccatca ccgtcgaaca accgctcctc gacgaggacg ggatgccggt gacggaccgc    145860
     agcggcaatc ccaagccgga cacgaagaag cgtgacaccg agaacatccc gttcacgtac    145920
     gggggcaaca ccgagggaga ggctggtcgc acggcgacca taaaggcata cttcgaggcc    145980
     gaagtgcttc cgcatgtgca tgacgcctgg atagatgcga agaagaccag aatcggttac    146040
     gagatcccgt tcactcgcca cttctacaag tacgtcccgc cccgcccgat cgccgagatc    146100
     gacgcggacc ttgagaaaca ggtagccaag atcatggagc tactccgggt ggttgagcag    146160
     tgacggcaga gccgtggctt cctgagatcc tccccagtgg gtgggtggtg gcgcagatgc    146220
     gccggatagc cacttttcga aatggggcgg actacaagga agtggaagtc accgaaggtg    146280
     gctaccctgt gtacggatcg ggcggcgagt tcaggcgtgc gtcgcagtac ctttacgacg    146340
     gcgagagcgt tctattcggg cgcaagggga cgatcgacaa accgctctta gtttctggtc    146400
     gattttggac cgtcgacacg atgtttttca ccgagctgac ctcgaatatc gagccccggt    146460
     acctgcacta ctacgccacc actatgccgt tcgactacta ctccacaagc acggcattgc    146520
     ctagcatgac tcagggtgaa ctgggtggtc accgtattcc tttgccacca ataactgagc    146580
     aaggggcaat cgctgacttc ctcgaccgcg agacggcccg gatcgacacg ctgatcaggg    146640
     agcagcggcg gctgatcgaa ctgctgcggg aacggcggat cgctgtggcg gaagggcccg    146700
     ttgtcggtct ctcctggagc actccgctac ggagcgtgac cgctctgatt cagacggggc    146760
     ccttcgggag ccaacttaag tcagacgaat acgagaccgg cgggacgcct gttatcaatc    146820
     catcgcatct agtcatgggg aggatcgagc ccgacgagcg cgtcgcggtg agcgcatcga    146880
     aggcgtctga gttgggtcgg cacgctctac gggcgggaga tgtcatcgca gcccgccgcg    146940
     gcgaacttgg tagatgtgct gttgtccgcg cagaaaatac cggatttctc tgcggcactg    147000
     ggtcggccct gattcggctt cgcgagactg tcgcagatcc cgagttcctc gcgctcgtct    147060
     tcagtagccg ccgcaaccga gactcgctat cgctggcgtc cgtgggggcc acgatggaca    147120
     acctcaatgc cgacatcatt gccacgctgc gcatcccgat gccaccactc ccggaacagc    147180
     gacgaatcgt cgaatcggtg gcagaagcca ccacaaagat cgacaccttg atcactgaga    147240
     ccgagagctt catcgacctt gccaaggaac ggcgatcggc actcatcacc gcagcggtga    147300
     cgggccagat cgacgtgagg gatgaggtgg cctgaagtgg cgcagcacaa cgagatcgag    147360
     ttcgagaaag aaattgccga atacctgcac gcccatggat ggctgtactc ccgggatgac    147420
     accggctacg accgtgagcg agcgctgttc cccgaggacg ttgccggctg gctcgccgac    147480
     acccagccgg agcaattgga caaggtcgtc aagtccggct cggctgatgt cgccaagcag    147540
     caagatcagc tgcttgatcg cattgtaaag attttagaca ctccgttgga gaacggcggt    147600
     ggcacgctga accttctgcg gaaagggttc tcgcatctgt ctgcgaagtt ccagatgtgc    147660
     gtgttccggc cggagtcgac gctgaatgtg aagcggaacg gtgagtacgc ggcggtgcgg    147720
     ctgcgagtga tgcggcaggt gcacttctcc accgccgaca accgctcggt cgacctggtc    147780
     ttcttcgtca acgggctccc tgtcgccacc gcggagctga agaccgactt cacccagact    147840
     gtcacggatg caatcagcca gtaccgcacg tcgcgactgc caaaggaccc cgcgacaggg    147900
     aaggcccagc cgctgttcgt gtccggtgcc cgggcgctgg tgcatttcgc gttgtccaac    147960
     gacgaggtgt ggatgaccac caagctcgcc ggggacaaga cgcatttcct gccatttaac    148020
     cgaggcagcg aggacggcgg tgccgggaac ccgctgaatc cgaacgggtc gaggacctcg    148080
     tatctgtggg agcaggtgct gcagcgggat gcctggctga acatcctcgg ccggctgatg    148140
     tacatcaagc acgagtccag cacggatccc atcagtggca agaccagcaa gtcgtcgacg    148200
     ctgcggttcc cgaggttcca tcagtgggag gcagtctccg agctcaccgc tgcggtcacc    148260
     gccgagggcg tcggtaagcg gtacctgatc cagcactccg ccggttccgg gaagacggac    148320
     tcgatagcgt ggaccgcgca ccggatggcg cggctgcagg ttgagaacac gaaagtcttc    148380
     gactctgtga tcgtagtgac cgaccgcaac gtcctcgatg cgcagctgca ggacgcgatc    148440
     aagcagatcg acaacgatca gggcatcgtc gttgcgatcg accgggatga ggctgcgagg    148500
     gccggcggct cgaagtcggg gctgctcgcg aagtcactga ccgacggcaa gctgatcatc    148560
     gtcgtcacca tccagacgtt cccgttcgcg atggaggaga tccgcaagaa caagggcctc    148620
     aagggaaaga cgttcgccgt gatcgcggac gaggcacact cgtcgcagtc cgggcaggtc    148680
     gccagcaagt tgaaggccgt cctgaccgca gaggagctgc aagacatcga ggatggcgct    148740
     gatgtcgatg tcgaggcggt gctcgcggcg gaggccagcg agcgtgcggc gtcagcgaac    148800
     atctccttct tcgcgttcac cgccaccccg aagggcaaga ccctggagct gttcgggcgg    148860
     gcccccgcgg ctggtgggaa gccggtgccg ttccacgtgt acacgatgaa gcaggccatc    148920
     gaggaggggt acatcctcga cgtgctgacc ggttatcact ctttcaagct ggcgttccag    148980
     atcgggcaga acgcgaccag cgaagacgag gtggaccagt cgcaggccac caaagaggtc    149040
     atgcgctggg taaagctaaa cccgcagacg atcgcccaga aggccgcgat catcgtcgaa    149100
     cacttccgtg ccaacgtcgc gcacctactc gatgggcacg cgaaagcgat ggtcgtcacc    149160
     gactcccgca aagccgccgt tcgctacaaa ctcgcgatcg atgacttcat cgcgaagaag    149220
     ggctacggct acggcaccct ggtcgcgttt tccggcgccg tccaagaccc agagtccggc    149280
     cccaaggact tcaccgaggc caccatgaac cctggggttc acgatctgcg gaccgcattc    149340
     accggtgatg cgtacagggt gatgatcgtc gccaacaagt tccagaccgg gttcgaccag    149400
     cccctgctgt gcgcgatgta cgtcgaccgg atcctgtccg gggtcaccgc agtgcagacc    149460
     ctttcgcggc tcaaccggac ctaccgcact ccgtcgggag tcttgaagtc cgcggcgatg    149520
     acccaggtcg tggatttcgt caacgagcca acggtgatcc gggaggcgtt cgagccgtac    149580
     ttcacggacg cgttcctcga aaccgaaacc gacccgaacc tggtgcacga tctcgcggcg    149640
     aagctcgaca ccgccgcgat ctacgcccaa gccgaggtcg accagtgcgc ggaggggttc    149700
     gtcaagggca gaggccacag cgctctcgca gccgctgtag acccgggcaa gaagcgtttt    149760
     gccgagcgct accaagcggc cttgatccac aacgggggtg agggcgacaa ggcggcactc    149820
     gctgaactgg acatgttccg caaggatgtc ggttcgttcg tgcggctcta tgacttcatg    149880
     tcccagatcg tcgactacgg cgacccggaa ttggagaaga agcagatcta tctgcgccat    149940
     ctcgacaggg tcatccagcc cgacaactac accgcaccaa tcgatttgtc cgacgttgtc    150000
     ctgcagcgtg tcaagcaggt cgaccagggc aagagcgata tcagcctcgg tgccagagtc    150060
     gggcttaccg gtgtgacagc ggccggttct ggagagaagc gtgacccgaa gatggtcgcc    150120
     ttccggcagg tcctcgaccg cctcaacgac ctattcgggt ccgaagactt cacccagtct    150180
     cagaaggtct cgtttcttga gtcgctgctg cggaccctgc tcgacaacga ttcgctcgtg    150240
     caacaggcga cggtgaactc caccaagcag ttcgtcgagt cgccagactt cgacgacgcg    150300
     gtgaccggcg cagtggccga caaccagggg gcgcacgaga agatgagcga ctacttcttc    150360
     accaacgccc ccggccgctc ccacctgatc tccgacatcg ccaagtggtt ctaccaggtc    150420
     gtctctgagg agaatgcgag cacataacgt tctggcaatg aacgccgacg agcagttcag    150480
     ctcgcagccg acctgcgagc ccgcggggca ccctgacccg agagccgctc gtcacggcga    150540
     gccccgtgat ccttcactca ggtttcgcgg gtgacgtgaa acgtagagcg tagggatacg    150600
     catattttcg atgcaaagaa tagtagcgcg aaccttccac agtatctagc caaagggaat    150660
     tatgggccac gaaaagaacg tcaaaagttt agccggaaag tatgatacgt caaatcggta    150720
     ttccaacttc gggccaattc tacagtccat tgagataagt ggatttcgcg gaattcaaca    150780
     cttggaactt gatctcaaat ctcccataac cgctatctcc ggattaaatg gcaccggaaa    150840
     aagcaccatc gcacagctga tgagctgtgg gtacaaaaag gcgagcacgg ctgccctaag    150900
     tcgctactat gtcaaagatt tcttcccaat ttctgcagcc gatccagagc cattctcaac    150960
     gattgcgaaa gttgtattct catattgcgt ggaacgcggc gcggaagcgc agaaggtcac    151020
     tgttagccgg aaggaaagtc aatggtcggg atataaaaga caacctgagc gcgcatgtta    151080
     ttatgtagga tttacgcaat ttatcccaaa ggtagaacgc cgggatttct cggtctacgg    151140
     tgcacatgaa ctgacgcttg gtgtctcgac cgaattgtca gaagaggctt ccgaaaacat    151200
     cgcaaagatt ctctcacttc catacgagaa tcttgacttt actgaagtat cccacaagga    151260
     tcgaactatg cagttagcta tggctgtcag gaggggtaag cgctactccg agaaccatat    151320
     gggtttcgga gaaggccggg tcgtgtacat ggtcactgca atggagtccg ctccgctgca    151380
     aagcctcttc gttctagagg aacctgagac ctccttgcac ggtgacgcgc aacggagatt    151440
     ggcgcgctat cttgtagacg tttgcagcag acggggtcat caaatagtta tgaccacgca    151500
     cagcagcgct attctaagtc aactgaaccg aaagtcagtg atctatcttc gacgagatcg    151560
     cgagggcggc ctgactgcga ccactggcct gagtacgtat cagatcgact cttatctgca    151620
     aagcgaagat cgatccagta acggaagcac gatttgtgtg gaagatcagt tcgcgaaatg    151680
     tttcgctaca gagatcctta gaatctgcaa tgcggacctg cttggtggat gcaacttcat    151740
     cacaattgga ggaggacagg agattccaaa agcggttgag ttgctccgcg acgcaggtct    151800
     gcgggctgtt ggaattaccg acggggacat gaatctcaag ggcgaatata tttcgcgtct    151860
     tcctgggaca attccgccag agcgactcgt ctttggcgac ccggccgtag catcacactt    151920
     cgatgaacgt tatcgacttg acttggacga ggtgcttgcg tcgattgacg atcatcatga    151980
     cttctcattg gcgattgctc gccacgcgtc agtggaagcg aacgtcattg ccactgaatc    152040
     ctgcatggct tacgttgccg cacgtgagcc cagcgagttt gatgagctca ccaacttcct    152100
     gaccaagacg ctaggcgacc gccggtagaa tttggttacc ggccttcacc tcagattgtc    152160
     aatgccggtg cctgcgactg ccgccctaca gacgtaagaa cgagcggtcg caaaagttca    152220
     cgcccacacc gctccgctga ttgacgtctg tgggatttgg ccaccgagga ggtgaaaacg    152280
     ggctgagcga cgatctgcgg ccaccagggt tcgttttggc ctaggacata ccggtacacc    152340
     ggagaacggc gctgtcagtt tcagaagtga gctgcacggc ggccgggact gccccggctc    152400
     tggttgacac ctgacctgtg agggatccgc cctcacggtg gaaggatgat cgacatgccg    152460
     aagccgtacc cggaggagtt ccgccgcgac gtcgtcgccg tggcccgcaa acgcgaagcc    152520
     ccgctggagc agatcgcgaa ggatttcggg atctccgaga cctgtctgaa gaactggctg    152580
     cgcaaggccg acatcgagaa cggcacccga cccggcctca cacgagacga atccgacgag    152640
     ctccgcgagg cccgcaaacg tatccggctg ctcgaacagg aaacggaggt gatgcgccgg    152700
     gcggtggcct acctatcgcg cgatgtcaac ccaaaatgat gttcccgctg gtccgtgaac    152760
     ttgccgccga cggtgtcgcc gtcgcggtga cctgccgggt gctgggattc tcccggcaag    152820
     cgttctacaa gtggaacacc gatcccgtgt cccgacggga ctgggacgat gcccatctga    152880
     tcaacgccgc actcgatatc cacgccggcg acccggagtt cggataccgc ttcatcgccg    152940
     acgaactacc cacccacggc atcgtcgccg gcgagaaccg cgtccaccgg ctgtgttcgc    153000
     agcagcggat cttctcggtg gtcgcgaaga agcgcggcct tgctcgtcga tccgggccac    153060
     cggtccatga cgacctggtc aggcggcagt tcaccgcgaa gcagcccgac cggttgtggt    153120
     tgaccgacat caccgagcac tggaccgatg agggcaagct ctacctctgc gcgatcaagg    153180
     actgcttctc caccgaagat cgtcggctat tcgatcgccg accggatgac cgcggacctg    153240
     gcgtgtgcgg cgctgcgaaa tgccattgcg ctccgcaacc cggacggcac cgtcgtacat    153300
     tccgatcgcg gcagccagtt ccgttccgga atcttcgtag aattgctgga ccgcaatggt    153360
     ttacaaggat caatggggaa ggtgggggca tgtggtgaca atgccgcgat ggaatcgttc    153420
     ttcgcgttgc tgcaacgcaa cgtcctcgac cggcgccact ggagcagccg tgaggaacta    153480
     cggttggcga tcgtcgagtg gatcgagaag acctaccacc ggcggcgccg gcaacgcggt    153540
     ctcggtcgac tgacacccgt cgaatatgag acgctccatc acaccgtaca cgcggcctga    153600
     aactgcacac cccgtgtgtc aaccagggcg ggggcagtcc cgcctgggag tttccgggtc    153660
     caggtccagg tcgggtccat gcagtggtct tctgatcctc cgcagtcagg agtgctgtgc    153720
     accacgtgac gtcaccacgt acgccgggcg gacgcctgag gactctccgc ttcgccgata    153780
     gtcgtgatcc gcgcaggggg cgcgcgtgcc cgaaagcgcc ggtgggcgga ggtaactcgt    153840
     ccatctgaga cgacgattcc ctcgaccgcc ccattgccat gcctcaagtg acctgttgcc    153900
     cggacgaacg cctgagctgt ctgcgttctt cttcggacaa gccgccccac acaccatggg    153960
     tctcattcgc ctctagagcg tgccgcaaac aagcttcctt caccgggcac tttctacaca    154020
     cgcgtttggc gtgacgtaga cgccagtccc gtggatcacc gcgctcgttg tcgaggtagt    154080
     agaaaagtga ggtgtcgacc gagcgacatg cggcgtgccg ttgccattcc cacgattcga    154140
     cgatcggcgg aggcagtttt agaagttttg caggcaactg caacctttcc tgatgtgtcc    154200
     gaccgttcac ctaccggcaa acggtgacga tgcagagatc actgcccgat cacgtccaca    154260
     gtggcattcc gaaggacatt cttttgaatc ttgcctgtgg acgtccgggg taagtttgcg    154320
     aagatgatct tcttaggcac cttgaagcgt gccaggtgtt gacgtgcgaa ctcaaccaac    154380
     tcctcttcgt ggacctccgt tccggggcgg accgtgacga atgcaattgg cacctccccc    154440
     caccggtcgt gggggatccc caccaccgca ctttccacga cagctggatg gctgtcgaga    154500
     acacgctcga cctccaccga ggcgatattc tctccaccgg agatgatcac gtccttgaga    154560
     cggtcacgga tctccacgta gccgtcggca tgcatgactg ccagatcgcc ggtgcgcagc    154620
     catccgtcga cgttggccgc ggcagtcgcg gcatcgtcgc ggtagtagcc caacatgatg    154680
     ttgttgccct cgatgatgag ctcgccgatc gcttgcccgt cgggctcgac gtccttcccg    154740
     gctgaatcca ccacccgggc gccgcccgtg atgacgttgg ggacaccctg gcgggcctgc    154800
     ttctcggctg cggcctgatc accgagtgaa tcccactcgg gttgccacag gttgatgatc    154860
     gccggcccga acgtctcggt cattccgtac agatgggtga tctgcatatt cagcttcacc    154920
     atcctccgga ggagtgtcgg agacggtggt gcgccaccgg tcgacacctt gaccggattc    154980
     gccgtgggac cgtcggccgc cgccgcatgt tcggcgatca tcgacaggac cgttggagcc    155040
     gcactgaagt gggtggcacc ttctcggatg tgtctccaga tctcgctggg gtcgacggcc    155100
     cggagacaga cgtgtgttcc accggcagcc gtgacggccc aggggaagca ccatccgttg    155160
     cagtggaaca tcggcagggt ccacaggtag cgtgagccgg gtcccagacc catgtggtag    155220
     gtcatcgcga gtgcctgcaa gtaggcgccg cgatggtggt acatcacgcc tttggggcga    155280
     ccggtggtgc cgctcgtgta gttgatcgcc agaagcgtcc tatcgtcgtc ggactcgact    155340
     ctggccggct ccgcggacac gagttccgtc tcgtaggcac tgtcactccc gtccgcctgc    155400
     agcagcggga tgtttcgtct tgcggcaagc gatccggcta tgtctgcgaa ctcatgagtg    155460
     gcgaccagca atgtcgcacc tgaatgctcc agaatgtagt cgagttcggg ttcggacagt    155520
     cgaatgttga gtgggaccag gaccgcacct cgcaggggca ccgcgttatg cagttcgagc    155580
     atgatgtggc tgttcgtgca caacacggcc acgcggtcgc ccacgcctat cccccgagcc    155640
     gcgagcacgc ccgtgagcct gttcgagcgt tcggcgaatt cccgataggt gaaggtcagg    155700
     tcaccatcga tgatggcatt gcggtgcgcg acggtaaccg ctgcgcgatc cagatactgg    155760
     gtcggtgtca gaaccgcgaa attgctcaga gtcatatgac cgctcctcgc gtcgtgggca    155820
     attcagaagt ggcgggggta tgcaactccg atttcatgga cgtgtatcgc ccgcacgagt    155880
     ccggcgcgta ccacgggatc tgcggttgcc cattgcatgg cctttccccg cgagtcggcc    155940
     tcgacgagga gcacgccccg gtccaccgga tcccgaactg ctcccgcgaa tcggagcgtg    156000
     cccgtctcga agctgtcgtc gagataggcc ctgtggtcct gtcggatctc ctcgcgacgc    156060
     cgctcgatct cgggcacata gaggtattcg acgaggaatg ttccttccgt gccaccctcc    156120
     tgtgtcatgc gacgtgttcc ttcaggaact caacgacctt ggccatcagg ccgtcccgct    156180
     cctggggctg gtagatatcg tggtgcgtca tgccggacag ctcgatgagc ttcttgggcc    156240
     cggtggctgc ctcatagagt tcgacggtgt agtcgtacga tgtcaatccg tcctcgtcga    156300
     cgccgacgag gagcagtgcc ttgtcgccga gccgcttcgc gtagtcgacg gaccggaatg    156360
     ccatgatcgc atccgccgag gcgagatcga gctggaaggc acgatcgggc cagttctcac    156420
     gcaggtactg ctcgtgcttc tccgattcgg ggtcgcggac catgatgact tccggttcga    156480
     cgacctcgga cacgcccgtg agcagtcggt tccgacggtc cttctcgagg aggtgctgga    156540
     attcgatcca ctcccagttg cgacgaagag aacggagcca gtgtccgcag tccgaaatac    156600
     caaccgcaca caccgccgca cgcatcttcg gatcgagtgc cgcagcagcg atcgcgatac    156660
     ctccaccgaa gctcgtgccg tagacgccga cacgttctgg atcgacctca tcacgggtcc    156720
     gcaggtatgc agcggcagcg agggcgtcct ccacctgctc gagcggatga agtcgattac    156780
     ggggcccgtc gctctcgccg aaaccgcggt aatcgaaggt cacgcatgcg aaaccggccg    156840
     ccgcgatggc cctggcgatg tcggccacga agaaggcctt gataccaccg aaaccgtggg    156900
     cgacgacaac tgccggcgcg ggcacaccca atccgggagg aaggaacaac tcggctgcga    156960
     ttcgtgttcc gtcactgtag aattcgacct cagtcacagc gacatcttcc ggcttgacct    157020
     gcacaacgac tcctctcaca actccgaacg tgtcggagac ttctctcggg ctgacctggc    157080
     gcccaggacg tatccgcagc accggatttc gcgatgagtc acattgggtg tgacacctcg    157140
     ttcggcggcc gatccggccg agcactatcc gtcagggtga acatatcgta taccgaatac    157200
     cgattgcgta catggcggac tcgatcgaaa acgctgcaca ggcggttcgc cgagcaactg    157260
     ctcactcacc accgccgaac gcgaccatgg gggacgctcc gccactgaca gtcaaggttt    157320
     ggccggtgat gtacgaggcg gaatcggacg ccaggaacag gcccgtgtcc acaatctctt    157380
     ccatccgtgc tgcgcgcccc atcgggacga gccgtcgaac gatctcgtcc cgcccggtgc    157440
     cggcggttgc ccgggaggac ggggtgtcga cgaaacccgg aacgatcgag ttcaccgtga    157500
     ctccgcggct cgcaccctgc gcggccaacg aggtggtcag accgaggaga ccagctttcg    157560
     aagcaccgac gtgcgtcgtc tccggagacg cccaccacac gttgagcccg gaaacgttga    157620
     tgactctgcc gaaaccacgc tccatcatcg aaggcatcag ctgcctcgcc agcagatacg    157680
     gagcccgcag gttgaccgca accgtgtgat cccactcctc cagttcgaga tcctgaggaa    157740
     gatgatgaga acgaacaccg gcattgttga cgaggacgtc gataggcccg agctccgcga    157800
     cgatgcgcga caccgcacct tccagagcca cggcgtccgc cagatccgca agctgtccgg    157860
     acacaggcac cccggtatcc ctcaggtcgt cgaccgcctt ttcgagagcc gcggcattcg    157920
     acccacccaa cacacccacc gaggcgcccg cccgcgcaaa cgcggaggcg aatacatagc    157980
     caagattgct cgtgcccccg gagacgagaa ccgtgcatcc actgaagtca aattcgattg    158040
     ttgcatttgg cgacaagact gaaatcctcc gttggtcggt cgaggtcggc gatccttcag    158100
     gcgccgggcg ttcgacgagt gggccacgta cctgcagatt gcagagcaat accactcgcc    158160
     cgaacacccg gaagccgctc ccgcacggct tccgaattgg tagcgcaccg ctcaccacgg    158220
     ccgacgctac acccggtgag cactggtaat gtgggcttga ccacaaactg tatccagaat    158280
     acggtatgcg tattggtgcc tcttcgggcg gcagcaacgc acgcaatgct gcgagtggca    158340
     caacacagaa atggggctca taggccatgg ccgaatcgaa ttcattcccg gtgactcacc    158400
     tctcctggcg agagacacgc cgggaagcga attgggatct ccctgacgcc gagaagtggg    158460
     gtctgcaccg agcccactat cccgaactgg tcggcgagac gttcacggcg cacatggtcc    158520
     agctgccctc atcccagtcc gtcccggagc gcacatccga cgccagcgtg gtctatgtcg    158580
     gggtcaaggg tgaattggag ttccgcatcg gagaggaacg gatcgtcgtc gggccgcgtg    158640
     acgttctgac ggtgcccaac ggtctccccc attcgtgtgc caaccacgat ttcgagtccg    158700
     cactcttcgt ctccgtgacg accaccgccg aggaggacga tgcctcggca ctctccggcc    158760
     ctcacctcct gccgtggatg gactaccgac ggcaattccg gtcggccatt ctcccccatg    158820
     cgatggaata cggacatcac cggttgtccg ccccgcacac cccgctgcgg agtctgctcg    158880
     ggcacaccgt caggattccc acgaatcagg cgagcccatg gcacggcatc ccgcgggacc    158940
     tgctgttcgt gcagttctcg ggcgaggtcg agttctctct cgccgggcgc aagtgccttc    159000
     tcgagccgta cgacctgatg ttggtccgtg cccggacccc atacagctac gccaacttcg    159060
     gcacagagga cggcctcttc ttcgacatcg gcggacgcat cctggtccag ggtgagacct    159120
     ccacctacta cgagtcggat ccgggctggc cgatcaaccc agaggtcggc acgtacaaga    159180
     tcgtgacaga tgatccagcg ttccgcgcca tctacggcag ccgctgacgc ccctatacac    159240
     cgaaatcgca ggaagaggtg gccgccatgg aaaacgaaca gggactcggg cttccgaaga    159300
     tcgggatcaa tctggttccc gttcacgtag gttcgctcgg cgcagcagca cagaccgctg    159360
     aagagttggg tttcgagtcg gtctggctcg gcgagcacgt gatcacaccg ctgagtgacg    159420
     tgtctgcggc ctacccggga aaggcagtga acttcgaacc cggttcaccg cttgtcgaac    159480
     cgctgatcgc gctgagtcac atcgcagcgg ccacgtccac gatccggctg ggtacgagca    159540
     ttgtctgtct gccgcttcgc gacccactgc tcaccgcccg tgagatctcg acgctcgacc    159600
     acctctccgg tggccgaatc gaactcggcg ccggcctggg ctggatgcgt gaggagtacg    159660
     aggccatggg acgggactgg aggacccggg gatccaggct ggaggaattc gtcacggtaa    159720
     tcaccgggtt gctcgccggt gaaccgttcc agttcagtgg caagcatttc gagattcccc    159780
     cgatgctgtt cggccccacc cccttgcaat cgccgcaccc gccgatccac ctcggcggcc    159840
     agggaccgaa ggccctcgcc cggtgcgcgg cactcgccga cggttggatc ggcggcgcga    159900
     agtccgcgga caccgtgcac gagatcgtcg acgaactcct ggcactgcgt cgctccgccg    159960
     gactgccgac cgacgacttc gacatttccg tcatcgtgct acacccgccg acagtcaccg    160020
     aactgcgcaa tatgcgagcg cgcggggttc gacgggtcat cgtgaccccg tggcagggca    160080
     acgacggtcc tccgttcccc ggcatcacgg gcgacctggc accgctgaac gccctggccg    160140
     acgaactcgg tctgtagcaa tccgggcacg cagcgtcccg tgcgaatgcg cgggacgttc    160200
     gccatatcca gaaatcggca ccgccacggg gaggcatctc ccccacttct ttgtccccga    160260
     caccctcatc ccaggagcgc atatgtttga tggactgtcc ggttcgcccc tccttgccgc    160320
     ccttcccaga agacgtttcc tccaggcagc gggtgcactg ggcggaaccg tcgccctgac    160380
     ggggtgtgcg ccttccgtcg caccggccag cccggctgat ggtgcagttc ccgcagacgc    160440
     ggtcgaactc acgggcgaca cggagggtta caacacgacg ttgctcctac tcggtaccgg    160500
     tggggggccg accgcccacc cgggacgcac cggagtctcc agcgcggtga ccgtcggcgg    160560
     ccgaccgtac ctggtggacg ctggctcgtc ggcataccgc cggatggcac aggccggaat    160620
     cggcgcaaaa tcgctcggcg gtgtcttcgt cacacacatg cacagcgacc acctcgccga    160680
     tctgttcacc atctttctac tgaacgtcgg caactacatg gcgggagcac cagaaactcc    160740
     cacccccatc ttcggtccgg gccacatcgc cggcgcgccg cacgccgaag tctccggcat    160800
     gcagggaatg ctgcagggtg tactcgccgc gtgggcgcat gaaatcgacg tccgcaacgc    160860
     cgaagccgcg aaacccgtcg actaccagaa ggtcgtcgtc ggacgagacg tcgtgatccc    160920
     ggactcggtg cgcatgtccg ccgacaatcc cgcacccgac atggacccgt tccccgtctt    160980
     cgaggacgac cgagtgcgtg tcaccggcat tctggtgcca cacggagcag cgctccctgg    161040
     tttcgcgtac cgcttcgata ccgacaacgg ttccgtgacc ttctccggag acaccgcgcg    161100
     ttcgtcgaac gtcgcccgac tcgcaaccgg gaccgacatt ctcgtccacg aagccatcga    161160
     catcgactat tacaagcgca acggattccc cgaggacgtc ctcgaacacc accgccaaac    161220
     ccacacttcc ccggacgacg tcggccgggt cgcaacggag gccggagcga agaaggtcgt    161280
     cctgaaccac cttgcaccgg gagatccacg actggtcacc gatgacgaat gggtttcccg    161340
     ggtctcgagc acatacgcag ggccggttgt cgcaggtcga gatctgactg cccacggcgt    161400
     ggggccccac agctgatctc cctcccccag cattgtccag tgacgaacgg gcgccgcacg    161460
     caggggcggc tgcggacact ccacaaaccg atgacgagga acgacgaatg acacagcagt    161520
     taaagctcgg gtacaaggca tctgcagaac agttcggacc acgcgaacta gtggaactcg    161580
     ccgtgctcgc cgagaagcac gggatggatt ctgcgacggt gtcggaccat ttccagccgt    161640
     ggcgccacaa cggtgggcac gcaccgtttt ctttgtcctg gatgacggcg gtcggtgaac    161700
     gcacgaaacg cctgcagctg ggtacctcgg tactcacccc gacatttcga tacaacccgg    161760
     cggtaatcgc tcaggcgttc gcgacaatgg gctgcctata tccgggacgg ataatgctcg    161820
     gcgccggtac cggtgaggct ttgaacgaga tcgcgaccgg gtacacaggt cagtggccgg    161880
     agttcaggga gcgctacgcg cgcctacggg agtcggtgca gttgatgcga gacctgtgga    161940
     cgggtgagcg caccgatttc aagggcgagt actactccac gacgggcgcg tcgatctacg    162000
     acgtccccga gtgcggcatc cccgtgtaca tcgcggccgg cgggcccgtc gtcgcacggt    162060
     acgcgggccg ggcaggtgac gggttcatct gcacctcggg taaaggcatg gaactgtaca    162120
     cagacaagct catgccggcc gtctcggagg gcgcaaccaa agcagagcgg gacgtgacct    162180
     cgatcgacaa gatgatcgag atcaagatct cctacgacac cgatcctgaa gcagcgctgg    162240
     agaacacgcg gttctgggca cccctgtcac tcacacagga acagaagcac tcgatcgagg    162300
     atccgattga gatggaggcg gcggcggacg cactgccgat tgagcaggtc gccaagcggt    162360
     ggatcgtctc ctcggacccc gacgacgcag tcgcccaagt gaagcagtat atcgatgcgg    162420
     gtttgaacca cctggtgttc catgccccgg gtcacgacca gaaacgcttc ctcgagttat    162480
     tcgaccgcga cctggcgccg cgcctgcgtg ccctgggctg acaggcacga gcagacgagg    162540
     agataaagca tgaccgcaac aacagcgcaa ttgctcaccg aaaccacacc gtggctgcgc    162600
     ctctcagagc acagtgaaga gatcgaccgg agtcacctga gggcgctgtt cgcatcggac    162660
     cccgatcgag tcgacgaatt caccgtcacg gcgggtgatc tacacatcga ctacagcaaa    162720
     cacctgatca cccgccgcac ccgcgaactg ctgctcgacc tggcccggtc ggtcgacgtc    162780
     gaaggcaatc gtgacgcgat gctgcatggc gagcacatca acaccaccga gaatcgcgcc    162840
     gtgctgcaca ccgcgttgcg actgcctcgg gatgcatctc tgtccgtcga cgggcaggac    162900
     atcgtcaccg acgtccacga aaccctggaa aagatgggcg ttttcaccga gcggctgcgc    162960
     gacggccggt ggcgtggtgc gacggggaag aagatcacca cagtcgtcaa catcggtatc    163020
     ggtggctcgg acctcggccc ggtcatggtg taccgcgcgc tgcgccatta cgcggacgcg    163080
     ggaatctcgc tgcggttcgt gtcgaacctc gatccggcgg atctgacaga caacctgcgg    163140
     ggactggacc ccgcagccac gttgttcatc gtgacgtcga agacgttctc tacattggag    163200
     acgctgacta acgcaacggc ggcgcggcgc tggctagtct ctgcgctcgg cgaagacgca    163260
     gtaacaaagc acttcgtggc ggtgtccacg aacgcacaac ccgtcgccga gttcgggatc    163320
     gccccggaga acatcttcgg gttctgggac tgggtcggtg gccgctactc ggtcggctcc    163380
     gcaatcggcc tatccgtcat ggcagcaatc ggcagagaac gcttcactga actactggat    163440
     ggattccata cgatcgacga gcacttccgc accgcaccgc ccgaatccaa tgcgccgctg    163500
     ttgctgggca tgctcggcgt ctggtattcg agcttccgcg gcgcccagtc ccgcgcagtc    163560
     ctcccataca gcaacgacct cgtccgcttc cccgcctact tgcagcagct cacgatggaa    163620
     tccaacggca aatccgtaca caccgacggc tcccctgtgc ggtgtgatac cggtgaaatc    163680
     ttctggggcg aacccggcac caatggccaa catgccttct tccagctgct gcaccagggc    163740
     acgcgcctgg ttccagcgga cttcatcggc ttcgcgcagt ccaccgacga tctaccgacg    163800
     atgagcggca ccggaagcat gcacgacctg ctcatggcca acttcttcgc gcagtccaag    163860
     gtcctggcgt ttgggaagac ccgaaaggag atcgccgcgg agagcgcttc ggccgacctc    163920
     atcccccaca aagtaatgcc cggcaaccgg ccgtcgacga cgatcctcgc ccccaggctc    163980
     actccctcga ctctcggtca gctcatcgcc ctctacgagc accaggtatt tgtgcaaggc    164040
     gtcgtgtggg gcatcgactc gttcgaccag tggggcgtcg aactcggcaa ggttcaggcc    164100
     ctcgccctcg cacccgcagt cgccggcgag gccgccccct gtacgggcga tacctcgaca    164160
     gatgcactga tccgcaccta cagacgactc cggcacccct gacaaccagc acgtgcaggg    164220
     ggcgacggtg atacactcac cggacatcat cggcgcgggc gactccggca agaccttgcc    164280
     gccgggtccc acacgagtgc acaccgagct ctcgcctcgc gtgagacgtg aggcgaaagc    164340
     agtaccgctc gagggcaaat gaccgccgtt tatcgatctc tcagcaatcc gcgcggctcg    164400
     gcgaagaaaa cacgcgatac cagaacttcg atcgattcgg ttgcggtgtc cacccggctg    164460
     tgcgggtcgg gatcgcgtcg accgtttatt caacgggccg cgatccgcca acgccgatcc    164520
     agttctgctc ggtcaactcg ccgctggtga tagccgatgg tgtcggcatc agtgttatcc    164580
     ccatcgtcgt tatccccatc gtcggcgccg aaaaatatca cgcagctgga ggttggcgat    164640
     tcgattcggt ctcgatgcac cacgggccat ccggtgctgg ttccaggtgt cacatgggca    164700
     cggactggac agtcggaatt ctctcggcat cgaacattcc ggagttcaga agttcgcgca    164760
     gggtcttctt tgcgaccttg ccgttggggg acaccggaag ttcgggccag aacacgaatc    164820
     gctgggggag cttgtacctt gccatgcggt gggagagcca ctcggcgagc tcgtcagcgt    164880
     cgggtggaat gctgtcggat gccacgcaca ctgcgacacc gatctcaccc cacttcccat    164940
     cgggcacacc gacaattgca acctcggtga tcgccggatg ctgtgacagc tgttcctcga    165000
     tttcgcgcgg atagacgttg tggccgccgg aaatatacat gtcggaagcg cgtcctgtga    165060
     tatatagaca gccccgggtg ttcaggtagc cgatgtcacc ggtgcggaac cagccgtcga    165120
     cgaatgcctc gtcgttggcg gcgtcgttgt tcaggtaccc ggcgaacacg ggaaggccgg    165180
     cggcacagat atggccccgt tgccctgccg gaagcaggtt cccgcggtcg tcctggatcg    165240
     agagctcgac gccggtccgc ggatacccag cgggaccgaa tccgtcggcg tccacgggct    165300
     ccacgtcgtg gccggcaggc gtcaggaccg tcatcgtgcc ggtgacctcg gccatgccgt    165360
     agaactggac cagcttgttg ccgatcacgg cgcgagcgcg ttcacgatcc tgcatggtga    165420
     tgggcgcacc agcgtagagc acgtacttca acgaggaatg atcgcgattc tcagcctcag    165480
     gtgattccac caggagtttg aggatcgcgg gaacggtgaa catgttcgtc acccggtgcc    165540
     gctcgaccaa tttccacacc tgagaggggt cgaacggacg tgccagcgtc agcacactgg    165600
     tcgcaccgcg ggccacctga cacaacagat gggtgccggc gccgtgcgag agcggggcgg    165660
     taacgagcga gacgtcctgc tgggtggtat ccggtacgag gtccgccaga cgattggtga    165720
     tgatgtagcc gagtgtgtga tgggtgagca cggcagcctt gggatttcca ctcgtacccg    165780
     acgtgaagaa ataccaggcc ggctgatcct gggagactcg cgcatcgtcc accctatcgc    165840
     cgtcgcgccg cacgacggcg ccgacatcgt cggagccacc cgcgccatcg atgacgagct    165900
     ggcctagttc gagtaggccg gtcgccgcga ctgcccggag atgttcgcga tagtcgccgt    165960
     gcccgatcat gaggcgcggc cgggccgtag cggccattcc ggccacttcc gcagggctgc    166020
     tgcggaagtt caccggagct aagatcccgc cagctcgcca caccgcatac atcgactgga    166080
     cctgttggat acggtttggg gagtggagca gcaccggatc gccgggacaa agacctcggt    166140
     cgagcaactc tcgcgctagc gcatcgactc cggagtcgaa ctcggaccac gtgatcgact    166200
     cggtgccctc gaccattgca caccgttcac cgtgtcgtgc ggtggtctga cggaggtaag    166260
     tcgaaaggtt gattgccctg gttcggtaca tgttctccgc gtctctcgct ggacgtccgt    166320
     tggtttggtt caattgttcg ggctgtcgaa gcgcgcatcg aagaacctgc aatgcaggga    166380
     gaatctccct gcattgcagg tgtcgccgac ctgatccgga tacgtcgctc ggtctcctgt    166440
     gcgcaggagt gtcggtgctc tccggcggtg cgcaacacga cgtgtgtgtc ctacggcatg    166500
     gaacagctcc gaccccaacg ccacattcac cgccttctcc gttcaccgtt accgcaatca    166560
     gaactcggag ttgccggcgt ccggtgcaag ctcgtgcgcg gtcacgaacc tcgattcgtc    166620
     ggacgcgagg aagagaacgg agttcgcgac gtcctcgggg tccgtccctc tgaccgggag    166680
     catgttgagc agcatgttgc ccaatcgtgg attcgtcgcg atcgccgctg cgagttcggc    166740
     ctgcatctcc tcggacgcca ggggggtatt cacgcctgtc ggatggacac tgttgacacg    166800
     aatgccgtga gcagacaatt ccgcggcgaa ggctttcgcc atcccgcgca ccgcgaactt    166860
     gctggtggtg tacgggacca tgaagggctg cgccttgatt cctgcaacag aactgatcaa    166920
     gatgatcgat ccaccgcccg cgcggatcag gtgcggggca cctgccatca ccgtattcca    166980
     gacaccggtg acattggtac tcattgtgtc ctcgaagatc tgttcggtca cccgctccca    167040
     ggcccgaggc acacagatgc cggcgttggc gacaatgatg tcgagtcggc ctagcgtgcc    167100
     gacggccgca tccaccgtgg tacgtagtgc cgcgaggtca cgtacgtcca cccgagctga    167160
     cactgctctg cgcccgaact tctcgaccag tcggaccgtc tctgccaggt cctcggttgt    167220
     cgccgccgcg tacgacacgc tgggcaaggg cgcacacacg tcgacgacga cgacgtcagc    167280
     accctcctcc gccagtttgg ccgcgtgggc ccggccctgc ccacgtgcgg cgccggtgat    167340
     cagcgcggcc ttcccttcga ctcgaccaac acccatcgac actcctcatc cctgttcgat    167400
     cgtgcacagt cttcatgtgc tgcaccatga ttcgtgcgca atcggcaacg acgcgaagct    167460
     gcgcggtctc cgcactcatt gtcgactgcg aaggtaggtc agtggtcgtg gacgatcaat    167520
     ccacgaatgt tgtggccggc gagcatgtcg tcgaaccctt ggttgatgtc ttcgagcgca    167580
     taccggcggg tgaccagatc atcgagaacg agcttgccgg cctgcgccat tcgcagcagc    167640
     cgcgggatat ccaccaaagg attgcagtgg ccgtacaacg aaccgacgat ccgcttctgg    167700
     aagagcgtga gaatcccacc gggcaactcg atcgtgttct ccatcacgtc atcggagaca    167760
     cccgttagca cgaccgtgcc gcccttgcgg gtcaactcga acgccgcccg caccacctca    167820
     ctggtgacca cacccaccgt taccaccgtg acgtcggcac cgacgccgta ggtgcgctcc    167880
     cacagatccg cgtgcgcttc ctcggccgag gtgtagacga aatccgcacc ggactgcttg    167940
     gcgaattcga gcttcgactc gactggatcg atcgccgcaa ccaggccggc attggcgccc    168000
     actgcggcac gcaccgcatt cgacccgata ccaccacatc cgtagaccgc taccgtgtca    168060
     ccggctttga cctcacccgc gttgacgacc gaaccccaac ccgtcgccac gccacacgtc    168120
     accagcgaga cccattcgaa cggaatcgtc ggatcgacct tgaccaccga ccgctgatcg    168180
     actaccgaga actgcgagaa cgttcccgtt gccgccatcg caccgatgtc cgtgccgtca    168240
     cgatggaacc ggaagccacc gttggccagc tcaccggtga ccatgttcgc gccgagatca    168300
     cacagattgc tctgcccgct cgcacaccat cggcacgtac cgcaactcgg aatccacgac    168360
     accgccacat gatcaccgat cgacacccga gaaaccccgt caccgaccgc ctcgacgaca    168420
     ccggcacctt cgtgaccgcc gaccaacggg taggtcatac cgccgaattt cgcgtgcttg    168480
     tccgagtggc atagccctgc caccttcatc tgcaccagta cctcgcccgg tcccggatcg    168540
     tcgagatcga actccagcac ctcccagtcc cgatgcaccc cagtcagtgc agctgccttg    168600
     gtcttcatgt cctcatcgcc tactctctgg gttcactctg tcaactggag aagaaatatc    168660
     gtgcgtgaaa tcgcgggtcg gcagtcactt tgttttcggt atccgcgtgc cgcgtgtctt    168720
     caggagccac ccgtcgccgc ggcaccgcga acgacatcga tgacaccggc ggcatcgtcg    168780
     ggcatcacgt cgccacgcca ggcgacgtgg ccgtcgggcc ggaccagaac aagcttgcgc    168840
     tcgtacatct cagccaccgc cggctcgtcg agcttttcca cccgcagcgg cactccggcc    168900
     gccgcccccg ccgactcgaa cgcgctcgtg tccaggtcgg ccgcgccgat ccgcaagagg    168960
     acgaatccgt gtccgaacag cgccaggatc gaactaccgt ccgacagagc cacatgcggt    169020
     gcacgatgtc cgggacgtgc ggtcgggacg taatcgatcg ggtcgtcggc cggctccgga    169080
     gtgccatcgt cgacgatgat cggcgagccc tcgtaacgaa acccgagagc ggtacctggc    169140
     gaatgccatt cgctcttcag tgcttcgacc agcatgtcgc cgacccgctt gcgcgtgaca    169200
     tcaccctcag ggccttcctg cgtcacaccg acgtagttcg agctgtcgac ccattgtcga    169260
     tagtggcctg tcgccttacg gccgttgcgc agcccgattg ggcgcctttc cctctcgtag    169320
     gcatcgagca accccttgcc gccccagcca ctcagcgccg cttccaggat ccagccgaga    169380
     tcggagacat cacccaggcc ggtattgagc ccgtggccac ccgtcggtga catcgtgtgt    169440
     gccgaatcgc ccgcgaggaa gacccgaccc tgacgatacg tcgcggcgac agactggctg    169500
     cggcgccacg gaacgcaccg gatgacctcg aacgggatgt cgcccgagcc gagcgcacgc    169560
     cgcacggtcg ccatgtggtc atacgtgtcg gcgtcgagct cgtcctgcgc gccgaccacc    169620
     gtcagccgcc agatctcgcg cccgtcgata tgggtgagga cgccccaggt gccgtcttcg    169680
     tcgatcagca ggtaccgctg cgcccgtgcc agctcctccg gcagctccag cttcgggatc    169740
     cggatcgtga tgttcagcga gaagtcgagc tggggtccct cgaacggaat cccgagcgag    169800
     cgacgcacgg cactgccggc cccgtcactc gcgaccacgt acttcgatcg gatcgtcgac    169860
     gactcaccgg ttgccgcatc gatgatttcg gtggtcactc cgtcggcgtc ctgcgtgatc    169920
     ttcccgtacg ccgagttcca ccgaacctcg accagaccgc tcgcggtggc actctcgact    169980
     agcagcttat cgagctccca ctgcgggcac gcataccgct tctccgatga accgaccggc    170040
     gggatctcct cccggataga gggattgaga ctacgaccca tcgggtagcc ggtcagcgac    170100
     gtgcagtaga ccgtgtcgaa ggggaagtcg acggggaagc ccacctcgag cacctgatcg    170160
     tgcaggcccc agcggcgcag ttgttccatg gaccgttcgt caaggcctgt tgccttcgcc    170220
     cggaactcct gcgtcccgtc cgcttcgcgc tcgacgatca tgctttcgca gccacgccac    170280
     gcgagatcga gcgcggtggc gaagccgacc ggcccaccac cgatgatcag caccggcgtg    170340
     tcatacgtct cagccattcg ttcgcacctt cacttggttc gttcgcattt tcacttgatt    170400
     ggttgcgtca cacacatcgc gcccggcgca gatcattcat ccgcgccgag cgcattgcgc    170460
     gatacccgcg tcgcttggac actgattcga cggacacggt cgaaggcgta tttgcgttgc    170520
     tgtggacggc ctccgggatg atcgagattc cagcgatgtg caggcttttg aaccggatca    170580
     ctctctcgta aatcgcgcgt tggctgtagg cccggtcgtg cgtacccacc gaaattgcca    170640
     cctcgctcca tcgatccgga ggtcatcgtc gaccccgcca aacaggtcat gtgacgccgc    170700
     tcactgggca tagtacacga aaacctccgc tcggatgttt ttcgtttcgg agtcgccgga    170760
     ggcaggcccc agatgtccgt tgatctgcga cggagctgaa agtttgcctc agttttcgtg    170820
     gtcgtactac gaaagcgatc ggtcgacgac gttggtgtgc cgatcgggat ggcgagtcgt    170880
     tctcgaacgg gatgacgggg gttcgtccag cggtcgggaa gcttcatccg cgcccggatg    170940
     ggcgccgaag ccgatgcgat gggcggcacc gactgcggcg agagctccga tacccgcacc    171000
     cctacctcta ccggcaccgg ggtttcgtcc accaaggggc ttcgcccgac gcgaactcgc    171060
     agacgcgaga ccacacggac cttatgtcgt agtgcactgg aagtgcctct ttcaaatcgg    171120
     gagattgttg cctgcagaac attgatcacc ccagttcaga gcgcattttt ctgaaaccgg    171180
     aatcctggca gtcgggtctc tgggcgatcg cgggtcagag tgagcagcgc ggtcagcgcg    171240
     atcgttccgc acacagcaat cgacacggcc atcggcaccg aggtggattc accaccaagc    171300
     ccgacgagcg gggagacgat tgcggcaacc gcgaactgag cagcgccgat caccgccgaa    171360
     cctgtaccgg caacggaagg aacttgatcc tgcgcgagcg caacggcgtt acccatcgtc    171420
     aagcccatgc cgaacatcat cgtcagcaac aatgcgagca acggccacgg cgtagtcggg    171480
     gagaacagcg agaccgcgag cagccccaac ccgctaaccc acacgacgcc gacgccgaat    171540
     atgagcaacc gccggacgga gatacgagaa accagacggg aattgatcgt catagccgtc    171600
     acgagagata gggcgttgaa agcgaacacc agcgagaact gggtgggcgt gaacccgaag    171660
     atcttctgca cgacgaacgg agatgccgcg atgtaggaga acatcgcacc ggcgccgatc    171720
     gccatcgcgg ccgcgtaacc gacgaatcgg cggtcgccga cgacttgccg gaagttctgc    171780
     ccgagcacga gcaagccgcc ggtgtgtctc gtctccggtg ggagggtttc cgggatggcg    171840
     gtggccactc cgaatgtcat tatcccgcct atcgcggtga gcacccagaa cgtgccgcgc    171900
     cagccgatag ggccgagcaa catgccaccg agcaccgggg cgataacggg ggccacacca    171960
     ccgatgatca tcatgacgct gaacagtcgc gcggcctcga tcccgcgtgc ccgatccgag    172020
     atcaccgccc gcgcgagcac gacgccgata ccgccagaga atccggcgat gagccgcgcg    172080
     acggtgagta caccgatggt cggagcgagc gcgcataccg cgcttgcgac agtgaaggcc    172140
     acggacccac ccagaaggag ccggcgacga ccccagctgt ccgacagggc accggcgagc    172200
     aactggccca ggccgaggcc gaccatgaat gtggtgagcg tcagctgcac gccgatgttc    172260
     gatgtaccca gtgcggacgc gatggagggc aggcctggca ggtacacgcc ggtggccact    172320
     ggtgacgtag ccgagagcag ggcgagtacc agcaacatcg gcactgtgat cgcttctctc    172380
     atgaacgaga cccttcttcc gaacgaatca attcggcagc gacgatggcg cggctcggtg    172440
     tttgcgaaag cacgtgctcg tggtcaaacc cagcgagggt caccgtttac gacaggtcac    172500
     gctgggcgta tccagattgt gagaggtgcg atttcttacc gaatgagaag caggagaggg    172560
     cgggggagag actgccacgg aaacgatgcc gccgacgcgc tcggtcgcac ggcccgaaca    172620
     attgtgcagg tgaggttgtg tggtgtcgtt gtcttacgcc gtacccggct cggccccaaa    172680
     cagatcgttc catgcgtgag cgttccgtgt accgctgatc accgcacgta tatcggttgg    172740
     tgcgtatcca cccgatcatc agcgcgcatg atccgcggac tcgcctcaaa gtcggctttg    172800
     actccgaccg cgatgcgaca caagttcagg aacgcctgga gagcacatat ccgcctacgc    172860
     ccgacatcat tcgggtacgg ccatcgatgt cgcccaccga gaacgacacc ggatagctcg    172920
     aatccggtat gtggtcttcg tgtctccccg gtgtgcgagc ggactccccc tgcagaagca    172980
     ggtcgattgc aatcggcgcg tccccacctg gtcgttcgtt cgatggtgca gtcccgggcg    173040
     ggatcgattt gtggggtatc aatctcgccc gggactgctg ctcagttccg tcatcaccgc    173100
     aagggtggtt cagaactgtg tgcgccctta ctgttccgca gcttcttcgg cctgaccttg    173160
     gcgaagttca ggacctcgaa gtaacgcgcg aaggtaatcg caacgatcag ggcggcaccg    173220
     ttgaatacgt ccgacaccca accctggact ccgaggagct gcagtccggt gatgccgaat    173280
     gcgagcaggt acagaccgat gagggtgccg atgatattga aacgacccat atggatcatc    173340
     gtcgtaccga ggaaagctgc agtcgcaggt gccaacaggt acgaatgtcc gctcgacgga    173400
     tcgacggagc cgattgaacc agcgaacaac acgccggcga tcgcgctgat gacggcggcg    173460
     gcgatgagcg ccgtgattcg gatccgcgag acgcgcaggc ccgcgagtgt cgccgcagcg    173520
     cggttgccgc cgacgaagag gaggtaacgc cccatcgggg tgaactcgaa cacgaaccac    173580
     accaccaaag caaccagcca tccgatccac acgatcgccg gcagggtgag gaatggagta    173640
     gtcgcgaaat ccttgaggga cttcggaata gtggtcacaa gattaccgcc actgacgaag    173700
     ctcgtcagtc ctgcgacaag ggtgtacata ccgagtgtca cgataatcga ctcgagaccc    173760
     gcgacgacaa tgagcaccgc attcagcact ccgatcacga gccccactcc gacggcgatg    173820
     acgcagctca acagcgcgga caccccgttg gaatacagcg cacccaccac ggtcgcacac    173880
     atcaccatca ccgccgcgac cgacagatcc atgtctcctg aacggagcgg aatcgtgatg    173940
     gcaacagcga gcaacaggac ggtagcctgc gctgccagca caattcgcac gtttgtccac    174000
     gagaagaaca gatcgggcga caagacactg aagagtacga aggttgcgac gaacagcagc    174060
     gggaccgcgg cgtgtggaag gatctcggtc agattctttc tggtctgctg ctgcgcggac    174120
     tgcggcgact tcgcaccaac tgagtcgccg ggcacgtcca gcgatgcgtt cgttacggtc    174180
     tgattcttca tgtcagatct cacttctgtt cgagaacgtc gagagcgcct tgactcgctg    174240
     cgatgagctg ctgctccgac aagcactctt ccgcgatttc catagtggcg cggccgtgcc    174300
     gcatgacaat gactcggtgg cacacattgg ccacctcctc gatgtcggtg gagaacacca    174360
     cgatcgcagc accattttcg gctgcgtcgc ggatcagctt gtagatctcc ttcttcgccc    174420
     cggcatcgat accttgggtt ggttcgtgta ggagaaggac tttgggattc acctggagcc    174480
     atctggcgag aacgatcttc tgctggtttc cgccgctgaa cctggtgatg tgctgtgcgg    174540
     gccgaagcgg tcgtactccg aacttcacca actcgccgtg tgagaattct gcctcggccc    174600
     gatgacggac taccccacct cttcggaacc tcggcagaaa gggaagcgtg agattctcga    174660
     ttgcagttcc gtctccccat acggaatcgc gctgccggtt acctggtacg agtgcgatcc    174720
     cggccgccag cgcgaatcgg actgaggact tcaccgctac accgtccacc gtgacggtgc    174780
     cggactcacg cttgtagtgc ccgttgacga gatagggcac ctcgtcctgt cccataccgg    174840
     ctaggcccgt cacaccgacg atctcgcctc gcccgaccgt gagatcgagc ccttcgacgg    174900
     ttccgccgct cagtccacgg atctggagga cgtcgacttt ccggtcgggg acgtgccggt    174960
     cgggatagaa cgctccgatg tcgtaaccga gcatcatgcg caccaactcg gaatcagttg    175020
     tttccgacgc ctggaccgtc gcgaccagct tcccgctacg taatacgctg attcggtcgc    175080
     acacactgag gacttcctgc aggcggtggc cgatgaagag cacggcggtc cccgctgcag    175140
     cgaggctgcg gacgatggcg agaagtcgtt cggattcgga gtggggaagc gcggccgtgg    175200
     gctcgtcgag tacgagaacc tgcccgtctt ggtgcttccg gaggagtcga agcgcgcgga    175260
     gaatcgcgac cactgtccgc tcggtcggcg cgagcgtgcc gacttcgaca tccggatcga    175320
     gctgcagatc gaactcctcc gacagcttgc gaatcagctc gctctcacgg gacttgctat    175380
     agggtgacag gagtttcgcg tcgaatccgc tggagattcc aatgttctcc gctacagtca    175440
     tcgcgtcgca gagtgcaagg tcctggtgga tgatggcaat tccgtgccgc tggggctgat    175500
     cgacggggaa ctccagtgga ttcccccata gttcgcagac acttccggcg tcgggtgcgt    175560
     ggacgccacc caggactttg acgagggtcg acttacccga cccattctcg ccgatgagac    175620
     cgtgtacttc gccgggtgcg atatcgaact cgaccccgtc gagaacggtg acaccgtcga    175680
     aactcttggt catcccgacc aaacgaaccg cagctttcat catgcttacc tccacccgat    175740
     cgatccgcat cacaaggagt tcggcgggtc gtcgaacgcc tcagcgcgac cgctcaccgc    175800
     acccctagtc atttttgagg ctccagagct ttgcgaactc ggcctcgtag ccgctgtagc    175860
     gaggtggctg gggggtagac gggtccgttc cccagttgct ttcgtcgatc atcgcgaccg    175920
     ggatcttcac ggcgaaattg gtttgacctg cagccgcttt gatcatcccg tcgaagtaga    175980
     accagcccag ggcggtcgcc ggcgcataga ccacgttcgc gatcagcggg cctgcgtcgg    176040
     aattgcctgc cagaactccc tccgtctgga ggctgacgac cggaatgtcg cggcccaggg    176100
     ccgagagggc ctgcttgatg tcggggtcgt acacgttggt agccgacagg atcacgttcg    176160
     tattcggatt gcgctgtagc gtggtctgta gcatgcccac aagcttgggc ccgaggtcgg    176220
     tcgcccggac atccacgacc tccgtcgtgc agtcgtcccc gcagagactc gcgatctgat    176280
     tcttcgcgcc gtccacgacc gccaggctgg tcggcgcgct cagggtaccg acgatgacgg    176340
     cgtgggtgtc acagccggtc gccttcaatg cgtagttggc ctgccacgta ccgacttctg    176400
     cactgtccag cgtcacgtga ccgacattgc ccttcgggaa cggtgcgttc ggattgccgt    176460
     tcgaaccgtc gacgacagga atccccgccg ctgccgcgtc ggcaagcgcc tggtcgatct    176520
     gagacaggtc gactgcgacg gtgatgatgc catcggcctt cgccgcgatc gccgcgttga    176580
     tgccctggat gaccgtggcg gcagtgccct tgccgtcgaa gacctgcgcc tgagcgcccg    176640
     cagccaccgc cgcggcctgg aagcccttcg cgtagtcggc ctgtgtgggt acggcagcgc    176700
     tgagaagcac cacccagtag ttcttccctt tcaccaccga tgcatcgaga gcatccgtcg    176760
     ggtatggggc ctgcgccttg gcgtcgagct ggtcggctac cagatcgcct gactgggatg    176820
     cgcattcggc cgatccccga gggcttccgc cggcggcact gctggtgtca gttcccgatc    176880
     cgcatgccgt gatgagcgcc ccggcaagta gcgcagcgga aaccagcgat gtgcggcgca    176940
     gggtatttcg tcgcagtcca gagagtgaca tcacttgtcc tttgtgaaga tgagtcggcg    177000
     agcgtccgcc gaggtacgaa taccgtattc tggatacggt ttgtggtcaa gcccacatct    177060
     ggattgaatt gtgttgcgac agaacgcact agaacgtgcc gctgggcgta cgggcggtgt    177120
     acacgccgcc gctccgcccg agtttcgtcg atccggtgtt tatcaaacag gcgtcgatgc    177180
     gtgacagcta cgggagcgaa tgcccctacg cgggtagatc tcttcgagca acctcaccag    177240
     ctcctgatcg catcgagtat tcgagacggc cccccagagc atttcgacga atctcgtctt    177300
     cgacgtcccg aacaggacga atatttcctc gtcgggcact cctccatacg gcgcccactg    177360
     ccgggcagcg ctgagaactg cttctgcgtc cccgctccgg ggaagatctc gaatggtcat    177420
     cgtggcctcc ttctcctctg aatactagag atcccgactt tggtcgggtc cgttcctttt    177480
     gactgtcgac atcagagtcg ctcggtgaca ccgcgataca cgttcggtcg tgccctcaga    177540
     atccgatcgc catcgggaac tggatctgca tcgtttcgag gaacgactcg atgccttcga    177600
     taccgccttc ccggccaatt ccggatgcac cgaaaccgcc gaacggttcc agaaagttcg    177660
     caccgaaatt gttgatgctg accgcgccgg cggtgaggtg cggtgctatc ttcacggcct    177720
     gatcgacgtc attcgtaaag atccctgctg caagtccgta ttcggagtca ttggcaatac    177780
     gaatcgcgtc gtcgagatcc tgaaaaggca acagaacggt gaccggtcca aacacttctt    177840
     cccgtgcaat gcgtgaatcg ggttccacgt cggtgaccag agtcggttcg taccagtaac    177900
     ccccatcgaa tccgtccggc cgctgtccac ctgcaatgat ggtgccctcc tcgcgtgcga    177960
     gcgacacgta gtactcagtc ttctcgagtt gctgcgccga gacgagcggg cccaccaccg    178020
     tggcgggatc ggtcggatcg ccgatcttca gagaggagaa cacatgcacc agtgcggcct    178080
     tccactcctc gaatcgctcc gctgggacga ggagtctgct gaacgtcgta catacctgcc    178140
     cggtctgagc cagacagccc ggcaccagca tcggggcgga tgcggggtcg aagtcgtcca    178200
     gaacgatggc ggcgctcttg ccgccgagtt cgagggtcag gcgcgtcatg ttctcggccg    178260
     ccgccctcat gacgtccttg ccgacggccg tactcccggt gaatgacacg tgcttcactc    178320
     cgggatgcga caccagatgc ttggcgacgt cgacctcggc tggcagcacg cttatgaggc    178380
     cgggcgggag tccgacttcg tctatcgcct ccgccaagag gaaggaggcg aggggcgtct    178440
     ggacatcgac cttcacgatt accggacatc ctgcggcaag cgcggttgcc accttcacag    178500
     cggcgaggat gagcggaccg ttccagggaa cactcgccag gaccggcccg accggcactc    178560
     ggtggatgag gacgtcactg ccgctccctg agcggcggga tggagaatta tccattcccc    178620
     gagcgagttt cgcggtaccg cggaacactc ctacagactg tccgatgacg aatggggcca    178680
     gggagacaag gccaccctga tcctccgcgt agattcgggt taactcctcg gtacgccgct    178740
     cgatcgcgtc ggcgatcgcg tcgagccgat ccgcacgctc gccgaacgaa agatccgccc    178800
     atgtgcggtc ctcgtgtagc tgcgtcgcgg cggcgaccgc ggcatccgcg ttctccaggg    178860
     ttgcgactgc gattcgggtg acgacctcac ctgttgccgg attgcgaacc tcgaccgtcg    178920
     gctggtcggc gtcggaccac cggcccgcaa ggtaaaggcg gtcgtacgag ctcaccgaaa    178980
     gactcattct ggatgctcca tttattgtcg ggctttcgtc ggaacgcggg atcgtctgat    179040
     tcggggcggt tccccgcgtg cgaggacaca tccgccgccc gccgtcgtga tctacattac    179100
     atcaaaacat ccacgtggaa gttttggtag tcccacttct caggactcgt acgccggacc    179160
     cgcacgaact ggccgcatag gcaggggatg ttcaatgcga ccagcagcgg actttctgac    179220
     agcagtccgg atggcgagct attcggccac ggcggaacag agcggagaca gattccccgg    179280
     ttcatcgcaa tgagtccctc cagcgcatcc ccaggacgtg tgtggactcg acctggacac    179340
     cgggcatcgt gacgagcgat ccgaagccgt cgttgggttc gggcgccgcc cgggcaacag    179400
     atacgactac aaacacgcgc ggagggacga ggggaacacc cctcgtctgc gtcaatcgac    179460
     ctgcccaggg gtgccgaaac ggccgctcgc cctcctgtgg ggcgtgtgcc tggcgagcgg    179520
     ctgagggatc gcctgtcagg cattgcccag ccgaaggtga gtgccgatca gcgcgttgat    179580
     gccttcggca tcggcgcctg ccgactgagg cggttactcg gcctgcgcgg cagcatcctc    179640
     tgaagtgggc gcacctgggg taggggaacc gaaaatccgt ccgatcagtc cgagagctgc    179700
     cgcgatgtcg acggacggat cgaggagcca ttggatctgc ataccgtcga acaccgcgga    179760
     gacgagggac gccgcctcgt ccaccgggag gtcggggtca atctccccgc gtgcctgccc    179820
     ctggcgaatt cgatccgaga tgatctgccg cgcgagcgcg aagcgctcga tgaagaagtc    179880
     gcgcgaggct tcgttccccg gttcgaccga gtgcgcgagc aggctcgtgt acaacgtgat    179940
     gagaccgggc acggccgcgt tctgcttggc aatctccgcg agattatcga tcagcgggac    180000
     gctgcgatcc cgcaactccc atgtctggct gagactcccg tgcgcattca acacctccag    180060
     caacaactct tctcgtgacg agaaatagtg ccgcagcgca gcgtgcgata cctcgatcgc    180120
     ctcaccgatc gcccgcagcg acgtaccgtc gatccccttg tcgacgacga cttctaatgt    180180
     gcggtcgagg atttcctgtc ggcgacgaat cccctttgca tatgttcccc gattatttcc    180240
     cccgaccctg gcgttcatgt cgaaagacta gaccaccgac ccaggagcgt tctaaacgcg    180300
     acacgggccg gcgcctaggc gcgatgggac tcacctatgg tcggaggtca gaacctttcg    180360
     ccgatctcgc aagaacaaca gacctggatc gaagaccctc agcgtcgcca gttccgctgc    180420
     ggtcggagct ggttccgcca cgagatcttc ggcgacctcg aagacccaat cggtgatccc    180480
     gcggatcgca tcgaccgctt cctccacggt gtcacccgca gtcggcagta ccgcggtgag    180540
     gacgaagtgt ccctctgaca aacgctcgaa caccgccaga tccgtgacaa tcgttcggac    180600
     gcgccggccc ggacacgtaa tgtagtcgac ctgatcgacc agtcgtccgg gttggtgcgc    180660
     caccgtgatg atgacctcgt ccgcggcgga aagcacgtcg ttcgcgccac ccgaaccgac    180720
     gatgaagccg ccatcggctc cgtacgtcga gttgatcgcg ccggtcttgt cgatctggcc    180780
     ggcaccgatg actccgatgg acttggagcc cggtcccgag accaacgtac ccagcacacc    180840
     catcacgtcg gtgagcagct tgttagtggg cacgttctgg ccggcgaaga tgaatggttc    180900
     ccccggtcgg ggcaggtaac cgtacagacc gatctccgcc atgagttcaa cgtcgatccc    180960
     tgcgttacgt agatgctcgg ctccggtcca ggacgccagg ttcgcgagtc cgacaccgga    181020
     caggacgacg tcgaaaccgc gttctcgtac cgcgcgctcg agacagcggg ccgtgacgat    181080
     cacttgcgtc tcggtcggcg tggcgggatc tctcgccccc cacgactccg tgacgcgtgt    181140
     cttccagccc tcgggccgtg cggcacgcac gagctcagct gtgcgccccg atccaagttt    181200
     ctcgaggtat tcctggtgcg agtcgacgcc gagaacccac tcgtcgatcc acgcacggaa    181260
     gtcctcaggg gtgcggctcg ccgtcagggt cctcgcgacg aacgcctcat cctcgacgta    181320
     gctggacaca ccaggcacgc cggggctgtt gaagccgtac gggtgtgcac cgaagggcac    181380
     ttcgcacacg gcacgcacca cgtggcccgg tattcgggtg agcgtgttca tctcgcggag    181440
     ttcctcggtc gagacgatgc gctcgacgca ggcgatcacc ccgtccttcg cggccagaga    181500
     accccagtgc ccttccccgt acggagccga caggacgacg ttcccgtgcg ggtcggccgc    181560
     ggccccgtgg agcagcacga tgtccgggcg gagtgccttg acgagtccgg tgggtccggc    181620
     gctctcatcg agttgcacct cgatgtactc cccccgtgcc cccgcttccg cacccatggt    181680
     gctcccaccc atggacttga ccgggaagtg cgtcacgccg agggctccgg ccaccagacg    181740
     agcgacaagg ctccacagag accagtgctc gatagtcacg cggccatctc ggatcgccct    181800
     gaccagggcc gggttcggtc gtgccacggg gtagttttcc cccgcgaacg aggagacgac    181860
     acgctcgacc aggcccaact cgatcaagga gtgctggacg ttcaccagac cggcggtgac    181920
     cagggtgaag cgcggatcgg taccggcgaa cgctcgcgcg agttcgagca gcacggcgtt    181980
     cggacgggcg tcggaatagg cgacgtggat ggtcgctccg gggtggatgt gacggcggat    182040
     ggccgaaccg aggtcggtga ccttcgaagt tccctcactc gctggcagcg aaaacctctc    182100
     ggccagttct acttccaaca ccgttgtggg tgaggcggtc atgatgtcat ggtcaggcca    182160
     ccgctgacgc tgagggtttg tccggtgatg tagctggcgt aatcggacgc caggaacacg    182220
     atcggagccg cctgttcgga agcggtgccc atgcgcttga gcgggaccgc cttgaccatg    182280
     cgatcgatca cgtgctgatc cgactgggca cgcagcagcg gggtatcggt cggccctggg    182340
     gagatcgcgt tgatccgcat gccgtcgcgg gcgatctcac gggcgagtga cttgacgaat    182400
     ccgatgacgc cggccttggc tccggcgtac acggtctcac ccatcgttcc gaccttgccg    182460
     gcatccgagc ttgtcaggac gatcgaaccc gatttctgtt cgctcatcgg ccccatcgcc    182520
     gagcggctca ggaagattga ccccatcagg ttgatgtcga tgatgcggcg ccagtacttc    182580
     gcgtcctcct gcgcgaagaa cgtggtgtcc gaccaaccga cggtgctcgt catcatgtcg    182640
     aggcggccga accggctcac aacctcctcg acgagcgcat cggtctgcgg ctgctccgtg    182700
     atgtcgcagg tgtggacaga gacgtcggcg ccgttgctgc ggaggatctc ggcggtctct    182760
     gccgcaccct cctcgttgat gtcggccacc gccacctttg cgccgttctc tgcgaacagt    182820
     tccgcggtcg cgcggccgat gccgctgccg cccccgacga cgatcgcaat ctttccgtca    182880
     cacttcattt ctgtctccta tcggcttggt gcgggcttct gtaagtccgg tacgacttac    182940
     ttgcggaact tggcgaagtc cggcgcccgc ttttcgagga aggcctgagt gccctcgtgg    183000
     aactcatcgg ttccgtggat gaagttgatc atctgctgtc cgtgctggac ggacggccag    183060
     agctgatcgg tctcgtagtt cagtgagatc ttggcgacgc gtagtgcctg cgggctgagg    183120
     gacagcagtc gttcgcacca ggcgtccact gcggcgtcca gctgatcagc gggcacacac    183180
     ttgttgatca ggcccagttc aacggcctgc ggtgcgggga tctgctcaca cagcatgacg    183240
     atctcgcggg ccttgcgctc gccgacgatg cgcggcagga gctgcgtgcc ccaccacacc    183300
     gggacactgc ccatcttcgg ccccgactgg ccgaagatcg agtcgtccga tgccagcgtg    183360
     aggtcgcaca gcatctgcat ctcgttgccg ccgccgaccg catagccttt cacgcgggcg    183420
     atgatcggct tgccgcagcc gcgcatgatc atcgagaggt tgctcgtccg gcggttcatc    183480
     cgggcagcac ccgcggggtc cgaggcgtcc tcccaagcaa tgtcgccgcc ggagcagaac    183540
     gccttgtcac cggcaccggt aaggacgatc acgccgaccg aggtgtcggc ctcggcctcg    183600
     ctgaaagccg caatcagatc gtcgagggtt tcttcgcgga aggcgttgta cttttcgggg    183660
     cgattgatgg tgatacgtgc gacgccattc tgagcgctgt acagaacatc ctgaagctgc    183720
     atgattactc cttgttcgtg acttggtcga actcgtcgtt ctaatcgaac tcgggcgtgg    183780
     ccctcgagcg gaaagccgcg agccctgtct ggacgtcttc cgatgccatg tggcgcagtg    183840
     cgatctgccg ctcggcgtcg atcgcgtccc gcaagggcag atccgcaccg atcgagaccg    183900
     cggctttgat cgccgcgctg gcagacatgc ttttcccggc aagcacggca gccatcacct    183960
     tggctcgtgc cagtacatcc gcctcgggca cgacctcgtt gacgaggccg gatgccagtg    184020
     ctgtcgcggg cccgatcgcg gcgcccgtca tgagcatcca cttcgctgtt cgcggaccga    184080
     caagcctggg cagacgctgc gtggagcctc cggccgggaa gagcccgaag ttcgcgtgct    184140
     ggtcgccgat cttcgtctcg tcacccatga cgacgaagtc acacgcctgg gtcacctcga    184200
     acccaccggc gaaggccacc ccgtgtacgg cagcgatcgt cgggagcggg caccgctcga    184260
     gcagtatcag cgtttcgtgc cagtagtcga ggaagcggtc gaactcggga ctgtcccgga    184320
     ccagtgcgga cacctcgtcc agatcaccac cagcggagaa ggccctaccc tccccccgca    184380
     cgatgatcac cttcaccgca ggatcactct cggcgcagaa gaccgcctcg cggatcccgc    184440
     ccaggacgga tcgaccgatc gcgttcatct tcgatgggcg gttcaggacg atgtgggcga    184500
     ccctgccatc gatctcgtat cggaccgcgc ccacggaagc gttctcgacg gtgtcctgag    184560
     cggtcggcac gtctccggcc tcggtgttca tcgtgcgagc tccccgaagt acgaccgggc    184620
     gatgagcatg cggaggatct ggttggttcc ctcgtagatt tggccgatct tcgcgtcgcg    184680
     catgaacatc tcgacgggga agtcccggac ataacctgaa ccgccatgga cctgaacggc    184740
     attcgtcgtc acctccatcg acacgtcgga cgaataggtc ttcgccatcg cggccagtcg    184800
     agacgagtcc gggtgcttgt tcacgaaggc gttcgcggcg tcgtacacca gtgaccgcga    184860
     ggaatgcact ccgatcgcca tgtccgcgat caggaactgg acgccctgat agcccgcgat    184920
     ctccttgccg aactgcttgc gttcggaggc gtaccgagtc gcagcgtcga gggctccctg    184980
     cgagattccg aggcacattg cggcgacacc cagccgacct tcgtcgaagc cccgcatgag    185040
     gtgcgtgaag cccttgtccg cctcaccgat caggtggtcg gcagggaccc ggacctcgtc    185100
     gaaatgcatc tcggccgtcg ccgagccgtg gagacccatc ttctgttccc agcgagcagc    185160
     acgtactccc gggcgatccg cttccacgaa gaacatggag agtccgcgcg caccgggccc    185220
     cccggtccgc gcgaggacgc tgtagaagtc ggcgaaacca ccgttcgtga tgaatcgctt    185280
     cgtcccctgg atgacccact cgtcgccgtc acgtcgggct cgggtggtga cattgcccag    185340
     gtcggagccg gcttcgggct ccgtgaccgc tatcgcaccg agtttttcgc ccgcggcggc    185400
     ctgttcgagg agtggcttga cccacggcgc ctcgctcggg ccggtcgcgt tcagcgcgat    185460
     gatcttcgtg gccagccagt gggccgtcag ataggtacac gcgctcgggt acacccgggc    185520
     aatctcctcc agcactatgg actggtgcct gatatcgctt tcggcgccgc cgtactcggg    185580
     cttcacgacg agtccgaaga acccagattc cgcgaggatc tcgcggattg cagggctgaa    185640
     ggtcccggcc tgctccgtct gttcgacgag tgggccgatc tttttcacag cgaccgcgcg    185700
     ggtcatcact gcgaggtcct gcagttcctc attgaggtca gttgtcagca ttgaacccaa    185760
     tcctcttgaa cacgggcccg taaacgggct cctcctcgga actgatcacc cgtacgtcga    185820
     gcacgacacg ctcaccgtga cttggatcat tttctcctgg tgcgcaatcg atctgggaga    185880
     agagtcgaac accctcctcc agatcgacgt aaccgaccca gtatggcggt tcgaatccgc    185940
     gcggagccat actcacctgg accgattcgt agatctctcc gcggccgctc aggttgacag    186000
     attcgcactt cgtcgagtcg ttcgggcaga tcttccgggc cggcaaacgg acgtcgccgc    186060
     actgggggca cttgctggcg gcgagagacc aactaccgtc gccgttctcg gtgatgatgg    186120
     actgccccag ggacgcctct ccgacgtagc tcatgcggct ccttccttga tcttcttcaa    186180
     gatggtcact cccgatgtgg cgaagtcgct ttcgtggaag ccaccggaga tgtgggccag    186240
     ggccgtctgc gcggacggga cctgtcgatc gccggcgcgg cccagaagct ggtccgcaag    186300
     ctcgacgatc tgcgccacac cggtggcgcc gagcggatgg ccacgattga ggagaccacc    186360
     tccggtgttc acaggaatct ttccgccgag cgatgtttcg ccactttcga cgaacttgcc    186420
     gcccattccg ggttcgcaga atccgaggtc ctcatagtga atgatctccg caattgagaa    186480
     cgagtcatgg acctccgcta cgtcgatgtc ggcggggccg acccccgcga cgtcgtatgc    186540
     ctggcgtgag gtcgagcggt ccagcccgaa ggacgtcata tctcgggtct ggttccgata    186600
     gaaaccactg ccgatcaccg atgccccgat ctggatccca ggttcgatcc ccaaccgttc    186660
     ggcgcctctc tcgctcacga tgaccgcggc cgcggcgccg tcgccggtgg gacagcagtc    186720
     gaggagatgc agcggaccga ctacgtgctt tgcggacagg acatcctcca tcgtgatcgg    186780
     ggtacgatac tgcgccttcg gattcagtgc ggcagctcga cggttcttca ctgcgaccgc    186840
     ggcgatctgt tcgcgagtgg tcccgtagtg ctccatgtgc cggcgagcag ccatggcgta    186900
     gtacgccggc ggcgtaaaac cttgttcgcc ttccagaagc attccgtccg aagtgagcgg    186960
     ccggcccttc ccgtctcggc gagacatctg ttccaccccg atgacgagtg cgacgtcgta    187020
     ggtgccgctc gccacggcca tattcgcgac attgaacgca atcgaaccgg aagcgcagta    187080
     cgccttttcg ttgtacacgg cgacaccttc gatgccgatc tcccacccta cgagctgacc    187140
     gacgccgctc tcgcgggaat ggaggatgcc gcttcgcgcg gatccgcagc tgatcatctc    187200
     cacatcgtgc ggccggacgt tcgcgtcacc aagcgccgag aggccagcgt ctcgccccag    187260
     ggaacccatg ttctctgtgg ggaattttcc gaagggcgtc atacctaccc ctgcgaggaa    187320
     tgtgctgcgt gtcaccgcaa gctcctgtct gtgcgtatac cgtatacgga tgatggttgc    187380
     aggtcaacga tctcgaccac gacagtcgaa tcagtccagt tccagtccct gcgactctag    187440
     gtaggccacc agtccgcggc cggaatcgac tatgtgctcg gtcatcaggc ggccgacctc    187500
     gtcatgctcg cccgcacgca tcgcgtcgag gatctggccg tgttcacaat tcgacttcac    187560
     cgaccactca ggcatttcga ccaggaaatc tcgcggaagc tcgagtgagg tcgtcttgat    187620
     cgcggaaagc agtttgcgcg atttggccaa ccgattgatg ttgcgatgca gagtccagtt    187680
     caactccgcc atcttctgat aattctcctg agccgccgca tcaagcatgg cctcgtgcag    187740
     accggtgagg gccagaagat ctgcctcctg cgcattgcgc gacgcccgct cggcggctat    187800
     gccggtcagc gttccctcga tgaggtaggt gtcgagcagg tcggatctgc tcagcggcgc    187860
     aacgaccgtg tgctgcgtgg catccgtggt cagcattccc tcatgtatga gggcacggag    187920
     accgtcccga accggcatcc ggcttgtgcc gaactcttca cacaactgct gctgggacag    187980
     tctcgtgccg ggcttgatga cgccgagcag aatattccgg cggagctcgt cagcgatctg    188040
     atttcccaga agcgcacgct gcaccggctg gaccgagccg cgacttgcac gaacccccgt    188100
     cataactgcc cttccgctag acctcatctg cgcacaattt ctcgtataca ttatccaggc    188160
     ttgggttcat ccgcgcacca tccactcgac cgtgggaccg tgttcgtcca gcccaggcgc    188220
     gccggaacgc gtggcggtgg gcgtcgcaga cagccggatc gggttgcgca tactggtcag    188280
     taaccctgcg tgtccctcgg agatctcgaa atcctggcgt gcgaggacca gcgggtcccg    188340
     ggatacctcg tcgatccggt tgaccgggga ataacacaca ttcgcgtcgt ccaacaggga    188400
     attccagtgc tggagatcat gcgtgcggaa aattccggcc aactccgacg cagccttgtc    188460
     cggctcagag tgccggaggg aaatcaagtc ctcacgctcg agcagcgtgc agagccggat    188520
     ccagaacttg ccctcgaaag caccgatcac gacgtggcgc ccgtccttcg ttcgatatgt    188580
     gcggtaggcc gggtcggcac ccagattgtg gtcccggtcg cgaggcatcg gcttcggggc    188640
     gagcgccttg acaatctgtg ggccggtcat cgcgagagca gcacccatta gacctacatc    188700
     gatgaactgt cccccacctc cggagtcccg gtgtcgaagg gccgcgagaa tcccgacggc    188760
     ggcgtgcagt ccggccgcca catcggcgat cggggggccg atcgggaccg ggcttccggc    188820
     ggcgtcggtc gcctgatcaa ggaagcccga ccgagcgagg tagttgatgt cgtggcccgg    188880
     cgacccgctg ccgtcgtgcc cgtggccggc tcccgagatg ctgcagtaga cgacgtccgg    188940
     attgacgact cggcagtcgt cgtacccgac tccgagccgg gctgccactc caggggtgaa    189000
     cccctcgatc acgacgtctg catcacgtac tagccccagg aacagttcgt gcccctcctg    189060
     cgacttcaga tcgacagtac aactccgctt gttccgtcca acccagtggt gcaaagcgct    189120
     atccccgccg accgagggtt cgatgacgcg gacgaggtca ccggtcggcg gctccacatg    189180
     gatgacgtcg gcgccgaggt ctgcgagcaa catcgacgcg tacggccccg gtagatacat    189240
     gctcagatcg agcaccttca gaccgtcaag ggcacccttc tgcgcgtctg cgggcatgtc    189300
     ggccttattc atcatcagac cccgcaatct gtcggcgcag gtctgctttg cggatcttgc    189360
     ccgtcgccgt catcggcatc tcgtcgaaga cctcgagccg ttctgggagc ttgtacttgg    189420
     cgagaccacg cccgacgagg tacgagttca gctcttgcag gtcgacctcg gtcccggccg    189480
     tgggaaccac aacagcgcag cagcgttcgc ccagtcgagg atccggatag ccgacgaccg    189540
     cggcggacgc gacattcgga tggttgatga gcaattcctc gacctcacgg acactgatat    189600
     tttctcctcc gcggatcact atgtccttga tccgcccggt gacgtggagc atcccgttct    189660
     cgtcgatgcg cccgaggtca ccgaagcggt accagtctcc gcggaacgct cggtgcgtga    189720
     gatctgggtc gccaaggtac ccaaggaaca cctgggggcc gcgggtgacg atctcgccct    189780
     cttcaccgcg aggcagctca cgtcccgact catcgacgat ggccacctga acaccgggga    189840
     gcggttcgcc gtcggttgcc aagatgtcat ccggagcccc agggcgcgtc gccgtggtca    189900
     catacgtttc gctggcaccg aagaccgcca tgagttcggc ggagaagttc tcacgcacct    189960
     cggcgacgag atgcctcggg atcgccgcac cgccggacgc gacgtaccgc aacgtctcac    190020
     cactgccggc gccacgcgcc ttcgccccga gcatgtcaat gatgaacggt gtcgccgcga    190080
     gggtgtaagt gcatcggtgc tcgtcgatca gcctgagcgc cgtatccgga ttccacttgt    190140
     cctgcaggat gagcggaacg cctgcatgga tcgcagctct cagtccccaa gccatgcccg    190200
     acgcgtggca gatcggcgac ggcatgaaca cgctgtcgga gccgttcagg cccagaacct    190260
     tgtcgagata agcccgaagc acgaacatcg tcgtctgatg actgtgcacc acgcccttcg    190320
     gtagggattc tgtcccggac gtgaaggtga cggtgtcccg ttcccgggcg tcgacgacta    190380
     ccgggtcgag tgggaatcgc tgttcccacg gctcctcaag aatgtccgcg agagaattcg    190440
     tcccacttct cactggtacg atcccgagaa tcgaatcgag gccctcggca gcagcaatca    190500
     ctctgtgcca cggggagttt tctcgaaggt ctgcggcggc gaagacgaag cgactttccg    190560
     ctgtgcgcag gatgtgcgcg atctcgggcg tgccgacctt cggaagtaga ggattgacga    190620
     cacccccgat gaggccgatc gcgctgtgga cgacaaagaa ctcacgccag ttgggaagca    190680
     ccaacgtgac gacatcgcct cgcctcactc ctcgcccgtg catgtacgac gcgagtcgtt    190740
     cagcggccga ataggcttca ccccgagtga gcgaaccttc ctcgtcgacg actgcaatcg    190800
     catgtgggtc ctccgacgag gttttgcgaa tgcgagtggt ccaagtgtcg gtcgaccaca    190860
     gtcctgcctt ttcgaattcg gaccgcgttt cgtccgtgat ccacgtggtt gtacgcgcct    190920
     ccagagccct accttctcga ttcaccaggc cgacaatacc gtatacagtc taccgaaaca    190980
     atggtcgccg cctcgccgca gctgggagga ggtgcgagtg tcaggctccc cgtgaagtgc    191040
     gaatcgcaat gccgagccag ttgtgggtcg gggaaccgcc cccttccgcg cggacacctc    191100
     ggggcaaggc aattcgctgc ccagtcagag gtggattcga ctactcggct ccgcgattcg    191160
     acgtttgaga ctccctgacc cacatggtct tgacatcaat caaagtccga atacggtata    191220
     caccattccg taacgaaagg ggcatacgtg atacgtcata tgtcgttcac cgtccacgac    191280
     actgccaacg tagccaagat cctggctgag attctggggg gaaccgttga ggttcccgcc    191340
     agaccaccct atggaccgca gagcctattc gtgtgccttt gggacgagca tggaacactg    191400
     atcgaactcg cgccgaccgg atccgcgtgg gttccgaacg acaaggcatt gccgattgaa    191460
     acgaagttgg atgacctcgt gcagcagcac gactatctgc actcgttctg ggacgccgct    191520
     gtgtccttcg acaggattcg tgagatctgc gaggagcagg gctggcgcta ctacatcacc    191580
     gatcagaaga tcaagatcgc tgtggtgtgg atcgagaacc atagatacat cgagttctgc    191640
     ccgaaggagc atgttcctgc gtacctcgag atttacggca cggccggcaa ggacaagtac    191700
     caggactacg tcgcgagccg agttgcagca atcaaggcca cccaagcagc gcaactgaac    191760
     aagccctgat ctgcacgaac ggatcgctgg atggatcgga tgagatgagc agcccccgag    191820
     aaatccggct caccacctga accttcccct aagaggcgaa ctcgacccaa ctaaaggttg    191880
     tgggaataca gcgcccggct acggggactc cgacgggaac ggcgttcgaa ccgcgacggc    191940
     tgcatgcctt cctggtcggt ctcggctttt gagaatcgct gggagtggac cagttctgcg    192000
     attgaggatc gcgcgctgtc ggtgcggccc gcgcctcata gcgcgacgaa gtgcgcgagg    192060
     gtcgagaatc cactgggaga ctccttcgcg cgtgaaccga caaggttccg gcggtcccgg    192120
     cgcgcctgtg gcaccacccg tgccatgtgt gcggggatcg atacgagcgc taccggttta    192180
     cccaggacct ccgtcaaggc gtcggacgcg acaggcgtgt tcgccccgca cgccctggtg    192240
     ctcatgccgc atctcgacgg gtcagttgtt taggggaacc agggcgaccc gagtcgcggc    192300
     atgtgacggg ccatcgaggt tcgtcgggtc tcgctttccg ttgtggtgca acatgatacg    192360
     gcgatattcg catccagtgt cattgaatgc agatgtctca cgtgaccaca aaccgactga    192420
     accaggagtg agaatggaaa tggacttccc gcaggtgtat ccgtcgagcc ccgagttcac    192480
     cgccgcggcg aacgccggcc ccgacctcca ggctgccgca gacgaggacc gactcgcatt    192540
     ctgggcgaca caggccgagc gcctgcactg gcacacgccc ttcaccgagg tactcgactt    192600
     ctccgacgca cccgtcgcga aatggttcgt cggcggcgag ttgaatgtcg cctacaactg    192660
     cgtcgaccgc cacgtgatcg ccggcaacgg cgaccgcgtc gccatccact tcgaaggcga    192720
     accgggcgac acccgcgacc tcacctacaa cgacctgctc accgaagtgt ccaaggccgc    192780
     caacaccttc accgacctcg gactcgtcgc cggcgaccgc gtcgcgatct acatgccgat    192840
     gatccccgag gccatcgtca ccatgctcgc ctgcgcccgc ctcggcctga cccactccgt    192900
     ggtcttcgcc ggcttctccg ccagcgccct gcgctcgcgc atcgacgacg ccgaagccaa    192960
     gctcgtcgtc accgtcgacg ggcagtggcg ccgcggccag gccgcacccc tcaagcccgc    193020
     cgtcgacgag gccgtcgacg gggccgcgtc cgtcgagcac gtcctcgtcg tcaagcgcac    193080
     cggcatcgac gtcgaggtcg ccgacggccg ggacctgtgg tggcacgaga ccgtcgacaa    193140
     ggcgtccggc acccacgacg cgcagccgtt cgacgccgag cacccgctgt tcatcctcta    193200
     cacctccggc accaccggaa aacccaaggg catcatccac acctccggcg gctacctcac    193260
     ccaggcgtcg tacacccacc acaacgtctt cgaccacaag gccggccaag acgtgtactg    193320
     gtgcaccgcc gacatcggct gggtcaccgg ccacagctac atcgtctacg ggccactctc    193380
     gaacggtgtc acccaggtgg tctacgaggg cactccgaac tcccccgacg agcaccgcca    193440
     cttccagatc atcgagaagt acggcgtcag catctattac accgcaccca ccctggtgcg    193500
     cacgttcatg aagtggggcc gcgacattcc cgacgcccac gacctgacct cgatccggct    193560
     cctcggctcc gtcggcgaac cgatcaaccc cgaggcctgg aagtggttcc gcgaggtgat    193620
     cggcggaaac caggccccca tcgtcgacac ctggtggcag accgagaccg gcgccatcat    193680
     gatctccccg ctgcccggga tcaccgccac caaacccgga tcggcgatgg cacccctgcc    193740
     cggtatctcc gcgaagatcg tcgacgacga cggacacgaa ctcggcgccg gcggctccgg    193800
     ctacctcgtg ctcgacaagc cgtggccggc gatgctccgc ggcatctggg gcgacatgga    193860
     ccgctaccgc gaaacctact ggtcccgcta ccccgagcag ggctggtact tcgccggtga    193920
     cggcgccaaa tacgacgacg acggcgccct gtgggtcctc ggccgcgtcg acgacgtcat    193980
     gaacgtctcc ggccaccgca tctccacctc cgaggtcgaa tccgccctcg tcggccacca    194040
     cggtgtcgcc gaggccgccg tcgtcggcgc cgcggacgag accaccggcc agggcatcgt    194100
     cgcgttcgtc atcctccgcg aaggtgtgga gaacaccggc gacaccctca tcgccgaact    194160
     caaggccgag gtgtcccggg agatcagccc gatcgccaag ccccgccaga tcaccatcgt    194220
     ccccgaactc cccaagaccc gctccggcaa gatcatgcga cgcctgctca aggacatcgc    194280
     cgaaggccgc gacctcggcg acacctccac cctcgtcgac cccaaggtct tcgacgcgat    194340
     cggagataag gacggccagt gacggacaaa ctatggactc gctcgatctc gccatgttgt    194400
     ccttcgccaa gaactagtac ccgtatgacg gtggagatga gcacatcttc actgagattg    194460
     ggatcggttc cgcaatacgt tcgatccgag atagcgcaga ccgaggattc gcgactgcgg    194520
     acaaaacact ccgctcactc aagttgaact ccggacctct tggctcaacg caactgagaa    194580
     aacctgaaca ggagaaggtg atgaatgccg atcaccatcc ccagcacccg ctgggaccct    194640
     tcatcgggag cgatctaggg atagacgacc aagtgcgcag ataccgagat gaacgccgtc    194700
     gccgtcacca ggaacaaaag aacaaagagc ggcgagatca gcagcgacgc tgcataccaa    194760
     gccgagaaga agagatcatc caatttgccg tgatttgggc cccatacggt gttccatccg    194820
     atgaagagac ataccaacgg ttcgggatgt ccactcgtca attcttcgag acagtacgag    194880
     acctcctgca cctaggaaag tgcccacccg aaacgcaaag tcgactcacg atgtatgccg    194940
     acccaaccgg aaccctgcca gatcaaaatg cgaaatgatg ataaatcaca gcgaatctcc    195000
     ggtcagcagg tccggcatgc aagctgcgga tgatcgccga gcagttgtcc agtgcacggc    195060
     gcactcgccc atgccttcgc tgaacccgcg gacccgatcg gccaaccctg ggatgttgtc    195120
     cgttgccgtt cgacctgagg cacgactggg acgctgacca gcggtgcctc aacaatgtgg    195180
     caatgaggca ccgtggcgtt tctgccatat tgttgacgca agagcacgtc gggcatgcgg    195240
     gttctcggcg agaacgtgcc aggtagagcc agtgctttgc ctcaacttgg tggcagaagt    195300
     cctgcactta cctcaggtgc tctggcaatg cctcggatcc gatggcatag gacatgtgaa    195360
     gtgacaccga agttgtccaa taggaccagg tatttgtcca gtgtcctggg cgcggagcgg    195420
     tggggtcagc gtgccaatga tcttgtccaa ctaccgcgga tcctgggccc tttcgcccgt    195480
     tgtgccgttg atgttgtcca ccgcggagac ccggccgaaa cccatcgtcg ttctgggaat    195540
     gagggggccg gacctgcgcc gatgacagcg ctcgagcgtt ggtcgggccg ctgtcacgag    195600
     gcggtttgcc tgcaaggact ggacaagccg taggcgcgat tggacagaaa gactggcaat    195660
     tggacaatcc gcgtgtcaat tccgggttcc ggtagtaatg gcgcaaaaaa caacgaagtt    195720
     cgcttagtgc ctggtcagcg ggaatccgga cgctcgttgt tggtggcttc ggtcggggcc    195780
     gatgaggctg gtgatgccgc gcatggctgc cggtgacggt ttgaagtagc ggcgttctcg    195840
     ggttgcggtg gcgggacttt gtcatcagct ccaccaggct ggcaccggcc tcgccgagat    195900
     gccccgcgat gcacccgacg acggccgtca agagtggtcg gggcaaagga gtttcggggt    195960
     ggtgcgccat ccggcgtcgg tgagccatcg ctggactgac tcgggaaggc cgccattgtc    196020
     ggcggattcg gcgagtgcgc cggccaggat ggggccgtca ccgcagaccg aacaagcgat    196080
     gtcgaacgct ggctgcccgg gttcgcaatg gcggcaatgg ctgcggctga tgagcgtccc    196140
     gagatggtcc gggtccgggt ggagccaggt gactgcgagg tcggcgcgtt ggtgcgcggc    196200
     ctcggcgcgc gtggtcggtt catgcccaca ggtgggacaa gcacgtggcg ccctcaccac    196260
     tgcaggagga tccgcaacat cagcggttgc cggcttgtcc ggatgactca cggctcgttt    196320
     gttcaggtgc ccgtacacgg tggtgcgcgg gactttcagc atgtccgcga tctgagcgac    196380
     ggtgtgttcc cctgcgtcgt acaggcgttg agcgagtgcg atctggtcgg ggctgagctt    196440
     cgagggacgg ccacccttac ggccacgggc acgggccgcc gcgaggccgt cgcgagtgtt    196500
     ggccacgatc agctcacgtt ggaactcggc cagcaccgac aacatcccga acatggcgcg    196560
     gccctcggcg gtggcggtgt cgattccctg ctcgagcacc ttcagcccga tgccccgttc    196620
     gcgcaggtcg gcgccgagcg tgatcaggtg cagcatcgac cgtccgagtc ggtccagccg    196680
     ggtgatcacc aggacgtcgt ccgcgcgcag cagctgcagc acaagatcga gttggggccg    196740
     cgaggccttc gcaccaccgg catggtcgat gtggatgttc tcggcggtga cgccggcgcg    196800
     gcgcagggcg tcgacctgat ggtcagggtt ctggtctgcg ctggacaccc gtgcgtagcc    196860
     gatcagcatg tgtcgacaat accctgcaca gggtttttcg acatagtttt tcgacacggg    196920
     ttgtcgacgc atccgacgta ccgagtccgc cggtcagagg cggtgtcgaa aaagtgtcct    196980
     gtctcatcca acccgaggta tggctcaccg atccgaggta ttcggtatgg cgtctcacca    197040
     aactgagaca ccgagtccgc tgacgtggtg agatggcacc ggcagaccgc tggcggcttg    197100
     atgtattgcc tcatgatcgg cgagtcttcg cgcgtctcca gccatctcac gcatatgagg    197160
     catcgcagct cagcggcccc tcagcgtgct gatcctgcct cgtattcaac gagacaggac    197220
     aaaaggatcg atttccgtca catgcctcag tccagggggc tgttaccgcg gccggagggt    197280
     tgtcgagttt ccgggcgggt gggtagcgcg gcggcgttct cgaaagcgtg cccggtgccg    197340
     caccatcacg acatcggatt cggtgtggat gctacttggg tggcgggcga tcgcgtcttg    197400
     gaaggcggca ctgcgacgac ggaggaaggt gtcatgcacc gtcgccgtgt cgtcggcgag    197460
     gaggtacgcc gcggcaccgt cgcagtcgag gaggaacttc ccgtacgccc gtctcaccgg    197520
     cgcctcctcg tcgaagatca ccggcagtac cacctcgtcg accaggtgga acgggaaacg    197580
     aacgagccgg taggcggccc gtaccagcgc tcgcgccacg gcgcccagtc ccatggcctg    197640
     atcgtaacgc cggcacggga ccatggtgac gctgtcacag ggccgggtcc cgaccggacc    197700
     ggcctcaccg cagtgggaat ggtgccgcga acccgcagcg gcgaccgggc gctcggtctc    197760
     gcccgaggca aaggccctat tcggtactcg cgccgccggc acgggccgcg tcgaggatcc    197820
     ggtctcgcat ccacgcgtcg aggggctggc ccgccgcggc ggccgcggcg acgcacagcg    197880
     catgttcggc gtcggtcaac ctgaggttgg tgacgtgtgt cggctccaac ccccgctctg    197940
     cggtgagccg gtgctcggtg acttgccgga ggatgtgctg acgcagttgg tcgaagtcca    198000
     ccgggaggac ctcgccgagc aaccgtgcgc cggtggattc gcggtcggcg atgagggcga    198060
     ggaggatctg ttcggtgccg atgcggtcat ggccgagcag ggaagtttcg cgcaggctct    198120
     gttcgaggat ccgtttggcg tgccgggtga acgggatgtg cacggatcgg gctggatcgc    198180
     cgtgaccggt ggggagtcgg ctgtcgagga ttgccgcgga cacgccgaac gattccagcg    198240
     atctcgccgc tgccccttca cgttcgccga tgaggcccag caggaggtgc tcggttccga    198300
     gataggcgtg gtggtgggcc cgggccgcct cggaggccag gacgacggag cgccgtgctt    198360
     ggtcggtaaa cctctcgaac acctttgctc ccatcggttt tggccgctgc atgcggtacc    198420
     tcatcttccc gctacaccaa ctgcaggctc gggcggggtg gcttcccggc caaccggcgg    198480
     tcagacgggc gggcgcagac cggccagggt gacggtgacg agtcgctgga ccgcggtctc    198540
     ggacggcagc ctggtggccg cggcaagggc gtgcaggcag tagccggcga gttcgtcggg    198600
     gctgatgtcg tcgcggacgt cgccggcctc ggcggcgtcg gcgatcagct cgcggatcat    198660
     gtcgtgcagc tgctgctgcg cgccagcgac gcgctcatcg tggtgcagga acgtcaccag    198720
     gtcggtgtcg ccgtggttgc gggtttgttg ggagacgagc gcataggcgt gcagcaccgc    198780
     gccgagacga cggcctgggc cggtggtgtg gtcgcgcacc tgcgcgagat gctgcaggtg    198840
     agcggtgatc tggcgggcgt gccaggcgcg caggatggcg tcgacgtccg ggaagtactt    198900
     gtacagggtg gcgcgtccga tcccggtctg ttcggcgatc tggctcatcg tcaccgaccg    198960
     cagtccgtgc tcgaacgcca gcgcggcggt cgtgtcgcag atcgcgtcac gaacctgctg    199020
     gcgatgcgtc tcgatcgtct cgttccacag cttcggcacg cacccactat acggcgcgac    199080
     catggtcgat acatcgcatc ttgtccatag acactatgtc tcgatagagt gaggtggtcg    199140
     ccaatcgagg gcgacggcgg aagtcccagc agtaaggagt cgtcgagatg gtcgacgcgc    199200
     cgcgcttccc gtaccccggt tcgccgcccg tgcacgggcc cgacgacctc tacgtcaccc    199260
     cgccgccgtg ggacatcggc cgagcccaac cggtgttcgt ggccctcgcg gagggcggtg    199320
     cgatcagggg gcgggttctc gattgcggtt gcggcaccgg ggagcacgtg ctgttggcgg    199380
     ccgggctggg actggacgcc accggcgtcg acctggctgc gaccgcgctg cgaatcgccg    199440
     agcagaaagc ccgcgaccgc gggctgaccg cacggttcct ccaccacgac gcgcgtcggc    199500
     tggccgagct cggcgagagg ttcgacaccg tgctcgattg cgggctgttc cacatcttcg    199560
     accccgacga ccgcgccgcc tacgtcgaca gtctccgcga cgtcctggtc ccgggtgggc    199620
     gctacctcat gctcggcttc agcgaccagc agcccggcga ctgggggccg caccgactca    199680
     cccgcgacga gatcaccacc gccttcgacg acggctggac catcgactcg ctcgaatccg    199740
     ccaccctcga ggtcaccctc gaccccgcag gcatgcgtgc gtggcagctc gccgccaccc    199800
     ggacctggcc ccacccaatc gaaagggagt gcagcgcgcc atgttgaccg cggagaccca    199860
     gatccccacc gatctggcga gccggtacct cacccaactc tgccgtcacg ccaccgcggt    199920
     ggccaccgcc ggccaccggt tccgccccca cgccggcggt gacacaccga tccgcgacgt    199980
     gcacccgagc gccgaagcct cggacaccag cggcgtcatc cgattcgggc cgtggggccg    200040
     gtgcacactc gaggcggccg caaccacgct cacggtgcgc gtcgaagccg tcgaccagga    200100
     gaaactgtca cggatccagg acatcatcac ccatgacctg caccggttcg gcggccgtga    200160
     acacccgacg gtgacctggc ctgagcccgc ggcaccgggg acgggggcca cgacgtgagg    200220
     tactcaccca ccggacaggc gggggtacgt cgaggccacc gcctgcccgt cgtgctcacc    200280
     atcgtcgtcg ccgtggccgt cgccgtgcat ctcgggctcg gcggatacct gctcgcccac    200340
     acccgttgga ctgccgccgt cgcgaccgtc gtcgtcgtgg ttgtgctcgt gaaactgctc    200400
     gccattatct tcggccgcaa ggtaattcga cgccgcagag ccaccccggc gccgccgcga    200460
     cgcacgccat gagcactcgg gcggcccccg agcgcgggac ccgcggcctc gtcgtcgtcg    200520
     cgagcgtccg ggttgcgttc agacgccgat cctcgtcatc ccgtagcgga accgcgccga    200580
     ctccgcccga ggcaacacca cggaccggcc ggatccgggg gcaaccgctc ccgcggtcac    200640
     tacggactcg ggtgttctca ccggagatag tcaaggcggg tcatcattcc tgattcttgg    200700
     tggtaggcgt tgtggcagtg cagcatccag tcgccgggat tgtcggcgac gaggtccacg    200760
     gcgaccgtgc gcatcgggag aacgatgacg gtgtccttgc gggggcccgg ggtgccgtcg    200820
     ggtttcacga tctggaaggt gtgcccgtgc aggtgcatcg gatgccacat catggtcatg    200880
     ttggtgaagg tcaggcgggc gcgctggcct tcccggatcg tcaacggctc ggtctgctcg    200940
     tacgggcggc cgttgatggt ccagtcgtag ctcatcatgc ccccaccgag aaccgctgcc    201000
     aggttaacct ccggctgact ctggggcagc aggacggtgt cggcgccgac gaaggcgtcc    201060
     gccgtcccca cccggccagc caactcacgg ggcgtgaatc ccgaattcgg cggcgatccg    201120
     ggcccggtgc gcagcacagc tcgggcgtgc gcgttctttc cgtcggccgc cgccacaagg    201180
     ggaaagacgc cgtccccgac agtgacgatg acgtcgtagc gttcacccat gccgagcaac    201240
     agagcgtcga cctcgaccgg tctcaccgga aagccgtcgg tgtgggtgac ggtcatggtg    201300
     tgcccggcca gtgcgatgcg gaaggcggtg tcggctccgg cgttgatgat ccggatccgc    201360
     acgcgctgac cgggtgtggc cgtgaacgtc gacggcgcgg acgggagccg cccgttgatc    201420
     aggtagtacg ggtaggtgat atcgccggtg tcgccgccca ggaggctgct ggtgcccacc    201480
     ccgttcgacg tcgcactcga ggtggggacg ccggattgat ccgagccgcc gcccatacct    201540
     cccatccctg gcatgttccc catgccgcct ggtccgccca tcgggcccat cccgctcgat    201600
     tgcagattcg agaagatctg ctgggggctc gggccgattc cgtgagtcca gtcgtcgagg    201660
     acgacgatcc attcggcgtc gtagtcgccg ggttcgcggg ggtcgtcgac gatgacgggc    201720
     aggtagagcc cgtagtcggt gtcgaggccg acgtgcgggt gcgcccagta ggtgcccgca    201780
     tgcggcaccg agaatcggta ggtgaagctc tggccaggtc cgatgtcggg gctggcgggg    201840
     ctggccccgt ccatgtcgtt gcgcagcgca atgccgtgcc agtgcacgga ggtctcgtgg    201900
     tcgaggccgt tggtgagggc gacagctatc tcgtcgccga cgttggcccg gatcgtcggc    201960
     ccggggacgg tgttgccgta ggcgagggtg cgcacgtgta tcccgccgag gtcgatgtcg    202020
     gccgcctgcg gggtcagggc ggcgtcgacg gtgcggccgg tgtgagggcg ggcagcttcg    202080
     acggcggcga tggtgttccc gtcgaccgga tgggggccgg ggggcgatga gccgcgggtg    202140
     caggcggcga gggcgaggcc acccaggcct gcggcggccg cggtgaggaa ggcgcgccga    202200
     ttcaggccgg atccgttgtc aggcacgggg gtcacgggat tctcgcgcac tgcgcggccg    202260
     gtgtgcttgc acaccagatg tgcctcggac cccggacaca cctgagcgaa cgacgctgac    202320
     gggcggtccc acctggttat cggtcatgcc cggtgcgtag ttgatctctg cggatgcggt    202380
     actcctcggc gtcgatctcc cctcgggcga agcgttcgtc gaggatcgtg tccgcgctcg    202440
     gcctgcgggt gtcggtgtcg tagggaggat tgcggtccgt gcggagggtg cggaacagtg    202500
     ccatgacccc gacgacgacc aacccccaga acgcgaccat cagcccggcc atcagcaccc    202560
     agccgcccca gcccatcccg tagcccattc cgttgttccg ccacatcatc gccgttcacc    202620
     tttcgttgca ctccatcgtg gagtccggat gcggtgaatc gatgagggtt ctgtgtagtt    202680
     tcgctgaaga tgaggccggt tcggggcgag ctgcacgggt tcggggaggg caccggcgac    202740
     gatggagatc atggacaaca cgccgcccct gtcgcccgac gccgcgggat atcgggcctt    202800
     agtggtcgac gacgagcgcc cgctggccgc ggtcgtcgcc agttacctcg aacgggagca    202860
     cttcgaggtc gccgtcgcct acaacggggt cgatgcgctc gccctcgccc gggagatcga    202920
     ccccgacgtg gtggtcctcg acctcgggct gccgggcatg gacggaatcg aggtgtgccg    202980
     gcagctgcgg acgttctccg atgcctatgt ggtgatgctg accgcccgca gcgcggaagt    203040
     ggacaccatc atcgggctgt cggtcggcgc cgacgattac gtcaccaaac cgttcagtcc    203100
     acgggagctg gtggcccgca tccgcgccat gttgcgaagg ccccggaagg caccggtgta    203160
     cgagacaccg tcacccgata ggggtggaga ggaggcgcca cgggtcttcg gggcactgag    203220
     catcgacgtg gcgggccggg aggtgtgcct cggcgagcag ccggtgatgt tgacccgcac    203280
     cgagttcgat gtgctggcgg tcttgtcgtc ccggccgggg atggcattta gtcggcgcca    203340
     gttgatcgag gccgtgtggg gagaatcctg ggtcgggaat gagcacctcg tggacgtgca    203400
     tgtcgggcac ctgcgccgca agctcggcga cgaccccgcc gcgccccggt acgtcaccac    203460
     cgtccgcggc atcgggtacc ggatggggac cgggcaatga cctcgcatcg ggaccggccc    203520
     cgcaccctcg gcgcagatcc gcggcgcagc cgtggccccg gcctcggcgt gcggttgctg    203580
     ctggcgcaat cgctggtgct ggttgcgggc gccgccacct gctgggtggt cgcggtgttt    203640
     gccggccccc cgctgttccg cgagcacctg caccgcgccg gggtaccggc ctcgtccgac    203700
     gagcagttcc acgccgagca ggcgtaccgc tccgccacag ccatttccct ggcggtggcc    203760
     ctcggggtgg cctccctggc cgcgttggtg gtgacctggt atttcagtcg gcgcctgcaa    203820
     cggtcggtga ccgaggtgtc ctccgcggcg accgcggtgg ccgacgggcg ctacgacatc    203880
     cgggtcacgt caccgcacct gggtgaggat ttcgacgcac tcgccgaggc gttcaatcgg    203940
     atggccgccg ggctcgaatc ggtcgagacc acccgccgcc aactgctcgg tgacctcgcc    204000
     cacgagatcc gcaccccggt gtcggtgctc gaggcgtaca tggaggcact cgaggatggg    204060
     gtcgagacct tggatgccga cacgatcacg atgttgcgcg atcagacccg caggctggtc    204120
     cgtttctcgg atgatgtccg cagcctctcc cacgcggaag agagccggac ctcgatcgag    204180
     cctacctggg tggatcccgc agcactgctc tcgaccacct tgatcgccgc ggccgaccgc    204240
     tacgcagcga agcaggtggc actgacctcg aatgttgctg cgcaccttcc ccgcctgtgg    204300
     gccgacccgg agcggctcgg gcaggtgctg ggtaacctgc tcgacaatgc cttgcgccac    204360
     acccccggcg gcggccgggt ggaggtgacc gccggccagc gacaggagct gctggtgatc    204420
     gaggtgaccg acaccggcga cgggatcgcc gccgagcacc tcccgcacct gttcgaacgg    204480
     ttctatcgag tcgacgcggc acgcgaccgc gaacacggcg gcgccgggat cgggctggcg    204540
     atcgccaagg ccctcgtcga ggcgcacggc ggccatatca ccgcccgcag cgacggcccc    204600
     ggaaccggca gtaccttcac catcaccctt ccgctgcgac cggatcagcg atgaggacgg    204660
     actctgtgac ggcgatcgcc cggcaccggc tcgcgcccgt tcgcagcgtg ccgagcggac    204720
     ggagcgcgga caccgtctac ggtggtcacg agcaccggct gcgccggact ctcatcgcgc    204780
     tcacccccgt cggcgagcgg ccgatgttcc cattcgcggc gagtccaccg tgtacatcat    204840
     gggcggtcgg ggcaggttgc ggtggcgggc gatctggtcg cgatcaccgc ggcgcgtact    204900
     ccccgggtcg aggcgccgag ccgagtctgt cctcgtcctc accgtcgcga aaccttcccg    204960
     atgccccggg cagggcgcgc tgagggtggc tcaggtgggt ggttcggcca gggagtatcc    205020
     ggcctcgtcg acggcgtcac gtacctcgtc gagtgacaag ggtcggctgc tggtgaccct    205080
     cacccgggaa tcgccgccgg gaaccaggtc gatgtcgacg ctcgtcacgg catcgaggtg    205140
     gccgagttcc tcggtgaccg cctgcccgca atgcgcgcag gtcatgccgc tcacctggta    205200
     gctggcggtg gtgctcaccg tgttctcctc gggcgcggtc agcggcgggt ggtcgactcc    205260
     acgaggccgg ggtgtcacag cgaggccagg atgttctgca tcgtggtgat ctcctgctgt    205320
     tgggtgtcgg cgatggtgcg tgccatcgcg acggcgtcgg gatactgacc ggagtcgatc    205380
     tcggtctgcg ccatagcgat cgcgccctgg tggtgggcga tcatctgcgt gagaaagagc    205440
     cggctggcgt ccaccccctg agcgttctgc agtgcggtca tgtcctcggc ggacatcatt    205500
     ccgctcatcc cggcgccggg caccggagct tgcgaggact gcatcggcat ggcgtggccc    205560
     ggcatctcca tcccgggtgt ggacatcggc atgttctcac cggtggggtt catcccgggc    205620
     acggacatgg gcatgctctg gcccggagtc atcatcccgg acgtggccat cggcatgccg    205680
     gactgtcccc agtcggtcag ccagccctgc agctgttcga tctccgggcc ttgggctgcc    205740
     ttgatctggg tcgccagatc ggtcacccgg gggtcgatac cgtccttggc gagcacgaca    205800
     tcgctcatct cgatcgcctg cgcgtgatgg ggaatcatct gctgcgcgaa cgtcacgtcc    205860
     gcctggttgt gggtatcggc gggggcggtg ctggcggtga cgcttgccga ggtactgctc    205920
     tgcgctgact gatcggtgct ggagttgctg caggcggtca acgcgaccag ggcggcgacc    205980
     gcggcggcgc cgatggcaag gttcgtggtc ttcatggcag ggaaattcct ttctcacttc    206040
     tggacacaac tgctgctcat cccggacacg gggaggttgg tcagtgcttg tgcaagctcc    206100
     gcgtaccgag cttcgcggga agccgcaggt accgcatgag caggacggag aggtccggcg    206160
     caccggtgac ggctcggggc cacacgtcgg tttgccgcgg aacgggtagc gcagagcccg    206220
     tgtgacgagc gccctttcgc atcgcgggcg cggtggatgc ggccggtgga gcgccgtcgg    206280
     aggtcgggac cggtcgtggc cgtcaggacc ggacgagacg ggcgatggcg ttggaggctt    206340
     cggcgatctt ggcctcggct tggtcgcggt cgccggtcgc ggcggcatcg accacacagt    206400
     ggctgatgtg atcttcgagc agccccagtg ccaccgcctg cagggccttg gtcatcgccg    206460
     agacctgggt gaggatgtcg atgcagtact tctcctcctc gaccatccgt tgaagcccac    206520
     gggcttggcc ttcgatgcgc cgcagacgca tgaggtaggc gtccttggac tggatgtagc    206580
     cgtggccggc ctcgggggtc tcggtgctca ttgccgactc ctctcatcgg gccgcttcca    206640
     cccccaacat acccatgatg ggtatcagcg ggaggtggcg gcgggagatg tccgatcgca    206700
     ggcaccgacg gggtggtcgc cgaggagttc cgtaggggtt cttcgacgcc ggttcacggg    206760
     cccgcccgcc cgtgtcggcc gcggccgggt ccgcggccgt caccggtagc ggtggcggga    206820
     gtcgtcggtg atcaggcggt agaggacata cagcgagaac catgtgatga gcacgctcac    206880
     caggaccagc agtgtctcgt agaagatgac cacgatctcc tcctcgggca tgagggtgga    206940
     cagtgaattc ggttggcgcc gcgggctctt cgctcatcgg ggaccggtgg gggtgggttc    207000
     gggtgccggc aggggcgccg tgagctgcgg ttcgggcggt gcgggcaacg cgagccgttt    207060
     gagcatcagg gcgttgaccg ccacgatgac gctcgacccg gacatcgaca gggctgcgat    207120
     ttccgggcgc aggaccagtc ccaaggaggg ttcgaagacg ccggcggcga tcggcaatgc    207180
     gatgacgttg tagccgacgg cccatccgag gttttgccgc atcttgcgta gcgtgccgcg    207240
     cccgatccgc agggctatgg gcacgtcgag cgggtccgag cgcatcagca ccaggtcggc    207300
     ggtctcgatc gcgacgtcgg tgccggcgcc gatcgcgatg cccaggtcgg cctgggccag    207360
     ggcgggggcg tcgttgacgc cgtcgccgac catcgcgacc gtcttgcccg cgcgctgcag    207420
     ttcggcgatc ttggcggcct tgtcgccggg gaggacttcg gcgatgacgg tgtcgatgcc    207480
     cagttgcccg gcgatgcgtg cggcggtggc ctcgttgtcg ccgctgagca tgaccacctc    207540
     ggcgccgagg tcgtggaggg cggacacggc ggcggcggag gtgtcgcggg cggcgtcggc    207600
     cagggcgatc accccgactc cgtggccgtc gacggccacg agcaccgcgg tccgcccggt    207660
     cgcggccagc tcgtcccgcc ggtccatcag ggcaccgaag tcgacctgtt cggcggccat    207720
     gagcttgcgg ttgccgaccg cgacgcggcg gccgtacacc tgggcggtgg ccccgtgtcc    207780
     gggcacgttc tcgaacccgg tcagcggcaa ctgcgggatg ccgcggtcgg tggcgtagcg    207840
     gacgatcgca ccggccagcg ggtgctcgga ttcgcgttcg accgtcgcga cgagcgcgag    207900
     gaactcgtcc tcgatgatgc cgtcggtgat caggtcggtg acctcgggtt cgcccttggt    207960
     cagggtgccg gtcttgtcca tcaccacggt gtcgatccgc gccgacgtct cgagtgcggt    208020
     ggcgtttttg aacaacaccc cgcgttgggc gccgaggccg gtgccgacca tgatcgcggt    208080
     cggggtggcc aaacccaggg cgtcggggca ggtgatgacc acgacggtga tcgcgaacag    208140
     cagcgccgtc tgcacgctct ccccgaccag cacccacacc aggaaggtgc cgatgccgcc    208200
     gatcagtgcg accagcacca gccagaacgc ggcccggtcg gccaggcgtt gcccgggggc    208260
     cttggagttc tgggcctgct gcaccagggc gacgatctga gcgagcacgg tgtcggagcc    208320
     caccttggtg gcccgcaccc gcagggtgcc ggtggtgttg atggatgcac cgatcacttc    208380
     ggagccgggt gttttggtca cgggcaggct ttccccggtg accatggact cgtcgacctc    208440
     ggagtggccg tcctcgacgg tgccgtcgac cgggatcttc gcgcccggcc gaatgagcag    208500
     cagatccccg gcggtgacct cggcggtggg gacctcaacc ggctgcccgc cgcgcagcac    208560
     caccgcccgc ggcggagcga gctcgagcag ggtgcggatc gcgtcgttcg cgccgccgcg    208620
     ggcccgcatc tcgaaccagt gcccgagcag cacgaaggtg gtcagcatcg tggcggcctc    208680
     gtagaacaca tccccgccgc cggtgagggt caccccgacg ctgtagagcc agccggcacc    208740
     gaccgcgacg gcgacgagca ccatcatgtc cagggtgcgc gcccgcagcg cccggtaggc    208800
     gccgtcgaag aagatccacg ccgagtagaa caccaccggc aggctcagca tcagggtgaa    208860
     cacgtcgtcg cgcagcccga acggtgccgg caccatgaac ccgaacatgt cccggcccat    208920
     cggggaccac aacatgatcg ggaccgacaa caccagcgcc accaggaaac ggttccgcat    208980
     gtcgcggacc atggcgtcca tcgacatccc ggcatgaccg ccgccgtggc ccatcatctc    209040
     ctgcggtgac cgccccgcag gcgcctcgtg cccggcgggc atctggtgac cggtcggccc    209100
     ggcggctgcc gcagcttccg gggcggggtg agcgtgttct gcctcgccgc gcacggcggc    209160
     cggttcggac atcgggtcgc agacgtgctc gggcaccgag cgtccggcgc agtgatagcc    209220
     gcagtcgcgc acccacttcg acagttcgac caccgacgtg aggccgggat cgtaggtgac    209280
     ggtggcggtc tggttgacgg cattcgcctc cacggaggtg acacccggtc ggcggcgcag    209340
     ggtggcctcg acggtcgccg tcgaactcgc ccagtgcacc ccactgacct cgagcacggt    209400
     ggttctgttc attcgcgctg gcacctcttc gttgtggcgg cgccgagtcc gacgctccgt    209460
     tcggtatgac gccttcttcc ggtccgggtg cggcccgggc acccattgcc gtcatctacg    209520
     gcgggagtca atgccgttgt ccccccatcg aaaacatcat caccgccatc atcccgaggc    209580
     acgccagcgc gaacaccagg ctcccgattc ccaccgttcc gctggcgatc agcgcgacgg    209640
     cgacaatcag catcggaatg cagcaggcga tcatcatcca ccggtgacga ctgcgaccac    209700
     cggctccctg tggttcctca ccagccccac ggtctccgtc gtcgccgacg tacggcgccc    209760
     gcccatcctc gttcgtcatg atgttccgcc cttcaacgag gccggtacat gacccagcct    209820
     ctggtacagc gggcaatgac cggtcgaccc ggtcaccacc agatccagtc cggcggcgat    209880
     gagcaacacg gccaacacca cggaccagag cgaggctccg cccgcgatga ccaggagacc    209940
     gccgaccgta ccgacaacgc cgatcacgat ccgggcgatc cgctcggcag gggtgacgtt    210000
     gacactcacc ctccgcgtca tcgctactcc ctcgctttcc gccgcaaccg gtttcaccgt    210060
     tctcgccgcc acctgccgat catgtccgag agtgccccca ccgggtatgc cttggttagt    210120
     gatttgatga agattcgatg aagaagccac ccgcggaagc cgggcgtgac ccacttcagc    210180
     ctgctgacct cgctttttcg cagccgaccc gacaatcgtc tttaccacta ccccctatgg    210240
     gtatatgttc ggttcaggct caccggagcg tgggcgagaa aggtggagat cgatgactgt    210300
     caccacgtac aaggtcgagg gaatgacgtg cgggcactgc gtgtcggcgg tgcgggccgc    210360
     ggtgggctcg gtccccgggg tgaccggggt ggaggtggat ctggcggcgg gaacggcgac    210420
     catcgccggc gtgccgatcg acggcgctgt cgcacaggcc atctccgacg ccgggtacga    210480
     cgtcgtggcg gcggggcgca acacggagtc gcatgacacg gtggtcggta ccgccctgcc    210540
     cctggtcggc gatgccggcg ggtgctgctg cagctgagcc cgcaatcggc ccggcatgca    210600
     tccgggccgg tgggccgagg ggtcgaccgc gcggtgggta ccgcgtccag cgcagtgcgg    210660
     cggggcgcgt cggcgatatc cggggagtgc cggataccgc ctggttcagg ctacccccta    210720
     ggggtattat gagagagatg cgagtggcaa gaggatgagc acatgacgac ccacctgacc    210780
     gagtccggtg atcgagaaca tgatctcgag ttgtcgatcg ggggaatgac gtgcgcgtcg    210840
     tgtgcggcgc ggatcgagaa gaagctcaac cggatggacg gcgtcaccgc caccgtcaat    210900
     tacgccaccg agaaggccaa ggtcaccttc gccgaccggg tggcccccga cgatcttgtg    210960
     gcgacggtcg aggcgaccgg atacaccgca accctccccg tttcccccgc ggacgccgcc    211020
     ggggcgacga ccggcgcccc cgcagaaccg gacgaggccg ccgagtggcg gcagcggctg    211080
     atcgtctcga cggtgctgac catgccggtc gtgctgttgt cgatgatccc ggcgctccaa    211140
     ttcgacaact ggcagtggct gaccctgacc ctcgcctccc ccgtggtggt gtggggcgct    211200
     ctgccgttcc accgcgccgc ctgggcgaac ctgcggcacg gcgccgccac gatggacacc    211260
     ctcatctccg tcggcgtcac cgccgcctac ctgtggtcgc tgtgggcgct gttcttcacc    211320
     cacgccggca tgaccggcat gcggatgaac ttcgacctgc tcaccaccgg cagcaccgaa    211380
     ccgcacatct acctcgaggt cgcctccgcg gtgaccacct tcatcctcgc cggccgctac    211440
     ttcgaggccc gcgcgaaacg gcagtccggg gcggcgttgc gcgccctgct cgacatgggc    211500
     gccaaggacg tcgccgtgct ccgcggggga tccgagatcc gcgtcccgat cggccaactc    211560
     gccgtccgtg accagttcgt ggtcaggccc ggggagaaga tcgccaccga cgggatcgtc    211620
     accgcgggca cctccgcggt cgacgcgtcg atgctcaccg gcgaaccggt ccccgtcgag    211680
     gtcgggcccg gcgacagcgt cgtcggtgcc accgtcaacg ccggtggccg aatcgtcgtc    211740
     cgcgccagcc gtgtcggcgc cgacacccaa ctggcgcaga tggcgcggct ggtgaccgag    211800
     gcgcagaacg ggaaggcgca ggtccagcgc ctcgccgacc ggatctcggc ggtgttcgtg    211860
     cccatcgtca tcgggctggc gctgctgacc ctcgcggtat ggctgctgac cgggaacacg    211920
     gtgacggcgg cgttcaccgc cgcggtcgcg gtgctgatca ttgcgtgccc gtgcgcgctg    211980
     gggttggcga cgccgaccgc gctgctcgtc ggcaccggcc gcggcgccca gctcggcatc    212040
     ttgatcaagg gcccgcagat cctcgaatcg acccgccgcg tcgacaccat cgtcctggac    212100
     aagaccggca ccatcaccac cggccggatg gccgtcgcct cggtgcacgc caccgacggg    212160
     gtatccgaca ccgaagtgct gcgtctggcg ggcgctctcg aacacgcctc cgaacacccc    212220
     atcgcccatg cggtcgccgc ccgcgccgcc gaggcaggcc cgttgccagc ggtcgagggc    212280
     ttcgaaaacc acggcggccg tggggtgtcc ggtgtcgtcg agggtcacgc cgtgctcgcc    212340
     ggccggtaca gctggctgtg ggagcagtgg gcgctgaccg cccccgacac gctgcagctc    212400
     gtcgtcgacg acgccgaaac ccagggacgc accccggtgt ggattgcgtg ggacggggcg    212460
     atccgcgcgg tgatcgtggt ctccgacacc gtcaaggaca cctccgcggc ggcgatcggc    212520
     gaactacgcg agctcggcct ctcacccgtg ctgctcaccg gggacaatca ccgcgccgcg    212580
     cagagcgtcg cgaaccaggt cgggatcgag gaggtgatct ccgaggtcct gccctccggc    212640
     aaggtcgacg tgatcaagaa cctgcaggac caggggcggg tggtggcgat ggtcggcgac    212700
     ggcgtcaacg acgcggccgc cctcgcccag gccgacctgg gcctggcgat gggcaccggc    212760
     accgacgtcg cgatcgaggc ctcggacctg acgctggtgc gcggtgacct gcgggccgcc    212820
     ccggacgcga tccgtctggc acgggccacc ctgcgcacga tcaagggcaa cctgttctgg    212880
     gcgttcgcct acaacgtggc ggccctgccg ctggcggcgc tgggcctgct caacccgctg    212940
     atcgccgggg ccgcaatggc cttcagctcg gtattcgtgg tgagcaacag cctgcgactg    213000
     cgccggttca ccccccacca gtaacagcac cctccacccc gctgcccgag ggcagcgggg    213060
     tggagggttc gccgccgatc acatccccaa ccggggacgc accggggtgg cgggggctcg    213120
     gtggaacaac cacccggcca gcgcactgag cgcgagcacc catgccagcg ctcccagcag    213180
     cgggccgacc gcatcgaacc gtgcggtcag cccgccgtcg agcaacaccc gcatcgcccc    213240
     atatcccggt aggccgtgtg cccaggtcgc cggttcgggc cgcagcatcg gactctggcc    213300
     gatcccgata tcgagaaacg gcaccagaaa cgcgatgaac accccaccca cgcgcccgaa    213360
     gatcggcccc aggcagaaac cgagcagccc gtaggtcacg gccatcagca ggttcccgcc    213420
     gccgtagaca ccccactgcc gggcatcgaa caccgtcgcg gtgatcatca gcgacgagac    213480
     ggtgaccaga cccgcggcga tcccgatcat cgacacacgg acagcgagca ggagggggaa    213540
     ggggaagccg gccagggtca gtcgtcgatc gcccgcgcgc gcgtcgagcc cgacgaacag    213600
     ccccgccaac gccgccagcg aggagatcgc gatcggggtc atcgtcccgg catgcacatc    213660
     cggcaaccag aacacctgca tcaccgtgcg accgccctcg accagggaga acactccgga    213720
     ctcgctcgcg gtcatcgcct tggccagcac gatgaacacg atcggtacca ccaccagcag    213780
     cacccacagc accgggttgc ggcggtagtc gcgcaacccc atccgcagtc cggccgaaaa    213840
     ctgggccggg ccggacgcgg cgggggatcg ccgacgcgag ccccgggaca ccccgactgt    213900
     ggtggtgatg acggcggtgc tgatgatcag cgccgagaac atccacacca gcgcccagcc    213960
     caagtccccg atccggcccc cgtgccggga cgggatatcc accatccaca acgtcacgaa    214020
     atgcgtcggg aaccaccggg tttcgatgcg gtcgggggat ccgacggcgg gtccgaagaa    214080
     cacgtccaga atccagacga acaagatgag gacggtgccg ttgaccgggt tgcggatcag    214140
     tgccccgacc agtgcgccga tcgccagata gatcaccgcg aacatcaggg ttccggcgat    214200
     cgcccggccg gggtcgtcga tgccggtgcg cgcggccagg gcgagcaggg ctgtcgcggc    214260
     gaccagcact cccaggacca gtccggtccc gagccgggcc gcgaccagcc gcgccggtgg    214320
     gagtcccgcc gacaccagcc gccgatcggc cgcacgggcg gcgctgatct ggaagaacat    214380
     ggcgataccg gcgaggaatc ccgccgccca gccggcggtc gcggtttcca ccgcgggccc    214440
     acccgcgccg ccgagcagct tcgccgcatc ggccatcgac ccggccgcaa cgatcacgaa    214500
     caccaccggg accaacacca gcaccagcat gttgaccgga ttgcgggcgt agtcgaccag    214560
     gaatcggtgg acgagtagcg ccacctcgcc cggcgccccc ggcaggtgat cctcgcttct    214620
     catctcgccg ccgccctccc gttgcgcagg tcgacgatgc ggtcgaatcg gtgctcgtcg    214680
     gtgacgaagt ggctgatgat cagcaccgag cggccggttt cccggcgttg tgccaccagt    214740
     tcccagaacc gcaggtaggt gtcccagtcg aatccggagt acggctcgtc gagcagtagc    214800
     acctccgggt cggcgagcat cgccaacccc aggttgagtt tcgcgagggt gccgccggac    214860
     agccggtcgg cgcgggtgtc cgcgtagcgc tcgaagccga gcgccgcata cagtccccgg    214920
     cgggaccgcc gctgctcgtt cggggtcatt cggtaggcgt aaccgaacag ctcgaagtgt    214980
     tcgtcgcagg tcaacctttc gtagaccacc ggctgctgcg gacagtagcc cagccgcccc    215040
     gaccgggcca cggtgccggc gtccggccgg tactcgccga cgaggatctt catcaacgtc    215100
     gacttccccg acccgttctc cccggtcagc ccgaccacct cacccggctg cagcacgaga    215160
     tccacgcccc gcagcactcg ggaatcgcgg cgggccggcc accatccctg ccggaagctc    215220
     ttctcgattc cctcggcggt cagcaccgcg ttcaccggcg ccgactccgc ggaccccgac    215280
     ctgttcatct cactcctcgg aacacttgcg ggtggtcatc gggacctcag cgccactgcg    215340
     tccggcgcgt gcacaccggc gacggccggc accggaaagc ggcggtgggg ctgtcgaatc    215400
     gccgcgacgt cgaggtcgat gtgccacccc ttcccctgca cgacaccaac ccgactgagc    215460
     gccggcctga tcggttcact ctccgccgat tcctcaactc aataccgtgc cggcgcccgg    215520
     gcgcactcga ccggccctct tcttcaacga atcttcacaa aagcctcacc gatttgcggg    215580
     ggtacgccgc cgacactcgg caacgaaccg acgcataaac gggtcagccg ccaccaggga    215640
     tcgagctgtg ccgccaccga gaaggagcag tcctgatggc gccgatcacg accagcatcg    215700
     acgtcgaccg cccaccgggg caggtgttcg cctacggcac cgacccgacc cgcttcgccc    215760
     agtggcagaa gggtgtcgtc agcggccaca tggatggcga cgcggccccg cgggtcggcg    215820
     agaaatgcct caccacccgt cgtatcgggt tcgccgagcg cccggtcacg tccgaactga    215880
     cgcatatcga tccgcccagt acctggggtg tgcacggcgt cgacgggccg atccgtgcgg    215940
     tcgtggaggt gaccgtcgac ccgctcgacg ccgggcagcg ttcccgggtg acgatcgcgg    216000
     tggacttcga ggggcatggg atcgggaagg tgctcgtgcc cttggcggtg cgaccgcagg    216060
     cccgcaagga gatgccgggc aatctggcca cgctcaagca gcgtctggaa gcgtcaccgg    216120
     cacagccgaa ctaggcgccg cacattcgtc gccacccggg atcgagctca tcctttcggg    216180
     gcccgctctt tgttcgtgcg gaggggtgtg gggtgggttt cgtacatgcg gaccgcgacg    216240
     gccagggcgg cggcggcgct gaccgcggcg gcgccccaca ccgcggcgtg cagtcccatc    216300
     aggtcggcga cgatgccgcc gcagatcgcg ccgacggcgt agccgctgtc gcgccagacc    216360
     cggtagatcc ccacggcgcg cccgcgccag gccgggtggg cgacgtcccc gatcacggcg    216420
     agcagggtgg ggtagaccat ggcggtcccg gccccgagca acaccgtccc ggccgcccac    216480
     ccggtgaagc cgtgggaggc ggcgatcagc gccaacgcgg cggcctgcag gctcattccg    216540
     gtggtgatca gatgcttgcg gccgatccgg tccgacaggg cgccggtgac caattgtccg    216600
     gcgccccaga cgccgggata gagggcgaag agcacaccga tctgcccggc gccgaggtcg    216660
     gcggtggcga acagcagcgg gaacagaccc caggagagcc cgaagttgag gttgttgacc    216720
     agcccggcct gactcgccga ggacagggcg ggctcggtga aactcgtttg gatcgcgatc    216780
     tgccggtcgg tcaggtcagc gtgcagatga tcgtgcgcac cgtccgcacg cggggtgtgc    216840
     tgggccgctt ccaggcgcgc gtagtcgcgg gtctcgcgaa tgaacacccc ggacagcaac    216900
     agggcgagtg cggtgtaggc gatgccgagc aggaacgggg cgggccggag cccgtagtgg    216960
     tcggcgaggt agccggccat cagggagctg accgcgacgg cgccgtagcc ggcggcctcg    217020
     ttcagtccca tcgccaggcc gcggcgggcg gggccgacca ggtcgatctt catcaccacg    217080
     gtggtcgacc aggtcaggcc ctggttgatg cccaacagca cgttggcggc cacgacccac    217140
     caccagttgg gggcggcgat gagcatcagt gggacgggga tggcgaacag ccagcccacc    217200
     agcagcaccg gtttgcggcc gaagcgatcg gagaaggttc cggcgacgta gttggcggcg    217260
     gccttggtga ttccgaacgc ggccacgtag gtgaagatga acgtgtagcc ggtcagcccg    217320
     aattcgttct cggcgagcag cgggagcacc gtttgttgct ggccgaccat gccgccgacg    217380
     agggcgttga ccgcgacgag caggctgaac tgggcgaggt tggggcccaa gccgagtcgg    217440
     atcggccggg gcgtggtggt gctcatgggc tggtcttcgc tcatgcgccg gtctcgaggg    217500
     tgcgcccggt ggcggcggcc cagtcgtcgg ggccgccggc gagcaccgtc agctgtcggt    217560
     ggccggcgcg ttcgaggagg ctggcggcgc ccatcgcgcg ttcgccgtgc ccgcacatca    217620
     ccacggtcgg ctcgcggggc aggtcgtcga cccggccggc gagggcgccg agttcgatgt    217680
     ggacggcgcc gggcaggtgc ccggccaggt attcggggcg ttgccggatg tcgagtaccc    217740
     gaatgttggt gccgaccgcg tcgggtccgg tcagcgccgt ggcggttacc tcgcggtcgg    217800
     cggctctcca ggcggcgatg ccgccgccga gttcgccgat caggttgtcg tacccgatct    217860
     tcattgcttg ccagacgatt tcgcccgggt cctggtcctc atcgcggacg atgatcagcg    217920
     gccggtcggt cggggcgagc cagccgagcc agctggcgaa caccggccgc agcgggatcg    217980
     agagcgcacc ggggatgtgg gcggccgcga accgggtcag cgggcgcacg tcgatgaggg    218040
     cggcgccctc ggccaattgg gcgcggacgg tgtcgacggt cagggccggc agtaccggat    218100
     cccggtcgag gagcggtggg ccgagtcggt tgatttcccc gagccggcgg aagtacggcg    218160
     ggtagctgcc cagcgagccg agcagttggt gcacgaacgc gtcctcatca ggtgcccgca    218220
     gcagcgggtt ggtggcgcgt tcgcgggcga tgatgctggt gcggtcggtg ccgggcgggg    218280
     ccgagcagaa cgagcccgcc ccgtgtgtgg gccagaccgc gacctcgccg ggtagtgcgg    218340
     cgagccggcg tagggaggcg tactgggcgc gggtgagggc ctcggtgcgc tccggggaga    218400
     tcaggtcggt gcgggcggcc gaacccacga tcaacgatcc gccggtgaac accccgacct    218460
     cggtgtcgcc gtcgaggagc aagaagcaca ggtgttcgtg ggtgtgcccg ggcgtcgtca    218520
     acgcccgcag ccgcagccca ccgaggtcca cctcgtcgcc gtcgcgcagc ccggtgtgcg    218580
     ggaactcccg gtccccggcg gccgacgcca acaccgtagc tccgctcttc gagccgagtt    218640
     ggtgggcgcc ggagaggaag tcggcgtgca ggtgggtgtc ggcggcgaac gcgacggtca    218700
     acccgcggcg ggcggccgcc gcgtgcaccg cccgcaggtc ccggctgacg tcgaccacca    218760
     acgcccgccc gtcccccaga tccaccaggt acgcggagtt gccgagcccc tcgtcgacga    218820
     gcggcaccag atcgatcccg gccatggcct tctccctgcc tcggctccgt gggcgttccc    218880
     ggacggaaca cccgatccat gttctacact attccaaaga tgattggaga atgctatggg    218940
     tgatcggctc gcgaagacgg aactgttcga tcagttcgcc cgggtcggca aggccctggg    219000
     cagcggcaag cggctcgaac tgctcgatct gctcgctcag ggcgaacgca ccgtcgacgc    219060
     ccttgcccgc gccgccgggc tggggctgac gaccgcgtcc gcgcatctgc agactctcaa    219120
     gcaggccaac ctggtcgcca cccgccgcga gggcaccaag gtgttctacc ggctcgccgg    219180
     cgccgatgtg gcgcagctgt tcgcgctggt ccgcacggtc gccaacgacc acctgcccga    219240
     cgtcgaggcc gccgccgccg cctatctcgg gccggccgac accgaacagg tcagcaagga    219300
     ccagctgctc gagcgggccc ggtccgggac ggtgacggtg ctcgacgtgc gcccccgcga    219360
     ggaataccgg gccgggcaca tccccggggc ggtgtcgatt ccgttggacg agttggccga    219420
     tcacctcgcc gacctacccg aagatcagga gatcgtcgcc tactgccgcg gcgcctactg    219480
     cgtgctcgcc cacgacgcgg tccgactgct gaccgaccac ggccgccgcg cggcgcggct    219540
     gaccgagggc atgctcgagt ggcggctggc ggccctgccg gtcgacaccc cggcctgacc    219600
     acgatccagc cgggcctggc gcctgcgggg tgtcagacgc ccggggtgcc cagcgcggcg    219660
     agcgtgccca gcgacgtcag cgcctcgagc gtttcggcgg cgttcggggt cttctccgga    219720
     tcggcgatcc actgccgcat ctcgccgcaa tgatcgcgaa ggcgggatcc gtccacggtg    219780
     gcgggcccgc cgtggatcat gatcgcaatg cctgtttcca cggccacttc ctggggtctg    219840
     ccgcctcgac gaggggcgcc gcggcatccg cgatgcagcc atcgcgttgg gtgctgacgg    219900
     cgcacccgtc agtttgttgg ttcagatcag tgctgatgac tacgaggtgc tcgatgtcag    219960
     gtaccgcggg ggaagcactt cgaagtgcgc cgggagtccg gtagagccgt cgaaaccttc    220020
     tcggggagcc tcaaagccga acgccccctc gcacgagtga tcgggcagcc cggcctcgtc    220080
     gaaggtgtca cggtgaatcg gatatggcaa gttcgatagc ccagatcgtc ctgctcgggc    220140
     acgaatagga tcgacaccga ccgacctcct gatctggccc tgctgaacgc gccaccgaac    220200
     cgtcacccat ccgaacgtcg ccaccaccgt cacctcgcgg cgcaacccca gtacctgacc    220260
     gatccgaccc gaaccgcagt gaacgaatcg cgggggaagc tgcgggaatc tctgagcgcc    220320
     taccacggtt ggtacctata tacccatggg ggtatatcag aacatcgatt tcgagcgagg    220380
     tgtcgataat gaaggtaacc gacgcgcggc cgcttctgcg ccctccaaac gacgggatcg    220440
     gcgatgcccc gcagatattc gtgattcgag gaccgagtca ggcgaagggt gcatccctcg    220500
     ccgtcgaccg tgacatcact gtgctcggca gccatccgga gtcggaaatc gtgctcggac    220560
     acggaaccgt ctctcgtcga catgccgaaa tccgcaggga gggtggaaag ttcatcctct    220620
     gcgatgccgg ctccctcaac ggaacgtatc tgaaccggca gcccgtcgat tgcgccggac    220680
     tggtggacgg cgacgaggtt cagatcggag tcttccgcat gctctttcgg ctacccgccg    220740
     catcgacgaa ctgacggccg accccaacgt gccggtacac gcgatccacc acaccatcat    220800
     ggcgctgccg ttctgcgctc cgcctggagg tgcgcgccga tcgcgattcc ggcaatgagg    220860
     gcaccagatc cgcgagcacg gtagcggcgg cccaaccgct ggtggccggc ggttcgtgct    220920
     ggtgcccgta gggtccgatc tctggcgtcg tgtctgggtc ggttttctga ctatgggcca    220980
     accccgccgt gagggatgca actaatcgtc caccgacatt ccgtgggcgt gatggggtcg    221040
     gacggtcaac gggagggacc ggccgacgag actgcgccgc agaatcggca gggatgccgc    221100
     gatctgccgg atctgtgtgg cggaggcggc ccggggggcg gcgatcaatg ccgggacccc    221160
     ggcatcgccc gcttcgcgta gctcgatgtc gagtggcacc tgccccagca gcggtgcggc    221220
     gatggcctcg gcgagacgct gaccgcctcc ggcgccgaac agcggagtgc tctcgcagca    221280
     cgacgagcag atcatcgccg acatgttctc cacgacgccg gcgaccggcg ttcgtgaatc    221340
     gagggccatc cggccgaccc gctgggcgac ggtctgtgcc gccggttgtg gtgtggtgac    221400
     gacgatgagc gctgcgtcgg gcacgaactc gagcagcgag agcgtcacgt cgccggtgcc    221460
     gggcgggagg tcgatgagca gaacatcgag ttcaccccag tacacatcgt ccaagaactg    221520
     ctcgattgcc ttgtgcagca tcgggccgcg ccagacgacc ggctcgtcgt cccggacgaa    221580
     gaaccccacc gacatcaacg cgaccccgaa ggcttcgacc ggcagcatca gtcccttcag    221640
     cgcgaccggc gcccggcgca ccccgaacag gtgcgggatg gagtatcccc agacatcggc    221700
     gtcgaggatg ccgacccgct tgccctgctg gaccagggcc accgcgaggt tggccgtgat    221760
     cgtggactta cccacgccac ccttgccgga ggccacggca tacacctggg tcgccgaacc    221820
     cgggccgaac gaatgggcac ccaatggcac ggagccgcgc aggcgtgcgg cgagccgcat    221880
     acgctcgccc tcgcccatcg ccgcgaaggc gacctcgacg ccggagacgc cggcgatggc    221940
     gcggactgcc gcggtgacgt cggtggtgag ggtctccttc agtgggcatg agggcgtcgt    222000
     gagccggaca gtcacccgcg cgacgccgga gcggtcgact tccacctcgc cgagcatccc    222060
     ggcctcctcg aggggcaggt gcagctcggg atcctcgacg cgtgccagtg cggtgcgcac    222120
     gtcggccgga tcgaccttcg cgtcggcacg cctccgcgac aacaggctca tgctcgctcc    222180
     tccgcatcgg gcgatcgaaa ggcgcgtcgg cggggtttga ccggacgcat catgaactct    222240
     ggacggcgca gcccggaccg gctcggtccg ggacgggtgt tgtccatcca ggcccggtac    222300
     acctcacggg accgctgcgt gtccaccacc acatcgccgt accggtcgtc cgcgtgggct    222360
     ctctcgacgc gcaccttctg gtgccagcag tgcatgcccg agaccgggtc gggatgcacg    222420
     gcgaatgcga ggttctggtg caccccgggg tcgtcccagt agatccggtc gctgtccggg    222480
     tcgtcactgt ggaacggctt caccccttcc ttgtagcgca gcctccacac cccgttgccg    222540
     tcgttgccga ggtcgaccag gcccatcacc caccgggacc ccgcgttctc ggacgtgcgc    222600
     caccgcccca tgtggtggga gagccccatg acaccggggc ggatcgcctc ggtggaccag    222660
     acgcgggcca cgaagtagcc gatctcggtg ttgacccgga ccagatcccc cgtaccgacc    222720
     ccgaagcgcc cggcgtccac gctgttcatc cacaggggat gggtgttgct gatctcgttg    222780
     aggtacttgg cattacctga tcgcgtgtgg accagggtcg ggagccgaaa ggtcggcatc    222840
     agcacaatct cgttgttggc ctggtcgatc gagccgtagc tgacatggga ctcgatgtag    222900
     ccgggtgtgg cgtactcctc ccacccgaag tcgaccatgg tgtcgctgaa cagctcgagt    222960
     ttgcgcgacg gcgtgagcca gccggcggtc ctgctgccgt ccgcgtggac gacccccacc    223020
     gcacccgcct ccccgaccag cggcggggtc gaatcgaggg tgacgggttt gcggagcacc    223080
     ccgttgccgt ccggggtcgc cccgtcgatt tcggcgtccg acagtggccg ctcgtcgagt    223140
     cgataggcat ccctggtgac ctcgaagacg ccgtactttc gcatgtactg caagggggtc    223200
     agcccctggc cggcggcagc gtgtggcaga ccgggcacgc tgttctcgaa gacccagcgg    223260
     tagtactcgt cgacggtgac cttctcgccc ggccggtacg gcgactcgaa gtacttccgg    223320
     atgccgaggc tgccgtcggg gtcgatgcgc caggacagct cgaaccagaa ttcgttctcc    223380
     tcccacacct cccccgggtt ggattcacgg gagtcggaca cgggccggcc catcttttcc    223440
     agggccaccc gggtgaccgg ctggcggaat ccgagccact tgccggcgta ctgctcgtag    223500
     gactgggtgt cgtgccgttc ggtgctgtgc cccatcggca ggacgtagtc cgcgaacgtc    223560
     gccgtctccg accacgtcgg ggtgagcgcg acgtggcagc cgacgagcga ttcgtcggtc    223620
     agggccttga gccagctgaa gccgtcgggg ttggtccaca ccgggttgta aacccgggag    223680
     aagtacattg acagcttccc gcggccgtcc gcgagtaggt ggggtagcag gatcgacatc    223740
     tcgttggtcg acagggggaa ctccgccggc cagatcatct cgttccacga ctggtgtccc    223800
     tcggggacgt tggggccgtg ggcgatgatc ttgtcccagc cgttggggct ggtgccgccc    223860
     ttggtgccga cgctgccggt gagcacgttg aggaagaaca gggcccgcga cacctgccac    223920
     ccgccgaggt tgccggacgc cgcggcgcgc cagacgtgtg ccgacagtgc tctgccggcg    223980
     gtggcgacga tccgggctag ctcggcaatc tgctcctcgg gcacctgcgc ctcctgcgcc    224040
     gcgtaggcga aggtgtatcc ggcgtagtcc tcggtcaacg cgcggatgaa ctggtcgaag    224100
     tcgtcggcag ggtgctcggg gtggcggtgt gtcatgtacg tcgaccagtt cacccagcgg    224160
     cggatgaatg cccggtcgat ctggccggtt cggagcaggt gggccgcgac ggccagcagg    224220
     atcgcggcct cgcttccggg ccacggggca atccagaggt cggcgtggga ggccgtgttc    224280
     gacagccgcg gatcgagcac gacgaccgtg gctccgccct cgatcttgcc ctccatgatc    224340
     cgttgcgcgt gtgggttgaa gtagtgcccg gcctcgagat gactggaaat cagcaggatc    224400
     accttcgcgt tggcgtagtc gggcgagggc cggtcgtagc cgccccagag cgagtagccg    224460
     agccgcgcgc cggcggaaca gatgttcgtg tggctgttgt gcccgtctat gccccacgcc    224520
     agcaggaacc gttcggcgaa gccgtcctcg ccgggccgcc cgacgtggta catgacctcg    224580
     tcccggcggt cctcgacgat ggcggcccgg atccgggccg cgatgtcgtc gagcgcgtcg    224640
     tcccagctga cccgatccca ccggccgctg ccgcgcgtgc cgacgcgctt gagcgggtgc    224700
     aggatccgtt cggggtcgtt gacctggttg atcgtcgcgg gacccttggc gcagttgcgt    224760
     cctcgtgagc ccgggtgggc ggggttgccc tccacccttt tgatggacat gtcggacttg    224820
     tccacgtagg cgagcagtcc gcaggccgac tcgcagttga agcatgtggt gggcaccagc    224880
     atgtactcgt gcggcacctt gcgcgggtgc gccttggcgt cgtattcgac gtggtggtcc    224940
     cagttttcga ccggcgggaa gttccgcagc cgttcgtgcg tgcgttcgcc cggcatcgcc    225000
     ggcgatgccg gtgtgcggtt cgtctcggca gtcatggctg gtcccttcgg cgtggtcgtt    225060
     cgttcacgag aggggcgggt cctggcccgc ccggacgtag gccgtctcgt agtccaggag    225120
     agcgacctgg gccagcaggc ccgcgaggac gaggagcacg gcactgccgg acccggtcca    225180
     cgcgggcgcg gccagcgcgg ccgccagcac cgcgggggcg atggctccca gccagaacag    225240
     tcgcgcgtag cggccgtgcg tgatgatgtg cgcggccacg gacgcctggc ggctggcgtg    225300
     cctgctggag tactcgatgc ccagcatcat caggtgcagg cccgtcgaga gcacgaacgc    225360
     gcgggtgagg aaagcgattg cgccactggc gaggtccgcg aacggggcca tgacgaggag    225420
     ggcgccggcg ccgaccattg cagcctgcac gagcaggtgc cagaacagca gcggcgactg    225480
     ccacaggtcg cggccctcgg cctgcccgaa gaggaagccg gtgtagccgg cgacgagcgc    225540
     accgaacggg atggcgagcc aggccagcac ggtctgggcc cagccgatcc cgaggagggc    225600
     ggcgaggatc cacaggaccg cgccgccggc gaaggcggcc agggcgtagg cgccccagac    225660
     gagccatgag gtccagttgg atttcaggaa gatgtagagg aaacgctcgg gacgcttgag    225720
     gtcccagatc agcagggccc cggtggcggt agcgccgaga agggcgacgg cgggggcacc    225780
     gtaatcgccg agccagccca ggtcgacgcc gaggaggtgg gccagcccgg cgatggccag    225840
     cgcgccggcg gccacggcct tggtccacag gtaggtcgtc acccgccacc cccacggccg    225900
     cgggtgcgcg gtgttcagcg tggtgcgcgc ccgggtggtg cggtcgccgg gcagatcgcc    225960
     ggcggtcgcg aggcggtgcg cgtccggttt cgcccacagg taggtgtcgg cgaccggtgc    226020
     ggccagcggg tcgaggacgg cgcggtcggc accgaggtag aagacgttgg gcccggtgtt    226080
     ctgctccggg gagcgcaccg cggtctcgtg ggtgctgatc aagccggcga tgccgctcgt    226140
     cgggtcgtcg aggtcgccga cccagatcga gtgcgtgggg cagaccacca cgcaggcggg    226200
     ctccatgtcg ttgtcgatcc gatgcgcgca caggttgcac ttggctgcgg tgtgggtggt    226260
     gtcgtcgatg tagagggcgt cgtaggggca cgcctgcatg cagctcttgc agccgatgca    226320
     gcgctcgttg tcgaagtcga cgatgccgtc gtcgcgcttg aacagtgcct gagtggggca    226380
     gatcttcacg cacggggcat cggtgcagtg attgcagcgc atcaccccga aggagcgggt    226440
     ggtgtccggg aactcgccgg tgtcgacgta cttcacccag gtgcggaact gtccgaccgg    226500
     cacctcgtgc tcggtcttgc aggccaccgt gcacgcgtga cagccgatgc aggtgcgttg    226560
     gtcgatggcg aagccgtagc gcaccgacct cacttcttcc ggatgatgta gcggtagacg    226620
     ccgttttcgc tggtgcgctc cagcagttcg ttcccggtgt ccttcgccca cgacgggata    226680
     tcggtcctcg acccgccgtc ggtggcctcg acgagcaaaa tctgaccgga cgcgagtttc    226740
     cgggccgcac gcgaggcgag gagcaccggc atcgggcact tctggccctt ggcgtcgatg    226800
     gtgacgtcga tctgataagt cacggcgggc tcccctgaat gcggcgggtc agatgaagag    226860
     gttgatctgg gacttgctca tcgcggacag cgcggtggcg gcaccgacgg gctcgccgac    226920
     accgtcgatg agctggtcgc ggcgcaggcc gagcaactcc atgctcatct cgcacggcca    226980
     caggttcacg cccagctccg tgcacatctg caccaggtcc atcggcaggg ccacattctg    227040
     gccccgcgcc agcttcttca acatccatgg accggcgccg gccatgtgaa gtttggacag    227100
     cttcatgtgg ctcatccccg gccggttcat ccctgccagt gccttggtca tcgcgttggt    227160
     gccggtgatc ctgacatcgt cacgcaccag cgggaacagc ccccagaacg tgaagaaaat    227220
     cgtggtggac atgccgtacg cggcaccggt cgaccccagg atcagcgtcg gccacatctt    227280
     gtccaggtca ccactccagg ccacgatcgt catgctctcc ggcatgacat cgtcatcgcg    227340
     ctgcgggctg tcggacatgc gccggccccc tttctcggct ggctgcccag gaggccccag    227400
     tggagccttc gcgcagacat tgctaactgt gatctagaac actacattcg tatatgcgca    227460
     tactgcaaga tgcctcttcg cgtcgtatcg aacacgcgga tcacccgaca tccgtgcact    227520
     ccgggaggac acatggccga caccatcacc tcgatgggac tgtttcgcga gatccaggcc    227580
     ggtaccgtca ccgagatcct cgacgtccgc agcaccgacg acttccaggc cggcaaggtc    227640
     gaaggcccgc ggcccgtccc cacccgacac gtcccggtgt accgcgtgat ggaggaactc    227700
     gaggagcagg ccgccgccac ccgcgagggt gcggtgatcg tctgcgggca gggaaacggc    227760
     tccgaactgg tcgccgaaga gttcgaggcg ctcggagtgc gcacccgctc cctggcgggc    227820
     ggaaccgacg cctggaaccg gcttctcgtc cccgtcgaga tcaccggatt acccggggac    227880
     gtgcgcgtgt ggcagttcca gcgacccgcg aaggcgtgcc tgtcctacct cgtcggagtt    227940
     cccggcggca acgccgtcat cgtcgacccc accagatctc ccgagcccta cctggaactc    228000
     gcgcaggtcc acgacatggc cgtcacacac gtcgtggaca cccacgtcca tgccgaccac    228060
     atcagtggtg gccccgccgt ggccgcccgg ctcggcgccg agtaccacct gccgccggag    228120
     gacgccggcg ggatcgtccc atttcccaac cggcccctca aagacggcga ccagctcgac    228180
     ctcggctccg ccgtggtccg cgccatgacg atgcacctgc cgggacacac ccccggcacc    228240
     accgcgctgt tggtgagcga gacggtactg ctcgtggggg acaccgtctt cgttcgcggg    228300
     ctcggacggc ccgacctgac cggtcaggcc gacgaactcg cccgcgacct cttccgcagc    228360
     gtgcacgagc ggcttcgacc tctcgatcca cgcacgatca ttgccccggc gcactggtcc    228420
     agcagcgaag agatcaacac cgacggactc gtcaccacca ccctcgacga ggtcttcacc    228480
     gccaccttgc tcaacgagcg ggccatcgaa cgattcgtcg agcagatcgt cagctcccta    228540
     cccgcagcgc cgcagtccta cgacacgatc cgccgggtga acgccggaca gatcaccccc    228600
     ggggacgacg agatcgaagt cctcgacgtc ggacgcaatc aatgcgcggc atcgacctca    228660
     ctgacgggga catcgtgacc agcactcccc gccgaccggc acgccccagg aaaaccccac    228720
     tgcacgaggt cggcgagcat cccgactacc ggttcaccct cgccaacgaa cgcaccttcc    228780
     tttcctgggt ccgcaccgca ctggccctga tggcggccgg agttgccgtc gtacagttcg    228840
     tgcccggccc cacggcgatt cgccacggac tgggcttcgc gctgatcagt ctcggcggcg    228900
     cactcagcgc cgtgtcctac acccactggg aacgcaacga acgcgcgatg cgactcggcg    228960
     aacagctgcc gtactcgccg atgccgagac tggtggccgc gatgctcgcg ctgggatccc    229020
     tggcggcact ggtgctgatc gtggtcgacc tcgtcgagac ctaggtcgca gcgatgaccc    229080
     tgaccggtcg gctgctgccg catcgccgca ggaaggaccc ggccgtcgac gtcggactgc    229140
     aggccgagcg gaccgccatg gcatggcagc ggaccgccct cggcgtcggt ggcgtgtcgg    229200
     cgttgctgct acacctggcc gcgggccgat tcccggcggc tgttgcaggg ctcgccgggc    229260
     tgtccgcctc cctgcttctg ctcctgctgt cggaacagcg gtacgtgcgg ctggtcaaga    229320
     aggtggcggc cggcgagccg ccgccggccc ccggcctcgt acgcctgctc gcagccggtg    229380
     tcgtcatcct cgcggtgtcc gccctggcgc tgctgctcct caccgacgcc tgaccgagcc    229440
     ggcgcgcggg ccgcacctat aatcagcttc cgaggcccgg tttggagggg tgatggacca    229500
     agacatcgcg gcacaactgc aagaactcca cgcccgggtc tgcaaagcca ttgccgaccc    229560
     caagcgcctt ctcatcatca acgaactacg cgaccgtgaa ctgagcgtcg gagaactctg    229620
     cgaggcaacc ggcctcagcc agtccaacgc cagccagcat ctgaccatcc tgcgtgaacg    229680
     aggcatcgtg acgacgcgcc gcgtcaagaa caacgtcttc tactcgctac gcagccaaaa    229740
     gatcgtgcag gcagtggatc tgctccgcga gttcctggcc gaggatctgg ccgaccacgc    229800
     agccttggac ggcgccatcc gaggctgaca ccgcaggact cggaccagcg gccccgtcgc    229860
     acccgcgccg gcagggcgtg cactgaaggt gccgcgcagc aaagccgcag gacgcaggac    229920
     gcaatggtcg ccgaattcgc ccctgcgccc gcggaatagt cggctggcca gccggcacct    229980
     gcccggcgtc ggttgcgcac cctcgccccg gccctaccga acaccggaag cgcacgccgc    230040
     gtccttgatc ggtgcccgac caggctgcgc cacccggata cacacaccac cgtccccgcc    230100
     gatgccggca gcggcgagga attcacgtcc gccgagcggc ctcggcgcgc ccgcggcaca    230160
     cgggcctgcg cggattcgtg ttttggcgcc ctacgtgatt gatgtgccgg ccgcgcgacc    230220
     gagcataccc cccggggtac ttgcataccc atgggggtat atggcagtct gtacacaagg    230280
     agaaagatcc tgccaacctg gaggagacca cgatgattct cgagcagtac tacatcgagt    230340
     gcctgtccca tgcctcgtac ctgatcggag acgaatccac cggacgagcc gtggtggtcg    230400
     acccgcgccg cgacatcacc gagtacctcg acgacgcccg cacgcacggg ctcaccatcg    230460
     acggggtgat caatacccac ttccacgccg acttcgtctc cgggcacctc gaattggtcg    230520
     aggccaccgg cgcctggatc ggcttcggtg aagccgccga aaccgactac ccgatccgtc    230580
     gcctcgcgca cggcgagcac atttccctcg ggcgggtcga cctcgagatc ctctccaccc    230640
     ccggccacac ctgggaatcg atcagcgtcc tgatccggga aaccccggac gccgacccga    230700
     ccgcggtcct gaccggggac tcgctgttca tcggcgatgt cggccgtccc gacctggtca    230760
     acctcggcga cggctccacc acggacctgg cccgagcgat gtaccacacg gtgcacgaca    230820
     cgctattggc cctgcccgac ggtgtgacgg tgatgcctgc gcacggtgcc ggctcctcct    230880
     gtggcaagaa cctgtccacg gagctgacct cgaccatcgg cgaacaacgg cgcaccaatg    230940
     catcggcgca gccgatgagc gaagacgcat tcgtcgcgtt gatcaccgac ggccagcccg    231000
     cggtaccggc gtacttctcc gtggacgcgg cgctgaacaa gtccacccac cccgcactcg    231060
     accagcatcg ccggatcccg gaactggccg ccgaccaggt gcgcgctgaa ctcgccgccg    231120
     gcacccgggt gctcgatgcc cgcaccgtcg acgacttcgc cgccggacat ctgcgcggtt    231180
     cggtcaacgt cggcttcgac ggtcggttcg ccgaaaccgg cggcatggtc gccgaggtcg    231240
     gcgagccgat cgtgctgatc acctacccgg gcgaggaaca ggacgcggcg atgcgcctgg    231300
     cccggatcgg ctctgacaac gtgatcggct acctcaacac cggcgtcgat ggctccttcc    231360
     ccaccgcact caccgacctc gtccagacgg cgccgcgcac caccgtcacc gaactcgacc    231420
     ggctgcgcgc cgacgatgcg atcatcctgg tcgacatccg caaccccggc gaacgcgact    231480
     tcggcgtcat ccccggtgcg atcccggtcc cgttggcgca gttacggtcc cgcgcccacg    231540
     agctgccgac cggcaagccg atcgtggtgc actgtgccgg cggatggcgt tcgagcgtcg    231600
     ccgcgtcgct gctccgcgcc cgcggtatcg agcaagtcag cgatctcgtc ggcggctaca    231660
     acgcgtgggc cgcacagcag gtgccggcct gacgctccct cgatagacac ccccacggaa    231720
     aggatccctc atgaccacca agaacctcac ccacacggac ttcgcatcca cgatcgccga    231780
     caacgccatc gtgctcgtcg atttctgggc gtcgtggtgc ggcccgtgcc gggccttcgc    231840
     gcccaccttc gaacagtcgt cccgcaggca ccccgatgtc gtgcatgcca aggtcaacac    231900
     cgaagccgag cagcagatcg cgtcggccgc ggacatccgc tcgatcccga cgatcatggc    231960
     attccgcgac ggggtgctcg tgtattcaca acccggagct ttgccgcccg ccgccctcga    232020
     ggagttgatt tcccagatca aggaactcga catggccgca gtacacgaca cgctcgcacg    232080
     acgacatgcc gcagcggggc aggcatagcc gtcattcccg gggatcaccc acgccgacac    232140
     gatcagtgag atgaattgcc gcccatgccg tcccgataca tcgccgaaat cttcggcgag    232200
     cagaccgatg acggtacgcg agtctcgacg cgatccccca cggccgaatc gcactgcacc    232260
     ggcgtggcca cctgccggac ctgcgcggcg atctggatcc cccgatcggt ggacgtcgct    232320
     gggaggagcc tgctcgcggg catgtccccg ggtcgaggag cctgctcgcg ggcaatgtcc    232380
     ccgggtcgcc ccggggacca acggccctgg cgcggtccgt ggtcccctgc caccctgaca    232440
     aggaggagca gggacctggt gccgcgccgg aggaggggca ttcgctgacg acggtaagtt    232500
     cgcccgtccc gtgccgtgcc ggaccccgag ccgacgagat cgataccgaa cgggaccacc    232560
     caatgatcgg aggtagagca tggactacgg caaggccgtc caacaggaac ttcggggacc    232620
     cgcccgggca ctgcgccaag cgatcccgca ggtctatgcc ggttacgggc agttgcacga    232680
     agccgccctg gcacccggag ccttggacgc caagaccaaa gaactgatcg ccctggcgat    232740
     cgccgtgagc aagcaatgcg atggctgcat cgccgcacac gcgcgcggcg ccgctgagca    232800
     cggcagcaca ccacaggaag cagcggaggc aatcggcgtc gcgattctga tgaacggtgg    232860
     gcccgccacc gtgtacggcc cccgagcatt cgccgcgttc aacgagtttc acaccgatca    232920
     ggaccccggc cacgagaacg atccggccgg acgatagttg gaatcacagc gctgcccggt    232980
     tcgtcgcccc ctgcgccgtc ggccgctgca acagcgcgca tcgccctcga cccggctgta    233040
     gccgatgcgg ggtccatggc aggtccgggt ccacctcgtc caccccgacg ttcggcggct    233100
     atctcctcat gccacccgaa cctgccggaa acggtgctcc gcgccttccg gtgaggacgg    233160
     ccgtcttggg catgcggaca ctagtgaaat cgtggacacc ctcccgcgcc acaacgccgc    233220
     cggaatccgc gaccagctca cgatcccctc acctgaccgg cgcttcgcca tgcgacgaga    233280
     ccatcgtcgg aaaacacggc tgtcaacaca acgggcggcc acggcactct caacctacag    233340
     atccgcgcac agatgccaac accgccgctt cccgccgagc acctactgag cggccggccg    233400
     tcctgagaca ttgtgtgcca tcgcggatcc ttcgaccgcc ggaacccgga tcccgtgtcg    233460
     ctcaactgcc ttggaagccg aggcggaaga aaccggcgcg ggacagctgt ggtcatgccc    233520
     acacttcccg ataaactata cccctagggg tatagttcag gtcgttacga gcagcggtat    233580
     ccgaggagga ccccaccatg tgttatccag ttacgtgccc cgactgcgga aagaccacct    233640
     ggggaggctg cggtgcacac atcgacggtg tcatgaaggc cgtgcccgaa tcccagcagt    233700
     gcacctgcaa gggcaacgcc gctcccccgg ccacacccgg attcttcgac agactcttcg    233760
     gccgctgacc gcacgacaca tccacccaac caggagacct tgtcgtcctg ccggccaccg    233820
     cggaggcgag gacgccgtcg acgagaccca gggcccgtta gcggagtagg gcgtcggccc    233880
     gctcgtcgag atcgatatgc aggccggcac gacggcgagg ctcggcgggc cgagcgggtc    233940
     aggcccaatt ggccgatctg actgcacgcc accctgggac gtcgtcgtgc gcgagggccg    234000
     tccaccgagc gcaccaaccc ccgctggagg cgcgcccgca gatgctggca cgtggtcacc    234060
     gaggagctcg cactcgcatc ggtggtcaga gaagccggaa cgcgccagcg gtgcgcaccg    234120
     acgtcgccag tgcccgccac ccgaaggatt cgtactgata ccccccctgg gtaatttggt    234180
     cgaaaaatgt taaatacccc ttagggtatg aaaggttgtg tcatgcgtga gatcgagatc    234240
     gatgaattcg ccgatgcgtg ggcggcggga gcacccgtcg tcgacgttcg ggagccgtgg    234300
     gaataccgga atgcgcacgt gcccggcgcg cagttgctgc cgctgggaca gctcggcgac    234360
     cgggtaacgg agatcccggc cggcgcggtg gtgtacgtga tctgtgcgtc cgggaaccgg    234420
     agcgtgcagg gggcacgaat cctcatgact gccggacggc ccgcggtgtc ggtggccgag    234480
     ggcacctccg ggtgggccgc ggcgggccgg cccctcgaca ccggtgaaga cggctcatgc    234540
     cccaccgctg atcgtcccgc tcccgcccct gtatcgacca aaatgttcct ctcagatcgt    234600
     caaggagacc gcggatgacg cgcagtacca ccctcgacgg cggccagccc acgaccacga    234660
     ccacgaccac gaccaccgcc gagagtgggg tgctgggccg catcggcgcg gtaatggcag    234720
     gccgttcccg atgggtgttc ggggtgtggt tgctcctgct ggtcgccctc ggtgccgcgg    234780
     ccccctcggt gttcagctca ctggccggcg ccgggtggca ggccaacgga tcggagtcgg    234840
     tgcaggttcg ccagctcgcg gagcagcatt tcgggggcaa ttcctcggcc gcggtacagg    234900
     tggtcgtgca ctcggacacg cagaccatcg acaaccccag ggttcaacag accctcagcg    234960
     acgtgggcac cgttttcgca ggtgacccac gattcggtgc gctgatcgcg ccgcatccgg    235020
     gaatgtcgat cagcccggac ggtcacaccg gaatcctcat cgcgggcgcg aacgcgagca    235080
     ccgatgacat ggtcaaggcc gtcgacgaac acaaagcgga actgaccgcc ctctccggtg    235140
     acggaatcga ggtctacccg accggcgcat ccgcactctg gagcgacttc aacaaggcga    235200
     accacgacgc gatgattcag gcggaattgt tctcctggcc ggtgacattg gcgatcatgg    235260
     tgctcgcgtt cgggtccctc gtcgccgccg ggctgccgct gctgttgacc ctggccgggc    235320
     tcgtagcctc ggcaggcggc ctggtgttgc tcaaccagtt caccccgatc tcggtgtggg    235380
     cgatgaactt cgccatgatg ttcgccctcg ccctcggaat cgattacgcc ctgttcatcg    235440
     tcgcccgctt ccgtgatgca atccgtcacg cctcgtcgcc gcgtgccgcc gtggccgaga    235500
     ccatggacac cgccgggaag gccgtggtgc tgtccggaat cacagtgcta gtcagcctgt    235560
     ccgccgtgct cctggtgccc gcgccggccg tgcggacgat ggccgtcggg atcatgctcg    235620
     ccgtgttctt cgtccttctt gcgtcgatga cgcttctccc cgcggccctg ggcgcgctgg    235680
     gcggcaaaat caacgccggc tccctgccct acgccaaggg gcagacacac cgttcgccgc    235740
     ggttcgccgc ctggggcgag ctactgcatc gccacccgtg gccgttcgcg atcggctccc    235800
     tcctactgct gatcgcgttg tcggtccccg cgctcggact gaaggtcgcg atgccctcga    235860
     tcgaggtggt gcccaccgac gccccggtcc gccagggata cgaactcgtc caagcccaga    235920
     tgggggaggg cgcgccgggc atgctgcaga tcatcacccc caccgcggag agcgcggaga    235980
     ccgcgacgac ggccgccgcg accgacggaa tcgccatggt cacccctccg ctgcccgccc    236040
     ccgacggcgg tgactacgtg atgctgcacg ccatcccgac cgtcgacccc tccgacgccc    236100
     gaatgggcac gatcctcgac accctacggg cggacctacc cgacggcgcg ttggtcggcg    236160
     gcgcacccgc ggagaatctg gacctgcagc aggcactgaa cgactacctc ccgctgatcg    236220
     tcggcatcat cctggtcctc ggattcgcgc tgttgctggt ggcgttgcag gccccgctga    236280
     tcgcgatcct cggaacggtg gtcagcctgc tctcgaccgc cgccgcattc ggggtcgcga    236340
     agctgatctt ccaggacggc cacggcgccg gcctgctcgg cttcaccccc cagggcttcc    236400
     tcgatggatg ggggccggtg ttcttcttcg ccatgatctt cgcaatcgcc atggactaca    236460
     ccgtgttcct gctggccacc gcgaaggaac actacgaacg ctccggcgat ccgaagatcg    236520
     cgcacgtcga cggcctggcg cattccggac gggtgatctt cgccgccgcc gcggtgatgg    236580
     tcgccgtgtt cttcaccttc gccctcgccg acccgctgcc cccgaaggag atgggcatca    236640
     tcctcggcgt cgccgtcctc ctcgacgcgg tgctgatccg gctgatcctg ctgccggtgc    236700
     tgctgaggtt gaccgggcac gccgcctggt ggtcaccggc ctggctgcgc aaggtcctgc    236760
     cgaagatcaa cttctcgcac tgagagaaag atccgagagg tgggccaaag cacacggcac    236820
     gcacccgcgc gccaataccc ccgggggtac agtagtggga ggtctaggaa aggaaaccgc    236880
     catggtcggc gacgaagaca gcattgcatt ggtactcaac cggctccgcc gggcccacgg    236940
     gcaactcgcc ggagtgatct cgatgatcga gcagggacgc gactgcaaag acgtcgtcac    237000
     ccagctcgcc gccgtttccc gggccctgga caaggccggg ttcaagatcg tcgccaccgg    237060
     actgcgggaa tgcctcaccg gggagaccga ggaaggtaag gagccgatga ccgaagccga    237120
     actcgagaag ctctttctcg ccctcgcgtg agcctcgcct caccccgtcc tccgttcgac    237180
     gtcgacgaaa ggtgaccatg agcgacgcac tccccgcccg cggctggacg atcgagcggg    237240
     tggtcccacc gctggccgga atggtggtgc tcgcgagcat cgcactcaca ctggcgttct    237300
     cgccgtggtg gctgctgctc accgggttcg tcggggccaa ccttctgctg ttcggcgcgg    237360
     tggggtggtg cccggcgagt ctgttgctgc accgcctcgg agtgccccgg ctcgccgctc    237420
     cgcgccccgt cccgtcgggg cgatgaccgg tgcacgccgt caccgatcag cccattgctc    237480
     cacagaaagg cagaacacgc tcatgacact cgcactgtcg accaccctgc acacctcgtt    237540
     cgccgacgcg gtggaccgca ctcgtcaagc cctggccgag cagggtttcg gcgttctcac    237600
     cgagatcgac atgaaggcca ccctgaaggc gaaactcggt gaggacatgg aggactatct    237660
     gattctcggg gcgtgcaatc cgccgctcgc gcaccgggct gtcaatgtcg accggcagat    237720
     cggactgttg ttgccctgca acgtcgtcgt gcgtgccgac cccgccgatc ccggtgtggt    237780
     gctgatcgat gcgatgaacc cgcaggtgat ggtccaagtg gccgaccaac ccggactcgg    237840
     ggcggtcgcc gacgacgcca ccgccgcgtt gcaggccgcc atcgactccc tcgaccgcgg    237900
     tgccggcgac cggtaaccaa acccggaccc gcgcacccgg ttggaggtga aaggagttat    237960
     gtggacataa cggtcgcact tgcgctcgga gcgatcatcg gtgtcctgct cggcctcctg    238020
     ggcggcggcg gatcgatcct ggccgtcccc gccctggtct tcggcctcgg tctcgacctc    238080
     gaacaggcca tcccgatctc cctgctggtg atcggtgtcg cctccctcgt cggagctgta    238140
     ccgaaaattc gtcagcacca agtgaactgg cgcatggccg gggtcttcgc cgcctgcggc    238200
     atcccggcca ccttcgccgg cagcgcgatc gggcgcctgc tgccgcaatc ggtggtcatg    238260
     atcggtttcg cagccgtgat ggtcgtcgcc gggatccgga tgctgatgga tcgaggcgac    238320
     accggcaccg cctgcgacgt cggggactcg gggatcgact ggcgccgctg cgccccccga    238380
     tccatccccg cggggatcgc agtgggattt ctgaccggcc tgttcggggt cggcggcggc    238440
     ttcctgatca tccccgctct ggtgttgatg cttggccttc agatgtcggt cgcggtcggt    238500
     acctcgctgg tcatcatcgt cgcgaattcg gcggccggat tggtctcgca tctgagcggc    238560
     gcgagcatcg actgggcgat caccgccgcg ttcgcgggca ccgcgatcgt cgggtcgctg    238620
     attgccggtc acttcggcac cacggtcgac accgaccggc tgcagcggtg gttcgcctac    238680
     ctcgtcttcg tcgtcgccgc ctacgtgctg atcgacacga tcttgctgcg ctgaggtccc    238740
     ggccgccgcc caccacaccg tttcgcctat gccctcccgg gtatgcgaac accacaagag    238800
     catgtgagga aggtacgagt catggacgtg tcgatcatcg agacctccgg tctgggcgac    238860
     cgcagttacc tggtcagcga cggcgccgtc gccgtcgtcg tcgacccgca acgcgacatc    238920
     gaccgggtct tggacctggc ccgtaatcgc ggcgtgcgga tcacccacgt cctcgagacc    238980
     cacatccaca acgactacgt caccggtggc ctcgaactgg cccgcaccac cggcgccgaa    239040
     tacgtagtcc ccgaaggcga cgacgtcggc taccagaggc gggccgtcgg cgacggtgac    239100
     atcatcgacg ccggacccat cctcctgcag gtcatgcaca cccccggcca cacccaccac    239160
     cacgtcagct acgtcctgcg ggagaccacc ggcggcatcc gcggggtctt caccggagga    239220
     tcgatgctct tcggcaccac cggccgcacc gacctcctcg gcccagagca caccgaggaa    239280
     ctgacccacg cgcagtacca ctcggtgcgg cgcctcgcgg gcgagctccc cgccgacacc    239340
     caggtctacc ccacccatgg gttcggcagc ttctgcgccg ccaccccggc caccggggac    239400
     tcctccaccg tcggcgagca acgcagcacc aacccagccc tgacccagga cgaacaacgc    239460
     tacgtcgacg aactgatcgc cggtctctcc gagtatccgg cctactacgc ccacatgggt    239520
     gtaatcaaca tccatgggcc ggcgccggtc gacctgtcgc tgcccacacc cgtcgacccc    239580
     gacgagctcc gccgccgcat cgaggacggg gaatgggtgg tggacctgcg taagcgcacc    239640
     gccttcgccg ccggccacct cggcggcacc ctcggcttcg agctgtcgga ctcgttcgtc    239700
     acctacctcg gctggctcta ccagtggggt gcgcccctga ccctgatcgg cgagaacgaa    239760
     gaccaagtcg ccgacgcccg ccgcgaactg gtccgcatcg gcatcgacga cctcaccggc    239820
     gccgcggtcg gcgaactcca caccctcgcc gccggcaccg aactgcgctc ctaccgggtc    239880
     gccgacttcg ccgccctcac gaaggcactg cccgagcagg acatcaccgt cctcgatgtg    239940
     cgccaacgca acgaatacga gacgagccac atcgacggag caatcaacat cccgctccac    240000
     gaactcgccg accgcctcgg caccctgccg gagggggaaa tctgggtgca ctgcgcgtcg    240060
     ggttaccgcg cctccgtcgc cgcctcgatg atcgaccgac ccgaccgcac cacagtgctg    240120
     atcaacgacg actacgacaa cgcgatagac atcgacatca cgagcacgac ataggtttcc    240180
     gcgcacccgc gggcggggcc ctgggcactt ccacgatgtc ggggtacacg acagcagacg    240240
     ccgacgggag gatagacgac atggtcgcac ccgaacgtga gacgaccgcc acccccaccc    240300
     gcgggatgcc cggcatcgga atcgacctcg gcggcttcgc cggcggatct gcacgatcgg    240360
     ctaggcgcat gtccccagaa gggtgcgcgg aggtggcgaa ccgcaacaag aggtgcggtt    240420
     cgtatgagaa cgggccaagg tccacgacac gggcgcgaga tgagcagcca cgctcacaac    240480
     agttggcctc tccctgcttc cggaccgtga tgtcagtgac cggcacccat ctgcccgctc    240540
     aggcgcacgt gccgttcaaa ggacatcgag ggtcgcggcg gtggaggcgt cccagatgtg    240600
     cgagtcggac aggtctatga ccacgtttgt cgggtccccg acgtagtcga ctggtagacc    240660
     aagtcgtcgc tcgaggcgaa aaacaactct ccccgcacct tgtagacgcg ggtgtcctca    240720
     gccgggtggg ccacgtcgac gacctcggtc aggtgtgcga cccggcgggc gaagagcacc    240780
     atcgcggtga tgacgccgac gatgacgccg taggcgaggt tgtgggtggc gacggtcacc    240840
     gtcttgcctg acgcctaccc gataacgcct cgcccggcag gggctcgtcc gctcgggcgc    240900
     tcgggccgca cgcttggatg atggatgggg actgtctcgc cgcggcaagg gttacggcga    240960
     cgtgcagttt ctctctccac cggccgcgga gcaccgcaag gacgactccg tcggctccga    241020
     cacctccggt gtctgtatcg agcgacgacc tcacgtcgaa ctgagacacg ccttcggcag    241080
     cgattccggc cagtgccatc catccgaact ctggtggttc cttcgcgacg gacggatcgc    241140
     cggattgatg gaccgacgtg ccggaaacct tcgccgccac ggtgaccgtc accggcgaag    241200
     ccaacctggc atcggccgaa tcggtagcag tcgcggaact acgcaagcgg cgccgaggag    241260
     gcggagtcac ttcgtcggtg ggccgaggtc gcggaaggat tcggggtcaa gggacgacga    241320
     tcagctttcc gacatgccga cgctgggcga gttgtgcctg ggcttcgcgt accttcccga    241380
     ggggaaaggt tgctgcgacg acgggtctga cctcgccacg ccgcgcgatt tccaccaggt    241440
     ggtcgaagat ccgtggcgtg tgcatggtcg agcccaccag agagagattg gcgaggtaga    241500
     gctttcgcac atcgatgtcg acagaccacc cgccgagggc accggcgacc acccagcgtc    241560
     cccctgtcct tagcaaactg aggccggggc cgaggactgc gccggcaacg acgtcgacaa    241620
     ccgcgtcgta tccctccggt gctgcgccgg ctgcgtcggc aagcacctga ccccctctcc    241680
     ggtccaccac ggcgtcggcg ccggcgctgc ggacagcctc ccccttgtcg ctgctgcaca    241740
     ctgcgacgac ccgagccccg cgggagtggg ccaactggac cgcagccagc ccgacgccgc    241800
     ccgaggcacc cgtgacgagc acagtgtgac cctccgagac ggctccgcgg tcgagcatgc    241860
     ccagcgcggt gccataggca atcggaaggg cggccagttc cacgtctgtg aggggcgact    241920
     cgtcgacgga gtgggctcgt gtgctcggca ccacgacgta ctcggcgaac cccccgttcc    241980
     gctcgctccc gagcacgtcg gccgggcgag cgtctagtcc cgggccgtcg tactcggccg    242040
     ggtccaccag cacccgcgcc ccgatcggtc cggcggctgc cccatcaccg gaagccacca    242100
     ccctgccggc cacgtcggcc ccctggatgc gtgggaagtc gagcggaccg agccatcccg    242160
     tcctgacgtc cggatcctct gccgccccgt aggagccctc gcgggtccaa agatcggtgt    242220
     tgttgcaacc tgccgcgtgg acccggacca agacctcgcc cggcccaggg cgaggcacgg    242280
     gcacctcacg ctcctcgatc acatcaaggc ctccgtggcc ggtgatgacg acggcacgca    242340
     tggtgcgggg aaggggctgt gtcagcaatc cggacggtgg cggggaggtc tgtgacatag    242400
     aggcaggatc gcatgcagcc ccgtctaccg ctgctcatcg gcacggctcc cggccgcgga    242460
     cgtggtgctc ggacgagtgc cgcaaactcg cctcggagga acgccgggcg gccgagcgcg    242520
     gtgttgtgtc gtcgcggtgg agctgcgcga gcgggtggtg gaggtcgcgc atagtggccg    242580
     ccgatggtga cgactctgca cgcgccgcac cggccgcccg cgaactactc gatgcggatc    242640
     cacggcagcg accgtcgtcg cggcaggagc accggtctcc tacacgtatc tgatcccggc    242700
     attaccgctc cgcggcacct aaatagcttc gctcgaactg acacgaaatc gagaaactga    242760
     caccgatcga cgatcgcgag aatctacacc aacttcactg agccaggacg cgtcaggagc    242820
     tgtcctgact ccgtgatctg atgccgcctg tcctgtgaca gaaaatcttc ctttttgcca    242880
     atgaatcttg cttatcccgg ctgtctcgcc actgtagttt gctcggttcg agttcacccg    242940
     accctggccg gcaggccagt tcgcagggcc gatgcgaatc accgcagcct gccgacggtg    243000
     catgagcaga aggcaacaca cgccggttca agcaagattc actggcacac agcgcccggc    243060
     ggctatgtca ccaacccccg aaacgctgac aggcacaccc gaatcccgcc agtcaaaatt    243120
     cctcggccca ggtcacagct ccacaccgag gacaatcccg tgtcaccgga caccgccgac    243180
     ttgcggtgcg tcagattgtc tgagccgcaa tgttcgactt cacctcactg aatctgatgc    243240
     gcgtggaatt tgttggcgtg ccgcccgacc ggttgcacgt ggcctgagtc ccgacgcacg    243300
     agggcgtcga ccgcgaccag ggaaccccgc atcagattca ccgagtcagg catcagatcg    243360
     accgtcggcc gcatcagatc tgctgagtcg gcatcagatg cactgagccg ggacactcat    243420
     tgtcctggct caggggatgt agcttctcgt tgaagcgttc ggattctcat tgaaagttcg    243480
     tgcgtcgttc ggattcgaat gattgctgag aatctgcggc ggccgccacc acacacccca    243540
     gcaagtgaca ctcgcctacg cgaccgcggt caaagccgtc ccgccctggc cggcctcgac    243600
     gaccgccctt cctcaccact ggcgataccg gctgctccgg ctacagaccc gcaaccacta    243660
     tctcggcatc caaactgatc acgacagctt cacccacgca gcgatctacc ccgacaccgt    243720
     cgaactggcc gcacagatcc tcaggcccgc caaccagcac acgccgagaa gaagtcgaac    243780
     gaaccgtgag aagtagacgc cgaacagttg atgagaatcg accacaaacc cccaggacag    243840
     accacgaaaa gtcgaacttt taggcgggaa cctacagggg atctggcgag atcgcagagg    243900
     ccgcacctgc tcttcgccag gtctattgag ttggcgcggc gacttcggac ttaaagagtc    243960
     tggcgagcat ggaactcggt gcctcgattc attcccgatc gcggggtgac cacctcggat    244020
     tcgccaggtt cgctgagccg tccgccagat agaccgccgc actcgccgga tttgtgaagt    244080
     gacaccgaag atgtccaatc ggaccaggta gttttccaca gcgttgctgc tggaatgccg    244140
     ttcggtttgc caaataacct gtccaacgat cgaaaatcgt tggtctccgt gcgcgtcgcg    244200
     tcagtgacgt tgtccaacgt ggaagacccg ccggagccgt cctcgtgatg ggatgagggg    244260
     tccggacctg cggcgatgac agggcagcga gcgcggtcgg gcttttcacg agggcggtca    244320
     tcagcagctg gacaacccgt aggcacgatt ggacaagaag gttgtcaatt ggacaacctg    244380
     cctgtcacgt cacaggattc actgggtcgt cgccaccttc accgagtcag gacactcatc    244440
     accgcgtcac tcatcatttg tgcgcactcg gcgacgataa tttcagttat cgcaccgccg    244500
     ggcccgaaat cccacgtcac tgcgttttgc tctgcaacgt gtcccgtcgc ctctgcccat    244560
     cgaaagtggt tcgattgccc gcgtcgtcac agtcaccgga tcgggtgata ccggtaccat    244620
     cacggccgtg atgcggatga tgatacgaac caggaccggc gttcatggct gacctgcgcg    244680
     acgcggagcc gggtgccgat gccgcgcttt tcgccccgca ggagacgacg cttgccgagt    244740
     tgatcgcccg cagcgcagat ttgaagagcg agttggtgga gttcgtccag catcgccgtt    244800
     tcgaccggca gttgaccgcc ctgctgcggg acgcggccga caccggcccg ctcgacgagg    244860
     ccatcctcgt ccgcaccctc gatcacttcg ccctcgagta ccgcctccgg gacggcggca    244920
     cggtggtgga acggttcgta gcacagcgcc gcccgccgct gaccgacgac gagcgcatga    244980
     tgctgctggg gtggcgcgac gtcgtcgagg gctacttcga ggtccacccg gcagccgacg    245040
     acgacctcgg caccgccgtc ctccacaacc tcatcgacga cctgcactac ccggtgcact    245100
     ccaacaccgg ccccgaggtg gtcgccgcac tgcagcccgg aatgttcgtc tactgccgca    245160
     tcgtgcccgt ccaccccgcc accggacact ggctgatcag cggacacctg ctccccttcc    245220
     cctcgtcctc cggcccggtc ctcgcacagg ccgcacagga agtgctcacc gccgacccga    245280
     gtctgctgcg ccgcaaccgc ggcctgtacc aacgggcctg gcagttacag gccgacgccc    245340
     gtgccgcatt cctcgacttc ttcgggacag atctggtgat cctgccgccc gccactgccc    245400
     aggaacagct gatcgagtac caccggcacc acctcgcccg gatcgccacc accaccgagc    245460
     cccacgacac acccaccagc ccggcggcgc cacacgcgct gaccgccgag cagatgggcc    245520
     gtctgcccga ggactacctc gacgccgaca gcgtcggatt gatctacgac gagaccgagg    245580
     gcctcaacta ttaccaagat ttcggccagc tggacacgat gttctccgat cccgcgctgg    245640
     ccggcgatca cacccacatc gccctactgc gcgcctacct cgacgacgac acggtctccg    245700
     ccctgccgct gcgccgactg gcccaacgcc accccgccgg cgtcgatccc gttttccggg    245760
     ccctgctgcg aaggcccaac ttctcctggc accacgacgg tgaagacctc ctgcgcaccc    245820
     gcaagacgga atacttccaa cgagagacgg cgcccagctt caccgtcacc ggtcaacgcc    245880
     tcgccgaact gctctacccc agccaatgag gacggcaccg tcatccctgc ggtgatgacc    245940
     tcgtggacca tccgaaccct gggacgagat ccggcgcgcc ttcgccagcg acgacccaca    246000
     cggcaacgcc cagccgacga ccaccgacga cccgcgacgc ggccgactcc gtgatgccgc    246060
     gcacccgttg cccgcgacga tcggtctcac cacgggcgtc gggaatgtcg cgcagtccgc    246120
     gcgaacctcg ccggacacga tggcgagaat ccccggtcgg cgaatcggga ggtgaccggt    246180
     tcgtcgcgaa cacacaaaca gtgtcggttc cgagcatcgg tgtcagtgca gacttcctcg    246240
     cccggtggtc gggagttcgg ggtgccctgg caccccgaac ctgcccgata ccagcggggc    246300
     cgaggtcagg agacgggtgt cgacacggtc ctcgacgagc ccttgacgat ccgggtgcgc    246360
     aggctggact gcaggggcca ccggggatgg aactccggtt cgcagggcga gatgggcacg    246420
     ggaccgcccg tcctggtcgg tgtcgggtac ctcctgcagg gtgctcgtct gcgatctgcg    246480
     tcatttcctc gacctgcccg gcgaggctcc cggccctgcc cgccgtctcg ccgagcagtt    246540
     ctatgacctg gttcgggcgg ccacggccgg tgagaccggt gtcaattggg tgagcgcgct    246600
     gccgtgccgg cgacgtccgg gtaaccgccg ctgcaccggc cggatgatca ttctgcgcgc    246660
     cgatcccccg aaccgatcgc gtggaaatgc gacgcctgcg gcgatgcggg gcgaatcagt    246720
     gactgggcgg actccccgtt cgacctccgc cgtcgacgat cgaccccgac cggcccggtg    246780
     cgccagctcc gcatccccga cgacgtcgcc gcgacacggc gcggcatcgt gctgctcgac    246840
     accgactgcg aacgcgtcgt ctaccgcgcg tccgtccagg gcgacgacct cagcctgccg    246900
     gccggcgacg acgagatcga ggagctgatc gggtacgtgg ccgccgacgc caaccatgaa    246960
     ccgaaccggc gccgccagcg cctcgacgcc gcgttcaccg tactcagtga ggcagccgag    247020
     aacccgcaca gcccaccccc gaccctggtg gccgccggcg acagtaccgg ccatgtgccg    247080
     ccgcggccgg gaccggcggt tcccggttcg ccggagctcg atattgggcg ggtgcagcgg    247140
     tggtgcggtg cccgcgtgcc cgagcacgcc cgccatcagg tgcgcctcga atgtgagatc    247200
     gcggcgcggc acctgaccat catcgagcgg cgcgccccca tggagcgacg acgtcggacc    247260
     ggagtggacc agcctgccca tcgcccggct ccgctacatc aaggccacca agacctggag    247320
     cctgtactgg cgcgaccgca atctccgctt ccacgcccac gaccggctgg cgccgtcgcc    247380
     gcacctcgaa cccctgctga ccgaactcga ccaggacccg acatcgatct tctggggctg    247440
     acgaacccca ccggggctgt ccgatgacgc ggcgccacaa cggataccag gccggggcca    247500
     ccggcaccga cccgcggcgc ctgcactggg cgccacgaga aaagtcgacc agcggtcgaa    247560
     ttccattggc cggctaaatc cagtcgatgt ggaccgaatc gatgtggtcg aagtggaagc    247620
     cgaactggtc gctgtacttg tcgaagccct tgttctccgg gtagtcgagg gtggcgtgcc    247680
     gctcgagcag tgcgacaacc cgggcgtgat cgtcattcgc caacgcggcg gccagctcgc    247740
     gggactcctc actggtgaac ggggtatccg agttcgcgaa atccagggtc cggacccggt    247800
     agtcgtagcc ctcgtcggca ccgttgcgga ccatcacacc acccttgacc cggataaccg    247860
     ccttcttcgg ggtaccgtcc gggcgcaaca ctccggcccg tttcatgatg tcctgcgcct    247920
     tcacgttttt gagcttcttg ctggcgtccg cacgcaactc gttcgtctcc ccggaccggt    247980
     accgggacac ggcggagcgg gaccgcccga tcttcgccgc caccgcgtcg acgccgccga    248040
     ggcgttcgat cgccgcacgc cgctgggcac gctcgagaac atcggcatgc gggatccggc    248100
     cctgctgcgc ccaccggcgc aacgtacgag ccgacggcgg ggtgcggccg gcatcgatcg    248160
     ccgcctgccg caggccctcg ttgccgagct ccttgcgtaa ctgcttgacc gagaccttgc    248220
     tggtcagccc cgccagcccc ccggacttga cctgcttcga cttctccaca ccgctggtcg    248280
     cggcgttggc aacggacacc ttgaggccgt cgagaccgac cgcctcctgc gccggtttcg    248340
     tggtgcgcgg tttgggaaga tgcagggcca tcagagatcc ccctcttcgt cgtcggcgaa    248400
     cgccgccttg atcgcgaggt tcacatcgtg cacatcctcc gccgaagcga aggcggacag    248460
     gagtgtgtcg gtgaggacca cgtccttctc caccgacatc ttccccaacg cctcgctcgc    248520
     gtcggcgatg tcctcgctgt cagcgaggag gtacacccag gagtcggtga ccgtgcggac    248580
     cggccagcgg ccgtgctcgc gggcaatccg catcgccacc cggcggcccc gccaccggca    248640
     gtgcgcgatg atcgacgcac gccacagcgg ttggtggtga tgttgcatcc gtgtcgcggt    248700
     ccacatgtcc gggttgacca ttcgcccgat atagcccttg tagcaggtgc tgaggaaccg    248760
     tttcgtcgct tcgtcgtcgg tgtctaccgc ggccttgcgg gcctcgcgca ggatcttcgc    248820
     ccacttgtcg agggcgcggc cctgttgtgg gtagacccag gcctcggtga tgtcgaggtc    248880
     gtcgagttcg gcgccgattc cgccgtccgc cactggtgag cacagcccgt cgaggctcac    248940
     ggtggtcacc caggtctgca ccggttggtc cgcgagcatg tgcgggtgcg gcaacgggag    249000
     tttctcgggc agcgacagcg cctgccccgc gggcagggtg atccgccaca gcccgaacgg    249060
     ggcacccttc tcccccaccg ccgccgcggc cgctgcgtta ccggtcaggt gtgtgggttg    249120
     cccgtagccg aattcgagca tgcccgcaga ggcgaggtaa gcggcgcgct gatcgatgga    249180
     caccaaccgg cccgtcccgt ccaaatcctg cgcgtcgggg acgcgtgtcc agccgacggc    249240
     gggttcgaga tctccccgcg gcgggccgtc cagcggtggg accgagcccg gtgtggtgac    249300
     aacgatgcct ttgccgctgc gggtgcgttc acgcttgatt ttgtcgacga tcgctgcgcc    249360
     ggtgcgcgcg ggcgttggtc ccgggagcac cccgaggtgc tgggcgcacc aggccagtcg    249420
     gcgaccgagt tcccgtgctg ccgggaggtc gtcgtcgggg agatacgttc cggccgtcgg    249480
     tgagccgagg atgcccatgt cgccgacccg gttgtgccaa ccgaagtcct tgttccagta    249540
     ggtccatacg tacggttcga tcaccacatc gaccatggag gtgaagttcc cgatcgagcg    249600
     ggacaggtgc accacgtgcc cgggatcgcc gcgcagttcc caccctgcgt tcagcagtgg    249660
     ggtgagggtg gcgtggagga ctgcggtcag ttcttgggcg gcgcggttgc ggagggcttc    249720
     catgtcgtcg acgtcgtcct cgctgcctgg gtcgatgatc cacccgagca gctcgcatgc    249780
     gccctgtccg acgatccaga tctgtgcggg ggcgcccaac ggtgtcagcg cggcccagcg    249840
     gatcagtttg tccagcttct cgactgaatc gacgggaccg gtcagctccc gcccggacgg    249900
     tgtgtacgtc cccgcagcgg tcacgatcag cgcatgacca tcggcttcct caccggccgg    249960
     aagcgtctcc cacaccggcg ggtcgacggc cacctcgtcg ctgccggccg cgtcgtcgtc    250020
     cacctcgtcg ccgtccaccg cagcgccatc cacctcggga gacggcggcg tcggggcgtc    250080
     gtcggcttcg gcggcgtccc gctgctcgga cgattcacgg tgtgctgcaa cggctggctc    250140
     cgagcccgcc tgatcggctg cgacgaagac accagcatcg acggaggcag cgtcgtcgtc    250200
     ggggagaacg tcatcggtga aatcgggaga cgccgttaag gttccctcgg gcagtgcgaa    250260
     caagggtatc tgttcccacg gaccgctcat gactcctgct cggcgatccg gccgtcgaga    250320
     tctgccggag ggacgctgta gcggtcgaag aactcctgca gggccacgtc cacgacgttg    250380
     gtcaccgtgg attgacggtt gttcaccagc cagttcagcc gggcttccgt cgaggccagg    250440
     acccgggtat tgagcggaac cttcgtcggt cccttccgcg gttccaactt cgccgtcaac    250500
     tccgcactcg gcgttcccgc accaccggag cctcccgcac cgggaccgcg tttccccgac    250560
     cccgcggcgc ctgcgcgtcc acccccggtc gggcggcggc gggcgctgcc ttgggaattt    250620
     cctaccttcg ccatacccac ccactcgtgt tccgcgtgcc gtccgtgtag ttccgcggag    250680
     ttcaccttac ccaccacatg ccttctcgca cgtatcttcg cgggcatgtt tgcatgcaga    250740
     tttgcgccca ggatgtgagt gttacggccg acggcttcga cgccgctggc gacgacctag    250800
     tcggacacac agctcgggta cgtcagcgca gggaaccgtc gtgacccgac cacctcggat    250860
     tcgtcattcc accagcgtga tcggcgcccc gggcgtgatg aacaggtggt gttgagcgcc    250920
     gccgtcatgg gtgagggaca ttgccactcc ggtggtgcgt ccctcggcga accgtacgag    250980
     cagctcgcgg gtggcctcga atctggtgtg gctgatgtcg taggtgacac ccgccctaaa    251040
     gatgaggccg ggcaccgtac cctccttctg ctgacggtgg atcgttgccg aacgtctcgc    251100
     tgacacctgg tcatcgtcat cggcgacggc ggacacaccg tcgcggtccg acgaaggtat    251160
     cggttgtggg cgggctacca gcggtggacg acgctcgggt ccggttcgtc gctgccccga    251220
     atcgcgaccg gagtcgctgg cgtaatcagc aggcgtaccg tcgagttctg gctgacaaag    251280
     ccgacgaatc cgccgttgcc gttgtcttcg aagatgcccc tgatagcttc ctcgaggcgg    251340
     tgggcggcgg ccgcatcggc gagcggatag cggaccccgt cgtagatcgc ttcgtaactc    251400
     atgatccttc tcccgctggt gtcgtggtgc tcacagcgta cgagcgccgg gctttcactt    251460
     gtggccgatg ccgacgcatt tccgccaccg cgtgatccgg ccgcatgaag gacggggaga    251520
     tgctgtgacc gccaagagtc gtgcccaact actgcaccac ccacggcgag ggcctggccc    251580
     gcgtggagat cactgcaccg cgggcgaccg cggtcagccc gtcacacacg ccaccgtcgg    251640
     ctgtgccggg agagacggcc cgaggccgat ggcgcccttt cagcttcttt cagcgttgtc    251700
     ggggaccggc accacccgcg ggcgggcagg ctaccgtctg tcggtatggg gaccaccttc    251760
     cacgggccga gcccgtggcc acacatcacc cgcgccatcc gcacccgcgg cgcccggcac    251820
     gccgcgatcg cgtatctcgg acaggacgca cccgagctgc tcccgctgcg cgccggggac    251880
     ctgttggtcg tcaacgcctc caaagccgct atccgggcac acgccacctc ccccgccgcc    251940
     ctcgcgtact acgtgaacaa gggggtgcgg gtgctgtcgt caccgaccct gcacgccaaa    252000
     gtgatcgcga ccaacacccg ggccgtaatc gggtcggcga acgcgtccga gaactccgcc    252060
     ttcgcagacg atgccgtcat catcaccgac gaccccgagg tcattgcctc ggtgcggacg    252120
     ttcatcgacc gcctcgacga gatcaccgag gtcgatcagg tgttcctcga cgacgcgatc    252180
     ctcgagtggg agatcggccg cgccgtcccc ctgcccgggg tcaccggccg cgtccgcacc    252240
     gagacggact ttctgccgac gccggtgacc cggatgttcg tcaaacacgc cgtcgactat    252300
     gaacccaccc gcaccgaaca acaggtcctc gatgagcagc ggggccggca ccgcagccgc    252360
     ggcggcccgg cggcgaaata ccaggtcgaa tcgcttcgcc tcgacaagcc cagtggcgtt    252420
     cggcgcggcg acgtgatcgt cttcgtctcc gccgacgacg catggtttta cccaccggcc    252480
     gtcgtggtgt ccgaccccat gaagatcccg cggtccggcg gggcggtgtt gtacttcctc    252540
     cgtatccgcg ccgacctgcc gccgctccct cttaccgagg cggagaagtt gctcaccgac    252600
     ctcgggcacc ccggctcacg gctgcggacc gaccactacg tccgctcccc cagcctccgg    252660
     accgcgctgc tgggactgtg ggacctctga gcagctgcgg ccataaatga gcggcgcaca    252720
     ccaccaccga gccgcctcga atgcgtcgag gtctgcgtgg acctcgctgg cgttctcgtc    252780
     ctcgagatcg atctggtatt cgacgttgtc gagcgcgtag ctgatgcttt cgccctcatc    252840
     gccgaacacg gtctccgtcg atgtcatcga ccagttccgc cacagcccgc tcgccacgag    252900
     aatgactgcc ggggtggtcg atagacacga accacacgac gggcgcggtg cgttgcacac    252960
     tcgcgccgta gcgatgctag ctaccctagc ggagttagct agcatcgccg tgcaatcagg    253020
     tcgcggtcgc ggagattctc ggcgcacggt tgctgactat gcccatttcc gcgacgatcc    253080
     gctcggggca cgagaatgga caaccggctc accgctcggg cacttacgtc accgtgatga    253140
     aattgcgtcc tgctctcccc cgccaccaga gcgcacgaga tgggttcctc aaccgttcag    253200
     caactcaacg aagcgtcgac acgcgcactg atacgcccgg cgcacggtcg aaccacctga    253260
     gcggccgcaa tggcgtctgc cgacaccgta ctcgacttcg tggcgcgatc gaccgcagcc    253320
     accccgcccc catcgtcaag ccctgcgacg ggagtaaaga cgaagtgggc gaaccggcga    253380
     tcgggaaggc cggtacgggc tgtccgcact ccgcacgcca tccaggctct cgacaggtga    253440
     cctgagtgtg ccgcgccgac ggcgctgacg gacgagacgg ctttggccca agcgtcgagg    253500
     tgaaacgcga ccagggtccg gccatcgact gggatccggg gcaacggggt cgtcgccgac    253560
     acccggcgcg agggcaccaa cggttcgcac tggatctcgc caccggatct acttgcccgc    253620
     ttcgggatcg agtgacggga tgtgcccctc acctttctcg agtgaactgg atgagtcatc    253680
     cgcgtccggc atgcaacgtg acgtccgccc agctgcaatc cgcagatgct cgtcgacgtt    253740
     gcaatggtgt tgtgtctgct tcgcggtcca cacgaccgat tgttcgttgc atccgaatcg    253800
     ggcgttgcgt tgcgttgcgt ttcacacctc gtgccgtcgg cgttgcgttt ccgcaccccg    253860
     gcgttgcatt gccacccttc tggttggtct gcaacgtctg tctgcgttgc ggtcagagtc    253920
     gctgagtgtt gcggagattc gggggattct tgtggggcga gattcgttct atttggtcgg    253980
     gtggtcttcc cggtcaagac gcggagtacg aactggccgt cgccgccttc cctcgggtga    254040
     tcagggtgcc ccgaccaatg tgtactgcgg atcgagcgtt gccgcattgc gtccgtccgc    254100
     cgcgtcctcg agttccggca acgggggcgt ccggaacccg gcgtcgacgg cgcgttgcgc    254160
     caccttgtcg aaccggcgca ttgcggtgct ggctgccttg gcccgcgtga gcgtggcgat    254220
     ctccgcgtag ctgtgctgtt cgatgattcg cagtcgggcc gtctccttca ctacaggctc    254280
     gaagtcggcg cacgtgtcga tgaagtcgag gaggttctcg atggtctgcg cctcgtccgg    254340
     caacacgaag ggctcttgcg agtcctccag cgcattgcgt gcaacgcgct cctcggtgag    254400
     ggttgcaacg tcggtgacgt catctgggtt cgcttcggtc ggctgtacgg catctgcaac    254460
     gtcagtggca tcctcgggtc cggccgcggc ggcctcacgg ctgtcgtcga gtgtcgagga    254520
     gccgtctgct gttgcggtgt cggcgacctg cggatcggga tgagcgaagc gctgcacaac    254580
     gtcgggggcc gatgcaacag gctgcgcaat gcgcggcgca acgtcggagt ccgatgcaac    254640
     gccggggtcc ggcgcaacgt tagggacgtg tgcaacgtgg gagtccggcg caacgctcgg    254700
     gacgtgtgca acgtgggagt ccgacgcaac gttggggacc tgcgcaacgc tcggagcaac    254760
     gagacccgca atttcgccgc tgttgcgttc ggatgccggc atcgactccg ccaccgccgt    254820
     ccggtagtcg gtgatgtcct cgtctcgctg ttcgcggtcg cgggtgtttc gaacgaccgc    254880
     tatgtattcg gtgtgggcgg tgccgatggc tttgatgagg attccgacac cgtgagtgaa    254940
     agccaagacc aagagtggcg ggatgactgc aatgagcgat gcgccggtcg gagttaatgg    255000
     ggtgtatccc agttcgatgc ccgccgcaac actccgcgca gcggcttccc cggcgcggta    255060
     ggcgtggtag gcgttgccga agacgctgat gaagacgacg accactgcga gccagagaaa    255120
     gaaatgcttc cccgttgcgc tgccgttgat cttgctcagc gcaacgatgg caatcgttgc    255180
     gccgaggatt gcgccgtcga cgatggcggg gaagatccag gtgaggtagt gcgggatgcc    255240
     ggcctgcaat gcgaggtcgc gttgcacggc gaacgacagc acaaatgctc cggtggtgat    255300
     gccgaccgca atggcgatcg caacgattag ggcggcaatc agggcgcgga gctggattcg    255360
     tgctgctcgg atactaaggt cgttcatgat cggggtttcc ttccacgggg tcccggtcca    255420
     cgaggccccc gccggtgcaa tcggcggggg cctccttatg tcggctcggc aagatgcgtt    255480
     gcggtgggca tatctcgaac cacgatcgct cacctagccc tgctagctag tgtcgcaatt    255540
     agtgctagca gccgtttttg gttaggtatt cgatgagcgc ggcgtcggtg actgacgaga    255600
     tggtgatgct gcgatccccg gtctcgtagc gcagcttgtc cacaccgcgc gttaggcggg    255660
     cctttgtcga gggccgcagt cgtacgttgt gttgttcgct gagcttctcg accggcgatg    255720
     ccgcctcggg tgcaggggac aagaccggtg tgacgggcac gtcggcgaca gacctgatgg    255780
     tcgattcggt cggaagttgc gtcggctgct cgtcgacggc ggccggggtg gggtctttga    255840
     cgacccgggg gcgctcagga agatctgcgg cagggtgcgc cggcctgcgg atagcgggtt    255900
     cacgttggac gctcatacgg tcgctcctgc ggtcttgatg ggtagttcgt tgagaaggtc    255960
     ggtgtaggcg agctgcaatg acagcgattt tccgccggtg aatttgtgga tcggggtgcg    256020
     cgcgctgtgt gcgtcctgcc gggtggcgta ttccgggatg gtggtgcgcg cgacgaggtc    256080
     gccgtagacc tcgcgcagtt cgctctcccg gaatcggtgt tcgcctgtcc cccgctgtcg    256140
     gctgaggacg atcttgtcga tagccaggtt cgggttgggg cgtcgctgga cattctcgac    256200
     ggtttcgaag agcttggtga cgccttgaac gctgtcgatg gtgggctcgg ttactgcgat    256260
     gaccccgtcc actgcacaga agacggcgaa gaggagtttg ccgagcgacg gtgggcagtc    256320
     gaagaggacg gcgtcgtagg cggaaaggtc gaggccttcg aaggcgatgt cgaggcggaa    256380
     gatgagatcg ttggccccat ccgattcgat gttcgcgagc gtctggtcgg ccgggatcag    256440
     atcgacgccg tcccatgggg tggcaatgac ggcgtcgatc gccgtgcccg attcggttcg    256500
     gctcatcagg tcgtaggttg tcagcatctc gtcggtgatg gtgacgccta cgccgttggt    256560
     ggcgttgccc tgggggtcga cgtcgacaat gaggacgtgt ccgccggcgt tgcttattgc    256620
     gctcgcgaga ccgagggtcg tggcggtctt gcccactccc cccttctgat tgcagatcgc    256680
     gcatttgcgt gtcatgactt ggtttccgtt ccgtcgaggc caggagactt ccagatgcgc    256740
     gcgatgagcg ttagtgcaac tccgcacgct cgcgtaggga gcatagccag gcttggccgc    256800
     tgaactagcc cgacacgccg agcaacgcta gcgccctttg ctaggtgagc tagcgtgaat    256860
     agcttaacta gtgtctctag tttggctttc gtagcaatcg acgcttacga cgcaaacata    256920
     gctaggacct ctatggttgc gcacctatct acagtctctg taatagattt gctcacaaca    256980
     gttactgcac tagttttcat agcgacgtta gatacgactg cgcttatagc gataacagca    257040
     acgatcgata gccaaacttc cctcgcaagc atcgcgctca tagctctgtt cgcactcata    257100
     gctctgcaag cacccctaca acccctagac tgcatagcca gcctattaag gctagaacgc    257160
     ctagaaaggc tcgaaaggca agtcggacta gacatgcaag cgaccataga aagcggcgca    257220
     actatagcgc tcatacggcg tctagctccg gtagatatcg ttgctgatgt ctctctgata    257280
     gcgacgattg cgggaattgc tgcgctacaa cgagtagctg cgatcgtcgc catagcagaa    257340
     ctatccgcgc tatgaagact agagccgata gcccagttag accggatatt tgcgctttcc    257400
     ctccctgcta ccaaagcgga tcccgtcaat gctatcggag ctagcgttga tatttcagca    257460
     ggtcaggaag tcgtcggccg caactatgcc acgaggcacc gtcacgcaaa acgcgcccct    257520
     ccaccagatc gcctccgcct aggcacgggc ggaacccggg gaaacagaac aggccggctt    257580
     cgagtcttca cagctcaaca tgccgcccga gcggacctcg ccccggatcc accaagtacg    257640
     attctcgagc tagcggcgct ccgctagcta ggctagcggt ccaatccctg tgagcgagaa    257700
     ctgctatttc cgccagcggc gtaagtgcaa cggtcgctat accgctagct actatgtcgc    257760
     tcctagcagc cgtcggcacg cgagcaatca acgctcgcat agctaatcga gatctctgca    257820
     atagcgttac attgctatct agcgtctcta gcaacgctac gtagcatgac tagcatcgca    257880
     ccgtgggtta catcgctttc gcaacgagca cacattcgct ggacagcgcg tcgcagggaa    257940
     gcattccccc gggttaagaa ggaagcggca ggacgtgtga atcaggtgtg cacagagccg    258000
     acggttcagg gcagtaatcg gtgggcgagt tgttcggcgt tgagttgccg aatgccgtcg    258060
     tcgacggctt ggcggtcggt gaggtcgacg cctcgctcgg tgagcgctgc ggccacctgt    258120
     ttggccgggc cccaggtagt ttcatcgtcg aatgcgtcat ggaactcggg taggaaggtg    258180
     tccacagcat caacgacgcg gctgatccat tggcggtcga tctcctgttg ggtcagcgcg    258240
     aaggtcagcc atcggcgcaa cacgaagggc agtgcgttgc gttggtcggc gtcgaggact    258300
     gctttgcggg gaagccaatc ggtgagcagc agcatcacct cgcccgggct ccagcacagc    258360
     ggtccggcgc ctatgtagcc gtcgccgtag tccaggaaca gctcggccag cgaccggctc    258420
     acctcgtcgt cgcttccgat gtcgttgagg aagtcctcga ccagttggcg gcgcctttgc    258480
     tcgggaagtc cgacgtgttc gggccattct ggcaggtagt tccggcagcg ggaccatgcc    258540
     agcgcccggt gatcgcaaaa gtcctcgtcg gcggtgcggg gccaggtcat gtcggtggtg    258600
     cgtaacgcgt gcgcgagatc ggcgagcacc tcggcgaccg ggaccgactg gagcggcatc    258660
     ggtgcctcat cgggctcgcg cagctggtcc cacgtggtgg ctgcgccagc attcaggaga    258720
     gcaagcttgt cgatcatcag cccgccgacc tggtagatat tcgccatcaa tgtgtgtggg    258780
     tgcggtccgt cgtagtcaat gaacaggacc cgttcgctct cgtacacgtc gaccgcgcgc    258840
     cacgctgcgg tcggagtcca cgccgcgacg gtgtgccagg ccggcagtgg ttgggtttcg    258900
     gccaagatgc cgagggtgtc ggtcagcatc gaaaggtcgg ccgcaggtgc gacccgcgcg    258960
     agcgcgtcga ccgcggccag cgagtgcggg gacggtgtgg agcatgctcg gccggtgacc    259020
     tgcatgcaca gtaggtgctc gggttcgtgt tcggtcagtg ccgccgtcga ccacgcctcg    259080
     ccgagccacc cgctggccca ggtctcggcg gtgagcacat cgtcgatttc gaggagttgc    259140
     cgggcgtcga gcagcagaag atcggctggg tgaagttgcc gaggagcacg gcgaacgggt    259200
     cggcttttgc cgcccttgcg gcggccacgg ctcttgggca tatccgcagt ccaccacaga    259260
     catcgaccaa ggcgccatca cgacgcgccg tccggtgaga ttccggcgac gtccatatct    259320
     gccgtcacgt gacagaaacc gtaggtagcc ccgggtatca acgctcgcca aactattcgc    259380
     aatagccaga actacctagc gttgctagct cgcattgcta gcaacggtag gtcagcgtta    259440
     tttggctgcc taatagccgg gaaggacgcg gtgcccgttg agcgcgaccg ctggtgtcgt    259500
     gcgccgttga aaagtcttca tccacgaaga tggggtgaac cgtctgctgt gtgagagggt    259560
     cgacttcgat taccaggcgt acgaggcgtt ctcggaactg ctggtgggca ggtggtgcgg    259620
     tgtcagagtt gcgtctgccc acgctcaggc atcatgtgtc cctcatagtg acgttcttgc    259680
     gagctggacc gcgaaccacg actgcggttt ccacgactgc gcgtgcctca tcggaaaggg    259740
     cgagaatcgc gtgatctcta gcctggaccg tggcctcgtc gtaggcgtgg acaacgacgt    259800
     tgtcgtcggc ccacacaacc gagtggtcac acgctctgat gaatgcgtga ttatgagcta    259860
     caacgcggca ctggtcgaag gcagtaaccg tcgcgtgtgt gtaggcccag acatgaactt    259920
     gcccggtgac ttccacggtc gtcgcgtcag tggcgacgat gtgcgcggtc gcgggtagtg    259980
     gtgagtcgag atgaatccgt gcctgcgatc cagcggtaaa ccgcaaggtc cactcgtcgc    260040
     cggccgatgc gaaggttttg tcgtcgagtt cgattagctg acctgcagtg tcaaccacga    260100
     ctgttttggc gccgttgcgg agacgctcgc ggatcgagtc tgcgttgcgg ctgatgcggg    260160
     gaggcgcctg gactcggctg acatagaccc gtgggtggcg ttgggtcgat cgggacacgg    260220
     tgttcttctt acccacgagc gcactccgtt ctgtgcgagt cggccacgat gattgccgca    260280
     gtatatggcc gagactcggt ggggagtggt acctcgctcg gcgcggtggt gatcgtccgc    260340
     ggccggtccg accagcgttg ccctatgtgc atggtgcgcc gaggatcgat gggcatggtt    260400
     acgccgcctg cctttggggt gccagggtgg cgcggatctg ttccatgagc gcttttcggt    260460
     gctcaggcga cgccgctgcg cgacgggatc gttcgcgttc ggcgtcacgc tcagccctgc    260520
     gctgtgcgct gtgtgcagcc tctgcggcgc gttgctcgct gggggagagg cccgaccagt    260580
     cgattctgga caaacgccag gtcagatatc cgatcggcga gcgaacagtg tctggccaga    260640
     gctcacctcg cgatacggtg tcagcggtca aagcttgggc gatatcccgt cctgtccagc    260700
     gcgtggtgtc gattcctgcg cgatcgatga cgtcgcacac ggcgccgatg tggccgctgg    260760
     gtgcgatgac tggagctgcg gcgatcaggg tggaggcggc tcgttggaga tttatcgggc    260820
     gcgggttcgt ctgattcgag gatgagggtt ggttctcgcg cgcgcacgcg cgtttggtga    260880
     ttacttctct acaagagatc cccttcgggg aaaaaccact caaagatagg gggtcacggt    260940
     cgcgggcttg gggattggga ttcgatcccg tcggggtggt ggggtgagtg tgctttgccg    261000
     cgcggtgtgt cctgcagtgg gagctgccgc gcttttttgc ttgtggggga gcgggggtgg    261060
     ctgcgacgag gtcaggtggg gaggatagag cccatacgct ggcagcgcgg tgctgacgtc    261120
     caccgtggtg gacttctgcg gcttggaatt cacgcgtagt cagggtacgg ccccgtacca    261180
     gctcgaagcc gaggtgtagt gctttcagca cgcggcgacc ccgtttgacc accgattcag    261240
     acacaccagc gcgggcggcg agattctgga cggtggcagt aacgcggcgc ccagttttcg    261300
     agtcggctga cgacgcgtgc gcgccagcga tggcgaccat actttcgacg ccgatcctgt    261360
     gtcgggcggc tgcggcgcgg ccggcggcgg tcttggtgat cgcgtaccgg acctgtcgca    261420
     tccatccgtc gcgacttgtc cagatcggga tgcttgcttc ttggccggga ttgacgggca    261480
     gcgtccaaga tttgccgcgc tgatcggtat ccgtattgag ctgtcgcagc tcgtcaatcc    261540
     acggcgtctg aagtggttgc gtcgccggtt gcgtggtttg gggaaccggc gagtgtgatt    261600
     tatcccacga cacgccgaga tcggaatgtt caaccgtgga aagggcatca gggtatgcgt    261660
     taccctggga cgtacctagt agcacaggta atcccttcgg ggaatgcagt accgagtcga    261720
     agaggctgca cacttcttct tctcacctca gggaatgacc gtcctgccag acgatcgccc    261780
     tagacgggag gacctgccag tcctcccagc gggattcatt gactaaaccc acccccgccc    261840
     gggggtccct tttgggtggt accgctgctc ttgaattagc tatcgaggta gttccgatcc    261900
     gctagtcgcc aggcccaccg ccctcctcag ttagaagggc cggtacgcgc atacgcagca    261960
     ccggaagtcg cagatcagaa cccgcagatt ccgtcgcgta ataggctccc tggtaggcca    262020
     acacaggtgt agcgccatcg aaagggtctc gcccgagcgg gagtgtcgta gccggcacgt    262080
     ggtctcgttg agacagacac gtgactgact ggaagttcgc aggcagggca gagttgcggc    262140
     cgtgcgttat catggagtaa gcaccgcctc ttcctttcga ggtagtggtg gtcagggagc    262200
     tggtaaggtc ccgaaatttc atacacggac aacccccgac gccgccaagc cctgggggtt    262260
     gttccgtgtt caggtgtcgt tcatgcgccc atcgccaatt gctcgatgcg atgcagtgac    262320
     cctgcagctt cgatttcaag tagccggagt tgttccggtc gaattttctc gctgatgtag    262380
     tccgggatgt ccagtccgtg cgtgatggcg aggataagca cggagtagtc gccagcaggg    262440
     atgccgagtt cggctgcccg actctcgtaa accttgtggt gtctgagggg cgcgcgggta    262500
     gcgatttgcc cgcggggccc cttgttgtgc tgtgccatga ggaaacccta gatcgaatct    262560
     gtaaccgata cgggtaaccg gcgctcttcg gtgtgtcgca tgtgactgaa gtggccatcg    262620
     gaggggctgc ctttcatgaa cgattcggcg tgtcaggact gaacggactt ggcctggggt    262680
     ttcaacgagc ccgcttacag ggaggcgcga caagattggt gatcgggacc gatctgccct    262740
     ggagaagcgc gctgtatctg tactgctacg cgggatgtcg gtggagaagt aggcggacga    262800
     gcgaagcgac ctcacggatc tgctcaatgg aagccgtctc agggtcagta acgaccaagt    262860
     cgatgacatt ggcgagcctc tctcgggcgc cgacactcag ggtcggcgcc tcagcagaga    262920
     tcaccaaaag gccgcattcg gcgagaagct gttcggaaag cacggtaagt gtcgtgacgc    262980
     cgtccgcaac gttcctggcg tggatgacat cctcgattgg gacgagttcc cactggcgcc    263040
     cgtggaagtc gagagcattg acggtggtca tgctgcgacc cctgtcgcac cctgacgacg    263100
     acttgacgcc caggcgttgg tagctgcgtt gatacggacc acggcggcgt tggcgggttg    263160
     ggtgacgagt tgtccccaga aggcggagga gacggtctcg gtaccgctga actcgatgcc    263220
     ggccaggtag tcgtacgcgt cgactgcgga ggcggcgact gcagcccatg cgtagtcggc    263280
     ggcctcggat tgtgcacggc cacctttgat tgcggcaagt cgatcgatgg cctgccagcg    263340
     tgctttgaga gcggtgaccc ggtctgcaat tacgtcagca tccgctgtcg gatcgataga    263400
     tgttgcccga cagagttcgg ccacagtgtg ggcggccgat gcggtgaagc ccgggatggt    263460
     acagaggccc cagcgtgggt tgtcgtatag atctgcgaac cagttccagc gaatctccat    263520
     gggaccttcg gcggcgggag gcgctatctg tccgctggcc atcagataga ccctgtcggc    263580
     gagtgacgtc atgccgcgac ctcgcgagct gtgccgcccc ggggcttctg ctgcttcttc    263640
     ttcgtccgtc cccgggcaac tgcgaacgca tcgacctcag cggcttcgat ctcgcggccg    263700
     gtgacggtga acaatcgtcc ggccataatc tgctcacgga ctttgacacc ggcagcgagc    263760
     cgctcctcca gttgtgcctc gcactgtgcg agcagcgggc ataccgagca ggtggccatc    263820
     gcacgcttcc aggccgccgc ctttgtgctg gtgacggtcc agccggagcc cttacctatg    263880
     cacagcccct gacctatgtg ggactgggtc gcgggcgcct tgccgcgggt ctcgagttcg    263940
     gcggcgatcc gccgcgacgt cgggcataga cgcacgtgac cggcgtagac gaacccggtc    264000
     aagtccatgg gggtggtgta cgagggtcat cgcgtgactc ctcgttggtg agtcaggcag    264060
     tcaaggccgg tgtcacctcc tcggtggact cggtgctgct gtcggtgggc ttgtcgttgc    264120
     gggaacgggc cagaacgtcc aggccgagat agcggcgccc ttcgatccac tcgtcgtgtt    264180
     gttcggccaa gaccgcaccg acgagccgga tcagggcggt acgatccggg aagattccga    264240
     ccacatcggt tctcctgcgg atttccttat tgaggcgctc ctgcggattg ttgctccaga    264300
     tctgtttcca aatctgcttg ggaaatgcgg tgaacgccaa caggtccggt cgtgctgcgt    264360
     cgaggtggtc agcgaccctc ggcaacttct ccgacagtgc gccgatgatt cgatcatatt    264420
     gggcatgaac agaatccgcg tcgggttggt cgtagaccga gtgcagcaac gtcttcaccc    264480
     aaggccacga tgccttcggg gtcaccgcca tcaggtttgt cgagtaatgg gttcggcacc    264540
     tctgccacga ggcgcccggc agggtcccac cgatcgccgc caccagcccg gcgtgcgcat    264600
     cggaggtcac caaccgcacc ccgcccaaac cgcgggcgac gagcgatcgg aagaacgcca    264660
     gccagccggc accgtcctcg gacgaggtca catccacgcc caggatctcg cggtagccct    264720
     cggcgttgac gccgaccgcg accagggtgt gtacattcac cacccgaccg ttttcccgca    264780
     ccttgagcac cagggcgtcg gcggcgacga aggtgtacgg cccggtatcg agcgggcggc    264840
     tgcggaacgc ctcgacctgg gtgtcgaggt ccttggccat cacggacacc tgcgacttgg    264900
     acaggccggt gatgcccaac gtgtcgacga gccggtccat ccgccgggtg gagaccccga    264960
     gcaggtagca ggtggcaacc acggtagtca gggccttttc ggcgcgtttg cgacgctcga    265020
     gcaaccaatc ggggaagtac gaaccggacc gcagcttcgg gatcgccacg tcgagggtgc    265080
     cgacgcgggt gtcgaagtcg cggtgccggt atccgttacg cgagttggtg cgctcctcgg    265140
     agcgttgtcc gtagccggcg ccgcacagtg cgtcggcctc ggcgcccatc agggtgtgaa    265200
     tgaacatcgt cagcagctcg cgcagcaggt cggggcttgc cccggtgagt cggtcggtca    265260
     ggatctgctg caggtcgata tcgtgggcac tggtcatcgc gtggtccttc atcgagtgac    265320
     tttggtaggt ctctcgaaga gtcacgcgat ggccaccttc gttggctacg acacgccggt    265380
     cagatgcgga accgcttcat acaccatctt catggacgca accccgaacc cgcaccgccg    265440
     gcaccggccc tcgccggtgt gctcgcgtgc catcgcacgg agtcgaccgc ttgtgtagcg    265500
     gcctagagac aggtcctggg gccggacggc gcccgtggat agttcgcgca gagcgtcagc    265560
     gacgggcggg cacaacggga gatcaggggt gtaggtgaat ccgcaggccg tgcacgacgt    265620
     gtggtcatgg ttcggacgat gcctggccag gatctcgcgg agagggccgt tggtcacgcg    265680
     atcgtgtccg tcgaccttct cccgcccagc atgagaactt gcagtcgcta ggcgtagagc    265740
     accagcgcca tctaacgtgt tcatttgcag gctccgatct gcattcgagg ccgcgggtcg    265800
     ctaacccgct ggtcttatgg cttgtccgac tgcgctaaca gtcgacttgc tgttctgacg    265860
     gtcccctggc tgcgctaaca gccaggggac cgctcacgtt tagtgagacc tccatccgaa    265920
     tctataccta ttgattcatg agtaccgtta tgtgcgcatc gtaacgaggg gattgcacag    265980
     tgtctagtga tgacgacttt tctggtaggg ctcagtctgt gagccgtcga gttatgcgcg    266040
     gattccagcc tgatcaactg gagaaagccc gccgatctgc tggtgtatcg cagcgcgaac    266100
     tcgcgcgcct ggcgcggctc aatgccgaca cgattcgacg atgggaactt ggcgactcgt    266160
     cgccccaggt tgatttgctc gcccgtgtca ccgccgcgat tggggtgtcc atttccgacc    266220
     tcgtcaaggt tccggagagt gagcgctacc ctggcgattg gcggattctg cgagggctta    266280
     cccagccaca gctcggtgcc gctgccggcg tcaccaccca aatcgtcgga agtgtcgaac    266340
     gaggcgagat ttcgctgtct gacaacgtgg ccaggaagct ctctgcagcg cttcgaatcc    266400
     ctgaaagcga actgcgggcg agctacgagc gggtacgaac ccgccccgcc ggcactcccg    266460
     cgtagccctc gggcgtctcg gatgcgaaga agacggttcc agtcgtattg gacgtgggtg    266520
     ttcgcgatcg tggttgtgca gtaagcaaag tgagtaatca ttcgaccttc tcgcgagcat    266580
     gacgaaaagc cccttcgagg aggggctttc tgcgtgctgc gcgggcaacg cgaaaaggtc    266640
     gcgccgcaac ctcgggtgag gtgcgctgac gtcggccgac cgggcacgtg ccagaggggg    266700
     catcgcgcag tcagtccgct tggcgaactc tatgtcgaac caacgtcgga ggggatatta    266760
     catagcttcc tcggattggt gggcgcgcca tgccgtgagg atgtagttgc gatgccaggt    266820
     ggcttgggcg agagcgaggg ccaagagact tccgggtgcg acgaagacgc gccaattgac    266880
     ccaggtgtcc gtggacatcg tgtaggcgac cacgatattg acggcgccga ccgcaaccag    266940
     tgccacgaac caactccagc tcaggaagcg ccagacagcg tccggtgcgc tcacccatcg    267000
     gccgatgatg acacgcaccg ggtcacgctt cgcgaccatc aacgacgtca ggaaagcgcc    267060
     ggcgattagc cagtacacac ctgtgggacg ccactttatg aaggtctcgt tgtggaacaa    267120
     cagagtcgaa ccgccgagga cgagcacaag gcatagaccg atccactgca gtttgtcgac    267180
     tcgttggcgc cgggccagcg tcacgatgat ctcgccgacg acgccggcca tgaccacgac    267240
     cgtcgccgcg aagattccgg ccgccttgta ggtcgccatg aatgcaacaa ccaacgcggc    267300
     gttgtaaaac actctccaca cgagctttgt cctccgaaaa ttttctccgt caggaggttt    267360
     cgtcagggat ggtttcgatc tcgggggaga tcaccgcgac accgatcgag tcgctgacga    267420
     ggggatcgag aaggaagccc cggaattcgg ccttcagcca gccgccaccg ccgcgtcgtg    267480
     cccgcaccgt gccggagacc ggccccttac gcacctgctg gacccactcg atgatcttcg    267540
     gccagtcttc ctcatggagc gcgaaggtct gtccggtgct cacgccgtgt ccgaggccgg    267600
     ggacgtgctc ggtcacccac ttcagccaat acgggtactg gtacgacaga tccccgaccg    267660
     cgatgtacat ccccgatgtc gatgccaaca tcgtcgacaa ccatgcgtcg agcatcgatt    267720
     catggacaag ggcttcgtcg gtgcccgcat cccagcagat cccgcgcacg cgtctacccg    267780
     ccgggccctc cacacaccgc tcggcgtagc gcagctcgcg ggtgacgtcg gcttccgccc    267840
     ggatggtgaa cgtgccgtca aacctgtcct ttacctggca gtctcggatt tggcgcacat    267900
     gccgcaaggt gtcggacagg cgggccgaac gggtgtagag atctgcagga ccgaaaaccg    267960
     atcgatcctg atgccgggtg gacatcccga tgagctcgat agctccgggg tccaactgca    268020
     gctgcggtgg gggcgggttg tcctccgagc tcagaaccca ctcccaggcc ccgacattgg    268080
     ggcggtccgg cgggttcttc ttcgggtcac cgctccagat ctgaactgct acgaccacgc    268140
     tcttgtcggg agtcaggatg gggtgggctg ccgcgaccgg gcccagggcg tcggcgacct    268200
     tgccctcgaa cgtctcgatc ttgagctcgc gatcggcgat gcacgtacgg atcaaaccca    268260
     ggacagcggt gcgtgcaggt tcgcgaaaga cattgccgat ctttcgccag tcgcggtgtt    268320
     tggggccttc ggcgacgaca aggtgctcgt cgccggtgcc gacgaagacg gtcgtccatt    268380
     cgcggatcgg gtgggtgggt tcggcggggg cgcgcacgag ggcatcagct gtcatcggtt    268440
     tatccgtttc tcccgtactg gctttcgggt ggtcagatca ggtttactgg catctcagtg    268500
     gggccgtgag tgcgccaggt atgtcgccgg tcgagtgttt cccatggctt caccagggac    268560
     aggcccgggt ggcgttggaa caggtggcga gtagcgatgt cgagctgcat cacggcgaga    268620
     tcggcgccga gacagtaatg aggtccgcgg ccgaaggcca ggtccgggcg ctcgccgcgg    268680
     gcggggtcgt ttgtcgccgc gcgtagggag agatacagag gactgccggc ggggatgcgg    268740
     gtgccgccga cggtgatgtc gtcaatcggg aatcgccgta tcgcatagga cccgggcgcg    268800
     gcgtcgagga caagctgctt cactcgggcg cgccagagct ggtcgtcggc gatttcgacg    268860
     agtagttggt ctcgatcgag tccggcgaga atgccgatgg cgttggcgat ctggtagacg    268920
     gagttctcga atccggcgag gaacgtcagg aacgccaggg agatgagttc ctcttcggtc    268980
     agccggtctt cggcgtcgcg ggcggtgatc caatcggtga tgacgtcgtc accgggagat    269040
     ttccgtttgg ccgcgatcac acgcatgagt acgagaacga tcgtggtcat ggccgggata    269100
     cgggggtcgt ccgcggtggg ttcgccagga ttcattgcca tcacggtcgc cgcggcggta    269160
     cggaactcgt cggcgtccgt atcggtcacg ccgaggatct cggcgatgat gtcagcaggc    269220
     aggggagaag cgtaggcagg gaagaggtcc acaacaccgg tttcgttcgg gtcgagctcg    269280
     tccaggagtc cgtcgacacg ggcggtcacc atctgcctca ccgctccgat tcgtcgccgt    269340
     gagaacgcgg gcgctgcgag agcgcggacg cgccggtgat catcggggac catattgagc    269400
     aggttgcggg ccagtgccgg tggcagggga agacccgggc tgcctgatgg gccgccgggc    269460
     cggacattga cgattccggg gtcagcgagc agtcgagaga cgtcgtcgta ccgggtgatg    269520
     atccagacgc gcagtccgtc ggcgtcggtg gcctcgacaa ctgggccggc ggcgcgaagg    269580
     cgctcatgca agcgatcggc ctccgcgaca ctcaggccgg gcgcaaacgg atcgagcacc    269640
     aggttccctt ctgcgatgtg gcaaatacct caggacgaag ataccggctg accgggattc    269700
     tgcagtgctc cggcggctag ggtgcgctac gtgagtgctc aggtcgacac cgtactggat    269760
     gaaaacgtgc acaaggcgga tgccgccgac cgtcggggtt ggaggagatc cgcagcggtc    269820
     tgcactctcc tcgcgctcgg ctcgtgcctg ctcgccgtcg ctgtcttggt ccccacctac    269880
     ggtgccgcca ggttgaagat catcccgctc gatgtgcagt cggcgacagt gtcggttgcg    269940
     gaggacgcgg cggtgctcaa ggccacctcg gtggctatga agggtccgct gaagaccgac    270000
     cggggtgtcc cgctgcggat tcaggtatac gtgacgacag aggatccagt ttcggccgat    270060
     tcgacaactc tgcaagcggc acagaagacg gtccggaccg actggggcga ggggttgggc    270120
     ctggtctcgg caatggtcga tcgagtcacg atcgaccgac gatcgggcat gccgctcgcc    270180
     gagcccgtcc cgaccactca agccgagcag ggcaagcccc cagcggagac gcctcgcgag    270240
     ggaattcagt acaagtttcc gttcgacgtc gagaaggtca gctacccgta ctacgacggg    270300
     acggcacgtg agacgcatcc gatcgagtac gtcgacgacg atcgcgtggt cgaaggcatg    270360
     cggctgtatc actttcagca gaagatcggc cctgtgaacc ttgggaaatc gatcggaagt    270420
     gtcgcgacga cgaccttgcc cgctgaaaag tgggggctac ctggtgcgga gccgaccacg    270480
     atggatctgc actactccac gacgcgcgat gtgtgggtcg agcctgcttc tggtgcgatc    270540
     gttgctgtgg aggagcagcc gaggcgatgg ctggcgcggt cggttgacga cccgaatgcc    270600
     gtgaccacgc tggaagcgca cacccacttc gacgacgaga cgatcaacgg ccttgctcaa    270660
     caagcgaagg acgcccgtac cgcgatcctg tggggaaccc gctatgtgcc cgccctcagt    270720
     gctgtggtcg gcattgtgtt ggtggggacc gcgctcatcc tcgcgcgccg ctggtcacgc    270780
     cgctagccga actggtcgaa agtcgcctac aacacctccg gacacgtcat taatatcgac    270840
     ggcactagcg gtttcgcagc atgccaatga tctgcgcaaa cggcacgtct ccgctcggag    270900
     ctttccctac tgcgaatcgc gcagctcggc gtacgcagac tgggccttgg gcagggcgac    270960
     ggcgtactcg gtggctgcgg tctcaccgtt tttgtagaag tgttcctttt cgttgtagcc    271020
     acgggggtct acggtctgga cggcaagcgc gtagacagcc gggtcgtcgg cgctgacggt    271080
     gatggtggcg gcgttgtcca tgaatgtgtt cgtcgcggct ttgaccgcat ccatggagtc    271140
     agcagcgatg ttgtacccga agcgccagcc gtagatgtcc cggatgtcta ccgatggcgg    271200
     ggccatcgaa agtcccgatc tccatccggt ttccgcttct gccgcgagga gggccgcgag    271260
     tgcctggtca ggagagccgc tacgtgcctc cacggtctcg acaatcgctg tcgcgttgtc    271320
     acggtgaatc ttggcgatga gggcactact cgcctcagac ccgaacggag atgccgctgc    271380
     ggcggtactc gggacagtgt gggtggtgct gggcgattcg tcctggctgc atgcggtcag    271440
     gacgacggcg agagtagcag tgattagtgc tgcggtaatg ctcttgcggg tcacgggccc    271500
     tccggtcagt agcggatgtt gtcgatgagc cagcggtcgc cctcgcggac gagaatgacc    271560
     cacacggtgg tgtccggttt aaccgtatcg gtgctgctgc cggagatcac ggtctgtttg    271620
     atggtagcca cgcggtggac gagggtgtct gtgtccgcgg gacacccgga gcattcgatg    271680
     ctgacatctg cgatgacctt cgcctgctgc tgcgcccact cgtcccactg cacacccggt    271740
     ccgcgctcgg tgcgggcgtc gacgatcata cggtcagcga gcttggcggt cagccagttc    271800
     cgggcccgcc tgtacgcgtc attctgggtg atgtcggtgg ctgggtacca ggtgaacgcc    271860
     acggtcaggc cctgtcgggc ggcctgttct gcggcgcggg aggctgtctg cagctctgtg    271920
     gcctccacgt cgactggtgg cgccgcgggc gcggcggtcg agcgcgcgct gatcgtcgac    271980
     gtcgccatgc tcgccgagtc ctcatcatgg ttggttcgga agaggtacgt gtaggtcagg    272040
     aacccgacga cagcgaccac caacaccacg atgacgagct ttcgtgtctt cacaccaccc    272100
     tcccttccgt caccgaattg ggctgtttag caggataagt gaatcgtccc cgggttccga    272160
     aggggtggtc cggcacgagg cggggcggac cgattcccag agacacgccc cgtaagttgg    272220
     cgcggaagta ccgtttgagc tgacaacatt cgttgcgcaa aaccaagatt gacgaaaatc    272280
     ggcgagaatg cgaaaagtca cttaagaatc tgcacctgct gtaggttctc gtccttcttg    272340
     tcgtcctggt tgtggccggc ctgggcggat ggtgcgtttt ctcataggtt tgtcgctcct    272400
     ggtttctcac tgttctgtcg ctttcttggc gtgttgagtt cgcggagggc ggcgcggcgc    272460
     ccgtctgggg tgagtcggta gtaggtgcgg cgtcgtcctg gtccgcatcc gggtggggcg    272520
     cccgcgagcc agtcggcctc gtcttcgtct cggctggtga gccatcgggc ttgttcgagg    272580
     cttctcagga gtgggtgaag ggtgctgtgg tggatgcctg tgcagtcgtg caggccgtgg    272640
     ccatagaact cctcggcatc ggttgtggtg aggtggcgta gcagggtgag tgtggtgtgg    272700
     gtcatccgca gccgctcgac ggcgatgtca ccgaagggat tgagcggtct aggttttcgt    272760
     ggtggtgtca ttgcttcgcg catcgcgtgt gcgagggtct tcgcgtcggg catggtgggg    272820
     gcgttgcagc catgcagggc ggcggtcatc agtgggtgaa cgtgttcgtt gtcgagttcg    272880
     cggagcaggg cgtgtccgtg tggggtgggc tggtgcgcgg tgccgcggcg ggatcggtgg    272940
     aacaggggtg tgcctgcgtg gcgttcgagg agttggagtt ggcggaccag gctggattgc    273000
     gtgatgccga ggtagtcggc ggcggtgtcc agggaaggga acgccatcgt gatccggaag    273060
     cggtgcagcc ggatccagcc gtgcagggtg ccctcgacgg ctgcgcggat gttcggtggg    273120
     aggtggtcgt aggtgatgag catttcggtg cggctggcga cgccttgcgg ccggaccggg    273180
     atgccgtgcc ggtgcagggc attgttgacg agcatctgtt cggtgccgag ttcgacggcg    273240
     atgtcggcgg tcgaacgaag ctgggtgcag tattgctcgc gcagccaggc cgggtcgatg    273300
     tggaagggcg cgcgggtctt gcgcagcgtg atcccggatt gtttggcgaa tcgggcgatg    273360
     atgtggcgtc cgatgccggt gtcggctgcg atgtcgttca gactgcgtcc ggcttggatg    273420
     tattcgcggt cgaagaactc gcgggtgaac aattgggcgg cgtgttgttc acgcaaccat    273480
     gcggcgggtg ccgcatgggg cgcccactgc cgttgtggct ggtcgagacg ttccatcgcg    273540
     atgcggacgt gttcggggcg gacgccgaga acctcggcgg cctcccgcga ggaacggttt    273600
     tcgtcgacga ccaggcggct gaccttgtcg gtatcgaggt tgccggtgtc gatgcccggc    273660
     agagcgagcc cgtcggcgag gtcggttggt ggcgaccagg tcagtggttc gtcgatgccg    273720
     aggttaacca gcagggattc ggcgtgttcg tgcagggccc ggcgcagcgg cgctgccatg    273780
     gaggtggtga actcgacgaa ggtgccgcgg tcagcgggac tgttgaacgc cagtgggtgg    273840
     cggcggtcgg cgaggtcggc gccggacagc agttgatgca ggtgtcgttg ggcgtgccgc    273900
     agccggcctt ggcgatgctt gccgaggtgc gctccgaccg aacaggcgag gtcacgccac    273960
     tgggcccagg tgagggtttc ggcggggatc tgctcgcgtc gccgctggta gtcgatcggt    274020
     gtgccgtgtt ggtcgaggtg gtcggtgatg cggcagagca gcgcgagaac atcggtcagc    274080
     gccgatccgg tgggaagctt gtcgaatcct tgcaggggga cggtcaggtt ggcggctgtg    274140
     acgcgggggt tcaacaatcg ggtgtgggtg tccatccgct gcgagggatc accggggacg    274200
     gtcagcagga cgctgagagt tgctcggaac aggtcggtgt ggaagccgcc cgcgacgggc    274260
     agcaggcggc cggtccagtc gggccagaac agttgcggca gcatccggat ccgcaccgct    274320
     ccattggcgc gcggtggtga ggccgagggt gtgacggtcc gcatgcgcag ccgcacggct    274380
     ccgggtaggt gggcgtcaac ggcacgcagg tagcggttgg ggaaccggct gggcatggag    274440
     gcaaagcggc gatcggtgaa ttccggcggc gggattcgtt gcggacttgg ggttttcgtg    274500
     atcagtgtgc gcagctcgtc gatcgcggtg gcctcgtcgt cgccgagaac aactcgtgcg    274560
     cgagtcagca gtgccgcggt cagtgccgca tcgaggttgg gcgggctgcc gttgcgtggt    274620
     ggcggcggag tcgcgtgccg acgcgggttg atcgcccggg ccgcagcgat cgcggccgtg    274680
     ccgtccagac gcagcaacca ggccaccacc aggtgcaaat cggtcagcgt cgcatgggcg    274740
     ggggcggggc ccggttcgcg ggccgaggcc atcagttgat cgatccacga ctggacatcg    274800
     aggacttcgt cggcggcggg taggtccgcg gcggtgaaca gctcggcgcc gcagcgcagc    274860
     cgggaccggt cgatgagacg gatgcaggtc cccgcagacg gtggggtggc gccgccgacg    274920
     atctgcactc ggggtgccgc gcggcagttc ggttccgcgc aggtgtcgtg cagcagcagt    274980
     cggtgccgct tgcaggccat cgcccaactc gaccgccatg acagttgcca gcgcccgtcg    275040
     gtctcggcca aacagcgcgg gcagaaccgt gaacaattca tcgacaaccg ttcgatcccg    275100
     gggacggcgg ggccggtcgc ggcgtcgaga cgatggggcg ccagcccggt cgcggcttcg    275160
     atgcggcgca gctgcgggga atcagtttca tcgaccagct ggcggatcga ctgaccgggg    275220
     taatcgatgc ccaaggcgcg cagcacttcc agcggggagg tgtcgttgcg gcgggcgagt    275280
     gcgtcgatcc aggaatcgag gctctcgccg gcggcgatcg gcgtccgcaa cggcagtgtg    275340
     gtgaccgcgg tcatcgcctc acccgcttgc gttcgccgct cgtgcgggtc gcggcttcga    275400
     gccggtggcg ggccttttcg gaggcttcat cgatgcggat agtgtcgagc agctcttgtg    275460
     acatcgcctc ggctccggtg cggatcgctt tgaagcagcc gcggttgatc agcgtcatca    275520
     gcgacccgat gtgcccgccg gtgcgagcga acaggtagtc ggccaggccg gcgagctgtc    275580
     cgggctgccc gcaggcgagc accaactgtt tgtcgaccgc cttgatcagg gacttccagt    275640
     gccggtcgcg ggcgaaggtc ccgacttcga ggcgggtcca gcgcctcgcg ctctgcgcca    275700
     acgcggccga gggcccggac aatccctcct cgaagaacct ccgttccccg agaccgacac    275760
     cggcgtaaat gaacgtcacc ggcagctcgt tcgccagcca tttcaggtga ttgctgacgg    275820
     cgagcccgtc tcggctgttc tggtcgatga aatgaatatc atcgatgatc ccgacccgcg    275880
     aatcacacga gaggacacag tccagggcgt agccggccaa ctgggcggcg ctgccgcgat    275940
     cggctccggg atgcccgtag aactggcaga tcatcttgtt caacgtccgc agtgtggtgt    276000
     tcgaggtcag accgacccgg aacaccggaa tgtgctcgtc accggactcg gtgaccggac    276060
     cgcggcgacg cagcgcctgg cggtgatagt cgcggccgaa caggttgacg atggtcgtct    276120
     tgcccagacc ggggaatccg tcgatgaccg ccgcgccccg aacacggtcg gggtcttgac    276180
     gattcgaggc gacgatcagc tccagttcgt cgcgcacggc cttgagctgc ggggtggcga    276240
     tggtgccgaa gttggcgtgc cagtcgtggc gtgcgtcgtc gtagtcctcg cgggcgtcgc    276300
     tccccaaggt ggacaacgcc gtagcggtga gggtgtcggg tcgggtgcgg gccggggtgt    276360
     cgacgaaccg gcgccacccg tccttgcggg agaggctgta ggcgctgctc actcgagcac    276420
     ctccagcgcg tcggcgtaga agtcgtcgac gtcgtcgagg atctcgctgt cgtcatcgtc    276480
     gtcgccgacc accggagggc ccgagctggt ggtggcaacg ctcagcgccg gaacagggtc    276540
     ggcggccagt tcgagctcgg ctgccgcggc caggccgctg cgctcggccg ccagccgggc    276600
     ggccatgcgc cgttcgcgcc ggtcgagaac ctcaccggca tcccatcggc tcagcagtgt    276660
     ggccagcgtc tcggcggggt cggtgaaacg gtcggtgcgg cgggcgagga tgcgggcgta    276720
     gcgggcggcc tcgtcggaga acggtgtgcc cagcatcggg gcgtgttccc agtcgagctg    276780
     atgccactgc ccatcgcccg ggtcttgaaa gtagatgtgg cggacatcgt cgtcgttgac    276840
     gcggaacggc catttcccgg cgtcgagtcc gccgtagggg ctggtcgcgt tgcggtagcc    276900
     gtccagtgca ggaccgttgt agcggcggcc gtcgatttcg acgccgtaat gctggatggt    276960
     gcgtttgacc acccgcagga actccaaggc gagctccggt gcggccggga tccgcagcac    277020
     tcccgccttg gcgatgccca gggcgaacat gtcgttcggc gacatcgaca ggttcggcca    277080
     ctcggcgacc gcgatcccgt catgatcact cgggtgatag accgtcacga tccagtcgcg    277140
     gatcacgtcc tcgagctcgt gcaggaacaa gaacgcctgc tcctcgagac cttcgccgcg    277200
     gctgtgcaga tccgggccct tgtaggccgg cagatgctga atcaggccct gacgcagtga    277260
     tctgaagaac ctctcgaccg tgggcttgtc ggttggcttt cgcggctggg ccggctggat    277320
     cgagatcccc aatcgggcgc agaccccgat cacgtgcgcc gacaggaacg cttttccgcg    277380
     gtcgatcacc agggtctcgg gcgggcacca gatctcggca tcggcgccgg tgttctcctc    277440
     ggtgaacacc agatgcttcg gcaacccgtg caccggcccc agcgccgggc gccccgcgct    277500
     gcggccggtg accgactcga acaacacact cgcgacatca accgatttcg tggacaccgg    277560
     ggtcaccttc aaccccagga tttgtcggtc gaacagatcc tgcgcgaccg tgagctgcgc    277620
     ccgcacccac cgacaggtca ccggctccat cgcgaacacg tccagatcct gggtatccag    277680
     aatcagatac tcacccggac gcgtggcgcg caggcggccg taaaccccct tcgggcgttg    277740
     ggcgatcgat cgccgcgcct tcgctgaccc gctcaccgcg ttcgtgccct tgaccagctc    277800
     cgccagccgc cgataggcgg tcgcctgcga cggcagcgct accaccccca ccccgtgctc    277860
     gcgctccagc cgctcggccg ctcgcatcag caccgccgag cgggtcggtg tcgacgccga    277920
     cacccccgca gccagttccg cggccaccgc cgcctcccag cgcggatcca ccgtcgatcc    277980
     gcggccacgg cggcgccggt cattgaccag ccccgcctca ccggcatccc ggtaggcggc    278040
     cacccaccgc tcgacggtgc gcgacgccac ccccaactcc gcggccttgg cctcgcagcg    278100
     tgccttcaat cccaccgccg gcgcatagtc ggggcggggc tcacctgttc gcgcggcctc    278160
     ggcgtaaccg gacctgtagc cggtcaatac ctcccggaca tgctcgcccc gcgctgcggc    278220
     ctgctcccgc tcggccggcg acagccccgc cagcaccagc cccgggtcca gaccttcttc    278280
     gaccggctcc aaaccgcgag cccgcgagac gaactccgcc aaagcaaagc ttccgtagcg    278340
     gccgtccgcg tactcaacga ccaccttgcg gccgtcgaac tccacgaccc gcgccgcgtc    278400
     gccgtcgacc atcagccccg ccccgaccgc gaccgtcacc gtgcgcgcgt tcacgccacc    278460
     acctccgccg acaccagcgt gtcgccgccg agaacccgcg acagatccgt caccagccac    278520
     gatcgccaca acaggtgcag gatcaccggt cgcaccagcc actgcggcac cgacaggccc    278580
     agccgccgtt ccaaagtgga gatcgtcacc ggcacgaccg ccgcatcgat caccgccggc    278640
     accagtttgg tcgcgaccgt ggcaggccgc ctatacccgg ccaggaagcg cacgttctcc    278700
     accagcaccg catcggcgcc cgtccatacc tcgaacccga aatcgtgtcg ctcacacacc    278760
     gcccttgtcc acgcgaactg agccgcaacc ttcggatcgg caacgcgggc agctgccttc    278820
     acgtccacca ccgtcagcgc tccatccttg tgtgcgagca acagatccgg cacatgccgt    278880
     cgtttccgat cgccatcgat accttcgagc agaaacggtt gcgccgcgat agccaccacg    278940
     ttccggtcct gttccgctag aaggattctc gccagctcca gacggctctc gtagaccacg    279000
     tgaccacccg tagtcgccga ccagtaccag cccgaatagt gccgccgccc ctgccacgac    279060
     cggaactccc gcaccggacg gcccgccagc acatcctcca ccggtaaccg ccgcaacgtc    279120
     gtatcgacga acgctccgtc gtctccccgg aaccgcacgg ccacttccga ccccggcaca    279180
     actcccgcca aaccagtcca catcaggctg ctctcatcag tcatggcgga cacccaaccg    279240
     cccaagccca ggatcaggcc gcagacacgc cgagaacgat tctcactaaa atgtcggaag    279300
     cgacatctgg gcgacagatc gatgagaaga gcgacatcaa tcatgagaac ctacacctgc    279360
     ggagattgca cgttccccta catcacgcgg cgggccttca tcccttcctg gagtggagct    279420
     tccttgacga cctcgcccgg cgtcggagcg tggaccatct ggccgttgcc cgcggcgatg    279480
     ccgacgtgtc ctggcccgtt cggcccccag ctgccgaaga cgaggtcgcc gggcttggcc    279540
     tggtcgatcg ggatctcggt gccgacaccc cactgctgct ccgaggtgcg ggggagtgcg    279600
     atcttgcctg cgctggccgc gtggacggcg tacgaggtca ggccagagca gtcgaagcca    279660
     ccgccggatg ggccgccggt gccgccgcca ccccacacgt acggggtgcc gaggtattcg    279720
     cgggcggccg tgacgacttg gctgcggtcg ccggacgcgt gggggatgaa cctgccccgg    279780
     gcattgggat tggtgaaccc ggtccgggcc tgcatgattt tcgggacgta attctcggtc    279840
     tgagcgtagg gcgggattcc gccgtactgc tgcacggcgc ctggtccggc gttgtaggcc    279900
     gcgagtgtca gttcgatggg atcgccggag gcctggccgc tggcgatgta gccggaaacg    279960
     ttctggtata gggcgcacat gaagtgtgcc tgcgacatca ccgcgtcgcc gatggagttc    280020
     gggtcggcct ttccgtcccc gtcgtagtcc ttaccccacg ttgcccaggt gccgggcatg    280080
     aactgcgcgg gacccagcgc tccggtcgac gacaccggcg cagtggagcc gtgccggaat    280140
     ccgttctcct gctggagctg agcggcgagc aacggagcgt cgatctccgg gcagacactg    280200
     ccggcgcggc gtagccacgg ctcgaactcg gccggcacga tcccgaacgc cagctccccg    280260
     ccgccggcca tcccgaagcc agagcagtca gccgtcgacc gggacgcggc cacgagttgg    280320
     atggggctgt tgctgttgct ggtggtgttg gggttggggt cgtcgctgct ggtgccgttc    280380
     tgtttggcga tgtcgggtag gacggtgagg gggtcgaggg ctgttccgcc ttgaagtcgg    280440
     ccgccctgcc agtactcgaa gtgcaggtgc gggccggtcg atccgccggc gttgccgatg    280500
     tcggcgatgt ggtcgccggc cttgacctgt tggcctggtt tgacgtgaat tccggtggcg    280560
     aacatgtggc cgtagacggt gctcacgggc ctgccgtcga cgttcgagtc gatgaccacc    280620
     cagttctcga acccgacccc gggcccttcg ccggagtccc cggccttgac gacgttgccg    280680
     tcgagtgcgg cgaggatctt cgtgccgacc ggtccggcaa ggtccacgcc ttggtgctgg    280740
     gctccccagc gctcaccgaa tccggacgtg aacgtggcgg tcccgggctc gaccggcagg    280800
     cgaattggtc ctgacacggt cagcgtctgc tcggcggtcg acgccggccc gcgttcgccg    280860
     ccgtcattgc tgtcgatggt gacggtccgg cacgggtcac gcggaatgac cggcgtgccg    280920
     agtgagcacg cggaggtgcc gatgacgatg ccgatggcgc cgctcatcag cagcgtccgc    280980
     cggacgccgc cgatcctcac agtccccccg ggatcggggt gtcgaggtcc gggatcggga    281040
     tcggtccggg aatcggtgtc gggtcgttgc cccggttcgg ggcggttgct ggttcgtcga    281100
     gatcggacgt gggctgcggc gccgtcgacg atgggctcgg ggtcgatgtc ggctgcggcg    281160
     tcgttgtgtc ggccgcggtg gtggtcggtg tcgtcgacgt gcgcgtcgtg gccgtggtgg    281220
     tcgttggggc ggtcttctcg acctcggaca ggttgagggt cggtagggga gtgtcgacca    281280
     cccaccgctt ctttccgtcg acgtcatcga cggagagcgt gatccgcagg tcaccggcct    281340
     gcgtcggaac agtcactcgt gcggttcgcg cgccgtctgg cccgtcggcg agggtgctga    281400
     ctgtggggcc ggtgatgacc accggggtcc gcgggcgggc cgctacgacg tactctcccg    281460
     gcttgtcggc ggtgtggcgg ccgatggtgc tggcccacac cgcatctgac tgtatggcgt    281520
     cgacgaacgc gtgcgcgtag gccatcgcgg tggccggcgc gctcgacgct gcccaggttg    281580
     cggttttggc ggcgaccagg gactcgctca cttcgtcgag gtcgtagctg atcgtctccg    281640
     cgggtgtgac cgattcgacg gtggtgtcgg cctgatgggc gactgcccgc ggcggcgggt    281700
     tctctccgaa gaccgcgccg gcggcgaaca gcaacgccgc agcgccgacc accgtaagcg    281760
     ccagatgggt gcgggagtag agcacccatc ggcgaatcgg tgcgagaaca gggttgggtc    281820
     cagatggcga catcagatgt accggtcctc aggtgtcgtg cgggccgggg cgtcggcgtc    281880
     ccacgccttc gccggtgagc gatgcggcgt ggacaccgtg gcgtgatctg cccgccgctg    281940
     gccgcgggtg ggggtgtaga ccttcatcgg cgcgatggcc gagcggtcgc cgccgtccca    282000
     ccgcggtccg acgctggcgg tcagcagttc cttgcgggcc cggctttcct gaacgaggct    282060
     gtcggcctcg ttctggtcga agaacttcca cgccgcggcc ccggagcgga ccgcgcgatc    282120
     ggcgtccttg ccgtcgaccc cacccttgcc cctagcgatg tcgcggctgg ccacggcagc    282180
     gatccccgcg atccgtgcat cgcgctcgat cgcggcatcg gaggtctggc ccaggcgtgc    282240
     gccccggccc accccctgcg ccttgcgggc atcggcacgg gactgcgtga gcgcctgctg    282300
     gcggcggttg cccagcgcgc gaccttcggg ccgagtgatc gtggccgccc cgtcgtcgtc    282360
     cgcgtgtccg tcgcggccgc gacgggcgaa gcgctcggcg gccttctccg cgatcgcctg    282420
     cgccggcccc ccgaccgtga agctcgcagc gtcgaatgcc ttgcgtttga tggacttctt    282480
     cgcgcttcgc gctttgcggt tgaccatgct cgcgctgttc tgggtgaacg tctggctcat    282540
     ccgtttgaac ggccgcatga tcgcccagca cacgacggtc agcaacgcca tgaaccacag    282600
     tcgccaggag ccgtcgacgg ccccgttcga atcgacgtag agctggacca gcgccatcag    282660
     atagagcgcg acgatcaccg aaccggccac gccccacatg taggccgagg cgagcatgcg    282720
     catcactcgg gctagccatc cgccgtaggc gatcgcgacc ggaacccaga tcggcgcgaa    282780
     caggaccgcg aaccgaatcg ccagcagcgc ggtcagtttc agcagggacg cgccgatcca    282840
     cagcaatgac ggcatggcta gcttgatcat gcccatgaaa ccggtggatg tgcggcccga    282900
     gtccttgccc tggaactggt agtaggagag ctggtagtcg gtttcgagat cggtgacgat    282960
     ctcccggaac tggtcggctt tctcctcggc gagctgcgcc tgcgccttcg gatcgtcctt    283020
     caccgcgtgc tgctggtcat aggtgaacgc cagtgagtct cggagcttca caccgaggcc    283080
     agctgtgtcc tcagggtcgt agttggtgcc gaaccatccc ttgcgccagt ctggaaggaa    283140
     aattttgtca atcagcacgt tgcgtgggtc agtgccgccg gcagcgagcg tgccatcgtc    283200
     gtcgccgaac tgcaccgtga aaatctggtc ttgcgtctcg gtgatcagcg acccaaacgt    283260
     ctcgtcggcc acctgcagcg ccttctgcgg agccccgacc atcaacgctc cgagggcgag    283320
     tcccgccgcc gcgatcgctg aggtcttcgt gaccccggcc gtgtcggctt tcatggcttt    283380
     ccacaggacg atggcggcca cgatgaccag ggcgatgccg acccactgtc cgtagaggaa    283440
     ccgcatgccc tcggtgatag agaagacgat ctggtcgaac cgctccagcg caggagttac    283500
     cccggccttc gtggcgtcct ggccggtctt ggtctggtcg tcgagccaga acgcggccgc    283560
     cgccattgac ttgccgatgg tcaagaacgt gttgcccagg gtggtgtcgc cgaccgcacc    283620
     cggtgccttg accaggtccg cgccgcagcc gaggtcgtag gtgtgccact cgagcccggc    283680
     ccacccgtag gtctgataac ccgtgccgcc ggtggtcggc cggtcggcgc tggttgagtc    283740
     gaaggtggtc tcgatgactt cgttcgggaa ctccggcggc gggacgtcct ggcagtcgaa    283800
     cccgccggcg gacgcgacag ttccacccag tccgatcagc gacaccgcgg ccagcatcag    283860
     caccaccaga acacgcccta cgagccccgt acgccaccca aaacggcgcg ggaaagggaa    283920
     acggtccatc cgtgcggctc tgagggtgag aagccggatc atttggtgct gacgtcccgc    283980
     tcgcagcagg ctgcggacgc cgtggccgcg ctccggtggg cgagcttgga gggcgccggt    284040
     gcggaaaacg tgatcggagt tgcggcgcat gccgggctgc gacgggctca tgccgcaccc    284100
     cggatcgccg cgcgggtggc tcgcgagtcc agggcgtcga acacgtgggc caggtgcacg    284160
     taatgcgtcc agtccgaacg gatcagctcg atgtcgtcgg ccatcttcac gatgaatcgg    284220
     cgggcctggt ccaggtgttc ggtgtcggtg tcctcgtcga gggtgtcctc cccgccgccg    284280
     ccgagaccgg ccaggagtga ctcgtagccc tcgccgaggg gaaggttcag cagcttgagc    284340
     gcgccctcga ttgcgtgggc gttgccgccg aggtcaccga tgatcacctc gtacgtcagc    284400
     gcggacttgt cgtcggtgcc gtcgactccg aggtagtcgt cgggcagctg tgagcacacc    284460
     agcgcgcgga ccttgtactt gcggctgtcg cgggcgatcc gcaggttcag ggtgcgtccg    284520
     gcgccggtct gctcgaggta cttgttctcg tcgaggaaga gaaccttgcg ttcgtaacgc    284580
     ggcagctcgt agacgagccg gttcgccatc cacgccgcca tatgcatgag agggccggcc    284640
     atccgctgct gcggggtcca ctgagccggg tcggtgccct cggggggtag ttgcaggccc    284700
     ggcatcgtca gaaccgtcag gcgcacgttg cgatcgacgt cctcgccgtc gccgatggtt    284760
     ccctcctccg ggaagagcac acgggcctcg gcaagctttg acatcatcgc caggtcctgg    284820
     tggatggacc gcgcgcagga aatcaggtcg acgttggttt cgtccttgcc gtcgccgatc    284880
     gcggcgatgg cggcaaggac ttcgctcagg ttgtggttgc ggtcgccgcc gaccatgttc    284940
     gccgcggtct gaaggaccgt ctcggtccat gggtgttcga gccgcgacgg cgtgagcatc    285000
     atcttcagca ccgacaccgc taccgagatc cgctccgcct ccgcggcccg cagatccgcc    285060
     tcgtactgcg actgtgcggc ggcgaccgga tcggcgtcgt cggcgtagtc gggattggac    285120
     gagtcgtact ccgggtcgcc gcgccggggg tcgacgatca cccggtacgg gttgagcgat    285180
     cccggacgcg aggtgcgccc ggtcagcgcc tgcacctcgg cgataccccg gaactcgggt    285240
     agctgcgcaa gcttcttcag cggccccgac gggtcgagca ccacaccgta ggcaccggca    285300
     cgcaccgcct ggtagacgag catcccggcg aggaacgtct tacccgagcc gggcaccgcg    285360
     acgatcggtg tcagacccga cttgtgcttc ttctcgtgcg cggcgaacag atcccacacc    285420
     gcgggccgcg gggcgatcga cgcggtctgt ccgaccacca cgccggtgcg gtcaccgatc    285480
     cggtcaccga ccgcggccat cccggccgag agggcttcga cgttcatccg ccggcagtgc    285540
     gcgatgttcg ccagcggctc ccccgggacg aactcgcgca gcagctggta ctggccgtgt    285600
     tcctgttcca ggcgaatccg cggcgcatac atctcctgca gcaacgcgac cttctccttg    285660
     gcctccttcg gcgacgaacc gacgacgagg acgcggtacc agccctcggt gcgtatcgac    285720
     aggcccgagt ggtcctcctc gatgtcggag atcacccgtt gggcgagtgc gtgctgttcg    285780
     gccagttcct gcggcgggga ctggtcgtgt tcgacggtgt agtggtcgaa ctgggcctcg    285840
     atcttcgatg tcagccggcg caggctgcgc agcgtctgcc ccttggtctt gagcgatatg    285900
     cgctcggacc attcgagggg ttcgccggac gggtcaccga tcacctgcca cggcagcatc    285960
     ttctccggga tcggcagcgg cgccatgcgc ccgaccgtca ggacgatcgc gtagccggtg    286020
     tagtcccggc cgccgacctg cccgcgcacc gtggtgtagc cgtcgccggg ggtcagctcg    286080
     aggttggtga ggtcttcgag tgcggcgaca tcggattcct cccagtcgcc ggcaccggag    286140
     atcacaccgt ccgcatcgag cggcagcccg agtgtcgccg agcgcaacag caggtagtcc    286200
     atctgcgctg cggttgcggg tttggcgttc acaccctgcc cggacaggtg ccgctcgatc    286260
     gtggcgaggt gatcggcgat cgccttctgc tcgcccagaa atgcatcgcg cgcccacgtg    286320
     cgccacagcc gggcgaacct gccgatcagt ggccagtcga cgaccggaag aagccactgc    286380
     ccgaccgtgt cgagaccctg cgcgcccgcc gagcgcggcg gcagttccac accccagtag    286440
     cggcccttct gggtcgggtt gccccacagc atcgcgtgct gttgcccgcg taggtaatcc    286500
     gcccacgaca acgcccccgg cacgtccggg atcggatcgg cccacccgtc atgcgcctgc    286560
     gcccactgcc gcaccggcca cggtgtgcgc accagccgcc ggtgcagccc cgtcaccccg    286620
     gcctcggcaa gattcgccac gaccaagccc tcgttctgga tgtagcggcg ctgcttgccg    286680
     accggacgca tgttccacgg ccccggcggc tgcacgaacc acgccgtcga ctgccggcgc    286740
     gtgcgggtga tgttgccctc caccccgacc agcgcgagac gcaccgcctt gcgttcgcgg    286800
     tccgcgcgcc ttttcgccgc cgcggcctgc cgggtgaact ccgcctccgg gtcggcgcgg    286860
     cggcggcgct tcttcccgcg tcgcttgccc tgtccggtgg gttctgccgc cgcgtccggt    286920
     gcgggggagg aggccgcgac cggtgcgggg gctgcgatgc tgttgttcgg ggccttcgac    286980
     caggccaatt cctgggccgg ggccggtgtg gcggccgatc ggttcgccgc catcgccgcc    287040
     gcccacgagg gcggtaacgc cccgggcggc acgatggccg gatcgggctc gccgaagttc    287100
     ggatcgaaca gtgcggcgat ctcgttgtcg ggctgcaaag tcatcgggag gactcacctt    287160
     cgatcggtgt aacggcatcc gcgctgccgg cagcgcggga cagggcggga atgcggagca    287220
     cgacggtctg gccgggcttc ggcgggcgcg gtgcgatcag gtcattccac gcggcccgga    287280
     tcaccgaccg gaccgggcgg tcggcgttga cgaacttcgt cacccgcgcg gtgagcgcga    287340
     cggtgatgac gatcatcacg acgagggact tgaaccccag cggcacgtgc acgacggcgc    287400
     gggcgatgac gaagacggtg accaggaatg cggacccgag cccgagcgcc gcataccgaa    287460
     tccggaccgg cagcgtgaac ccggtcggac cgagatagtg ctgatccacc cggtgcagca    287520
     ggtcgtcgtt gtcgatcacg gtcggctccc ttcgaacgtc gattggtgat cgggcacggc    287580
     aggtcagacc acccggatac cgaacaggcc gagaatccag ttgccgatgc cggtcgcggc    287640
     actctcactg ctcgcgaggg aaaagaacgc gataccgacg agcgagaggc caccgacggt    287700
     gaagaccttc gacaggttgc cgcgcagacc accgacgagg accacgcacg cgatcagcgc    287760
     gaggatcgtg aagatgatgt tgtcgccgat ccaggcacgc aggccgccgg tggagacttc    287820
     ggtgtcctgg gcgagtacgt cgacggttcc atgcggggtg gtcgccagtt cgacgactgc    287880
     ggacgaaagg gacatgagca cactccatcg ctgagattcg gtgcaacctg aatgtggatg    287940
     cgcacgaccg taagtcgatc tcgcttttca tctcaacggg gtgtccgcgg cgggatcggg    288000
     tcatcggcgc aggtgaacga aacagtgcgg catcgggaat gtcgcttcca gcgacgaccg    288060
     cgcaacgcgg ggattcgcag cggtgaaccg cacaacggtg acggcccatg gacggtcgcg    288120
     acgccaaggg gtccaggggt gtagcggata tgggtgcaca ccctggctgg acaagcgcga    288180
     gactggggtg cgcgcacgcg gtgcagacgg ccacacccaa acgggtcagt cgagggcggt    288240
     tcacagcgag cggatcgagc gaacaggaag gcgtgcgtcg aagaaacgct cagatgcgcg    288300
     gtgaaaacgg gaccggattc ggcgatggat ttcggcggtg gattcgagcg ctcgaaaaag    288360
     cgcctcccac gcccaccccc tccgggggcc actccccccc ggcgttcctt gggggggagt    288420
     gtaatccaga attacgctca gcgccaacgc tattcggaac gcccacgtcg aacgcaatcc    288480
     gcagtgctcg aaccaccttc atgccgagca ctcatcgccc acgcgtgcaa gctgtgttcc    288540
     acagcgctca caacaccgct cgatcgacca cgcgaaccca ctcaccgagg cgcgcggcga    288600
     agcgctcgag agagcactcg aacgagcatt gaaagccgcg ctgaaacaca gcccgtagag    288660
     cactcggtga acgccccgca gagcgctcga acgagcgtgc cgaacaatgg cctgcagagc    288720
     gcccgtcagg tgcgagtcga gcacttggag ggttcggcaa tacggcctgg agatcgagtg    288780
     cgagagcggt gttcgccaca ccggcgggag tgctccgctc gagggggaca ccccgttgag    288840
     gaaaatcgcg ggtttctgtc actgtgctca aagacgcctc agcggacggc gttcaggctc    288900
     gacacgatcg aaaggcacag gcggtgagcg gaaatcacga cccactcaag gactgggtgg    288960
     tctcggcgtg gcgcgatact ttcggcgatt ccggcggtcg cgccggccag gtcggcgaga    289020
     acggcccgcc gacgcgcatc cgccgtttca ccccgctctc gccgatcgtc gtcgtcgccg    289080
     cgggcgttgc tgggtcctcc ccgcgtctga tgtcgatggc cgccgacaac gagacggtcg    289140
     tcgaggtatt gacgaggttg cacgactacc gggtgctgct tgtcgccgcc gcggccctgc    289200
     tcgtcgtcgt cgacgtcctg cgccaccgca ggcacaggtg gtcgcagatg ctcgaatcga    289260
     tggtccggca gggcaccgga cacctgccga agaaggtcgc cgtctcgttc ccgtcggggt    289320
     ggcgtgtgat ccgccgcgcg aggatcacac tgcaccgcgg caccatcatt cggcccaagc    289380
     agctcgaaga ggtctcccgc gcaatcgagg ccgcgttccc cgccaccgta cagagcgaga    289440
     ccaaagtgcg gcacgtggcg caccgcgacc gcatcgtcat cacccgcgag tcgatcgccc    289500
     cggacacgcg ttccgtccgt cagcggacac tacagtccgc gctcgatgca gcgtcgatgt    289560
     tcactgaccc gaaggtgtcg gtcgagagcg ttgacgagga cggcatcgag accggctacc    289620
     ggatcgcgtt cgagaagtcg atgaataccg gtgtgaaggg cttccagttc aaggtcgaag    289680
     aagccctcgc ctcgctggcg ggcccgcacg agtccggtcg caactggacc accgactggt    289740
     accccgaagg gggctatctg gtgatgcgtc tggtcaccgc gatgcccgcg cgcgtcgacc    289800
     acccgctcga gttggtcgac gagaacctgc ggcacctgcc gtatgcgacc ggtgccgcgg    289860
     accgaatcat gtactgggac gtctccacca gttccaacaa gccgcactgc ctgatcgtcg    289920
     gcccgaccgg tggtggcaag acatcggtga tccgcaccct gttgaccgag gccgcccgcc    289980
     gcggggttcc gttcgtcgga gtcgatccga agatgatcga actcgacggt ctcgagggtt    290040
     accccggctg cggcgcgatc atctacgacg cactgcgcgc ggcgatgttc gtgcgcgtac    290100
     tgcatgccga gatgatggcc cgcaacgcct acatccatca gatgaagatc gagggctcgc    290160
     agctaccgct gatgatcgcg gtgctcgatg agttcttcat tctctctggc aagtggcagc    290220
     gtttggccaa gaccggtgac gacgagaccc gcgcactgct caaagaactc gaccctctcg    290280
     gtgcgtgggc cgacctcgct gttctggccc ggtcggccgg tatccgtctg ttgctcggtg    290340
     tgcagcgccc cgacgcctct ctgttcggtg gtgcctccgg taacgcacgc gacaacttcg    290400
     gtacccgcat cagcctcggc aacctctcgc aggacggtgc gctgatgatg tggggcgatt    290460
     cgaccgtggg ccgcgaggtc gacacctccg tcaagggccg cggcatcgcg ctcggcgacg    290520
     acggcaaccc ggtcgatgcg cagatgtggt ggaccccgaa cgtcgaccgc caccccaaca    290580
     agtggaacca gctcgccgag cgcgagaagg cgatcatcga cggcctcatg cccaccgagg    290640
     ccccgcggtt cacctgctac tcgcaggagc tggcctcgtt catcgagtcc gagcgcgccc    290700
     tggccacgcg ggcacgcagg cacggccgtg ctcccgagcc gatcgttatc ggcgcgaccg    290760
     ccgccaccga cggcgacacg tccgccgagt cgccgactgt ggacgccgcg cccaccggcg    290820
     atgacgactt ctcggacgtc attccggcct ccgcggtcga ggccggccag accgtcctcg    290880
     tcgatgacga ccacggcgag ctcgtcccgg tcaccgtcga ctcggtcgac gtccgctgcg    290940
     gcgccgaggg cgatgtcgtc gagaccgtac tcaccgtggg caccggccgc gtgaagaccc    291000
     gcatcaccta cgacgccact ggcgtcgtcg tcctcccaga acccgacctc gtcggagcgc    291060
     ctgtatgacc actcgcggta actccaaatt tcctcgagga cacctcccga gactgacccc    291120
     cagctacacc aacaccatca ccgaaaggga acacccatga gccgccgtat ctcccagtcg    291180
     atcaccccga cgaccgagga cgtggccgcg ctgcgcggtc cgttcgtcgc caagggtgcg    291240
     aacgaccctg tcatcaagtc gcttcgggaa tacttcaaga gttcggtccc cacgtggctg    291300
     gccaagctca gcgaggagca ggagctgacc cgcgaccggc tcgcagagat ccgagccgcc    291360
     tcgtcgaagc gccgcgtcgt tatcgaagcg ctgcctgagg gaagcgcccg tgacaaggcc    291420
     cttaccgagc tggagacggc cgaggccgtc gtcgacgaca tggacaacgc gctgtccgga    291480
     gccagcgcct tcggggtcag ctagagatga cgccgactgt cgatgtcgag atcacctcca    291540
     agactactgc ccgcgccacc ctggcggacg ccaacgtgcc tccaatgaat ctggaggcgc    291600
     acgaaagcaa gacgctctcc actgttgtgc acgagttttt gcacaacatg gcgcaggccc    291660
     agggcgttga tgtcgaggtg gtctaccgga cagccaagga cactcggttc ctgaccgtcg    291720
     gcccggacgg gaaggcagag gaacgtgctc cgagcatgcc cctgccgatc atcaccgagg    291780
     ccccacctgg accggttgtg gagcctgtct ccacgcctag gggtgggccg gtggtggtgg    291840
     cggccgaaca gatggcctac gaggctgccc cgcaacccgt cgatgcctct acaccatccc    291900
     gggtggggca gcggccgacc gggccggtca caggcccgat caagggtcca ctggatgtgc    291960
     gcccgcagct ctccgcgccg cacgtaaccc ccgacgactc acccgacgtg gtttcgcccg    292020
     cccgcaaagg actgcgcggc accctcaaca cgctcggttt caagctcccc ccaaaatcgg    292080
     gatcctccga ggaacgcgca cgccgcaccg ccgctgtgac aggtcggtat atcgctacca    292140
     tcggccggca ggtggacgcc gacgcgacga ttgtggtact caaccccaaa ggaggcgttg    292200
     gaaagacacc gctgttgctc ggcatcgccg acaccctcgc gatgtaccgg ccggcgacct    292260
     cgattgtcgc cttcgacgtc agcgactccg gcggcggcct cgctgacagg gccgcagtcg    292320
     gcgccgacca cggacccgac gtatgggatg tcctcgaaca cgccgaagag ctgacagccc    292380
     ccggagtgcg ggccagcgcg ctgggaaggt tcacgatccg acagcccacc ggcgtcgaga    292440
     tcgtgcccgg ctaccggcgg atcgctgccg cggctatcga ccgccacgcc tgtgagatcc    292500
     tcgcctcggt cctgcgccgg caccgacagt tgctgctcgt cgacaccggc aacaacacaa    292560
     actcctcggc atggcagtgg gccaccgaag ccgatgtcgt cgtcattcct gtccccctgc    292620
     gcggcacgat tcccggcacg gtcgccgaga tgatcgatga cttggcgggt gtggcaccag    292680
     aggtcctcga ccgagtgctg atgctgatca ccgaaggtcc cgacgatgac ccggaaaccg    292740
     aattcgacga cgtggagaac ttcatcaggg gcggcatcgc gccggacagg ttcgtgcgca    292800
     ttccctacga ccggctgctg cacagcggcc gcatcaatta cccgcaactc cagccgaaga    292860
     cccgaacagc gctgatcgcc gccgccgcga aggtcgtcga gctgctgagc accatcgacc    292920
     ccaccgccgg gggactgatc gacaccacca aattgcactc gatcgcccgc ccacagccca    292980
     tcacccgtat ccgctcgtaa tccttcgctc acgtcggtct ctcgagcacc acagaacagg    293040
     agctacacca tgcccgtcac caaccgcgct acccgccgcc atggccggca ccgccgccag    293100
     agcgccaccc aggccgcgac cgtgctcgcg gttatcaccg cagccctcgc ctccggtctc    293160
     acactcaccc cgtccgcggt cgcggaaccg atccagggcg gcgtcaccgg cgacagcaac    293220
     caggaagggg tcaccggcgg tgacacccag actggaacca ccaccccgac gcctgcaccc    293280
     gagcccgcga acgcgcccgc gaccccggcg gagccggtgt actgggtcga cccgcccgcc    293340
     gcataccaaa acatcgagta ccagcccctc ccgaactatg actacgagac caacgcgtat    293400
     gtggcgccgg aggactacta cgtcgcaccg gtgcagtggg agcagttgca tcttccgact    293460
     ccggtggagc cgacgaagcc cttcatcgca ccccgggaca cccttcgtct gggtgagctg    293520
     cacatcaagc aaccaaactg ggtgtccgac atggaccggg accgcacgaa caacacgatg    293580
     gccgttgtgc aggcaggggt ctcgacgggt tggcggtcga ttggtgtgga aacctcgcgg    293640
     gccgaccgga tcgccgccgc gcaggtcggt gccggagcag ccggagcagc actcggcgca    293700
     gtcaccgcag gcggggcggc ggccaccgca ggcgcactgg tcggtggcac catcggcggc    293760
     ctcgccggaa tgaccgcggg caacgtcttc cttcccggac tcgggtgggt gcccgccggg    293820
     atcgtcggca ccgccgccgg ggcgggaatc ggtgccgccg cagcgggcat ccccgccgcc    293880
     gctgccggcg ccttggtcgg cggcggaatc gcggtggccg cagtcacacc gatcgctgca    293940
     ggcgacaagg gcgaaccgaa ggagatcgaa gtcccggaca tcgactccga agccgtgacc    294000
     gcacagaccg cgacggtcct cacggactgg gagaactccg gccagatcgg acaggcagcc    294060
     gcctccgcag tgcaggacac cgtcgagtcc gcgcccgcga tcgaccacca agcccgcgac    294120
     ttcgtcgctg cacagcccgg cgggcagcag atcatcgagc aggtcgacaa caccctgacc    294180
     tcgttcttca acgacgccac gcccggcctg gccgcaaacc tgttgtcggg cgccgtcggc    294240
     ggcggcattc cggccgcgaa ctgacaccac gaaggcgggt gaacaccatg aagaagacga    294300
     ccctcggccg atcgacgccg cgacaccccg cggtactcga ccttctcggt agcccatcca    294360
     ccatcgacca tccgccgggc gcccgcacca tggcgcccgg cggcccggcc acaccactgc    294420
     ccccaccccg gtctcctcta ccgtccccac gcggccgccg ccttggaaag aacgcggtgg    294480
     ccgacattgc agcggtcgcc gtcgtggtgg ccggcggtgt ggccatcagc cacctgcgta    294540
     gcggagatag tgaaaccgcc tctccggcgg ccacaaccac ccccaccgcc accgttgcag    294600
     ttgacgagaa tgggctgccg atcctcaact tgcccgaacc cgagcagacc gaaaacgcat    294660
     ccgcgtcgga cggggattgc cgggcagacc gcggtgatca gacgagcggc gcaggcgtga    294720
     tcgcagcctt caaccacgcg tactacagcc tgcgcaacgg cgaagctgcc cggggcctcg    294780
     ccacctccac ctcatcggtg ctgccaggtc ccgaactgca gaaggtcatt gacgcggtcc    294840
     cgatcggcac caactattgc ctccgcaccg ccgagctggc cgacggggtc tacctggtcg    294900
     atctgtcggt aatgcagccg gctcagccag ccaaacgcgg cacccagacc gtcaccaccc    294960
     aggaggtcga cggcaaatgg tacgtcgacg tcttcaactg agcacccccc cgcaaggact    295020
     tcagcgaaag atgcccgtgt cctgcacacg gccgcgatgt gcggccacca tcgcagcaga    295080
     gaccgaaaaa ggagcctggg tcacgccgac accccgttga ggtgaaacgc cgaaatgggt    295140
     gaaggtaggc gtcagtgtcc gttccggtaa tcgaggtgcc aatgcccgcc agacgttcga    295200
     gaacgcgtcg caccgtcgcg ctgatcgcca ctgcgaccgt cgccggcggc ggcgtcgcgc    295260
     ttaccgcacc cgcgatcgtc aacgccgccc cgatgaactg cgcgacggcg ttcaacctgt    295320
     tcatccccgg cacatgggag accaacgagc acgccgaccc aaaccggccg gtgggcatgc    295380
     tggctcccat cgcggaggcg atcaaggcga agaacggtgc ccgcgcgcag gtatacacgc    295440
     tgccgtacat ggcgcgcgcg ttcgacaacg gccacaccta cgccgacagc aaagccaacg    295500
     cggtcagcaa ggccaccgcc gtgctgaaga attacaccga caaatgcccg gacgcgaaga    295560
     tcaccatcac cggatactcc caaggttccg acgccgcagg tgatctcgcg tcagcaatcg    295620
     gaaacgatca aggacccgtc gatgccgacc gggtcctcgg tgtggccctg ctcgccgatc    295680
     ccggtgccgg tacgaagggc gccgcgacgg ttgggccgaa gacctccggg caggggatcg    295740
     ccggtccccg ggaacagggc atgggcaagt tgtcggggcg ggtcgcctcg atctgtgacc    295800
     cgaaagacct gtactgctcg atccaaaagg gtgccaaccc gttcctcgga tcgctcgggt    295860
     cgattctgtc gaagaccaca ggcgccgccg atggcggaga tggcaacgcg gcggtcgcca    295920
     ccgcgctgac gtcggatttc actggcgccg acctgcccgg tctcggctcg aatctggacg    295980
     ctctcggaaa gcaactgcgc gacaccggcg gctccgtcga cgtgaaccag atcgccgaca    296040
     ctgcgaccgc gctgtcgaag accctcagtc ccctggccga gctgctccag tccggggccg    296100
     caaacagtgc cgccaccggc aacctcgccg cagccctggc aggcacgccg gaaaacgccg    296160
     ccgcgcaggt cctcaccaca gccagccacg cggacctgac tggtgcgctg gactcggtgg    296220
     ccacaatcgc gaacaccgcg gccaagcttt cgactagtgg caccaccacg ctttcctcca    296280
     ccgaccctca gatctcgcag ctctccacga ccgccgcgtc actcggtagc cagatcgccc    296340
     ctgtggcaac cacacccgca gatgccctat cgaccgcgtc gagcgtgtta tcggtcctca    296400
     aaccgacagt cgtcgtcgag caggccctta acgtggtcac cggcatcacc gccctcgaca    296460
     tcccgaagat cttgcacagc ctgatcgtgc tcccacagaa gatcgccgcc ggcgatgtcc    296520
     gcggcgcccg ggacgccgcc cgggagctga acgtgcagtt cgcgccgttg gtgaagatgg    296580
     ccgctgctgc cgatttgaag tgggtctccc aaatactctc gatcatccca gacccgaccg    296640
     gctacaccca gatcgcagcg ctggtcacca gcattctcgg caacgtcgac gtgatcaagc    296700
     tggccaatat cgccggccag gcccaggaaa tcgcctgggc cgccgcggac aaactcttcc    296760
     caccgcccgg agtgctaccc gacccgctcg gtgccgcggc gcagaccgcg gcgttgatcc    296820
     ccctcggcct cgaactcgcc tcggtggccg cgaacatgct caccggcaaa gccagcaaga    296880
     ccgaccccgc gctactgggc aagcaggcca acccggtggg caacgcgatc accacgcagg    296940
     cccaaactct cgacctcgca ggcctggccg gatcagtgtc cacgatggcg cgctcgcagg    297000
     gggccgagga tctcgccgcg gtcgtcggcg agggcctgaa cgcagccagc ttcttcgcct    297060
     ccggtgccca ccagagctac caaaccctgg tcgtcgacaa cgccggccgc aatgccatcc    297120
     agtgggtctc cgattggctg aacctgcaaa tcacccgcgc cgtctgacga cccggcggcg    297180
     tcagtccacg agcgcacgag aagaggcaca cgcgatgaca acccaccgat cacacaaccc    297240
     gtccgcacgc tggacctggt gcaggcgctg caaacaacgc ggttacttcc tcagatccga    297300
     cgccaagaca gtccgcaaac gtctccacac caccagaggc ctggcagtct ttccctgccc    297360
     gcacaacaac gacctgtatc acgtcggcta acgccccacc gcactcagtc gaggcatcat    297420
     caccagacgc caattacgca gacagacagg ccaaggccca acgtgacgac ggcaggcaac    297480
     cgtcgcacgc gtgaaacatg ccctcgagct gggaccgttt acgaccacgg ttcggccgac    297540
     ccaccacaga ctctcagaac taccgccgaa gcacaccgac tgtcgcttcc acgaaaggcg    297600
     cgcgtgaaca gcttctcgat cctgccagga tgcccgtcat cgccggtgat cctgcacgta    297660
     ccgcacgcct cccgcacgat tcccccgcag gtccgcgcac agctgctgct cgacgacgcg    297720
     gcactcgacg ccgaactgga cgaggccacc gataccgata ccgacctgat cgccacgctc    297780
     ggtgccgacc acgcacgcac ccatccgtgg atcgtgaaga acgccttgtc ccgactggtc    297840
     gtcgaccccg aacggttccc cgacgcagcc gaacccgcca cagtctttgg ccgcggtgcc    297900
     gtttacaccc gcgcatgcga cggaaggcgg ctcagggacg aaccattcgc cgacaccgag    297960
     gggctcctcg acgagtactt ccgtccgtac gcccgcgctg tcgccgaact cgtcaccgac    298020
     cgcatcgtcg catgcggacg agcagtgatc atcgatgtcc actcctaccc cgaacgcccc    298080
     tccggattcg agaacccggc cgcggcacga ccagccctgt gcatcggcac ggatcccctc    298140
     cacaccccgg actggttgac gagcgcaacc cgccgggcct tcctgccact tggggagatc    298200
     gctgagaaca ccccctacac agggtgttac gtgccgctta accgctacgg ccacgacgaa    298260
     cgcgtatccg ccgtgatggt cgagctgcgc cgggacacct acctgcccga cgatggtcgc    298320
     ccaggaaaac aatcggtcgc gcagctcggc acgtgccttg ccgcactcat cgacacggca    298380
     accgaggtcg gcgccgatgt gtaaacccaa gcccggacca cgctgcaccc cgcacatgcg    298440
     caaccgtctc caccgcgctg cgacgcggtt gaccgaagcc cgccgcgacc tcgaaaccca    298500
     tccggacgcc gtccatctcc agcaccggct cagcaaggcc gaatccaacc acgccgagat    298560
     ccaagccctc tacgacgcca caccgggtgg ccaacaagac ctgcggtcgg cgatcaagag    298620
     cgaagccggg cccgcacgaa gcgacctcga gcgccgcttg gcggcaggtg acagactgcg    298680
     tgcgaaccaa atcgaagcac tgagccgcgc ccgaaacatt ggggaagatg ttcgaaccga    298740
     aggagctgac agcaatgaat cacgagcaga tgacgcagga gcgcagggag gcgttctggc    298800
     ggaagtaccg gtggacgccc gaactgccgc cggagcagcg caaggcgatc gagcaggtct    298860
     ggacggacga gaagatcgag gaagccgaag ccctcggctt ctgatcggtg gacgccgagt    298920
     cgacccgctc gccgcgcatc gccggccaga gtccgagcga gccgacttcg cggcgcgtgg    298980
     gctatcgagc ccgaccctgt acgagctgcc gtcgtcggat gctgatctgt accgcacaca    299040
     aatgctggaa ctgacccgca acaaccggta cgcatcctcg gtctacgtct atgacgaggg    299100
     cgaatacgcc gagatgagga tactggtcac cgacgatgga aaagccggcg ttgctctgaa    299160
     ggacgatgaa gtcgtctcgg tgttctccca tgcctacggc gcgcatccca acgcggcacc    299220
     gtcgatgctg cgccaggcca ccgtcctcgg agggcggcga ctcgactgct tcgacacggt    299280
     tctgccgaac atctatgccg acgccggctt cgtccccgtc gcccggctgg catggaacga    299340
     cgactacgcg cccgacggct gggactacga cacctaccgt cgctacaaca atggacggcc    299400
     agacgtcgtg ttcatggccc acgatcgggc agcggtcggc tcactgtatg accgagcggc    299460
     cggtgagtat gtcagcgact acgacgacgg tatcgctgcg gcgaaggcct accggaccac    299520
     acaaacgggg ccgtagatgc tgttccttca gaagccgttc gcggcccctg gcgagcttcc    299580
     gggggccagt tcggctggga tcgtccatat cgatctgccg tcatgcgtcc ccctcgaatg    299640
     cccccgcccg ccccgttagc ggaggatcga gggtgacgct acttccctgg gactccgtgt    299700
     gcgccgtcgg gtgcggaaac acgccctctt ggccagtgca gccgagaaca tcggtgcccc    299760
     tgtgtcgttc acgtgaacta caatccagaa acgtcggtgg caaccgactc ggggtgacgg    299820
     tcgggcgcgc gggggcggtg ccggatcgtg ggttatgaga cgaggtccgg ggtgagggac    299880
     agggccgcct gcgccagcca cgggttgtgg tagcgggcgt aggtgcacgg acctgctgcg    299940
     gtgagcctat ccgcgaggtc cctcgctgcg gtatccaacg gcagctcagc gaactggtcc    300000
     aagctgatgt cgtagctgat ccagctgact gcaacggcgt caccgccggc ggcgcgatgc    300060
     accggtgtca cgaagtcgag ggcgtcgtac tgatccttca gcactgcgac cggacgtccg    300120
     gcagcttttt ccaggaccga ttgtgtgacg aagacggtgc cgctcaggag cggtccgtcg    300180
     tcgtccgtca acagacgcag gtagtaggtc tcgatggcgc cgacgttgac cgtgaacaat    300240
     cggcggtcct cggcggtcct gttggtggtc ggcaggcagc tgaccgacca ggtgtcctgc    300300
     tgcgtggcag cggcgttcgg cacggcggtg tcgaggtatt cgcgcaggat ctccacggcg    300360
     gcgtcgtatt cgggcatgga ctcgagttgg cggaagttct cttcggaggc cgaggggtac    300420
     cgctgacctg tggtgtgcat gtggctcctg aagattctgt ttgacaacgt tagtgagatg    300480
     tcgtgctcgg atcgcatgac accgtcgacg ccgccgacac gatgacccga tcgcacagtc    300540
     tggcatgcac gcaggtgcgc cgagaccgtg caggctggga ggactggact tctgccttgt    300600
     cgccctgcgg ccgttaccgg ccggctacag cccgatcacc caggcgtcgg ccaccggcac    300660
     accgaccgta cgccgcgccg gcaacgacgc gtcccatgac tcaaagaccc aacttccaca    300720
     cctcgacatc ggacccgccc gcgacgcctc ggatgaatgc gactactcgg tgtacggacg    300780
     ggaaggcagc gacagttccg cggcgaccgc gtcctccgcg ggggagggct ggaccagccg    300840
     gtgcaccggt tcggcgcgtt cggcccagtc gccaccgacc tcggcggcga cctccgggtg    300900
     gtgccggtgt cggcggatca gcagcgtctc cacgtcctgc ttggtgaacg tgccgtccgg    300960
     cgccaccatg gtcgggtcca gcagccgcag cagttcggcg aacgactctt ccctaccgtt    301020
     gtgcggggtc gccgaggcga ggatcagggc ttcggtgttc ggggccaaga cccgcgcgag    301080
     ctcgttgttc tgggtgccca cgttggtgag gttgtgcgac tcatcgatca ccaccgcatc    301140
     ccagtgctgg cgctcgaggt gagccttgtt agcgggggct tttgagggtg tcgatcgaga    301200
     tgatcgcccg cttgaagtag gtgaacgggt tccgcgtcgc gggcagcttc tgccgcacct    301260
     tctggatgcc ggccgagtcc agccgtacga acggcaacgc gaaccggcac cacagttcgt    301320
     gctgcatctg ctcgagcacg tgcttcgggg tgacgacgag aatccgctcg ccgcgcccgc    301380
     gccgcaccag ctccgacagg atcatcccga tctcgagggt cttgcccagg cccacggcgt    301440
     cggcgatgag gatgcgcggg cggatgtgct gcggatcgag tgccttcgcc accgcggtgc    301500
     gctggtaggc gagcgaatcg gcgagcatgt gcgtcgatac cgtcagcgac tggtcgccgt    301560
     acggtaccgg ggtcttgcgg agaagggcct cgagccacag ccggctattg cggtaaccgg    301620
     cggacgcgtc tgcgactact tgggcctggg ccgggtcgag gacctcgatg tcgtccaggc    301680
     ttgagtagaa cgccgcagtg gtatccgcca ccagctcgga gagaccacga acccggacca    301740
     accaaccatc cgacccctgc tcggcctggg tgaccagcca ctcctcgtca cgcacgacaa    301800
     cgatcgagcc gggggcgacg ttgagttcgg ctgctggtct cagcacgggc aactcggcgg    301860
     aattcaacgt ggtgctcacg tcggctaccc actttctggt gtgttcgtcg agccgcggcc    301920
     cgttgcggga aatgatgccg gcagcgtcct tagcgtcgcg ttcctcgggt cggcattgag    301980
     gcgtgtcctt ctcgcgcggt ctggcagggg cttgggttgg aggcttctca atcgttcctg    302040
     catggtcctg ctcgtcttgc cggtccatct cgccgatggc gaccagttcc gcccacacaa    302100
     tttcgcggag cgttcttgag tttctcagat ctctgaggta cgccaattga gctctgctgc    302160
     ctttcagaag gcccctctcg tgacgagcct cttgaagcgc ctccacgatc cagtcacggg    302220
     actccttggc ggtcctgagc cacgattccc ggagagttgg ccacgcctcc cgaacgaact    302280
     cgacggtggg gcgggcaccg tagaccgttt gcagcgcgac agccgcgcct acttcctggt    302340
     cgtatgcgtc cagtagttca cggcacaggt catgtagaag cgatggcggt aggttcgacc    302400
     acttgaactt gtacctcggc accgcaatcc tcaagcttcc acgtgaaccg gtgtcggtct    302460
     tcagtccggc ctcagacgac cccgagttga acatagttct tatcgcaaaa agcgtaggcc    302520
     acgttaacca gaccgcccga cagctatacc gctatcggtt cagtggctga gcgcctcttt    302580
     cgacgtggag gaaccctcac cggggtcgga tactgacacc actgggcagt cgaggacagc    302640
     gccggtgcag accgaggcgg cgttgggggc tgtcaggtgc cggcggtggt gtctgcgttt    302700
     ggaagggctc tgggtaagtt ccacaccttg atggaggaga cggctgacca gttcaccgag    302760
     acgttgcggc agtggttcgc gtttcctgga cgcctggtac ccgatgccgg aggagggagg    302820
     gcgctcgcgc acgatcgtgg cccgggtgcg cgaggagctg gtggcgatgt accggtacga    302880
     tgtctgccgg tcagcatgtg gcagggagcc gcgttcgggg tggttcaggc ggtgaacacc    302940
     tgggctcatc acaagcatcc gtgaaagggc gccccgcgcg ccgagcggaa ccaggagggg    303000
     gcgatctcgg gccgcttcga caagctcgtc gcgggctgac caggccccac agacagcggc    303060
     cagcttcccc tgccggtagc cacaggtgtc gaatcgtccc tcccgaatgg agggctttct    303120
     tgcctatcag taaagttgat tttgccccac ccgccgcgtc agtcgtgttc cgcggcggtg    303180
     ggatccattg tcccaccgcg cggctcgccg ttccgggtag caaattaaca tgcatcgtct    303240
     accatagcaa ggtaacttgt agtcatgcac gcggagccgg tcatcgcaga gagcgcctac    303300
     aagcatggga tcgactccga ggacatggtc cacgccttca acaacgcgat caaggcgtac    303360
     tccgtggacg agggattcgc catgctgatc ggtcccggac gcgacgcgtc cctcatcgag    303420
     gtcggttacg tcacgtcgtc ggacggcgcc cacgtcatcg tccacgccat gaaggcccga    303480
     ggaaagtacc tgaggtgatg aacatgccac gcacaaccga agagatcctc gcgcacgccg    303540
     acgagctggc gaagcgattc gaggactacg aacccaagca ggaggacgag cgcgaccccc    303600
     gcgccctcgc cgccatccgc accgccgtcg tcgcccgcgc caaggccgag cgcatcctca    303660
     ccaagagcat cgaggaagcc aaggccgatg gatggtcgtg ggcatcgatc ggcacggaac    303720
     tcggcacctc cggtgaggcg gcccgccaga aatacggcac gtcgcccacg gcgcccacga    303780
     agaaggaagg ggtacggaag gccgcgtcca agggcaagat gccagcgaaa accccggcta    303840
     aatccgcggg gaagatgccg gccaaggagg cgaagaagac cagcgccgcc accaagaagg    303900
     cccgcaaagc gcagcaccag tcgatcgagg acatgctcaa gaacagcgag ggccgcacct    303960
     ccaagcgggc accgaggaag gcatcaaacg cgaagatctg acgtcagaca cgacaatgcg    304020
     ccccaccctc ccagcatcgg gaaggtgggg cgcatttgtg tcggtaggcg gtgtaatttg    304080
     cccggtgggc gatctggtcg gagagggaag ctccggtcgg gccgcccatt tgctccgccg    304140
     accggggccg atccgcggtt ctcggaggtc gggtgtcggg gtggtcgtga tgcgcacgaa    304200
     ctgcgcgatg acgccctcac cggcccgccg ctcgaaggcg gcatgcccgg tcagcaggca    304260
     gaacaacgtc gcgcccagac cgtacacatc cgatgcggcg gtcgacggtg cgccatcgag    304320
     gacctccggt gcggtgaagg ccggggaccc cgcgatagtg ccggtcgtgg tctggaacgc    304380
     accccctacc cgggcgatcc cgaagtcggt caattgtggt tcgccgtagt cggtgatcag    304440
     gatgttggcg ggtttcacat cgcgatgcag gatgccgaga cggtgggcgg tctcgagcgc    304500
     ccccgcaagc ttcactccga tcgccaggac atccggccag ggcagcgggc cgtggcggcg    304560
     aacctcggcg tcgaaggagt cgcgcgaatg gtagggcatc acgatgaagg ggcgaccggc    304620
     gtcggtgatc ccgacctgga gcacgggcac gatgttcggg tggccggata gtttgcccat    304680
     cgcccgttgt tcgcggacga accgatcgcg atcgtcacga tcgacctcgg tggtcaacac    304740
     cttgatggcg acggtccgct ccagtgccgg ctgcgcgcac cgatacacca caccgaagcc    304800
     tccgcggccg atctcctgtg cgtcgtcgaa cccctcggcc gccaactcgc aggcgatccc    304860
     gcgccgcccg aggtcgcgtt gcgtaccttc tggttcgata tccgacattg caggtctcga    304920
     tccgcgtgca gcttcatcgg ctgaccgccc gagtggctgg ccccggatcg gcctcagtca    304980
     aggatacgtc gcccatacat cacccatgcc gatactcaga tgatgtgcgt cggcgaacag    305040
     gaatgcctca ttcctgtccg ccatgtcgtg gggacgtgtg ctatcgacga gatcggcgaa    305100
     gaggagaccg ttgcgaccga agtccgccag ccgtagggca aggtggggaa cgggacaccg    305160
     gccgcggtat ccggggtcga cggcgacgac gacgagatgg ccgggccggg tcagatcacc    305220
     gggtggcgtg cggaggtcgg caagagtacg tgccgtgtgt gttcggtcgg cggccgatat    305280
     tccggtggtg accccgtagg ctgcatcgac cccgatgcac tgccggtaac ccacccccgg    305340
     tggtccggca aacatggtcg gggcggcggg aaggagaagc cggtcgcacc gcggagcggg    305400
     cagggcaatc tgcaggaagc cggacgtgtg gcggatgacg aacgcggtct gctcgacggt    305460
     ggccgtggcg gccgaatagg ccagcatggt tcggtctccg tcacacaata cgatcgtctc    305520
     cccgagtgcg aggcgagaga ccgtctcaga tagggccgcg gcggttccgg ccggtcgacc    305580
     ggacctgcgg acggggggtg cttcgagttc gatggtcatg atgctccacg cttaggtgtt    305640
     gaccggagtg cttgggctga gagggagtga gccgctgaaa gctgcttggg cggagatcct    305700
     ttcccgggcg ttcggtgcga cgagttcggc gatgatggcc tgatgctgcg catcgcgggc    305760
     ataggtcacg tagttgtcgc gattgtcgaa caacgcgacg atgccgaagt ccgcagtgtt    305820
     ttcccgcaac ccgagatcgg gtccggcatg atagaacagc aggccgggca ccgtgaccgc    305880
     gtagctgttc aaggcggccg cgacccggac cccgtggtcc ggaccgaccc cgtccttcca    305940
     gctgatggtg acgctgtgta ccaccgcact cggcggaagg gtgatggtgg ggtgatcgct    306000
     cacattctgc tccttgctca ggactgactc gggacgggca tatcggtcga cgggtgcggt    306060
     gcgtgcccga caagggcgcg ctgcaacagc actcgaacgt cgtcttcggt gacgggacgg    306120
     ggattggcgt acggactcgc ggtgacctgg cgtgcgacct cgccgatctc ggttgcggag    306180
     aatccgatat cggccagggc cgtcggcatc ggcagtgagc gttgcagatt ccacagtgcc    306240
     gtccacggct cgccgtcacc gaagacatcg gtcaacgcca cgaccatgtc ggcggcgaac    306300
     ggtgcgttga aggccagcac gtgcggcagc acgatcgcgt gggtgtgcgc gtgcggcagg    306360
     ttgaatgtgc cgccgagaac atgacacagc ttgtggtgca gcgacatcgt ggtggtgccc    306420
     agcaccgccc cgcagagcca tgcgccgtac agtgcttcgc ccctcgacgg caggtcgtgg    306480
     gggtcgtcga cgacgcgtgg cagggcggcg gccaaggccc gggccccttc acgggccatc    306540
     agggacacga tgggggagcg atcgggggca tacagcccct ccacggcgtg ggcgatggca    306600
     ttcatcccac tcgcgaccga aatgtccacc ggcaggtcgg tggacagggc cgggtcgtag    306660
     accaccgccc ggggaaggac agcctggtcc cggccggtgc gtttgatccg gttgtcggta    306720
     attccccaga ccggggtcat ctccgacccc gcatacgtgg tcgggacagc gatgattggt    306780
     aagcccgtgc gcaaggcaag ggctttcgcc aacccgatcg cggagccgcc tcccaccgcg    306840
     atgtagccgt cggcgtccag gtccccgctg acctggacgc accggtcgac gacctcgacc    306900
     ggaacatgca tcacggcctc ggcgagcacc ccgacgaccg cctcgccgac aatccgggtc    306960
     acggccgcga cgaccggttt gggtccgggg gtggagatga tcaccgccct gcggatcccc    307020
     agatgctcga cctcggcggc gagtggctcg agtccgcgtc cgaacaccac acgcatcggc    307080
     agagcggtgt aggagaaggg gtcagggagc atcggtgccc ccaggcgcgg cgggggccag    307140
     caccaaatcg actgtggcca aaggggagcc gatctcgacc ccgaactgtg ccgcgtgctc    307200
     ggcatcggct gtgcccatgt ccccgacgag ggagtgtttg accgcgaaga cggcatcgga    307260
     gtccaggtat gggctgccgg gcatgaagat gtgggtggtc agcgggcggt gctggggggc    307320
     cgcggcgatg aagtgaatgt gcgccggccg gtacggatgc cggccggtgg cgtggagcag    307380
     ttcccccacg ggcccatcgg tgggaatggg gtagtggctc ggagtcacgg tgcggaacca    307440
     gaaccgtccc tgctggtctg tggtgaacag gccgcgcccg ttgccggccg gctggagatc    307500
     gggttgctgg acgtcgtaga agccctcctc gttgcactgc cacacatcga ccgtggcgtg    307560
     cgggagaggt tccccctgcg tgctgcgcac tgttcccgtc accagtaggt gctgcggggc    307620
     accgacctca tcgatggtgt caccgagttg tcgggccggg gattcggtca tgtggaaggg    307680
     gccgagcacg gtgctgtccg tcgcgccggg tgcctgctga tcgttgatcg tttcgacgag    307740
     catcgagacg ccgaggacgt cggagagcag gacgaattcc tgccgtaccg ggtcgcattt    307800
     tttcccgacc gcggtcagga actcgatcgc ggtttcccac tcggggaggg acggctcgat    307860
     ttctcggacg aagttgtgca ggtggcgcac cagggccgtc acgatggcct tggtccggac    307920
     attgggggtg ccgtcgaacg accggatcac ttcatcggtg agggtcgcga tgtcgacgtc    307980
     gccggtgtgc gtcgatgtca tatcgtggtg tcctcgaagt ggatgacgtg ggggatcttg    308040
     acgaagtagt ggccgatcgc ctcaccgagc aacttcccgt tcgtcgacga cgcgaacact    308100
     tcggtgtggg cttcgacgga gtcccagccg acgcgcagca aatagagacc aggatggtct    308160
     acactgcgca cgagctcgac agtcttgccg ccgttggcgt cgagaaggta cttcttcgcc    308220
     cgagcgaagg cctcttcgaa ctcggcgctc ttgtcggcat cggttgtgac gtaggcgtgt    308280
     tcgtagatca tggctgctcc gtaactatca tggcgggtgg cctcggcggc actcaggcgc    308340
     tgacgaggtg gtcgaggttg aggaaggtgc cctggtggta caccagcggc agttcctcgc    308400
     gcagaacgtg cagcttgctc acctcgccca cgacctggag gtggtcaccg agcaagcggc    308460
     tggagtgctt gacgcattcg aagacaaccg acgcctcggc gagaatcggg tcgccgttgt    308520
     ccgagggagt ccactcgacg ccggcgaagc ggtcgactcc cttgccggag aaggatcggc    308580
     accgttcgcc gccgccgtgg ccgaggatgt tgatagcgaa ggtatccgag tcttccatcc    308640
     gcggccacgt ggtcgactgc gtgtccacga aaaaggtgac cagcgccggc tcgagcgaca    308700
     cggatgtgaa cgacccgacg gtcaagccga ccggattacc atcggaggtg gtggccacga    308760
     tggcaaccgg tgtgggcacg tgccgcatgg agcggcggaa catcatcgga tcaatctgtg    308820
     ccggcgcgac tcgggaagtg ttctggttca tcgctataca tccatcgtga gtgcgtcgtc    308880
     cgcgccgatc aacaggcgcc cgtagacctc tttgccgacc tcgggggtga cgtaggcgtg    308940
     ccgccccgcg atctctgcat cgcgccagat ctggttgagg acgttcgcgt cggcgaacga    309000
     gccggccccg ttggtggtca tcaggatgtc gatcccgtcc ttgacgagct ccgcgatgat    309060
     cccggtgttg ttccggatcc gcccgcgggt gatcaggtcg ggcaactcac cacgtgcggc    309120
     ggcgttgtcg atgtcggcgg tggcctgctg catcaggagc tcggccatgt tgaacttcgt    309180
     tgcggccgcc gccacgccga gctgatgcgt cggcgagttc ttcgccgccg tgtacctggt    309240
     gtaggccacc cgcttgttcg gcagtttctc cagtgtcagc tccatcgcat gccgagccag    309300
     accgagctgc gcgccgacga gaatcagcgc ggcgaccggg atgaacgcca tgttggagtt    309360
     gcgttcggtg ctcttgtacg gggtggcgaa gtccgcctcg cgcattgcga cgaaccgctg    309420
     aattcggtgg tccgggacga agtggtcttc cacgacgatg gtgtcactgc ccgatccctt    309480
     catccccgcc acgaaccagg tcggcttaat cgtccacgca tccttgggga tgagcgcgag    309540
     cgcacgcggg tcctcgcctt cctcgacgtc gagggcgata cccagggtgc cccagtccgc    309600
     ggcgaacgat ccggacgaat acggccactg gccactgacg atgtaaccgc cttcgacccg    309660
     ctcggccttg ctaccgggcg tgaagatgcc gcagcatttg gcgtcgggat tcgcgccgaa    309720
     cacgtcgtct tgcgcctgct gcgagaacgt ggtgccgaac caggtgcaca cgttgagcag    309780
     tgcgaccgcc catgccgtgg aaccgtcgcc cttcgcgacc tcggcgaccg tctccatcgc    309840
     ggtccgaagg ttttcctcgt agccgccgta gcggcggggc acgaacagct tgaacaggcc    309900
     ctcggcctcc agcgcggcca tcacctccgg cgcggcacgc cggtcagcgg acccctggtc    309960
     ggcgtactgg cggatcagcg ggatgagcgc ggtcgccttg ccgatgacct cccggttcgg    310020
     acgcgaggcg tcgacgtcgg cggtctccgt gctggtgggt tcgagcgtct gagtcatcga    310080
     aggtctcctc tacactgatg aatgtgaccg gtgccacgtt gttatcgaag ataatgagca    310140
     atcgcggccg tcgaaatcct cataacgcga tcgcgtatcc acttcgcgac tttcttccgt    310200
     aatcgaggac ttcggcaggg cgcagcaccg ttagtgaaga ggtccacaat gaagcacaac    310260
     gagacagcac acactgggcg gcaacagaga tcggatgccg aggtggcggc gatccccaag    310320
     atcggggaaa gcagcatcct ctgcgtcacc aacgacttgg atgagttccg agccagcctg    310380
     aacaccgtct tctaccccgc cgatatcggt ttcgtcggga gtcgaacgcg ggtgtcgagc    310440
     gccgaactct ccgccgtccg gctgaattac ctcaccatcg gccgcgccag gttcggcagt    310500
     gaagcgcgag tcgatcccgg ggatctcggc acctaccacg tcaatgttcc gctcgaaggt    310560
     tcagtggttt cggtgtgcgg ttcccagcag atgaccgcca caccgcaaca cgccgcggtc    310620
     ttcagcccga acgagcacac aatcttgccg cggtgggatg ccgacgccac tcaaatctgc    310680
     atcaagatcg accgggcggg cctgcagggg gagttggcgc aactactcgg gcgcccgatc    310740
     gaccagcgga tccgcttcga cctcgccctc gatctgacga cccccgccgg cgcccgatgg    310800
     ctgtctctgc tcaatctcct gctctccacc ctcgacgacc ccggcctcgt cccgaccccc    310860
     ggcctcgccg cccacgtgaa ctacctcgag cgggccctca tcgcgggtct gctcgtccac    310920
     cacacccatt cgatgagcgc cgaactgaac gcaccccagc cggtccgcag cccccacgcc    310980
     gtgcaaaagg tcctcgacca gttcgagtcc gtccccggcg cccaatacac catcggcgat    311040
     cttgccgcca tcgccggaat aggtgcccgt cagctgcaga aactcttcca ggaccagttc    311100
     ggaatgcccc catcggtcta cctacgacac ctccgcctcg acggtgtccg acacgacctc    311160
     ctcctcggcg acgagaacac caccgtcggt cacaccgcct tcaaatgggg cttcaatcac    311220
     ctgggccgat tcgccaacag ttacgaggac aagttcggag aatcgccgtc tcacacgctg    311280
     cgtgcggcga tcaggaaaac acattgagcg cggtgctcgg gtccggcttg atcgtcttct    311340
     caggtgaaca cggggcctgt gtgcacgcac cggccacgac gaccgctggc cgatgcagct    311400
     ggggatggcg tccgattcgc aaagtggacg aaccgcctcg cgaagtggat ttccacggac    311460
     cagtctgtag cctatcgtca cattcgatga cgaacacacc acggccggac tgagaatcag    311520
     tcggaccggc cggaccgacc tgcaggggcg ctccaccttc cgtccggccg ccgattccac    311580
     ctgtgtcgga aagtaaatgg ccggcgcccg ggagatgccg atggaacaga caccacgaag    311640
     tgccgtgacg ctggcaccca ccctggacac atggtcttgg cagctgcgtg ctcgatgccg    311700
     atcgatggac accgagttct tcttccctcg ggtgggagaa ccacacggag cacgcgtgcg    311760
     ccgagaacgg gcagccaaga ccatctgcag tatgtgtcct gtgcaagaga actgtcgcga    311820
     gcacgcgctc gcgacaggag agtacggagt gtggggcggt acgtcggaca ccgatcggcg    311880
     acgaacacgg ccggcgcccg ttttgcggaa acactgagat cttgccccat tgcaggcgga    311940
     cgagcaccac tgtccacgac ggaacaagtg cccatgttcc cactgctcga tcgcccgaag    312000
     agtccacacc gaggagaaac cgcaaatggc gccagacacc gctcagatag aaacgcttca    312060
     ggaaccgttg accgacgagg aaatcttctc cgcgcatctg ggcggcaaac tcgctgtcca    312120
     ggcggtcgtc cccctggcct cccggcgcga tctgtcgatc gcctacaccc caggtgtcgc    312180
     ccaggtgagc cgtgccatcg ccgccgatcc gcaactggca cagcagtaca cgtggaccaa    312240
     ccggcttgtg gtggtggtca gcgacggcag cgccgtgctc ggcttgggga acatcggagc    312300
     ccgcgcgtcg ctgcccgtga tggagggcaa gagcgctttg ttcaagcaat tcgccgacct    312360
     gaactccatc cccctggtcc tcgataccac cgaccccgac gagatcgtcg agaccctggt    312420
     ccgactgcga cacagtttcg gtgccgtgaa cctcgaggac atcgcggcgc cgcgctgctt    312480
     cgagatagaa gaacgcgtca tcgccgccct cgactgcccg gtcatgcatg acgatcagca    312540
     tggaaccgcc attgtcgtac tcgccgcgct gatcagtgcg gcgcgcctac agaatcgtga    312600
     tattcagtcc ctccgaacgg tcatctccgg tgcgggtgcg gcaggtgtgg cgtgcgcgaa    312660
     aatgcttctc gcgcgcggaa tctcgaacgt gacagtgacc gactccgtgg gcatcgtcca    312720
     ttccctgcgg gatgatctga acgcgtacaa agccggcctc gcggcgtgta cgaacccgga    312780
     ggggcgaacc ggtggtctcg ccgaggcgct cgtcggcgcc gatgtcttca tcggggtgtc    312840
     ctccggggcg gtagccgagg agctgatagc caccatggca ccggaatcga tcgtgttcgc    312900
     actgtcgaat ccggaaccgg aaatccatcc cgacgtggcg atcaaccatg ccgcaatcgt    312960
     cgccaccggg cgaagtgatt ttcccaatca gatcaacaac gtgctggcct tccccggcgt    313020
     gtttcaagga gctctggacg tgggagccac cacgatcacc gaaggtatga agctcgcggc    313080
     agcgaatgcg attgcctcgg tggtccttcc cgatatcggt gtcgaccaca tcgtgcccag    313140
     tccgctggac cccacagtgg cgccagccgt ggccgcggcc gtcgctgagg cagcgattgc    313200
     cgagggtgtg gcggcagcgc cgcttactcc gtcgcggtag gtcttcgaat cggaccatcg    313260
     atgaggaccg gcggcacgaa cgggcgacgg gtgggtatga ccggcggcct ccctcccggc    313320
     gagcggcggc cacggggccg ccgagatacg ttcggaccct tcgtgcaccc tcagcccccg    313380
     aaatgagcga ccgaacctga aagggatgac agttgaacgc accgtccgat ccgatcgttg    313440
     acgagctttc cgccacgggc ccgctgccac gcggcacggc cacgacgccc tcgccctggt    313500
     ggacctgacc accgctggcc gatctccacg ccggccaccg tgcaggcacc gacgtgacgt    313560
     gtccgggccg ctttcgccgg attccggcgg ctgatccggc agcgagctgc ccgtgcctac    313620
     ctctccaggg tcggggaacc cgctgcacaa cggcccgaaa ggccctttga tctagaatag    313680
     tgacagagaa gttagtcttc gcaccaactg cgtgtgccgg tgcgtgcgta tggcgaacac    313740
     cacggaggtg gtcttgcttc aggcggtcgt caggagaccc tcgccgacca gtgaaaggcg    313800
     atcagaatga ctgcgtcgta catttctcgg cgcaaccatt cagactccaa gccggtactc    313860
     ctgcatatgc acagcgggga tgtcgacgag gcaaccgcgg cggtgagcga cgtgttccac    313920
     ccacacgagc tcacccgtgt cggagcggta gcccggttcg aagcagatct gcaagccgtc    313980
     acgaccgcct cgatggtgac cggccaagtg cgatacaaca gcaacagcga cctcttctgc    314040
     ccgtcgatcg atggctacca cgtcaacatc ccgttgtcgg gcggattggt gtcggtctcc    314100
     cgcggtgagc gcagcctcgt cgaggaaagc aatgcggtgg tgtatcagac gggttctgac    314160
     gcccgaatac tgactccgcc gaacagtcag ctgaacatgt tcgggatgaa gctcgcccgc    314220
     gcggccgtgc acactgcgat cgaggatctc cttgatcgac ccatctccga acccattcgg    314280
     atgcacggca aactggacct cacgggtgcc gacgggcagg cgtggcgcac cctggtgctg    314340
     aatacctatc acagtcagct cgcgggatcg atgatggcca gaccgttgct ggcagagcca    314400
     ttgacatacg cgatcgtggc gggactgctg tccctgaccg agcatcagtt ttcggaggat    314460
     ttggcgaggc cggcggccgt gaccgcgccc gccaccatcc agcacgcgat cgaattcatc    314520
     aactcgcacg cgatgttgcc cctcacaccg cctgacattg cccgagaagt aggtgtgagc    314580
     attcgcgcgc tgcagcgcgg cttccgggaa ttcgtgcacg cgtctccaat ggaatacatc    314640
     cgcaacgtcc ggatgcacaa ggcgcatgac gacctggtgc gtgcgcaacc cgacaccgac    314700
     accgtctcag tgatcgctgg tcggtggggt ttctaccact atggacggtt ttcgcaggac    314760
     taccgacgga tgtttggagt cagcccatcc gagaccttgc gctcgagctg acgtcggttc    314820
     ctcgctcaga ctgctaccag tccgtttcct ggcccagccc acggaaggca gccgggccac    314880
     cggagtggac aaccgtggcc cggagaagga cagaacctac cgccgctcga tctcgacatc    314940
     aatgtccact gctgcggctc tccagtacgg ctcccgcgaa cccccgcgat catcaccgag    315000
     tgacgaaagt gaaccgaccc gaagatcgca cacagaaagc ccaccggccg atcactccac    315060
     ccccggccgt accgcaccac aggtgcacaa gacgatcgac atgaagagca caggcacgcc    315120
     ttcttcacct ggaccgcagg acacgtcgaa cgctgacagg cactgacgcc agccggcgag    315180
     cctggtgaac cccaccacca cccccgaatg acggtggggc agaaaccggg cagacttttc    315240
     gcgcaccgcg ccctcgccgc cgacgaggag aaccagtttg ccgctgcaga ccgggaaacc    315300
     cacaggtgat cggcggcacc accctgccgc cgggtcaggc atccggtctg catctcgggt    315360
     cggtcgtcga gcgttgtccc aagtcggtgg cgtccaccgt cctgtgtgcc cagaagagtc    315420
     ggttgaggat ggttggtcgt gcagttcgcc ctccggccgg acctcccacg ctcgctcaca    315480
     tctgtcgtgt ggccgaccgg aatggtgcaa caccatcgcc tgtggagcct gctccgcgca    315540
     tgcctgaact cgtcggagag cggaatggtc gaaaccgtgt cgctacacgg acagttcgtg    315600
     gcgcccggtg gatagcgatg cgagacgcaa cttcgtagct tagatgtgag gccgaacaca    315660
     gtgccgacct ccccggggca ggcgatccgc ctcgccggcc cactcacgat cgtcgtcacg    315720
     agacgattcg cccgctttca agccctatgg agggtgctat gtccaccgac gtatccgatt    315780
     cggcaacagt cttgaatctg atcgtggatg aagtccgcag agaatgcgac gacgtgctca    315840
     ccttgagcct gatcgacagc gctggacagg atcttcctac ctgggaagcc ggcgcacaca    315900
     tcgaccttca cctgccaggc aatttagcgc gacagtactc gctgcacagc gatccgggcg    315960
     atcgagcccg atacgaggtg gcgatcctgc gcgatccaaa cagccgcgga ggctcccagt    316020
     acattcacga ggaggtcagg aagggagcaa tgcttccgac atcgactcct cgtaacaact    316080
     ttccgctgca accggccgac gagtatctgt tcgtggccgg tggaatcggc atcaccccga    316140
     tgcttcccat gatgcaggcc gccgcagaga tgaaccgccc ggcgcggctg atctacgctg    316200
     gtcgttcccg caccacgatg gcgttcgtcg agcaactcgc cgagcaggag aatgttcagt    316260
     tgtgtgtgtc tgatgaaggc acacgtgcac atgtcgccga ccttctcggc ccgcaccttg    316320
     ggccggacgt tcacatctac agctgcggcc cggagcggct cctcgaggcc gtcactgccc    316380
     gggccgccga ggtcgggttg tcgaagcagt tgcacgtcga gcgcttctcc ggaacagccg    316440
     tcgatctcga tcccgacgtc gagaagtcct tcgacgttga actctccagg tcaggccgca    316500
     tactgacggt cgccccagac cagaccatcc tcgatgctgt cctcgcatgt ggcatcaagg    316560
     tagcgaacag ctgcgcagaa ggagtctgcg ggtcttgtga gacaacggtt ctcgaaggag    316620
     aagtggacca tcgagatcag atcctcgacg aggatgaaca agcagagaac gacgtcatga    316680
     tgatctgctg ctcgcgatct cggacgcccc ggctgatcct cgatttgtag cgggtatcgc    316740
     cgtcccagaa tccacggttc gcctcagccc ggcgttcccc ggccccatca acacacagga    316800
     gaatagacat gaccgaaacc agcgcggagc ctcaccgttc acagggggcg ggtaagtgcc    316860
     cggtgagtca catcgctgcc gagttcaatc ccttcgccga cgattatttg caggatccgt    316920
     acgccgtgtt cacccgagca cgcgcagaag aaccagtctt cttcagtccg tcactcggct    316980
     attgggtcgt ctcccgtcat gaggatgttc ggcaggtctt ccaggacccc gccttctctg    317040
     catcgatatc catcacaccc ctgaaagaac tgtgtcccgc ggccgtggac gagttggtca    317100
     aggccgagat ggtgatgggt cccagcctcg tcaacgaaga tcccccactc catacgaagc    317160
     ggcgacggct gatccagaag gcaatgatca gccccgctcg aatcgaagcg gtcacacccc    317220
     gcatccgcgc gctgacgacc tcctacatcg acggctttgt ccgtcggggc cacgcggacc    317280
     ttgtcgcgga cttcgcgtgg gagatcccgg ctctggtcgc attcgcattg atgggtgtcc    317340
     ccgatgaaga cgtggagcgc gccaaggaat tcgccggtcg actcgcgctg ttcacctggg    317400
     gctacccctc ggaagaggag caacggaaac tcgcagccgg catgggacag tattggatct    317460
     acgcgaagga gcatgtgaag cggaggctcg aggaccccac cgacgactac atcagcaatc    317520
     tcatcgcggc ctggcgcaaa ccgggcaacg aggacttgtt cgacgagaac tacctcgtga    317580
     ccacgatgat gaacttcttg ttcgccgggc acgagacaac gacgaatgcg acggccaacg    317640
     gtctgcgggc gctgctcgag catcgtgacc aatgggcagc gctgtgcgcc gacccttcgc    317700
     tcgtgccggg tgcggtcgag gagattctgc ggttcagttc ctcagtcgtc gcctggcggc    317760
     gagaagccac cgaggacacc cacatcggcg acgtgccgat cccggcgcag gccaaggtgt    317820
     tggtcctcac cggctccgcg aaccacgacg aggaggtgtt ccccgagccg gagcgtttcg    317880
     acatcactcg tacaaacgcc gacgaacact tggccttcgg tttcggccgt cacctgtgtc    317940
     tgggtgcgcc actagcgcgt attgagatgg ggatcttcct ggaggagctt actcggcggc    318000
     tgccccacat gcagctggcc gaaggtcaga cattcacgta ctcgcccaac acttccttcc    318060
     ggggtccgga ccacctcttc gtagggtggg atccgagcca aaatccagtg cctgaggacc    318120
     ggccctagcc gaacgcgggt tcccccgaag cgtgcgccgt ccgaggattc agcgacgccg    318180
     ctgtcggagc gaactcctca ccttcgccag catcgtcagg atcgtcaagg gcagtgagag    318240
     cgggcagtat tacgtgacga aatgccaggt gaccctctaa tgaacgaggt tgtgccgctt    318300
     cctctcaaag gcactcgtgc gagtggcatc ctccggcacg aaaagagcca ctgcgatact    318360
     tcccgcgagt cggcggcaac aatcacttgt gttcgtggct cacgtcttac aacgcctttg    318420
     caagttggca actagaggac gacacagtga atccgcgcca atctcggatc tgcatccgcg    318480
     agcggtcggg aaacgcagcg atcgtgcctc gattcgggcg tcacaactat ttgggcgtca    318540
     caaccaaata tgtccccagc gacgagaact cgggctagcc gcagaagcag tggttcgccg    318600
     acctagccgc catgggggaa cgcagcgacg acttgttcct cgatgcgtgc ctgcctcgat    318660
     atatcccagc acaacacaat cctccatgtc ccttcgtact ttcatcaccg accatgagga    318720
     agaagccatg tacacactga tggttctcta cggccaaccg acagacccgg aagcctttcg    318780
     gacgtactac gaggacaatc accttcctct tgcccggaaa ttgccgggcg ttcgcgcgat    318840
     ccgccacacg gtagacatcg ccgcagccga cggcgcctca ccgttcgtcg cgatcttcga    318900
     ggcggatttc gactcagcag aggacatggg cgcggccctc gcgtcccccg agggtgcagc    318960
     tgcccaggcc gatgtaccca acttcgccac cgggggagtg cagatccttc acttcgaacc    319020
     gaacgtgacg tagccgctcg gccgcattca caacacgggg gtttctccgc catatattgt    319080
     tggcggagaa cctctttcgc ttagattcgc gtttcgaacg tgaccgtcgg gaaacgcaga    319140
     ggcagtccgt tgcgccgctc gaccggcagg taccgccact ctcagcggag gcttccgcga    319200
     gttcgtggtc gtcaactacc cggtcagcgg cggacgggtg cagcaatccg gtaacacgcc    319260
     aaccgacacg gtcggtcctt acacccgcac acggcccccg agcacgtgaa cgctgttacg    319320
     tgctcgcaga atcgaccaag gagtataagc aatgccggct agaagaaccg ccatactcgc    319380
     cgtcgtggca acgatcggtg cagtgctagt tatctttccc ctcgtcaccg gaatgttgag    319440
     caagactcag ggcgtggaga atctcacggg caacctgcgt tcgagcttcg agccggcggc    319500
     gttgacccaa acgcgggctg acatggacac cgtgcaagcg atgtcggatc agctccaagg    319560
     gcagacgttg cgggcgttgc cgagcgcgtt ggggatgagc ccagaacagt tccaggactt    319620
     catgggtcaa aactttcccg atgttgccag cggtatcggc cagctcaaca ctattttgcc    319680
     gaagtttgag gggctcgtag gtggactgga agcccaggcc tccaacttcc gcagcgccga    319740
     tcaagttccc acgaatttcc tgcccagtac cgtggtgcct tacctgttct tgatccccgg    319800
     tgcagtgctg ttagtgcttg ccgccggcgc gttggtactc gggcgcgaga agccggagcg    319860
     cggcgtctcc agggccgccc tcctggtcag tatcgtggta ggtctggtgt tcatcattgc    319920
     gccgctcgcg ttgtctgtgc cggcgaaggc gaaagcagtc gacgacctca ccgctgcttt    319980
     cggtcccgtc ttcaccgacc agggcgccgc tgaggttcgg tcagacttca ccgtcatcga    320040
     gaagatgtcc acacagctgg aagccgacac cgtgccggcc ctggccgggg cgctgaagat    320100
     ggatcccgca caattccaag ccttcatgac cgagaacttc ccggatgttg ccacgggcat    320160
     ggcgcagttg agcgagatcc ttccacgctt tcaggcactc gttgccggta tcgagggcaa    320220
     cgtcgacaac ttccagcaag cggccagtat tccgaccggc ggccaggaca ccaccatgct    320280
     gatctggtgg ttcctcgttc ccggagtggc actcattgct ctcggcgccc tcggggtgac    320340
     cgcgggtgca ggatcacgtc cccgtcccgc accaagggaa cgaaccctgg aacgggtctg    320400
     acggtcgagc acccgaacac cagcaccgca cgctggtcga aagacacagc actattgccg    320460
     cgcagaacta tccccgtccg cagagtgcat gatcgacaac tcgcgggcgc agcccgcgat    320520
     gaaccagagc gaccctgtcc gcgtcggggg atacggactg cgcacccacc aacggatggt    320580
     tggcgcagat ccgtgccggc cacaacgaaa caacggagat cgaatccatg accgacgcac    320640
     tgaagttctt ctcacaagag tggtgcgacg ctgcccacgt ggccgtcaac gcgaatcccg    320700
     ccgtttacca aggcttcaag gacccggcca ccttcaccaa ccggatggag ttcggtgtca    320760
     ccggccgcga tgacctggtc tgccacctcg catgggatag gggcactgtc gtgtcctgga    320820
     ctccccgcaa gtacgacgac cacgacctgt ggatcaaggt cactggcagc ctcgagacct    320880
     ggcagcaggc ggcggccggg caagccgaag gcggcacgct gctcatggcg gggcagatca    320940
     agttcaccaa ggggccgatg tcctcagcca tcgagaacgc cggcgcgctc aacaacttcc    321000
     tgctgacctg ggggcaagtg cccaccgaat gggccgtctg accagatacc ggtcaactcg    321060
     cgcgggactt actgtccgca agtcccgccc ggtcttctac gtccccgcac acgaaagtga    321120
     atccatgaca accgtcgaat ccggctcgta cgagatcacc ttgtacgacg acgacgccaa    321180
     cggcgtcgcg aacattctcg ccactttgct cgagcagaac attcagatcc accccgaccg    321240
     catcgacatc gcccgccaca tcacccgtcc cgtcgccgtg ttcagcacgg acaccgacgc    321300
     gtcggccact atcatcttcc gttccgacca cgcggtgatc tgcaacgaca tcgtgaacaa    321360
     acctgccgtc gtggtgtggg ccacggtggg ccagatcctt gatgtctccc aactgaagat    321420
     gaatgccggc ggcttacttc ccgtcggatt tttcacccga cgcggactaa cggtgctcag    321480
     caacatcgtg acgggacgcc tcgtagtgaa aggtctactg acccacccgg cgaccgcgct    321540
     gcggatgatc gccatgctct ctgtggccag ttgaccttcg tcgcaggagc ctcgcgccac    321600
     atgcagcggc gatccggccc cggagccggg ttccgtccga atccgtcggt cagcagtcct    321660
     ttgatgcggc acccgtcggg tggccagacg atttgcgacc ccgcaaccgg gacgacctca    321720
     ccgcggaacc gaacgacatc accggccagt catctgatgg tctcgccagg tgactgagta    321780
     ggaccacctc agccggttgc cgaggacgtt cagtgagact gcataactcc cgacaccacg    321840
     gagaacacat ggattcctat gatcaagcat tgctcgactt cgccctccag tggagcgcct    321900
     acggtggtgg tgactactgc atcttcaccg agttcggcat accgccagtg accttctacg    321960
     aacgcgtgct ggggatggtg gagaagcggt tcgcctccgg tctcgacctg cccacgaaac    322020
     agcatctcca ggatcactgc ctcgcgaaat tgtcgattct tcaaatatcc atgccgacag    322080
     cataattcct ccacattttc gtcgcggaca accgcgaccg ggcggtcgca aaactcaccc    322140
     gcctcgacat caccgaagta cccgacaacc ggagtgcgct acccatccgg cagatctacg    322200
     gaagggcacg ataaacccat ggcacgcctc gacttcgacg cattgaactc tgaaatccgc    322260
     tacctcatgt tctcggtgtt ccaggtggaa cccggtgtac tcggggacga ccgggaagct    322320
     gtgatcaagg aagcgcggat cttcttcgaa ggtcaggccg acaacggtgt cgtggtgcgc    322380
     gggctctacg acgtggccgg cctgcgagcc gacgccgact tcatgatctg gacgcactcg    322440
     gcgagcatcg aagccctcca ggcgacctac gccgacttcc gccgcaccac cgcactgggc    322500
     cgcgcgagca agcccgtgtg gagcaacgtg gcgtgccacc ggcccgccga attcaacaag    322560
     agccacattc cggcgttcct ggccggtgag gacccgggca actacatctg cgtgtacccg    322620
     ttcgtccgct cctacgagtg gtacctgctg cccgacgagg agcgtcgcaa gatgctcgcc    322680
     gaccacggta tggcggcccg cacgtacaag gacgtccgcg ccaacaccgt gccctcgttc    322740
     gcgctcggcg actacgagtg gattctcgcg ttcgaggcgc ccgagctgta ccgcatcgtc    322800
     gacctcatgc gcgacctgcg tgccaccgag gcccgcctgc acgtccgcga ggaggtgccc    322860
     ttcttcaccg gcccgtgggt ggatgtggag aagctgatca ctgctctgcc gtgatcagcg    322920
     gcacccggcg acgggaggta gaccgtcggc ccacctccag catgtagcgg cgaggtccac    322980
     tcaggggcgc cccacggtgg cggtgccgtg cgcccgcacc ccgtggtacc aacggatcat    323040
     cgaggcagtc gaggagtcga gatccgaagg cagtgaacca tttccggatg agagggccgg    323100
     ctccaactcg agggcctgag tctttccgag ttcaactccc cactgatcga acgagccgat    323160
     cccgtagatg attccttcaa cgaacacttg atgttcatac agggcgatca gctgcccgag    323220
     caccgatggg gtcaggcgtg gggccaatat tgtggttgag ggctggttac cgggcatcgt    323280
     cttgtgggcg atcagatcgg gggcggtgtc ttcccgtgtg agctcctcgg gggtcttccc    323340
     gaaggcgaga acgcgcgatt gcgcgaacag gttgctcatc aagatgttgt gcatgctgcc    323400
     tgcgccgtcc gccgccggaa ggtcgtgggt gggttcggcg aagccgatga aatccgccgg    323460
     cactagccgt gttccctgat gcagcagttg gtagaaggcg tgctgaccgt tgcttcccgg    323520
     ctcgccccag aacactgcgc cggtcgtggt tccgatgggg ctaccgtcgg cccgcaccga    323580
     cttgccattc gattccatgg cgagttgctg caggtaagcg gggaaccgac cgagatcgtt    323640
     cgagtacggc agaatcgctc gtgtctcggc gccgaagaag ttcgaatacc acacacccag    323700
     cagcgcgaga atggccggcg cattgtcctc gagcggtgta tcagcgaaat gcctatcgat    323760
     ggtgtggaaa ccgtccaaga actcctcgaa ggagtccttg cctatcgcga ccatgacggc    323820
     gagaccgacc gcggaaccca ccgagtacct gccaccgacc cagtcccaga acccgaacat    323880
     gttctcggtg tcgatcccga acgccgcgac ccgttcagca ttggtggaga cggcgacgaa    323940
     gtggcgagcg accgcctgct cacccaacgc ggacgtcacc caccgcctgg cgttggcggc    324000
     gttggtgagg gtttcgaggg tggagaaggt tttcgacgcg acgatgaaca aggtggtgga    324060
     tggatcgagg tcggcaaggg tagccaccag gtcggacgga tcgacgttcg agatgaaccg    324120
     gaccgagata cccgagtccg cgtagtgccg caacgcgcga tacaccatgt gcggtccgag    324180
     gtccgagccg ccgatcccga tgttgaccac tgtcatgatc gggcggccgg tggctccccg    324240
     ccactcaccg ctgcggagcc ggtcggagaa aacgcccatg cgagcgagaa cgcggtgaac    324300
     atcggcgacc acgtcatggc catcaacgcg caggctggca tgggcgggta gacggagggc    324360
     ggtatgcagg acggcgcggt cctcggaggt attgatccgt tctccgcgga acattgcgtc    324420
     gcgtcgctcc tccacacccg cggcgcgagc gagttcgacc agcagtgcca gggtgtggcg    324480
     tgagacgcgt tgtttgctgt agtcgatgta cagctcacct gctgtgaggg tgagttcgcg    324540
     accgcgttcg gtgtctgcgg cgaatagctc acggatcgtc agggccgagg tttcatcgcg    324600
     atgggcgtgc agtttctgcc aggccgaggt ggctgttatg tctgagtgct gtgcggtcat    324660
     gttctagccg atcgcagcgg gttcggccag acgcaccgcg tggccgccga actgtttgcg    324720
     cagcgcagag acggccttca tcgcggggga gtcgtcctgc cgggaggcga agcgggcgaa    324780
     caatgccgcc gagatgaccg ggaccggaac ggcgtgggca atcgcttcct cgaccgtcca    324840
     gcgtccctcg ccggaatcct cggtatatcc ggagatggtc gcgagtgcgg gatcgtcggt    324900
     caaggcctcg acgagcaggt caaggagcca ggaacggaca acggtgccct cggaccaggc    324960
     acgcatgacc gcaggcacgt cgacgattga atcttcggcg gcgaggagtt cgtacccctc    325020
     ggcgtaggcc tgcatcaacc cgtactcgat tccgttgtgc accatcttcg cgtagtgacc    325080
     agctccggtg gggcctgcgt gaacgaacga gtcccggcga tcgccgaggg gacgcagtgc    325140
     atcgaagacc ggcatcaggc gctcgatgtc gcgagcgtcc ccgcccgcca tgagcgcgta    325200
     gccccgctcg cgcccccaca ctccacccga gactccgcaa tcgatatagc cgattcctcg    325260
     ttccgcgagt acatcggcat tgacccggtc gtccgagaag cgtgagttgc cgccgtcaac    325320
     aacaaggtcg cccggttcga gaatgcggga gagttgcccg atgacgttgc gggttgcgtc    325380
     gcccgcgggc accatcaccc acaccacccg tggtgccgac aacgacgaca ccaacgtctc    325440
     caaggacgga acgtcgcttg tgttggagtt cgggtcgaag ccgatcgcgt catggccgcg    325500
     ctgacgcagc cgtgcctgca tgttcgatcc cattcggccg aggccaacaa atcccaattg    325560
     cattgtcttg ctgctccatc tcgatagaag aagtgttggg tggatgcgtc aacgtgaacg    325620
     cgggcccttt ccgcgtgcga aagggtatag accgcccagc aacacatcac gtaacaaact    325680
     gcgggcatgc gaatgggcga aggccctgaa ctggttttgt tcagggcctt caccgtcggc    325740
     gatcgcgtgc tacttggtga gtgcgtcctt gagtgccttc gcggccacgg cggggtcctc    325800
     ggcgctgtag atggcgccac cggcgacggc gacgtccgca cccgcgtcac ggacggcggc    325860
     gatggtgtcg accttgacgc caccggcgac ggagaacggg acaccggcga tcttgccgtc    325920
     gtcgaggagg gtctgaatgg agtagccggg ctgggcctgc tcgtcgaggc cggcgtggat    325980
     ctcgacgaac gcgacaccga gcttggcgat ctcgcgggcc cgctcgacac ggttctgcac    326040
     gccgatcagg tcggcgacga ccttcttgcc gtgcttcttg cctgcctcga cggcaccctt    326100
     gatggtggcg tcaccggcgg cgccgaggac ggtgaccagg tccgcgccgg cggagaaggc    326160
     caggtcggcc tcgaggaagc cggcgtcggc ggtcttgagg tcggcgaaga cctccttgtc    326220
     cgggtgcgcc gccttgatcg cgctgatggc gctgaggccg gcgctcttga tcagcggggt    326280
     gccgagttcg atgatgtcga cgtacggggc caccttgttg gtcagggcca gcgcgtcggc    326340
     ggtggtgagt agatcgacgg caacctgcag cttcgtcatg tgtttctcct ggttatcttc    326400
     tttttggggg tttgggattg ggggacgctc aaccgatgtt ggcgtggcgt tcccacagcc    326460
     gctcggcggt ctgatcgacg ttgtgccaca gcgcctggaa cagtgcgtcg aaggcgagga    326520
     gcacggactg ttcgaacagg ctgcccgcgt actgggcggt gatggctgcg ctgtggtcct    326580
     gcttgtcggc cgcgggcagg atcaggacct cgtcggcgcg ccgggcgagc ggcgagtccg    326640
     gcgcggtggt cacagcgagc accgaggcac ccaccttgtt cgcggtatcg gctgcgccga    326700
     cgaccgaggc ggtggtgccc gacccggaga cggcaatcag cagatcgccg tcgccgatgg    326760
     caggggcggt gacctccccg gccacatgga cgcgcaggcc gaggtgcatc agtcgcatcg    326820
     cggccatctg gacggccagg ccgctgcgcc cgttgccgat gacgaacacc gcgcgtgcgg    326880
     acgtgatcaa ggatccggcg cggtcccact gttcggcggc aacggaattg agtaggcgct    326940
     cgttctcgtc gagcacgatg cggcgcccgt cactgaaccg tgtgcgtgtc tgctcgacgg    327000
     tgacggtcat ggtcctcctc ggtgatagcc gttccggtct gatccaaggc tgccgactcc    327060
     ggtgcgccgc ggcacccggc cggtcggccg gttcgggccg gccgcttggc cagtgccgtt    327120
     gcctcgtacc cggccatact gtgaatgggt ggtaagcgtg gaggactcgg ctcggttgca    327180
     ggtcgacccc tgggtggaga tgcggaaggt gatcacggga ccgctcccgg acatcgcgac    327240
     ccgcttctcc cggttcctgg gccgatggtg gccgcacgac gcgctggtga tcttcacccg    327300
     ggagtgcacc ggacgccccc gcaaagtcgc cggaaaccgc gagatagtcg accgagtgac    327360
     catcgacgaa ctcgacgaga tcaaacaatc catcgaaccc ggcggtgtcg tcgccggaat    327420
     ccgttcactg ggaggtggac gccgccgggt ctgggcggtc cgcgactccg gcgacacgct    327480
     gctcgtcctg gtcccgcggc catctcaggc cggcccaccc gagcccgatg gggtcgcggc    327540
     gatgttcggg atcgtcgcga cctccatcca gcaacaggtg gcacaggcca gccctgacta    327600
     tctcgccgag tcacgggcgg cgtcgagtga acgcgcccgc accatcgccg aactgacgga    327660
     ggtgcacgag gcgaccctgt cgtcgatcct cggaaccctc cgatcgaacg acctcgacga    327720
     tcggcggtcg cgcatcaccg cgagcgagac ggcatcggcc gcactgatcg cgctgcgatc    327780
     ggcgggtgcc gccgatcggg ccctgtcaga ggaggcggtc accacggcat tcgccaggtt    327840
     gcagggcgaa ctacgcccca tgctgcggca tcgggaggtc gacgtcgact atgtcgaccc    327900
     gccggccgac ggccgtccgc ttccgggtga ggtggcgcac gcggcgcgcg cgatggttcg    327960
     cgccatcgtg ctggccttcg gcgcccaacc ggtgctgagt cgtttgcgga tcgcgtggga    328020
     ctgcgacggt gacaacgtgc tgatcgaggt ccgtgaccag gggcccggca ccatcgaccg    328080
     caacgcgttg actcggcaac tgtccggacg cttacacacc ctgcgcggcc acatcgatgt    328140
     cgagtcaatc gacggctggg gcagccgggt gtccctgacg attccactcg atccccccgc    328200
     agcgcggccc ggcgagcaac tcctgtcgac attgaatccg cgcgaactcg aagtcctcgc    328260
     ccacctcgcg gtcggcaaac ggaacaaggc catcgccacc gaactaggca ttagcgaaag    328320
     caccatcaaa ttccacgtcg cgagcgtgct gaagaaactc gacgtcgcca accgaggcga    328380
     ggcgggagcg atcggcatcc aagccgggat catggcacac gagacacccc gaccggcctg    328440
     aggggcggcc cgccaagtag gggttcgctc gccctggcga cggcgtcagg caatcagtcc    328500
     ctggtgcgca acgcgcatgc gcaagtgcct gcgctcaacc cgcggcagtg aggatccggg    328560
     cattccggaa acaacgcacc ctcgaattca caacggccgc cacacccttc ccgtacggcc    328620
     gacaatggac tcggccgaac tcggcccggc actgccggat cggtattcgt cggggcgccc    328680
     gtgctcggcc cagaacgtga tgaccggatc gataatcgcc cacgacgcat ccacctcggc    328740
     ctgcgacggg aacaacgagg cgtcaccgcg aaggacatcg aggatcaatc gctcataggc    328800
     ctcgggggag gatccgccga acgagtcggc aaaagacatg ctcagatcca catcctggat    328860
     tcgcatccca tccccgggtg tcttcgcacc gatccgcaac gagattccgt cgtcgggctg    328920
     cacccgcacc accagcacat tctggggtgg cgggccggcc tcggcggaac cggtcaaatg    328980
     gtgcggcgca gcgaaggtca ccgcaacttc cgtggtcctc ttggtcaggc gcttacccgc    329040
     ccggagatag aacggaaccc cggcccagcg ccgattcgcg atctgtgcgg tgatggccgc    329100
     atacgtctcg gtagtcgagc aaggattgaa tccgtcctcc tcgagtaacc ccggtaggta    329160
     tgtctcacct cggatggtgg ccgcgtactg cccacgcgcg gtggtctcgg tccacggacc    329220
     cacagctgac gtggcagaga gcaccttcac cttctccgcc gacagactcg ccgcatcgac    329280
     accaacgggc tcctccatgg caatcaaggc caacaactgc agcagatgat tctggatgac    329340
     gtcccgagcc gcaccgaccc cgtcgtagta gccggcccgg ccttcgacac cgatgtcctc    329400
     ggccatggtg atctgtacgt tgtcgatgtg gcggtggttc cacagcggct caaacaatcc    329460
     gttcgcgaac cgcagcgcca ggatgttctg gaccgtctcc ttgccgagat agtggtcgac    329520
     ccggaacacc gaccccgcac cgaaaacctc gtcgacggtg gcgcccaatg cccgtgagct    329580
     ggccagatcg tttccgaacg gcttctccag cacaatgcgc cgccatccgc ggtggtgctg    329640
     gctgaggccc acggcgttca gctgcgcgca caccagggaa aaatgggccg gggagatcga    329700
     catataaaac gagtggccga cggcggagtg aagcatatcc aattgtgcca gttcctgttt    329760
     caggatctca aaagccgatc ggtcgtcaaa actacctcgg acatagcgga agtttcgtgc    329820
     caactggttc cacgtgtcga tccggaagga agtgcgcgcg cctgcaatca tcgccgcctg    329880
     gatggtctcg atgacgcggt caggttcgtg ccggccgaag ccgaccagcg aaaagctagg    329940
     cggaaggagc ccccggttgg ccaggtcata gattgccggg agcagcttct tacgggacag    330000
     gtcgccagtg ataccgaaga tcaccatcga cgacgacggc acgaatccag cggcaggact    330060
     gaccgcatcc ggtataacgg tttgcccgcc gactggattg atcgtgaccg gatcagttac    330120
     ttgaggcatg ctcacgtgtg ttgtcctcgt tttgagctgg aatttcgaac cgccacccga    330180
     ccgtccgccg atgggtgcgg ctctcagtgt tgccgtgcgt ccccggcgac gcacctggct    330240
     gaatggggga atgtacctgg tcgaccggcg ggcgtgactt cgcgattcgg agtcctgcac    330300
     gccagttcgg ctacaggcgc acggagttct ccatgcgcgc ctgctatcac agccgcaagc    330360
     ccgagccctg ccctagccgg taggttgagg aggaacagtt cgtcgaaggt gtccataacc    330420
     gcgtcgacgg gtgtccccgg aggcgccgac ctaggctttg cccttacccg ggtctgcagc    330480
     cgggggctct cccagatggg gcgggtggcg gccgagttgg ccggcctcgc cgaacgggtc    330540
     ctgcgcacgc acgatcccga actggccgcc gagatcggta gacgcgacga cgagctcgac    330600
     gacctgcacc gccggctgct cactctgatc gaggatccgg cctgggccgg cagcgtcccg    330660
     gtcgcggtcg atgtgacctt gctcggccgc ttctacgaac gcttcggtga ccatgccgtc    330720
     acggtcggac gcagggtgat tttcctcgtc accggggaac agatgacccc gtaggtcgtc    330780
     gccgtcacgg tcggacgcag ggtgattttc ctcgtcaccg gggaacagat gaccccgtag    330840
     gtcgtcgccg tcacggtcgg acgcagggtg attttcctcg tcaccgggga acagatgacc    330900
     ccgtaggtcg tcgccgtcac gggccccatc gtcacgggcc ccatcgccgc ggccgatccg    330960
     agcgtggact tcgccccgcc cgttggtgtg cgcgttcgtg ccgttggtgg tgtggttctt    331020
     catgtcgatg gagctgttct tcacccccga ctgaacctgc tattcgggtt gttcggtgtc    331080
     gagggcgtcg gtgatgcggt cgtggaccgg aggtttcgag gttctggccg gcggtgcggg    331140
     cggtggcgtg ggcgcgggtg tattcgtcgt cgctgagccg gatggggatg cggtgggcgg    331200
     ggcctggggt gggttgctgg gccagttcgc ggttggtggt gctcacgcat ttcgctgatg    331260
     ggcaggggtg cgcggtcggt gaggatgtga gcgccggtgg aggcggggtc gtcgagcaga    331320
     gccaggagca gatggtcggt gccgatctcc tcatgcccga gcagggccgt ctggcgcagg    331380
     ctggcttcga gggccttctt cgtcttcggg gtgaatggga tgtgccccgc ggccggggcg    331440
     gatcccgccg gtgcggtgtc acccgcgagc ttgctctcga gtgccggggc ggtgacgccc    331500
     catgcggtca gcgctgccgc tccggggccg ccggcgtcga agatcccaat gagcaggtgt    331560
     tcggtgccga cggagttctg gtggtgggtg cgggcggcgg cggcggcgag gacgaccact    331620
     tgtcgggctt gatcggagaa tctttcgaac accatgacgc gctccctccc tgggcgtcgc    331680
     cgcgagcgac gcgatccgct gctgaattcc ctgctgccca ttctgggcgt gtgcaggtgg    331740
     ttatgggtgg gatcgacgcg acctcggcac tcgcggccgt aatgttgttg tgacctggtg    331800
     tgatgacatg tccccggttt gtgatgtggg ggcgccggcg gcctgttagg ggggtgccgg    331860
     cgccggggtg tcggcggggc gcgcgggtgt ctgtttcgtc cggttttgag ccgtttttga    331920
     aagatgttga ttgacaacat gtttcggtaa tagattgatg aatcagtatt tacgtgtgtt    331980
     gtgcacagat gtcaggttgt aaggttcgga atctgttact gatcaacatg tttgagtgtt    332040
     tcgggatttt cgattttttg gggtgtgtgg gggtggggtg gtatgctgtg ggtatgacat    332100
     ggagcagtgc gggaaggcga gtgggcggcg ggtcgggtgc accctcccgc ctccccagct    332160
     tcgttggggt gtgggggacc ggatcgaacg ggacgagtaa aagcgcaggt gagaacctaa    332220
     tctcggaaac tcggaggagc gaagcgactc gatcgacggc aacgggaatg gacccactgc    332280
     gagccgcgca gcggctccct ggcggggagc ggagcgactc gccccgtctc ccggcgcgga    332340
     gcgccgggag cagcgccgcg g                                              332361
//

If you have problems or comments...

PBIL Back to PBIL home page