(data stored in ACNUC29543 zone)

EMBL: CP000435

ID   CP000435; SV 1; circular; genomic DNA; STD; PRO; 2606748 BP.
XX
AC   CP000435;
XX
PR   Project:PRJNA12530;
XX
DT   03-SEP-2006 (Rel. 89, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 12)
XX
DE   Synechococcus sp. CC9311, complete genome.
XX
KW   .
XX
OS   Synechococcus sp. CC9311
OC   Bacteria; Cyanobacteria; Synechococcales; Synechococcaceae; Synechococcus.
XX
RN   [1]
RP   1-2606748
RX   DOI; 10.1073/pnas.0602963103.
RX   PUBMED; 16938853.
RA   Palenik B., Ren Q., Dupont C.L., Myers G.S., Heidelberg J.F., Badger J.H.,
RA   Madupu R., Nelson W.C., Brinkac L.M., Dodson R.J., Durkin A.S.,
RA   Daugherty S.C., Sullivan S.A., Khouri H., Mohamoud Y., Halpin R.,
RA   Paulsen I.T.;
RT   "Genome sequence of Synechococcus CC9311: Insights into adaptation to a
RT   coastal environment";
RL   Proc. Natl. Acad. Sci. U.S.A. 103(36):13555-13559(2006).
XX
RN   [2]
RP   1-2606748
RA   Palenik B., Ren Q., Dupont C.L., Myers G.S., Heidelberg J.F., Badger J.H.,
RA   Madupu R., Nelson W.C., Brinkac L.M., Dodson R.J., Durkin A.S.,
RA   Daugherty S.C., Sullivan S.A., Khouri H.M., Mohamoud Y., Halpin R.,
RA   Paulsen I.T.;
RT   ;
RL   Submitted (04-AUG-2006) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
DR   MD5; aa1277fd5091670956b65f3984d1d662.
DR   BioSample; SAMN02604031.
DR   EnsemblGenomes-Gn; EBG00000996653.
DR   EnsemblGenomes-Gn; EBG00000996654.
DR   EnsemblGenomes-Gn; EBG00000996655.
DR   EnsemblGenomes-Gn; EBG00000996656.
DR   EnsemblGenomes-Gn; EBG00000996657.
DR   EnsemblGenomes-Gn; EBG00000996658.
DR   EnsemblGenomes-Gn; EBG00000996659.
DR   EnsemblGenomes-Gn; EBG00000996660.
DR   EnsemblGenomes-Gn; EBG00000996661.
DR   EnsemblGenomes-Gn; EBG00000996662.
DR   EnsemblGenomes-Gn; EBG00000996664.
DR   EnsemblGenomes-Gn; EBG00000996665.
DR   EnsemblGenomes-Gn; EBG00000996666.
DR   EnsemblGenomes-Gn; EBG00000996667.
DR   EnsemblGenomes-Gn; EBG00000996668.
DR   EnsemblGenomes-Gn; EBG00000996669.
DR   EnsemblGenomes-Gn; EBG00000996670.
DR   EnsemblGenomes-Gn; EBG00000996671.
DR   EnsemblGenomes-Gn; EBG00000996672.
DR   EnsemblGenomes-Gn; EBG00000996674.
DR   EnsemblGenomes-Gn; EBG00000996675.
DR   EnsemblGenomes-Gn; EBG00000996676.
DR   EnsemblGenomes-Gn; EBG00000996677.
DR   EnsemblGenomes-Gn; EBG00000996678.
DR   EnsemblGenomes-Gn; EBG00000996679.
DR   EnsemblGenomes-Gn; EBG00000996680.
DR   EnsemblGenomes-Gn; EBG00000996682.
DR   EnsemblGenomes-Gn; EBG00000996683.
DR   EnsemblGenomes-Gn; EBG00000996684.
DR   EnsemblGenomes-Gn; EBG00000996685.
DR   EnsemblGenomes-Gn; EBG00000996686.
DR   EnsemblGenomes-Gn; EBG00000996687.
DR   EnsemblGenomes-Gn; EBG00000996688.
DR   EnsemblGenomes-Gn; EBG00000996689.
DR   EnsemblGenomes-Gn; EBG00000996690.
DR   EnsemblGenomes-Gn; EBG00000996691.
DR   EnsemblGenomes-Gn; EBG00000996692.
DR   EnsemblGenomes-Gn; EBG00000996693.
DR   EnsemblGenomes-Gn; EBG00000996694.
DR   EnsemblGenomes-Gn; EBG00000996695.
DR   EnsemblGenomes-Gn; EBG00000996696.
DR   EnsemblGenomes-Gn; EBG00000996697.
DR   EnsemblGenomes-Gn; EBG00000996698.
DR   EnsemblGenomes-Gn; EBG00000996699.
DR   EnsemblGenomes-Gn; EBG00000996700.
DR   EnsemblGenomes-Gn; EBG00000996701.
DR   EnsemblGenomes-Gn; EBG00000996703.
DR   EnsemblGenomes-Gn; EBG00000996704.
DR   EnsemblGenomes-Gn; EBG00000996705.
DR   EnsemblGenomes-Gn; EBG00000996706.
DR   EnsemblGenomes-Gn; EBG00000996707.
DR   EnsemblGenomes-Gn; EBG00000996708.
DR   EnsemblGenomes-Gn; EBG00000996709.
DR   EnsemblGenomes-Gn; EBG00000996710.
DR   EnsemblGenomes-Gn; EBG00000996711.
DR   EnsemblGenomes-Gn; EBG00000996712.
DR   EnsemblGenomes-Gn; EBG00000996713.
DR   EnsemblGenomes-Gn; EBG00000996714.
DR   EnsemblGenomes-Gn; EBG00000996715.
DR   EnsemblGenomes-Gn; EBG00000996716.
DR   EnsemblGenomes-Gn; EBG00000996717.
DR   EnsemblGenomes-Gn; EBG00000996718.
DR   EnsemblGenomes-Gn; EBG00000996719.
DR   EnsemblGenomes-Gn; EBG00000996720.
DR   EnsemblGenomes-Gn; EBG00000996721.
DR   EnsemblGenomes-Gn; EBG00000996722.
DR   EnsemblGenomes-Gn; EBG00000996723.
DR   EnsemblGenomes-Gn; EBG00000996724.
DR   EnsemblGenomes-Gn; EBG00000996725.
DR   EnsemblGenomes-Gn; EBG00000996726.
DR   EnsemblGenomes-Gn; sync_0044.
DR   EnsemblGenomes-Gn; sync_0082.
DR   EnsemblGenomes-Gn; sync_0201.
DR   EnsemblGenomes-Gn; sync_0278.
DR   EnsemblGenomes-Gn; sync_0299.
DR   EnsemblGenomes-Gn; sync_0335.
DR   EnsemblGenomes-Gn; sync_0350.
DR   EnsemblGenomes-Gn; sync_0390.
DR   EnsemblGenomes-Gn; sync_0405.
DR   EnsemblGenomes-Gn; sync_0441.
DR   EnsemblGenomes-Gn; sync_0458.
DR   EnsemblGenomes-Gn; sync_0474.
DR   EnsemblGenomes-Gn; sync_0524.
DR   EnsemblGenomes-Gn; sync_0542.
DR   EnsemblGenomes-Gn; sync_0553.
DR   EnsemblGenomes-Gn; sync_0554.
DR   EnsemblGenomes-Gn; sync_0555.
DR   EnsemblGenomes-Gn; sync_0556.
DR   EnsemblGenomes-Gn; sync_0557.
DR   EnsemblGenomes-Gn; sync_0576.
DR   EnsemblGenomes-Gn; sync_0577.
DR   EnsemblGenomes-Gn; sync_0719.
DR   EnsemblGenomes-Gn; sync_0738.
DR   EnsemblGenomes-Gn; sync_0745.
DR   EnsemblGenomes-Gn; sync_0747.
DR   EnsemblGenomes-Gn; sync_0832.
DR   EnsemblGenomes-Gn; sync_1005.
DR   EnsemblGenomes-Gn; sync_1131.
DR   EnsemblGenomes-Gn; sync_1135.
DR   EnsemblGenomes-Gn; sync_1199.
DR   EnsemblGenomes-Gn; sync_1264.
DR   EnsemblGenomes-Gn; sync_1324.
DR   EnsemblGenomes-Gn; sync_1393.
DR   EnsemblGenomes-Gn; sync_1643.
DR   EnsemblGenomes-Gn; sync_1913.
DR   EnsemblGenomes-Gn; sync_2083.
DR   EnsemblGenomes-Gn; sync_2145.
DR   EnsemblGenomes-Gn; sync_2164.
DR   EnsemblGenomes-Gn; sync_2167.
DR   EnsemblGenomes-Gn; sync_2194.
DR   EnsemblGenomes-Gn; sync_2259.
DR   EnsemblGenomes-Gn; sync_2376.
DR   EnsemblGenomes-Gn; sync_2458.
DR   EnsemblGenomes-Gn; sync_2535.
DR   EnsemblGenomes-Gn; sync_2536.
DR   EnsemblGenomes-Gn; sync_2537.
DR   EnsemblGenomes-Gn; sync_2538.
DR   EnsemblGenomes-Gn; sync_2539.
DR   EnsemblGenomes-Gn; sync_2589.
DR   EnsemblGenomes-Gn; sync_2844.
DR   EnsemblGenomes-Tr; EBT00001523075.
DR   EnsemblGenomes-Tr; EBT00001523076.
DR   EnsemblGenomes-Tr; EBT00001523077.
DR   EnsemblGenomes-Tr; EBT00001523078.
DR   EnsemblGenomes-Tr; EBT00001523079.
DR   EnsemblGenomes-Tr; EBT00001523080.
DR   EnsemblGenomes-Tr; EBT00001523081.
DR   EnsemblGenomes-Tr; EBT00001523082.
DR   EnsemblGenomes-Tr; EBT00001523083.
DR   EnsemblGenomes-Tr; EBT00001523084.
DR   EnsemblGenomes-Tr; EBT00001523085.
DR   EnsemblGenomes-Tr; EBT00001523086.
DR   EnsemblGenomes-Tr; EBT00001523087.
DR   EnsemblGenomes-Tr; EBT00001523089.
DR   EnsemblGenomes-Tr; EBT00001523091.
DR   EnsemblGenomes-Tr; EBT00001523093.
DR   EnsemblGenomes-Tr; EBT00001523094.
DR   EnsemblGenomes-Tr; EBT00001523095.
DR   EnsemblGenomes-Tr; EBT00001523097.
DR   EnsemblGenomes-Tr; EBT00001523099.
DR   EnsemblGenomes-Tr; EBT00001523101.
DR   EnsemblGenomes-Tr; EBT00001523102.
DR   EnsemblGenomes-Tr; EBT00001523103.
DR   EnsemblGenomes-Tr; EBT00001523104.
DR   EnsemblGenomes-Tr; EBT00001523105.
DR   EnsemblGenomes-Tr; EBT00001523106.
DR   EnsemblGenomes-Tr; EBT00001523107.
DR   EnsemblGenomes-Tr; EBT00001523108.
DR   EnsemblGenomes-Tr; EBT00001523109.
DR   EnsemblGenomes-Tr; EBT00001523110.
DR   EnsemblGenomes-Tr; EBT00001523111.
DR   EnsemblGenomes-Tr; EBT00001523112.
DR   EnsemblGenomes-Tr; EBT00001523113.
DR   EnsemblGenomes-Tr; EBT00001523114.
DR   EnsemblGenomes-Tr; EBT00001523115.
DR   EnsemblGenomes-Tr; EBT00001523116.
DR   EnsemblGenomes-Tr; EBT00001523117.
DR   EnsemblGenomes-Tr; EBT00001523118.
DR   EnsemblGenomes-Tr; EBT00001523119.
DR   EnsemblGenomes-Tr; EBT00001523120.
DR   EnsemblGenomes-Tr; EBT00001523121.
DR   EnsemblGenomes-Tr; EBT00001523122.
DR   EnsemblGenomes-Tr; EBT00001523123.
DR   EnsemblGenomes-Tr; EBT00001523124.
DR   EnsemblGenomes-Tr; EBT00001523125.
DR   EnsemblGenomes-Tr; EBT00001523126.
DR   EnsemblGenomes-Tr; EBT00001523127.
DR   EnsemblGenomes-Tr; EBT00001523128.
DR   EnsemblGenomes-Tr; EBT00001523129.
DR   EnsemblGenomes-Tr; EBT00001523130.
DR   EnsemblGenomes-Tr; EBT00001523131.
DR   EnsemblGenomes-Tr; EBT00001523132.
DR   EnsemblGenomes-Tr; EBT00001523133.
DR   EnsemblGenomes-Tr; EBT00001523134.
DR   EnsemblGenomes-Tr; EBT00001523135.
DR   EnsemblGenomes-Tr; EBT00001523136.
DR   EnsemblGenomes-Tr; EBT00001523137.
DR   EnsemblGenomes-Tr; EBT00001523138.
DR   EnsemblGenomes-Tr; EBT00001523139.
DR   EnsemblGenomes-Tr; EBT00001523140.
DR   EnsemblGenomes-Tr; EBT00001523141.
DR   EnsemblGenomes-Tr; EBT00001523142.
DR   EnsemblGenomes-Tr; EBT00001523143.
DR   EnsemblGenomes-Tr; EBT00001523144.
DR   EnsemblGenomes-Tr; EBT00001523145.
DR   EnsemblGenomes-Tr; EBT00001523146.
DR   EnsemblGenomes-Tr; EBT00001523147.
DR   EnsemblGenomes-Tr; EBT00001523148.
DR   EnsemblGenomes-Tr; EBT00001523149.
DR   EnsemblGenomes-Tr; EBT00001523150.
DR   EnsemblGenomes-Tr; sync_0044-1.
DR   EnsemblGenomes-Tr; sync_0082-1.
DR   EnsemblGenomes-Tr; sync_0201-1.
DR   EnsemblGenomes-Tr; sync_0278-1.
DR   EnsemblGenomes-Tr; sync_0299-1.
DR   EnsemblGenomes-Tr; sync_0335-1.
DR   EnsemblGenomes-Tr; sync_0350-1.
DR   EnsemblGenomes-Tr; sync_0390-1.
DR   EnsemblGenomes-Tr; sync_0405-1.
DR   EnsemblGenomes-Tr; sync_0441-1.
DR   EnsemblGenomes-Tr; sync_0458-1.
DR   EnsemblGenomes-Tr; sync_0474-1.
DR   EnsemblGenomes-Tr; sync_0524-1.
DR   EnsemblGenomes-Tr; sync_0542-1.
DR   EnsemblGenomes-Tr; sync_0553-1.
DR   EnsemblGenomes-Tr; sync_0554-1.
DR   EnsemblGenomes-Tr; sync_0555-1.
DR   EnsemblGenomes-Tr; sync_0556-1.
DR   EnsemblGenomes-Tr; sync_0557-1.
DR   EnsemblGenomes-Tr; sync_0576-1.
DR   EnsemblGenomes-Tr; sync_0577-1.
DR   EnsemblGenomes-Tr; sync_0719-1.
DR   EnsemblGenomes-Tr; sync_0738-1.
DR   EnsemblGenomes-Tr; sync_0745-1.
DR   EnsemblGenomes-Tr; sync_0747-1.
DR   EnsemblGenomes-Tr; sync_0832-1.
DR   EnsemblGenomes-Tr; sync_1005-1.
DR   EnsemblGenomes-Tr; sync_1131-1.
DR   EnsemblGenomes-Tr; sync_1135-1.
DR   EnsemblGenomes-Tr; sync_1199-1.
DR   EnsemblGenomes-Tr; sync_1264-1.
DR   EnsemblGenomes-Tr; sync_1324-1.
DR   EnsemblGenomes-Tr; sync_1393-1.
DR   EnsemblGenomes-Tr; sync_1643-1.
DR   EnsemblGenomes-Tr; sync_1913-1.
DR   EnsemblGenomes-Tr; sync_2083-1.
DR   EnsemblGenomes-Tr; sync_2145-1.
DR   EnsemblGenomes-Tr; sync_2164-1.
DR   EnsemblGenomes-Tr; sync_2167-1.
DR   EnsemblGenomes-Tr; sync_2194-1.
DR   EnsemblGenomes-Tr; sync_2259-1.
DR   EnsemblGenomes-Tr; sync_2376-1.
DR   EnsemblGenomes-Tr; sync_2458-1.
DR   EnsemblGenomes-Tr; sync_2535-1.
DR   EnsemblGenomes-Tr; sync_2536-1.
DR   EnsemblGenomes-Tr; sync_2537-1.
DR   EnsemblGenomes-Tr; sync_2538-1.
DR   EnsemblGenomes-Tr; sync_2539-1.
DR   EnsemblGenomes-Tr; sync_2589-1.
DR   EnsemblGenomes-Tr; sync_2844-1.
DR   EuropePMC; PMC1569201; 16938853.
DR   EuropePMC; PMC2442094; 18534010.
DR   EuropePMC; PMC3390001; 22768379.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01067; ATPC.
DR   RFAM; RF01116; Yfr1.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01419; IsrR.
DR   RFAM; RF01701; Cyano-1.
DR   RFAM; RF01704; Downstream-peptide.
DR   RFAM; RF01716; PhotoRC-I.
DR   RFAM; RF01752; psaA.
DR   RFAM; RF01753; psbNH.
DR   RFAM; RF01851; cyano_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000435.
DR   SILVA-SSU; CP000435.
DR   StrainInfo; 529133; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2606748
FT                   /organism="Synechococcus sp. CC9311"
FT                   /strain="CC9311"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="edge of California current after nitrate
FT                   enrichment and low light incubation"
FT                   /db_xref="taxon:64471"
FT   gene            174..1331
FT                   /gene="dnaN"
FT                   /locus_tag="sync_0001"
FT   CDS_pept        174..1331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="sync_0001"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45873"
FT                   /db_xref="GOA:Q0IE82"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE82"
FT                   /protein_id="ABI45873.1"
FT                   /translation="MKLVCSQAELNAALQLVSRAVASRPTHPVLANVLLTADAGTDRLS
FT                   LTGFDLNLGIQTSLAASVDTSGAVTLPARLLGEIVSKLSSDSPVSLSSDAGADQVELTS
FT                   SSGSYQMRGMPADDFPELPLVENGTALRVDPASLLKALRATLFASSGDEAKQLLTGVHL
FT                   RFNQKRLEAASTDGHRLAMLTVEDALQAEISAEESEPDELAVTLPARSLREVERLMASW
FT                   KGGDPVSLFCERGQVVVLAADQMVTSRTLEGTYPNYRQLIPDGFSRTIDLDRRAFISAL
FT                   ERIAVLADQHNNVVRIATEPATGLVQISADAQDVGSGSESLPAEINGDAVQIAFNARYV
FT                   LDGLKAMDCDRVRLSCNAPTTPAILTPANDDPGLTYLVMPVQIRT"
FT   gene            1348..2148
FT                   /locus_tag="sync_0002"
FT   CDS_pept        1348..2148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0002"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45445"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE81"
FT                   /protein_id="ABI45445.1"
FT                   /translation="MTVPDQLLLSDLLHHRVRCDLGLDHGPGVMAWMHPPVHRLLGWVS
FT                   RPSALRTSRDVWRLDQCRGFDDQQVFVKGAPAEADQITLDRLPTLLDADLLNADGERVG
FT                   IIADLAFLPASGQISHYLVARSDPRLPGTSRWRLLPDRIVDQQPGLVSSAIHELDDLPL
FT                   ARASVRQDFLQRSRHWREQLQQFGDRAGERLEGWLEEPPWDEPPAVSDVASSYSSTAAP
FT                   TVDPLDDWDDGDWTDAPRVERGRSVRNDPTDRNDWPDHEEDPWV"
FT   gene            2185..4518
FT                   /gene="purL"
FT                   /locus_tag="sync_0003"
FT   CDS_pept        2185..4518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="sync_0003"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR01736"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47570"
FT                   /db_xref="GOA:Q0IE80"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE80"
FT                   /protein_id="ABI47570.1"
FT                   /translation="MTQSSHAVAAFDLGAALRQEGLTETDYSEIQRRLGRDPNRAELGM
FT                   FGVMWSEHCCYRNSRPLLSGFPTEGPRILVGPGENAGVVDLGEGHHLAFKVESHNHPSA
FT                   VEPFQGAATGVGGILRDIFTMGARPIALLNALRFGPLDEPATRGLVEGVVAGIAHYGNC
FT                   VGVPTVGGEVAFDPSYRGNPLVNAMALGLMETDEIVRSGAAGVGNPVVYVGSTTGRDGM
FT                   GGASFASAELSADSLDDRPAVQVGDPFLEKGLIEACLEAFQSGDVVAAQDMGAAGLTCS
FT                   CSEMAAKGDVGVELDLDRVPAREKGMTAYEFLLSESQERMLFVVRAGREEQLMQRFRRW
FT                   GLQAAVVGRVLEEKVVRVLQHGAVAAEVPARALAEDTPINKHELLSEPPDDIQTHWTWR
FT                   ESDLPSPAIDRDWNADLLRLLDDPTIASKRWIYRQYDQQVLANTVIRAGGADAAVVRLR
FT                   PQQGDASLQMSQRGVAATLDCPNRWVALDPERGAIAAVAEAARNLSCVGAQPIAVTDNL
FT                   NFPSPETSKGYWQLAMACRGLSHACRSMGTPVTGGNVSLYNETRADDGSLQPIHPTPVV
FT                   GMVGLVEDLDRSGGLAWRQPGDFVVLLGVSTDEEGNESVGLAGSSYQGAVHGLLTGRPP
FT                   SVDLELEGQVQALVRQAFAQGVLASAHDSSDGGLAVALAESTLASGLGVDLNLPHRSAR
FT                   LDRVLFAEGGARIVVSVRAEQRSAWHSLVASQEHRSVPVTEIGTVADHGCFRLAVEKHP
FT                   VIDLAVETLREQYEQAVPRRLGAV"
FT   gene            4518..6023
FT                   /gene="purF"
FT                   /locus_tag="sync_0004"
FT   CDS_pept        4518..6023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="sync_0004"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM PF00310; match to protein
FT                   family HMM TIGR01134"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47034"
FT                   /db_xref="GOA:Q0IE79"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE79"
FT                   /protein_id="ABI47034.1"
FT                   /translation="MQNLETHPKSRRPVHQLEIERPDRMEEACGVFAVQALEQPVANLV
FT                   YFGLYALQHRGQESAGIAVFNEGKVRLHKDMGLVSQVFDQDVLERMPGGLAVGHNRYST
FT                   TGSSKVCNAQPVVLMTRLGPFALAHNGNLVNAAELRAQVDDGEVEFTSTTDSELIAYAV
FT                   QQAVDGGLDWTEGIKVAASQCQGAFSLVIGTSDALYGLRDGYGIRPLVYGYLGEQDLGH
FT                   WVLSSETCGLDIIGSPFVADVEPGELVVFRCGDPTPERHRWIEPTTRMCVFEMIYFARP
FT                   DSRFFGESLYSYRQRIGQILARESAVDADLVIGVPDSGIPAAIGYSQSSGVPYADGLIK
FT                   NRYVGRTFIQPTQAMREAGIRVKLNPLPDVLSGKRVLVIDDSIVRGTTSKKLVQALRDA
FT                   GAIEVHMRISSPPVTHPCFYGIDTDTQDQLIAARLTLQEIEEHLKVDSLAYLSKEGMVE
FT                   AAHAQSEHFCTACFDGNYPVPMDASIKASKLMLEPSGVAATNL"
FT   gene            complement(6024..8486)
FT                   /gene="gyrA-1"
FT                   /locus_tag="sync_0005"
FT   CDS_pept        complement(6024..8486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA-1"
FT                   /locus_tag="sync_0005"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46187"
FT                   /db_xref="GOA:Q0IE78"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE78"
FT                   /protein_id="ABI46187.1"
FT                   /translation="MAEERVQSIALHHEMQRSYLEYAMSVIVGRALPDVRDGLKPVQRR
FT                   ILFAMHELGLTPDRPYRKCARVVGDVLGKYHPHGDQAVYDALVRLVQTFSSRHPLLDGH
FT                   GNFGSVDDDPPAAMRYTETRLARISHEGLLDEIGDDTVDFASNFDGSQQEPTVLPAQLP
FT                   FLLLNGCSGIAVGMATSIPPHNLGEVVDGLIALVQNPDLSENEVLKLIPGPDFPTGGEV
FT                   LLGSGVRETYLRGRGSIPMRGVAHIEEVHPGKGKHRRNAVIVTELPYQLSKAGWIEKLA
FT                   EHVNDGKIGGIADIRDESDREGMRVVVELRRDADPETVLTDLQRRTSLQSNFGAILLAL
FT                   VDGRPQQLTLRQLLQTFLDYRELTIIRRTNHALRKTEDRLEVVEGLTTALASLQQVIAM
FT                   IQEARDAAKARASLMVHFDLSERQADAVLAMPLRRLTGLEQESLRKEADDLRKERQRLT
FT                   LLLENRDQLLDALIQELRQLKKRFATPRRTRLVEGGDHLLAERAASQRPNAELQRRQAL
FT                   DALPSDSRLLIQDDGQVKIVSPQLLGRLHLNDPIPMGDEPSPALISLPIQPPPRLLAVT
FT                   VSGRVALVRWEFAGQQQGTLERFLPTALEGDEVVSLLPLPNPEDLVANETKSLGLLTSD
FT                   GRFKRLPLKDIQELSGRAATVLKLKEGVSLKAALICQDGADVAVISDIGRVLRLQAEET
FT                   NLPVMGKLAQGPITMRLLPGEQLVTAIAGHAERPTTILLASQTGRLQWLELTCIRSCKR
FT                   GDLGEIGWEFDSESTSGSERIAAACLADSLIGVVTSSGRHGRLKVNEQDQLTLKDNESI
FT                   LRLVPLIS"
FT   gene            complement(8556..9455)
FT                   /locus_tag="sync_0006"
FT   CDS_pept        complement(8556..9455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0006"
FT                   /product="tetratricopeptide repeat protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45553"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE77"
FT                   /protein_id="ABI45553.1"
FT                   /translation="MGSHRRSSQSFKKAWVSAALMSAIGLCSAEPAKALIPYVFTPSTQ
FT                   ELEGAGIGIGRTAAQLLRLGQPKEAARLAALAVRLQPNDERLWSVLAEAQLRSEQLDDA
FT                   AGSLARAKSLNPTNAGLWFAEASLALRDNRPDDAIPLLDRGLKLDPKNATAYFDLGNAR
FT                   VMQSNKKQALKAFERATAIKPSFWEALNNQSLVLFEMGNTKEAIRRWRSVLTINANPEP
FT                   MLALAAALNKVNPGDQESLELAQKALAESPNYVLPGHQKKQLWGLKLRRATAELFNNPS
FT                   LQNAVERAEANADPKSAN"
FT   gene            complement(9455..10429)
FT                   /locus_tag="sync_0007"
FT   CDS_pept        complement(9455..10429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0007"
FT                   /product="iron-sulfur cluster binding protein, putative"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM TIGR00276"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45130"
FT                   /db_xref="GOA:Q0IE76"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE76"
FT                   /protein_id="ABI45130.1"
FT                   /translation="MSSSGQTQLTAALKERARQEGFDPVGIACLPGSSRLQMRTASLQR
FT                   WLDAGFQAEMGWMAAPRRLDARTLLDGARSLLAVGLNYYVSESRQPNSLAIARYAWGRD
FT                   YHRVVNQRLRRVGRWLETQRPASRWRVCVDAEPLLDKAWAEEAGLGWIGKHSNVIHPQR
FT                   GSWMVIGHLLSTEDLVADQPAQPRCGRCRACMDACPTDAIREPFVVDSRRCIAYHTIEN
FT                   RDQQLPDLIKAGMGPWVAGCDICQDVCPFNQTELPSSQDPEVQPRPWILDLSATQVEQW
FT                   DPSTWDQKLRGSALRRIKPWMWRRNAASAKSVDPPTVSTSEIR"
FT   gene            10474..11136
FT                   /locus_tag="sync_0008"
FT   CDS_pept        10474..11136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0008"
FT                   /product="unnamed protein product"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45564"
FT                   /db_xref="GOA:Q0IE75"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE75"
FT                   /protein_id="ABI45564.1"
FT                   /translation="MSASPSGSQALRLSFVLRWLGITLVVLLALQMAVLLSAADWADGV
FT                   FKQLLIERLVNQAPMGLIGLLLMLLGSRLDQPETARPPIRWLVCVISALLAILMIVVVP
FT                   VSISGNQNLSGESDQTLEQQKGQLEMARQQSANPENVKMLGNQLTQAGQLPADASEEDQ
FT                   VKAAQAFIDKQLAQMEQQIKQGERQRNLAVNQRRFGGTLSAVILAVAFVLLALAAVI"
FT   gene            11192..11941
FT                   /locus_tag="sync_0009"
FT   CDS_pept        11192..11941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04367"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46461"
FT                   /db_xref="GOA:Q0IE74"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE74"
FT                   /protein_id="ABI46461.1"
FT                   /translation="MVQSNTRPDLPLSARLQQDLKNDLIAGLLVVIPLATTIWLATTVS
FT                   RFVLAFLTSIPKQFNPFITLNPLLQDLINLALGLTVPLFAILLIGLMARNIVGRWLLEF
FT                   GEETLQRIPLAGSVYKTLKQLLATFLRDNSQRFRRVVLVEYPREGLYSVGFVTGEVGPS
FT                   LQAELTEPLLSVFIPTAPNPTTGWYTLVPEKSVKDLDISVEDAFRTIISAGIVNPDERE
FT                   APVNRSFSSLISQLRGSVSPSSSTTGA"
FT   gene            11963..12595
FT                   /locus_tag="sync_0010"
FT   CDS_pept        11963..12595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0010"
FT                   /product="putative transcription antitermination factor
FT                   NusB"
FT                   /note="identified by match to protein family HMM PF01029"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46916"
FT                   /db_xref="GOA:Q0IE73"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE73"
FT                   /protein_id="ABI46916.1"
FT                   /translation="MQSRSLSRELALLVLGQCPERVDDPPDFSLDTLLQKALDSLMQHW
FT                   TEVLDCCAGDLEKAQQHLLESELKDGPSSDQASVRESLQSSLTGAEQVLNGLSASLELP
FT                   RLLALSNQDQVRREAMQRVTFVLKKRKAIDQMLDGVMEGWRLTRLPRIDRDILRLAVID
FT                   LSELKTPAAVACNEAVELAHRFSDEQGRKMINGVLRRLQNAPSLVLS"
FT   gene            12600..14255
FT                   /gene="ftsY"
FT                   /locus_tag="sync_0011"
FT   CDS_pept        12600..14255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="sync_0011"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="identified by match to protein family HMM PF00448;
FT                   match to protein family HMM PF02881; match to protein
FT                   family HMM TIGR00064"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47633"
FT                   /db_xref="GOA:Q0IE72"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE72"
FT                   /protein_id="ABI47633.1"
FT                   /translation="MVYDWFNRGSVPPETPADPLVDPEVQSDQSSAPQPSATEPSGTQP
FT                   ADVQASEPQSTESEDDSLEWARQAYARLKAQKAQAAEAAKTVQDDSTSVQNVVVPPVME
FT                   PPAVVPETVVPSVVSPSEEPPALEAPSVEPAQPAPVVEPAVVPAPTPAASASPATTPTP
FT                   PAPALSFLEQAAAQRDQRQQELEQPAEPNPVPVVPADAQDAPNIDEDEPSLGDFDDAFT
FT                   WSAEVLAAQGRSAEQVTLEEIDWLGRLRQGLEKTRQGFVTGLLENLGDDPLTPEVLDDL
FT                   ESLLLRADAGVQATDQVLDALRQRMNEQVVDPSEGIRFLKEQLRDLLDEPIKSSAVEVL
FT                   APQRDRLNVWLLVGVNGVGKTTTLGKLANLAVRSGYSALIAAADTFRAAAVQQVQVWGD
FT                   RSDVPVVANPSANADPAAVVFDAIGAARSKGTDLVLVDTAGRLQTKHNLMEELEKIRRV
FT                   VDRLAPEAHVESLLVLDASQGQNGLKQAMAFARAAGLTGVVITKLDGTARGGVALAVAS
FT                   EAKLPIRFIGAGEGIRDLRPFNSFEFVEALLASR"
FT   gene            14323..15732
FT                   /locus_tag="sync_0012"
FT   CDS_pept        14323..15732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0012"
FT                   /product="SpoIIE domain protein"
FT                   /note="identified by match to protein family HMM PF07228"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45682"
FT                   /db_xref="GOA:Q0IE71"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE71"
FT                   /protein_id="ABI45682.1"
FT                   /translation="MSSTPSWRHPASPQRGINQSLTATASLRQLLESMSREQRSNQELL
FT                   VSLGFALRSFSNLNRFLELVPVVAARLVGVQGSLLVPFQADGRLWRDQLHMLPGSRTEG
FT                   MLRALAAHEPGNIIGFGSDESLVRAMDRLVQRQLGSAGLFATSLIARGRPRGRLYVFNP
FT                   SSPLAWSDVYRRHVQLVADLTGVAIENDLMLQEARRHERVDRQLSIGADIQAQLLPDHC
FT                   PVIEGVDLAARCRPAFQVGGDYYDFIPTRPELIGRRRERGRWAFVMGDVMGKGVPAGLL
FT                   MTMLRGMLRAEVLSGLPPDRILYDLNQLALEDLSQSHRFVTLFYSDFDPRTRRLRYANA
FT                   AHNPPLIWRAQSRKLMRLDAPGLLIGLQPEAEYGCESLVLEPGDVLLYYTDGVTEAPGI
FT                   TGDRFDEARLMRSLEQACRSGTGSQGILDQLFSRLDRFVGPTRQLDDDASMVVLKVKEE
FT                   IMLPSVPRSLA"
FT   gene            15764..17182
FT                   /gene="argH"
FT                   /locus_tag="sync_0013"
FT   CDS_pept        15764..17182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="sync_0013"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00838"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46333"
FT                   /db_xref="GOA:Q0IE70"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE70"
FT                   /protein_id="ABI46333.1"
FT                   /translation="MAGGVTGGGSATWSDRFEQGLHPAIERFNASIGFDITLLQEDLDG
FT                   SIAHARMLADCGVIQVEEADQLVGGLEQVRQEAASGLFQPGLADEDVHFAVERRLIALL
FT                   GPVGKKLHTGRSRNDQVGTDLRLWLRRRLDELEQHLLGFQRALLDQANLHSNTLIPGYT
FT                   HLQRAQPLCLAHHLLAYVEMVERDRQRMADLRKRLNLSPLGAAALAGTPVPIDRRSTAS
FT                   ALGFDGIYANSLDAVSDRDFTVEFSAAASLVMVHLSRLAEEVIFWASEECGFVRLTDRC
FT                   ATGSSLMPQKKNPDVPELVRGKCGRVFGHLQGLLTMIKGLPLAYNKDFQEDKEALFDVV
FT                   ATTSQCLEAMTILLQEGLSFRTERLEAAVAADYSNATDVADYLVAKQVPFREAYQLVGA
FT                   VVKHCLQEGVLLRELTLERWQQFHPAIEADLFEALTPRNVVAARTSEGGTGFDRVNEQL
FT                   AIWNQRFGLADQVF"
FT   gene            17309..17854
FT                   /locus_tag="sync_0014"
FT   CDS_pept        17309..17854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0014"
FT                   /product="RNA-binding region RNP-1 (RNA recognition motif)"
FT                   /note="identified by match to protein family HMM PF00076"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47343"
FT                   /db_xref="GOA:Q0IE69"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE69"
FT                   /protein_id="ABI47343.1"
FT                   /translation="MSIFVGNLPFRAEQEDIIELFSTYGEVTNCALPLERDTGRKRGFA
FT                   FVEMSDEAAEASAIEALQGAELMGRPLRINKAEPRGSAPRRDFGGGGGGNYGGGGGGNY
FT                   GGGGGGNYGGGGGGNYGGGGGGNYGGGGERRSGASGWEDRSYGSGAPPAGGSAYDDGRT
FT                   RRRRGGADDNSGYGGAEG"
FT   gene            complement(17873..18877)
FT                   /locus_tag="sync_0015"
FT   CDS_pept        complement(17873..18877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0015"
FT                   /product="tRNA-dihydrouridine synthase A"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF01207"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47861"
FT                   /db_xref="GOA:Q0IE68"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE68"
FT                   /protein_id="ABI47861.1"
FT                   /translation="MDSPLNPDREPAWRFSVAPMLDCTDRHFRMLMRQISKQSLLYSEM
FT                   VVAQALHHSKRRERLLDFDAEEHPIALQVGGDDPALLADATRMAADWGYDEINLNVGCP
FT                   SPRVQAGNFGACLMAEPQTVARCVEAMVAASSLPVTVKHRVGIDDLDSDDLLRQFVDQV
FT                   AEAGALRFSVHARKAWLEGLDPKQNRTIPALQHDRVIALKESRPALTIELNGGLDTPED
FT                   CLNALKHCDGAMVGRAAYAHPLRWREIDSLIYGAAPRQVLASDVVLGLIPHAERHLQRG
FT                   GRLWDLCRHLVQVVEAVPGARYWRNNLSTKAQRAGAGIEIIEEAAQQLLDAGL"
FT   gene            18944..19456
FT                   /gene="msrB-1"
FT                   /locus_tag="sync_0016"
FT   CDS_pept        18944..19456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrB-1"
FT                   /locus_tag="sync_0016"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.-"
FT                   /note="identified by match to protein family HMM PF01641;
FT                   match to protein family HMM TIGR00357"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47023"
FT                   /db_xref="GOA:Q0IE67"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE67"
FT                   /protein_id="ABI47023.1"
FT                   /translation="MTTSMQPWLLSRRSMLLASIAGMVGVLRAPDQVLAASKAGEATWD
FT                   LSDGEWKKRLSPEAYQVLRQEGTERPFTSPFNNEKREGTYLCAGCDLPLFASTAKFDSG
FT                   TGWPSFWQPLPGGVETKVDFKLILPRTEYHCRRCGGHQGHVFNDGPRPTGKRYCNNGVA
FT                   LRFQPTA"
FT   gene            19383..20696
FT                   /locus_tag="sync_0017"
FT   CDS_pept        19383..20696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0017"
FT                   /product="conserved hypothetical protein TIGR00275"
FT                   /note="identified by match to protein family HMM PF00890;
FT                   match to protein family HMM PF03486; match to protein
FT                   family HMM TIGR00275"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46168"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE66"
FT                   /protein_id="ABI46168.1"
FT                   /translation="MTVPDRRVSATATTESPCVSNPRHDLIVIGGGPAGFMAAITAAER
FT                   GVRDVLILEATPEVLTKVRISGGGRCNVTHACWDPMELVGHYPRGSKPLRGPFSQFACG
FT                   DSIAWFDEHGLTLVEESDGRMFPQQNRSEAVVECLRRAALAAGVKIQCGSAVRELSCSA
FT                   GGDFQLCDQRSALHHTKRVLLATGGHPSGRRLAQDLGHRIVPPVPSLFSLKLQAPALTA
FT                   CSGIALDDVSLDLKVGDQRFREKGRVLITHRGVSGPAILRLTAFAARALHASRYKGELR
FT                   VDWSGGLGRERVQQRLQQARREQARRTLVAAKPFENLPRRLWLAFLTQAGVAGERRWAD
FT                   LPVKAERNLVETLCAQRLSVQGRGPFGEEFVTAGGVDLGEVNLATMESRRCTGLYLAGE
FT                   LLDVDGVTGGFNFQACWSGGWLAGKAIAAALAPVDGPT"
FT   gene            complement(20744..24079)
FT                   /locus_tag="sync_0018"
FT   CDS_pept        complement(20744..24079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0018"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47561"
FT                   /db_xref="InterPro:IPR011121"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE65"
FT                   /protein_id="ABI47561.1"
FT                   /translation="MSLKSFFMSDTQAPQLLGVTLDTTTLDPSTPGGAFLSGAITFSDD
FT                   LSGLSNIYITYTEVNSGQEIQLSFNLSEFGGNALTGNALNGTITSSRQLDRFAASGDYI
FT                   ISSIQVDDQAGNGEFYSRFEDNWDTQLDALNIAEAARSFTVANSSADTQAPQLIDVTLD
FT                   TTTLDPSAPGGAFLSGAITFSDDLSGLSNIFITYTEVNSGQEIQLSFKLSEFGGDALTG
FT                   NARNGTITSSSQLDRFAASGDYIISSIQVDDQAGNGEFYSRFEDNWDTQLDALNIAEAA
FT                   RSFTVANSSADTQAPQLIDVTLDTTTLDPSAPGGAFLSGAITFSDDLSGLSNIFITYTE
FT                   VNSGQEIQLSFKLSEFGGDALTGNARNGTITSSSQLDRFAASGDYIISSIQVDDQAGNG
FT                   EFYSRFEDNWDTQLDALNIAEAARSFTVANSSAEPQTGEDSSAPTITGLNLSATTIDPS
FT                   QPGGAFLTADVSFTDDASGIDFLFLSFESVDSNQEITFSLLPSDSLEGNLLEGSIGTSE
FT                   FIDPFAANGEYVLRQIEGSDKAGNQFVFRDNSELPVDNSDWEQFLSDSNIQQTSFEINN
FT                   SQSDITAPTITGLNLSATTIDPSQPGGAFLTADVSFTDDASGIDFLFLSFESVDSNQEI
FT                   TFSLLPSDSLEGNLLEGSIGTSEFIDPFAANGEYVLRQIEGSDKAGNQFVFRDNSELPG
FT                   DNSDWEQFLSDSNIQQTSFEINNSQSDITAPTITGLNLSATTIDPSQPGGAFLTADVSF
FT                   TDDASGIDFLFLSFESVDSNQEITFSLLPSDSLEGNLLEGSIGTSEFIDPFAANGEYVL
FT                   RQIEGSDKAGNQFVFRDNSELPVDNSDWEQFLSDSNIQQTSFEIKRSDSDNGAVDADNN
FT                   GLVDNTPVYTLFNDGDPLTITKERSDGSTRTFSATGIPNWDATQAVNTEDNSGNFYVLL
FT                   EGADGSTREDQFKVWTTDISGSIASSTGWRSAEQLVQAGWEERFNIDFDGDELIGIPTA
FT                   DEDQNGLVDNTSVYTLFNDGDPLTISKQRANGSTRNFSATGIPNWDVTQAVNAEDNSGN
FT                   FYLLLEGADGTTREDQYKVWTTDKTASFLSGTGWRSAEQLSDAWGEFFSILNSTDSTTT
FT                   SISV"
FT   gene            complement(24218..25498)
FT                   /gene="pilC"
FT                   /locus_tag="sync_0019"
FT   CDS_pept        complement(24218..25498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilC"
FT                   /locus_tag="sync_0019"
FT                   /product="type IV pilus assembly protein PilC"
FT                   /note="identified by match to protein family HMM PF00482"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47546"
FT                   /db_xref="GOA:Q0IE64"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE64"
FT                   /protein_id="ABI47546.1"
FT                   /translation="MVSFTATYTSATGQPRTVTVKANDAVSARRLLRRRGIKADELRQD
FT                   TSKRKGKEKFQAESKGAGGSSSAGWLSMDLGEAFQKPPGVKEKAIWASKLAALVDAGVP
FT                   IVRSLDLMATQQKLPMFKKALTSVGLEVNQGTAMAAAMRQWPKVFDQLTIAMVEAGEAG
FT                   GVLDESLKRLAKLLEDNARLQNQIKGALGYPVAVLVIAILVFLGMTIFLIPTFAGIFED
FT                   LGAELPLFTQLMVDLSALLRSSASVVFAGILMIGAWLIGRYYNTHKGRRVLDKLILKLP
FT                   LFGDLIMKTATAQFCRIFSSLTRAGVPILMSMEISSETAGNSIISDAILDSRTLVQEGV
FT                   LLSTALTRQKVLPDMALSMLSIGEETGEMDRMLSKVADFYEDEVSTSVKALTSMLEPAM
FT                   IVVVGGIVGSILLAMYLPMFTVFDQIQ"
FT   gene            complement(25515..26579)
FT                   /gene="pilT"
FT                   /locus_tag="sync_0020"
FT   CDS_pept        complement(25515..26579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="sync_0020"
FT                   /product="twitching motility protein"
FT                   /note="identified by similarity to SP:P24559; match to
FT                   protein family HMM PF00437; match to protein family HMM
FT                   TIGR01420"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46791"
FT                   /db_xref="GOA:Q0IE63"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE63"
FT                   /protein_id="ABI46791.1"
FT                   /translation="MIEDLMEQLVNGGGSDLHIASGQPPYGRFSGELRPMQEEPLSEEG
FT                   CNRLIFSMLNNSQRKTLEQTWELDCAYGLKGVARFRVNVYRQKGSYAACLRALGSKIPS
FT                   IQLLNLPPVVVETSKRPRGLVLVTGPTGSGKTTTLAALLDHINHTRAEHILTIEDPIEF
FT                   VYTSDLSLVHQRQLNEDTRSFANALRAALREDPDVILVGEMRDLETIQLAISAAETGHL
FT                   VFGTLHTSSAAQTVDRMVDVFPPSQQTQIRVQLSGSLTAVFSQTLCRRQNPAPGQFGRV
FT                   MAQEIMINTPAIANLIREGKTAQLYSQIQTGGELGMQTLERALANLIDQGEISLDEGQS
FT                   KASKPAELERLLNN"
FT   gene            complement(26600..28471)
FT                   /gene="pilB"
FT                   /locus_tag="sync_0021"
FT   CDS_pept        complement(26600..28471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilB"
FT                   /locus_tag="sync_0021"
FT                   /product="type IV pilus assembly protein PilB"
FT                   /note="identified by match to protein family HMM PF00437"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46434"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE62"
FT                   /protein_id="ABI46434.1"
FT                   /translation="MEASPLILTRCKITSRHVEGSHGPTTSAESRISMSADSTRMPLPP
FT                   ALPAKLISEAELAAGEALLHSGQVLDLETWKQLQALPIHLTDDGLMVAIASSSDRNSRE
FT                   QLKQVLKSHGYITKLVLANGADLKRILDPQEFNSDSNISQTSISETAKSLLDGFDTEGI
FT                   LSADPDEAEIQSNSASSLDINSSITGASPVVTLVDRILIKALDMNASDIHVEPQQSGLQ
FT                   IRLRKDGVLTNLAQPLPIKLIPAITSRFKIMADLDIAERRQAQDGRIRRQYKGRTVDFR
FT                   VNSLPSRYGEKICLRLLDSQSTQLGLDKLISNPNTLELVRTLGSKPFGMILVTGPTGSG
FT                   KSTTLYSLLAERNEPGINISTVEDPIEYTLPGITQCQVNREKGFDFSTALRAFMRQDPD
FT                   VLLVGETRDQETAKTAIEAALTGHLVLTTLHCNDAPSAIARLDEMGVEPFMVSASLLGI
FT                   VSQRLLRRVCSECRIPYHPDSRELGRFGLMTSDEGNITFFKAKHHEGPETPCPTCQGTG
FT                   YKGRIGVYEVLRMNEALAASVAKGATTDLVRQLALEAGMKTLLGYSLDLVREGHTTLEE
FT                   VDRMVLTDAGLESEQRARALSTVTCRGCGGGLQEGWLECPYCLTPRQ"
FT   gene            28371..29180
FT                   /gene="grpE-1"
FT                   /locus_tag="sync_0022"
FT   CDS_pept        28371..29180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE-1"
FT                   /locus_tag="sync_0022"
FT                   /product="co-chaperone GrpE"
FT                   /note="identified by similarity to SP:P15874; match to
FT                   protein family HMM PF01025"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45126"
FT                   /db_xref="GOA:Q0IE61"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE61"
FT                   /protein_id="ABI45126.1"
FT                   /translation="MLIRLSALVVGPCDPSTCLDVILHLVSMSGDASIPANDSASDVPE
FT                   AQQDPTSSVEETPAAASSDSASEGVPSAQDNEARLEQLEREHSTLRQEHETLSAQYVRI
FT                   AADFDNFRKRQSRDQDDLKLQITCSTLTEILPVVDNFERARQQLDPQGEEAQSLHRSYQ
FT                   GLYKQLVDVLKQLGVAPMRVVGQEFDPSLHEAVLREPSNEHPEDVVVEELQRGYHLSGK
FT                   VLRHALVKVSMGPGPQQSDAAVQATEGGESAPPIQGDDGSPMPAPSE"
FT   gene            29298..30353
FT                   /locus_tag="sync_0023"
FT   CDS_pept        29298..30353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0023"
FT                   /product="DnaJ protein"
FT                   /note="identified by match to protein family HMM PF00226;
FT                   match to protein family HMM PF00684; match to protein
FT                   family HMM PF01556; match to protein family HMM TIGR02349"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47537"
FT                   /db_xref="GOA:Q0IE60"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE60"
FT                   /protein_id="ABI47537.1"
FT                   /translation="MARQYHPDINKEAGAEDRFKEIGRAYEVLSDPQTRGRYDQFGEAG
FT                   LGGGGGMPDMGDMGGFADIFETFFSGFGGAAGGAGRQRRRGPQQGDDLRYDLTIDFDQA
FT                   VFGQEREIRIPHLETCTTCGGSGAKSGSGPTTCTTCGGVGQVRRATRTPFGNFEQVAEC
FT                   PSCNGSGQVIADPCSSCGGQGVTQVRKKLRINIPAGVDTGTRLRVSGEGNAGLRGGPSG
FT                   DLYVFLTVKSHPSLRRDGLTVLSEVKVSYLQAILGDTIEVETVDGPESLDIPAGTQPNS
FT                   VLSLENKGIPKLGNPVARGHQRISVTVTLPTRLNDEERGLLEDLAGHHSARGEQHHHHK
FT                   SGLFARLFGQR"
FT   gene            30357..30599
FT                   /locus_tag="sync_0024"
FT   CDS_pept        30357..30599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AI2111"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46800"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE59"
FT                   /protein_id="ABI46800.1"
FT                   /translation="MSDAQPDHYLDLRGTPCPTNFIRCRLALEAMRPGQHFQVDLDRGE
FT                   PEEMVIPGLTRDGHQVQVMDQASDWVRLLVVCGGA"
FT   gene            30586..31500
FT                   /locus_tag="sync_0025"
FT   CDS_pept        30586..31500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0025"
FT                   /product="ribosome-associated GTPase YjeQ"
FT                   /note="identified by match to protein family HMM PF03193;
FT                   match to protein family HMM TIGR00157"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47470"
FT                   /db_xref="GOA:Q0IE58"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE58"
FT                   /protein_id="ABI47470.1"
FT                   /translation="MVVLDQPAQSGMVVALQANYLEVELDQVSELIPSRLLCTRRTRLS
FT                   HRGEAVYVGDRVRVEAIDVSHARAVVADVEPRVSFLTRPPVANASTVVVALAVDQPAFD
FT                   PDQASRFLLTAERTSLAVQLVLTKTDLLEPEALERLRVRLQAWGYPPLLVSTFSGLGLS
FT                   ELKQRLAESSLSVLCGPSGVGKSSLLNALIPELDLRIGSVSGRLQRGRHTTRHVELHHL
FT                   GAKARVADTPGFNRPDLPDDPRNLEVLFPELRVQLEQHPCRFRDCLHRDEPGCGVTRDW
FT                   ERYPIYRRAVEDLLGLSRPSRGG"
FT   gene            complement(31475..31816)
FT                   /locus_tag="sync_0026"
FT   CDS_pept        complement(31475..31816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0026"
FT                   /product="conserved hypothetical protein TIGR00103"
FT                   /note="identified by match to protein family HMM PF02575;
FT                   match to protein family HMM TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45040"
FT                   /db_xref="GOA:Q0IE57"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE57"
FT                   /protein_id="ABI45040.1"
FT                   /translation="MAGFGLPNFGQLTEAFRKAQQIQQDAQKLQEELDAMEIEGNSEDG
FT                   RASIWLSGNQQPLRVRLDPSLLSEGQEATEAATLAALQSAYERSTGTMKERMEELTGGL
FT                   NLNLPGMGG"
FT   gene            complement(31841..32779)
FT                   /gene="murB"
FT                   /locus_tag="sync_0027"
FT   CDS_pept        complement(31841..32779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="sync_0027"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF02873; match to protein
FT                   family HMM TIGR00179"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47331"
FT                   /db_xref="GOA:Q0IE56"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE56"
FT                   /protein_id="ABI47331.1"
FT                   /translation="MFTGDRGLNALLESGVLQQEVPLANYTTWRVGGPAQWLAEPNNAE
FT                   QCLELLQWAKAEGLTTRVIGAGSNLLIADAGLPGLTLCLRRLQGSQLDAESGQVKALAG
FT                   EPLPTLARRAARLGLHGLEWAVGIPGTVGGAAAMNAGAQGGSTADCLTAVEVIDQSLTD
FT                   TVKTTTLLSNTDLAYDYRHSLLQGSDQMVVAAQFQLEPGHDAKELMRKTSGNLSHRTTT
FT                   QPYQWPSCGSVFRNPEPEKAGQLIEGLGLKGRRIGGAEVSSVHANFIVNVGDATADDIR
FT                   ALIDLVQNEVERMNGITLHPEVKRLGFQTTD"
FT   gene            complement(32755..34206)
FT                   /gene="murC"
FT                   /locus_tag="sync_0028"
FT   CDS_pept        complement(32755..34206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="sync_0028"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="identified by match to protein family HMM PF02875;
FT                   match to protein family HMM TIGR01082"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46504"
FT                   /db_xref="GOA:Q0IE55"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE55"
FT                   /protein_id="ABI46504.1"
FT                   /translation="MADSIQPEKHIHFIGMGGIGMSALALILAERGHSVSGSDRKLTPA
FT                   MQALETKALAIFESQVSKNFAHLQSRGIEEPLVVVSTAIPSTNPELIEAQRLDLTIWHR
FT                   SDLLAWLIEQQPSIAVAGSHGKTTTSTVLTTLLATVGEDPTAVIGGVVPCYGSNGHKGN
FT                   GRLLVAEADESDGSLVKFKASLGIITNLELDHTDHYRNLDDLIETMKTFGRGCKRLLIN
FT                   HDDPILKEHFQADACWSVHHVETADYAALPVQLDGDRTIADYFEQGQKVGQITLPLPGL
FT                   HNLSNVVAALAACRMEGVPLEALLLAVTELRSPGRRFDFRGEWQDRQVVDDYAHHPSEV
FT                   QATLTMAQLMVQSGRSPLPRTPQRLLAVFQPHRYSRTQEFLNAFAQALVSADALVLAPI
FT                   YGAGEQPIEGINSELLARSIRLIDPNQPVFVASTMEELAGLVKQHSQPDDLILAMGAGD
FT                   VNSLWERLSQEGIGGEASCSPAIAA"
FT   gene            34373..35398
FT                   /gene="gap-1"
FT                   /locus_tag="sync_0029"
FT   CDS_pept        34373..35398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap-1"
FT                   /locus_tag="sync_0029"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.-"
FT                   /note="identified by match to protein family HMM PF00044;
FT                   match to protein family HMM PF02800; match to protein
FT                   family HMM TIGR01534"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46054"
FT                   /db_xref="GOA:Q0IE54"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE54"
FT                   /protein_id="ABI46054.1"
FT                   /translation="MTLRVAINGFGRIGRNVLRGWISRGADTGLEIVGMNSTSDPKTSA
FT                   HLLTYDSILGRLDPSVDIKTTDDSMFINGKEIKFFADRNPLNCPWKEWGVDLVIESTGV
FT                   FNTDEKASMHIQAGAKKVILTAPGKGAGVGTFVVGVNDDQYRHEDWDILSNASCTTNCL
FT                   APIVKVLDQNFGMEWGLMTTIHSYTGDQRILDNNHRDLRRARAAALNMVPTTTGAAKAV
FT                   ALVYPEVKGKLTGFAMRVPTPNVSAVDLTFGTSKGPSVEEVKAAMKSASENGMKGIIKY
FT                   TDLPLVSTDYAGTNESTIFDADLTYAMGDKAVKILAWYDNEWGYSQRVVDLAEVVAKGW
FT                   K"
FT   gene            complement(35461..36441)
FT                   /gene="thiL"
FT                   /locus_tag="sync_0030"
FT   CDS_pept        complement(35461..36441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="sync_0030"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="identified by match to protein family HMM TIGR01379"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45187"
FT                   /db_xref="GOA:Q0IE53"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE53"
FT                   /protein_id="ABI45187.1"
FT                   /translation="MSITLAELGETQLLDRLARFAPPGQLNDDTALLPPDSRALLVNTD
FT                   VMVEGVHFSDATTAPADVGWRAAVANLSDLAASGSEQVEGITVGLVAPGSTSWWWVEQV
FT                   YEGISEALERFGGTLLGGDCSTGNQRVLSISAFGRLGPLRLHRALARPGDLLMSSGPHG
FT                   LSRLGLALLQDTALPTPLSLPPMLKKQAIRCHQRPWPRFDALQTLMACKPEQLPWRAGG
FT                   TDSSDGLLAAVESLCRSSGCGAVLRREALPRADDWPCEERWDRWCLSGGEDFELVLSLP
FT                   PEWAESWKRHQPESRCFGTITAETGRIIWNEDGALLQPSGFSHYR"
FT   gene            complement(36449..37522)
FT                   /locus_tag="sync_0031"
FT   CDS_pept        complement(36449..37522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0031"
FT                   /product="peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin-type"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00160"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47117"
FT                   /db_xref="GOA:Q0IE52"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR023222"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE52"
FT                   /protein_id="ABI47117.1"
FT                   /translation="MAHRRLTALLLAWLAAFGLWLAKPVWADLPQGNAVQDPAAILRDS
FT                   LPMNQEDLRELQHRLESTSNDLRAKRWGALGRTVSRTQKLVATQGNNIVEAVPEEQRSQ
FT                   AELLLNEVRSDLVKLQDEADANDRDGFIQIRRDTLSRIGDLEALLIDDRLPDIPSEFDA
FT                   LPRLAGRATVVIETTQGNLTAVVDGYNAPLTAGAFIDLSLKGFYDGLPFNRAEDFYILQ
FT                   TGDPEGPDIGYVDPKTKQERHVPLEIRIPGETDTLYNETFEDVGLFKAAAVLPFSTLGT
FT                   LGWAHSDQALDDGSSQFFLFLYEAELTPAGLNLVDGRNAAFGYVVDGFDVLEELGVDDG
FT                   IKRIQVIEGADRLQAHA"
FT   gene            37588..38151
FT                   /gene="efp"
FT                   /locus_tag="sync_0032"
FT   CDS_pept        37588..38151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="sync_0032"
FT                   /product="translation elongation factor P"
FT                   /note="identified by match to protein family HMM PF01132;
FT                   match to protein family HMM PF08207; match to protein
FT                   family HMM TIGR00038"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47842"
FT                   /db_xref="GOA:Q0IE51"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE51"
FT                   /protein_id="ABI47842.1"
FT                   /translation="MISSNDFRTGTTIELDGAVWRVVEFLHVKPGKGSAFVRTKLKAVQ
FT                   SGSVVEKTFRAGEMLQQALLEKSTLQHTYMEGEDFVFMDMSTYEETRLTAKQIGDSRKY
FT                   LKEGMEVNVVTWNEKPLEVELPNSVVLEIAQTDPGVKGDTATGGTKPAILETGAQVMVP
FT                   LFLSIGEKIKVDTRNDTYLGRENG"
FT   gene            38154..38633
FT                   /gene="accB"
FT                   /locus_tag="sync_0033"
FT   CDS_pept        38154..38633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="sync_0033"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00364;
FT                   match to protein family HMM TIGR00531"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45924"
FT                   /db_xref="GOA:Q0IE50"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE50"
FT                   /protein_id="ABI45924.1"
FT                   /translation="MQLDHDQLHTLLAALVESDIQEFRLEGDDFRLEVRRNLPVTTVAA
FT                   PLAPVASAPVAPPPESPAVEFSAGTPPPAAGSRSDLLEVTAPMVGTFYRAPAPGEPSFV
FT                   EIGTRIGVGQTICILEAMKLMNELESELAGEVVEILVENGTPVEFGQVLMRVKPG"
FT   gene            complement(38620..39648)
FT                   /gene="pdxA"
FT                   /locus_tag="sync_0034"
FT   CDS_pept        complement(38620..39648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="sync_0034"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="identified by match to protein family HMM PF04166;
FT                   match to protein family HMM TIGR00557"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45100"
FT                   /db_xref="GOA:Q0IE49"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE49"
FT                   /protein_id="ABI45100.1"
FT                   /translation="MSFSHPSSDATHRLVIALGDPAGIGMEVTLKALADPRLPDGLNPL
FT                   VVGCRKTLEQTYTRLKAQQCPLLMDPSNLDIDDLPIHDAITPGRPSPESGASSFRWLSH
FT                   AVSRVKEAQTLALVTAPIAKHAWHAAGHDYPGQTERLAELDNARQASMLFTAVSPNHGW
FT                   RLNTLLATTHIPLQEVPTALTPDLILRKLDVLSEFCLRFNPNPRLLVAGLNPHAGEQGR
FT                   LGSEETNWLIPALHQWQHNHPHIYLSGPLPPDTCWLSAAKAWQQGGQAESPDGILALYH
FT                   DQGLIPMKLMAFDEAVNTTLGLSFLRTSPDHGTGFDIAGQGVARSTSMVAAIRAAWELS
FT                   RA"
FT   gene            complement(39804..40733)
FT                   /gene="wcaG-1"
FT                   /locus_tag="sync_0035"
FT   CDS_pept        complement(39804..40733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wcaG-1"
FT                   /locus_tag="sync_0035"
FT                   /product="NAD dependent epimerase/dehydratase"
FT                   /note="identified by match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45796"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE48"
FT                   /protein_id="ABI45796.1"
FT                   /translation="MLNDLVNRCAPLPSGATLCILGAGFSGGHLAKLSKALGTRVICTS
FT                   RRPESGSDHLPFDSAKGIVPGHEVLASVTHLISTIPPTKEGADPVLSCLGEQLQQLPLQ
FT                   WVGYFSTTGVYGNSNGNWVNETNEPQPTQLRSQKRLDCEQLWRKSGLPVQILRLPGIYG
FT                   PGRSPLAAVRSGEVTPVDQPGQMFCRIHVDDLAGACWHLMHRAAAGQRPTVVNISDNRP
FT                   ASRLELQRFAAELLGCKLPAPIPFSEAQATMSPMALSFWADNRKVSNALLRDELGYTFL
FT                   HPDYSSGLKDCFEAEGFNAMNPEPEAEP"
FT   gene            40806..40997
FT                   /locus_tag="sync_0036"
FT   CDS_pept        40806..40997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0036"
FT                   /product="possible Squash family serine protease inhibit"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46788"
FT                   /db_xref="GOA:Q0IE47"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE47"
FT                   /protein_id="ABI46788.1"
FT                   /translation="MLPQSRVSRRGRAQAQDIARLRTGSALLAAALVTGALLLAPERPE
FT                   QSASICQHYHSAAACRVW"
FT   gene            complement(40998..41429)
FT                   /gene="mcrA"
FT                   /locus_tag="sync_0037"
FT   CDS_pept        complement(40998..41429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcrA"
FT                   /locus_tag="sync_0037"
FT                   /product="HNH endonuclease:HNH nuclease"
FT                   /note="identified by match to protein family HMM PF01844"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47543"
FT                   /db_xref="GOA:Q0IE46"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE46"
FT                   /protein_id="ABI47543.1"
FT                   /translation="MHSRDAVFLEDLCPKLRNRRWRQSIHLHTCNRCIYCGKPSESIDH
FT                   VFPLSRGGMSVTENCVPACLSCNGQKSDADVFDWYRRQRFYDPRRAMAIRAWTDGDLRL
FT                   AIRLLQWAQPEHNQPPNSKRANDTLTKGDDEQSWGLRTA"
FT   gene            41838..43223
FT                   /locus_tag="sync_0038"
FT   CDS_pept        41838..43223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0038"
FT                   /product="possible helicase"
FT                   /note="identified by match to protein family HMM PF00176;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45109"
FT                   /db_xref="GOA:Q0IE45"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE45"
FT                   /protein_id="ABI45109.1"
FT                   /translation="MRWLHWHRHPLPPLPPHRDLIAHADLDQRLRDGRLPMPHQRSGAR
FT                   WLLARRGAVLADEMGLGKTLTVLLAARALLRALPLRLLVVAPVGLHSHWRREAAALDLI
FT                   PDLCSWARLPSELPEAGTLLLVDEAHYAQTLHAQRTQSFLRLARHPRLRAIWMLTGTPM
FT                   KNGRPDQLYPLLAAMDHPIARDQHSYEELFCQGHFREQGGRQRWQTAGASRLDELRRLT
FT                   RPLVLHRRKQQVLDLPPKRRMFEGIDLDAEEVKGFDYRLRLVIDDYRQRVAEGLVRSDA
FT                   ESLAVLTALRQIAAEFKLPAAQQLIQRLRQQHKPIVVFSSFVDPLLLLHERLGGVLLTG
FT                   RQKPDQRQFAVDCFQAGETDLLLATFAAGGLGFTLHRSQDVVLLERPWTPGDIDQAEDR
FT                   CHRIGMEGGLTSHWLQLGLADQLVDGLVASKAERIELLLGPRRVTLDRQPLPKMVSRCL
FT                   QDL"
FT   gene            complement(43576..44091)
FT                   /locus_tag="sync_0039"
FT   CDS_pept        complement(43576..44091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0039"
FT                   /product="possible Penicillin amidase"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45762"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE44"
FT                   /protein_id="ABI45762.1"
FT                   /translation="MGWVIPDSGLDRATPIDILVSDRFNRPAMALLRQRLALLLSLAGI
FT                   AGLGLTPLEAIAGTPEAVKGAKIYCYMRSSNNDHTVSWEAAYALIKRQKSGMFKTSPEH
FT                   AAVMITEAVVEDPGSYPDCGQYLGDLFGGSKGSAKSLNSVLNSTNSSNSSTTSETSSDW
FT                   DKDDRYSY"
FT   gene            complement(44072..44587)
FT                   /locus_tag="sync_0040"
FT   CDS_pept        complement(44072..44587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46769"
FT                   /db_xref="GOA:Q0IE43"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE43"
FT                   /protein_id="ABI46769.1"
FT                   /translation="MPPLTTVLLYLLAGTSMGLLATRTGIPAAPLAGALIGAAMVSMSG
FT                   RLEVAQWPTGTKTCLEIAIGTVIGTGLTRTSLDQLQQLWKPAVLITLTLVLTGIVVGLW
FT                   SSRLLGVDPLVTLLGAAPGGISGMSLVGADYGVGAAVAALHAVRLITVLLVIPVVVKLL
FT                   TPLGLGDS"
FT   gene            44672..44962
FT                   /locus_tag="sync_0041"
FT   CDS_pept        44672..44962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0041"
FT                   /product="possible methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47453"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE42"
FT                   /protein_id="ABI47453.1"
FT                   /translation="MTQSVSFRITRTAEDVAETLNALSQRLIKLENRLESLELQLERQS
FT                   SEVNTMPTDEMERLDGVDRLLTDCRDLLLRSEPQWVDQSNSDMSSEQDLAA"
FT   gene            45001..45204
FT                   /locus_tag="sync_0042"
FT   CDS_pept        45001..45204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0042"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45487"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE41"
FT                   /protein_id="ABI45487.1"
FT                   /translation="MAHSPTNSAAMCEVMLRNRQNFFEGGHQLEKLEFALAVAITRGDA
FT                   SRCEMLRGQIAELGGNIEEPGT"
FT   gene            45259..45486
FT                   /locus_tag="sync_0043"
FT   CDS_pept        45259..45486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46157"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE40"
FT                   /protein_id="ABI46157.1"
FT                   /translation="MLNSVLDRTSTMVQSAPNQKQEHLAKAGVFFQKAQSAAEAGDVSS
FT                   SGSFILKALEQERRAGTVGPQVMQLIKPRS"
FT   gene            complement(45490..45561)
FT                   /locus_tag="sync_0044"
FT   tRNA            complement(45490..45561)
FT                   /locus_tag="sync_0044"
FT                   /product="tRNA-Gly"
FT   gene            complement(45613..46767)
FT                   /locus_tag="sync_0045"
FT   CDS_pept        complement(45613..46767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0045"
FT                   /product="soluble hydrogenase, tritium exchange subunit,
FT                   putative"
FT                   /note="identified by similarity to SP:P14776; match to
FT                   protein family HMM PF00266"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46053"
FT                   /db_xref="GOA:Q0IE39"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE39"
FT                   /protein_id="ABI46053.1"
FT                   /translation="MQDKLTLMIPGPTPVPETVLKAMGRHPIGHRSGEFQAVVERTTAQ
FT                   LRWLHQTNNDVLVITGSGTAAMEAGIINTLSRGDRVICGDNGKFGERWVKVARAYGLEV
FT                   EVIKADWGHPLDPENFRTALEADSDKTIRAVILTHSETSTGVINDLETISRHVQAHGTA
FT                   LTIADCVTSLGATNVPMDDWNLDVVASGSQKGYMMPPGLSFVAMSERAWKAYERSDLPK
FT                   FYLDLGPYRKTAAKNSNPFTPAVNLYFALDAALEMMQAEGLEAIFARHARHRDAAIAAM
FT                   KAIGLALFAAEGHGSPAITAVAPAGMDAELLRKTIKDRFDILLAGGQDHLKGKVFRIGH
FT                   LGFVCDRDVLTAVAAIESVLHSLGFHKGQMGAGLSAASAALSNN"
FT   gene            46810..47997
FT                   /gene="cbiD"
FT                   /locus_tag="sync_0046"
FT   CDS_pept        46810..47997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiD"
FT                   /locus_tag="sync_0046"
FT                   /product="cobalamin biosynthesis protein CbiD"
FT                   /note="identified by match to protein family HMM PF01888;
FT                   match to protein family HMM TIGR00312"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45244"
FT                   /db_xref="GOA:Q0IE38"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE38"
FT                   /protein_id="ABI45244.1"
FT                   /translation="MLFGITQSRTDSPQGLTLPVWVAAAARAATQVLCGQAFENPQSLK
FT                   IPGRDQPLSVQVQSAAPLQRGEQALAISRCDPGPGLDLTRDLEIWVQVRWSQPETGWLE
FT                   IVPGEGLGRQGSEGDLCASDFARRVMEANLRDLVPTGRCLQLEVVFPLGRELAQRTSNA
FT                   AFGVVDGLALIGTQAEVQSSASPDQLRASLDALQAIAGAADFCGSLTLVIGENGLDLAH
FT                   QLGLADQQPLLKAGNWIGPLLVASAEAGISNLLLLGYHGKLVKLAGGIFHTHHHLADGR
FT                   LEVLAAIALQQGLGVDLIKDLLGCASMESALQELQKRDSTRADQVWQAIAQAVEVRSEA
FT                   YLKRYGTWPMRVGAALFDRQRQLRWTGLTGLSLLACCGLGIHSEGDEAGFGPSLR"
FT   gene            48046..49632
FT                   /gene="guaA"
FT                   /locus_tag="sync_0047"
FT   CDS_pept        48046..49632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="sync_0047"
FT                   /product="GMP synthase, glutamine-hydrolyzing"
FT                   /EC_number="6.3.5.2"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF00958; match to protein
FT                   family HMM TIGR00884; match to protein family HMM
FT                   TIGR00888"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47248"
FT                   /db_xref="GOA:Q0IE37"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE37"
FT                   /protein_id="ABI47248.1"
FT                   /translation="MSSVQSEGQRKPAIVILDFGSQYSELIARRVRETEVFSVVLGYST
FT                   SAEELRALAPRGIILSGGPSSVYADEAPLCDPAIWDLGVPVLGVCYGMQLMVQQLGGQV
FT                   VAATGKAEYGKAPLKVDDPTALLTNVESGSTMWMSHGDSVEALPDGFLRLAHTANTPEA
FT                   AIANHKRRLYGVQFHPEVVHSTGGMVMIRNFVYHICGCEPDWTTEAFIDEAVANVRDQV
FT                   GQKRVLLALSGGVDSSTLAFLLKKAIGDQLTCMFIDQGFMRKGEPEFLMEFFDRKFNIH
FT                   VEYINARERFIKKLDGITDPEEKRKIIGTEFIRVFEEESRRLGPFDYLVQGTLYPDVIE
FT                   SAGTNVDPKTGERVAVKIKSHHNVGGLPKDLRFKLVEPLRKLFKDEVRKVGRTLGLPEE
FT                   IVSRHPFPGPGLAIRILGEVTEEKLDCLRDADLIVREEVNAAGLYHDIWQAFAVLLPVR
FT                   SVGVMGDKRTYAWPIVLRCVSSEDGMTADWSRLPYDLMEVISNRIVNEVKGVNRVVMDI
FT                   TSKPPGTIEWE"
FT   gene            50173..50553
FT                   /locus_tag="sync_0048"
FT   CDS_pept        50173..50553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0048"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46411"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE36"
FT                   /protein_id="ABI46411.1"
FT                   /translation="MEIRVTLKQGGSVLPMPVEEVVERFLKTKRARIREEWEGKDAAGR
FT                   RSITKERYALIEGKLRNYLVPFLGAKTDARNVPFSKWNEWEGWRVESRHTRTGGKPKAI
FT                   TIQNEMGGKRFLLSGVLMRNPD"
FT   gene            51902..52549
FT                   /locus_tag="sync_0049"
FT   CDS_pept        51902..52549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0049"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE35"
FT                   /protein_id="ABI45388.1"
FT                   /translation="MASISLAPGINPLTAAQEQDLQLQRRLQQDSILLAGKTIYINPFL
FT                   YWRRFDSNTDRWLREPGQLPEEQIASNRSRFYPELDWTLLDDSNREIKDGAVEMFLKSL
FT                   ELIGTFHPELSSGHLLEVERKMAITKKRSFERWVEKSYRRRAKQETRERRRFDRDRFWR
FT                   SWGEWLALEATHHALAPAVALLVLTGVGGWWIGSSNSSCPTLLPPPEQTGVR"
FT   gene            52504..52959
FT                   /locus_tag="sync_0050"
FT   CDS_pept        52504..52959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE20222.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47689"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE34"
FT                   /protein_id="ABI47689.1"
FT                   /translation="MSDTFASSGADWSPLSTSLLMAENQPFDTLRLTLMQEVLPVGLAL
FT                   VERVRAGGPAKVVEPFTSGASDPLRELRDEGEPAAKGVRERLDQVSPGLGNPVMPVQVA
FT                   VEEPSAEVVDVIEEGSSPEQEEHQLHEVLARITQRLQALEAQLEQES"
FT   gene            52965..54770
FT                   /locus_tag="sync_0051"
FT   CDS_pept        52965..54770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0051"
FT                   /product="Putative penicillin-binding protein"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF03717"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46764"
FT                   /db_xref="GOA:Q0IE33"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE33"
FT                   /protein_id="ABI46764.1"
FT                   /translation="MTRSASPQRDAQRHSGLRQQPLVLFGLVLLFCSAMVARLVWLQVL
FT                   EGPRYRQLADENRIRLVPRSPTRGRLLDRKGRVLASSKLTYSLYVEPRLVDDAAWPELR
FT                   DRLSSLMDLNPMTLDRRRQSGPDRNGYRINLASELSSEQVLRFREQSLGLKGAQVDVDI
FT                   LRAYPYGTLAAHTLGYTQPITEEEYTALADRGYKIRDRIGRIGVEAAYESHLRGKWGGQ
FT                   MLEVNAMGEVQRHLGDRPSVAGKDLTLTLDLDLQKTAEQALADKPGGAIVAMDPRNGAI
FT                   LALASNPNFDPNFFSKLVTTQKEYDALFSNPKKPLLSRAMNAYDPGSTWKPVTAMAGMA
FT                   SGKFPPEVKLNTTSCITYGGHCFPDHNGAGFGRIGYADALRFSSNTFFYQVGVGSGSLA
FT                   LKKAATQLGFGRKTGIEIGWEENVGLVGDEEWAKEGRGWAEPGSTPWIPEDMASASIGQ
FT                   SVVQITPLQLARAYSVFANGGWLVTPHLADQGLDWTAPSRRTKVPIKPSTLAKIREGLR
FT                   KVVEDGTGYGLNGEGIPPAAGKTGTAEDSTGGPDHAWFASYAPYPNGEIVVVAFAQNTP
FT                   GGGSVHALPMAKKVIEVWNRNRKQN"
FT   gene            complement(54772..55917)
FT                   /locus_tag="sync_0052"
FT   CDS_pept        complement(54772..55917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0052"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45827"
FT                   /db_xref="GOA:Q0IE32"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE32"
FT                   /protein_id="ABI45827.1"
FT                   /translation="MKIAFFTETFLPKVDGIVTRLTKTVKHLVDAGDEVVVFCPEGAPS
FT                   HYMGAKVVGVPAMPLPLYPELKLALPRPAVSEAIDAFQPDLIHVVNPAVLGLGGIWLAK
FT                   TKSIPLIASYHTHLPKYLEHYGMGMLEPLLWELLKAAHNQAVLNLCTSTAMVQELSDKG
FT                   IQHTALWQRGVDTELFRPELRSPELRQRLLGEYDDRGALLLYVGRLSAEKQIERIRPVL
FT                   EALPDTRLALVGDGPHRQQLEKHFEGTATTFVGYLAGEELAGAYASGDAFLFPSSTETL
FT                   GLVLLEAMAAGCPVVGANRGGIPDIISDGVNGCLYEPDGADAGAGSLIEATGKLLGNDL
FT                   ERQALRNAARSEAERWGWAGATEQLRGYYRQVLSSDISSAA"
FT   gene            complement(55931..57127)
FT                   /gene="sqdB"
FT                   /locus_tag="sync_0053"
FT   CDS_pept        complement(55931..57127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sqdB"
FT                   /locus_tag="sync_0053"
FT                   /product="sulfolipid biosynthesis protein SqdB"
FT                   /note="identified by match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45489"
FT                   /db_xref="GOA:Q0IE31"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE31"
FT                   /protein_id="ABI45489.1"
FT                   /translation="MKVLVLGGDGFCGWPCAVNLADQDHDVVIVDNLSRRKIDIDLEVE
FT                   SLTPIVSIGERLNVWESIGGKPMRFIHMDIAHEYQRLLDLIIEEKPDSIVHFAEQRAAP
FT                   YSMKSSATKRYTVDNNVNGTHNLLAAIVESGQDIHVVHLGTMGVYGYGSHRGATIPEGY
FT                   LKVEVPQPDGSRFEEEILHPASPGSVYHMTKTLDQLLFLYYNKNDKVRITDLHQGIVWG
FT                   TNTEATDRDPRLTNRFDYDGDYGTVLNRFLMQAAIGYPLTVHGTGGQTRAFIHIRDSVR
FT                   CVQLALENRPEKGERVKIFNQMTESHQVGELAKKVAALTGAQVNNLPNPRNEAVENDLI
FT                   VDNRCFIELGLKPTTLDDGLLKEVVEIATRYADRCDRNRILCTSAWTKTQAQAIGNAS"
FT   gene            complement(57186..57353)
FT                   /locus_tag="sync_0054"
FT   CDS_pept        complement(57186..57353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0054"
FT                   /product="possible high light inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46288"
FT                   /db_xref="GOA:Q0IE30"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE30"
FT                   /protein_id="ABI46288.1"
FT                   /translation="MQVTEEDGGRLNAFAKEPRMEVISEGASLSNGSRLLIISGAVLVV
FT                   ALMALSVAVS"
FT   gene            complement(57488..58357)
FT                   /locus_tag="sync_0055"
FT   CDS_pept        complement(57488..58357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0055"
FT                   /product="thiamin biosynthesis protein"
FT                   /EC_number="1.5.3.-"
FT                   /note="identified by match to protein family HMM PF05690"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46968"
FT                   /db_xref="GOA:Q0IE29"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE29"
FT                   /protein_id="ABI46968.1"
FT                   /translation="MRPAWTPSRSGSPTKPQLTTMDPTHSHDDALQIGGRTFNSRLITG
FT                   TGKYPSLEAMQHSLQRSGCEMVTVAVRRVQAVAEGHAGLMEAIDWSQIWMLPNTAGCTN
FT                   AEEAVRVARLGRELAKLAGQDNNFVKLEVIPDSRHLLPDPFGTLEAAEMLVKEGFTVLP
FT                   YINADPLLAKRLEDVGCATVMPLGSPIGSGQGLRNAANIGLIIENAKVPVVVDAGIGVP
FT                   SDAAQAMEMGADAVLINSAIALSGQPPLMAEAMANAVNAGRQSLRAGRLPTRPEASPSS
FT                   PTSGRING"
FT   gene            58299..58913
FT                   /locus_tag="sync_0056"
FT   CDS_pept        58299..58913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47505"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE28"
FT                   /protein_id="ABI47505.1"
FT                   /translation="MVSCGLVGEPDRDGVQAGRNRSNLRESSIACMPVPPVMDVPVEIQ
FT                   APFESSQSFDSSQLAIPLELEGSVESFDPVARAADLAATLPRQWCGNYTSFTSNSTVDV
FT                   ELTLTRLKPMGQMVDLRGEMRIGSISTPVQGNLNAKSDQLDLLPLSSELTDDLEIGGRF
FT                   LGLQDFSLAGWVAPRLTNPGGRLDLSGSCAVSESAPIRALW"
FT   gene            complement(58881..59456)
FT                   /locus_tag="sync_0057"
FT   CDS_pept        complement(58881..59456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0057"
FT                   /product="putative photosystem I assembly related protein
FT                   Ycf37"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45320"
FT                   /db_xref="GOA:Q0IE27"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE27"
FT                   /protein_id="ABI45320.1"
FT                   /translation="MNSLLPQTYLLGLIGLLAIVAVVGGRQFLRVRRDEQSLLKMEQDK
FT                   VASSKDAGALYELASVQLRKRLYPQAIVTLRQAVKRLNDEPDEARALIENALGYALAAE
FT                   KDFTTAVRHYKSALRAKENYPVAINNLAFAQERLLENEEACALYRKALVLDPKNKTARK
FT                   RLNRLERAASKSKNSSQASPKSPDGRGF"
FT   gene            complement(59493..59840)
FT                   /gene="rplT"
FT                   /locus_tag="sync_0058"
FT   CDS_pept        complement(59493..59840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="sync_0058"
FT                   /product="ribosomal protein L20"
FT                   /note="identified by match to protein family HMM PF00453;
FT                   match to protein family HMM TIGR01032"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47747"
FT                   /db_xref="GOA:Q0IE26"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE26"
FT                   /protein_id="ABI47747.1"
FT                   /translation="MARVKRGNVARKRRNKILRLARGFRGSNGTLFRTANQRVMKALCN
FT                   AYRDRRRRKRDFRRLWIARINAAARMNGVSYSRLIGGLKKADVRINRKMLAQMAVVDPA
FT                   SFANVVNATQG"
FT   gene            complement(59911..60108)
FT                   /gene="rpmI"
FT                   /locus_tag="sync_0059"
FT   CDS_pept        complement(59911..60108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="sync_0059"
FT                   /product="ribosomal protein L35"
FT                   /note="identified by match to protein family HMM PF01632;
FT                   match to protein family HMM TIGR00001"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47147"
FT                   /db_xref="GOA:Q0IE25"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE25"
FT                   /protein_id="ABI47147.1"
FT                   /translation="MPKLKTRKAAAKRFKATGTGKFMRRRAFHNHLLDHKTPKQKRHLK
FT                   TKAVVDRTDEERVTLMMPYA"
FT   gene            60053..61798
FT                   /locus_tag="sync_0060"
FT   CDS_pept        60053..61798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0060"
FT                   /product="SpoIID/LytB domain protein"
FT                   /note="identified by match to protein family HMM TIGR02669"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46136"
FT                   /db_xref="GOA:Q0IE24"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE24"
FT                   /protein_id="ABI46136.1"
FT                   /translation="MPVALNRLAAALRVLSLGIGLAARGISDNNRTLPSPKPINSSHVM
FT                   LNPVAADVSLTPPFGWLKCRVVVPLALVSAIACGCRAQEATLESGSPVVVTHRSVPLPP
FT                   KANQAPLWVALDDHLGRGTTTQRSGPLLTLNSAGQQSLRMRDGSGAEVAEARSLRLSWR
FT                   LAPLAEPVDIARQIAGPFASFESAERIANRWRNQGVVARVAHPGDWEVWAPIDAEPLEG
FT                   VPVRRWMRTVKTEMKAVLEGPSGGRTLTGPLMLEAPNGLLWQGGVLRGPFRLQPDAYGS
FT                   WTLLEQVPLERYLEGVVPHEIGAGSPRAALEAQAVLARTWALANSHRFAIDGYHLCSDT
FT                   QCQVYSDPRQASAAVRQAIRATSGQVLAWNGEPIQAWYHASNGGVMAGGDEAWAMDSLP
FT                   YVQARADGSEAWVNGMALPMKDASSVSGLLARSEGAYGTNHPRFRWSRTYSAGQVAQAL
FT                   SAAGLPSGVPSDLSVQKRGASGRVLALDIEMSGDGEAVLLQLDGIRRTLRRLPSTLFVI
FT                   ETLGPDRWRFNGGGFGHGVGLSQAGAIDLAARGWSFERILSHYYPGTTLTSVQPSASSV
FT                   TGQAP"
FT   gene            61805..63208
FT                   /locus_tag="sync_0061"
FT   CDS_pept        61805..63208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0061"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46641"
FT                   /db_xref="GOA:Q0IE23"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE23"
FT                   /protein_id="ABI46641.1"
FT                   /translation="MTSNGDRVLAAGTGDRRRGKTALFLVACGCAGAAPHWLDPSRSLI
FT                   PSLTLALVLGGYSLSTTLRGSDESASPANGTPANEGDEPSSKDTSLAAEPAVVESLASW
FT                   PNVDVVVAARDEEAVVARLMERLGALRYPADQLTTWIIDDGSEDKTPDLLDELKPQYPN
FT                   LNVIRRPRNAGGGKSGALNAALAQSSGEWILVLDADGQISEDQLERLIPIAVMGDWSGV
FT                   QMRKAVTNADTNLLTRLQAMEMAFDALIQQGRLLGGGVSELRGNGQLLRRDVLEACGGF
FT                   NEDTVTDDLDLSFRFLLQGARTTLLWNPPVREEAVETISALWKQRQRWAEGGLQRFFDY
FT                   WPGLLSNRLTVGQRRDLACFFLLQYALPVLSFADLLTSVFTRTSPAYWPLSIVAFGVSG
FT                   VAYWRGCRRFSEGPSLPQPDPFSLLLGIAYLSHWFFVIPWVTLRMAVLPKRLVWAKTSH
FT                   RGNEETVKA"
FT   gene            complement(63229..65160)
FT                   /gene="dnaX"
FT                   /locus_tag="sync_0062"
FT   CDS_pept        complement(63229..65160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="sync_0062"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM TIGR02397"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47529"
FT                   /db_xref="GOA:Q0IE22"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE22"
FT                   /protein_id="ABI47529.1"
FT                   /translation="MSQAYQPLHHKYRPQRFDQLVGQEAIAATLGHALTSGRIAPAYLF
FT                   SGPRGTGKTSSARILARSLNCLSHDGPTPQPCGTCELCNTIARGTALDVIEIDAASNTG
FT                   VDNIRDLIERSRFAPVQARWKVYVVDECHMLSTAAFNALLKTLEEPPPQVVFVLATTDP
FT                   QRVLPTILSRCQRFDFRRIPLEALNSHLAWIAEQESIPIQPEALHVVAQRAQGGLRDAE
FT                   SLLDQLSLLPGPIKADAVWDLLGAVPEQELLNLAEALAEGEPLTLLEASRRLLDRGRDP
FT                   GAVLQGLAGILRDLVLMAVAPDRPELTGVSPQFREQLPALAKRLGRQRLLYWQAQLKGS
FT                   EQQLRQSVQPRLWLEVLLLGLLAEAELPVAKPSSAAPGSNPPSSAQASIPPAISTPALT
FT                   STDPAAETTAPPPVSLPNTSPQPVVSSEPAPTPQSVQDPDPDSHNLAELWQQILASLEL
FT                   PSTRMLLSQQAQLVRLDPHRAVVQVAGNWMGMVQSRASLLEQAIKRSIGGNRQLVLENH
FT                   GGAAPMASTPAAATQSTPSTPITAPTASQAQPSQPKPASPAPVAVPAVQPSSITPVAAP
FT                   TTNSPPASAKPPSVVSAEGSGPGSPSMGSPTPPPQADVSPPSIMDEKVKRFADFFNGQV
FT                   LDVELDND"
FT   gene            complement(65184..65879)
FT                   /locus_tag="sync_0063"
FT   CDS_pept        complement(65184..65879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0063"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46737"
FT                   /db_xref="InterPro:IPR007053"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE21"
FT                   /protein_id="ABI46737.1"
FT                   /translation="MAAADHLSVPRQHGLFLHHGIDLGDGTIAHYLEGREILRSPLEEF
FT                   KRGLETSVVEHDHPSPAGVTLRRAMSRIGEQRYNLLFNNCEHFASWCKTGRHQSGQVEN
FT                   FLHTTSLGALAIGQLMPAALLTGLRLLLKQGLVNKQSRDRARRGLLQLKKLRESLLDQL
FT                   EGTLEQAEGWIRGGPNNGASDRYGGQSRKLLKAGQSLADELAALEELEQRISDLLNEQH
FT                   GPSISDQAE"
FT   gene            complement(65892..67247)
FT                   /gene="clpX"
FT                   /locus_tag="sync_0064"
FT   CDS_pept        complement(65892..67247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="sync_0064"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX"
FT                   /note="identified by similarity to SP:P50866; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF06689; match to protein family HMM PF07724; match to
FT                   protein family HMM TIGR00382"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47536"
FT                   /db_xref="GOA:Q0IE20"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE20"
FT                   /protein_id="ABI47536.1"
FT                   /translation="MAKFDAHLKCSFCGKSQEQVRKLIAGPGVYICDECIDLCNEILDE
FT                   ELIDAQGNPRHGAEPSKKTAAGGTRKTSKPAPTLATIPKPQEIKGFLDEQVVGQEAAKK
FT                   VMSVAVYNHYKRLAWQGDGQGEAAQTATRLHKSNILLIGPTGCGKTLLAQTLAEMLDVP
FT                   FAVADATTLTEAGYVGEDVENILLRLLQKADMDVEQAQRGIIYIDEIDKIARKSENPSI
FT                   TRDVSGEGVQQALLKMLEGTVANVPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLDDV
FT                   VQKRMGRNAIGFVPNDGRGRNRATRDIQAAQVLRHLEPDDLVKYGLIPEFIGRMPVSAV
FT                   LEPLDEHALESILTEPRDALVKQFSTLLSMDNVQLDFEAQAVEAIAKEAHRRKTGARAL
FT                   RGIVEELMLDLMYELPSDQNVTAFTITKAMVEEHTGGKVLPLPGTKQHKESA"
FT   gene            complement(67336..68025)
FT                   /gene="clpP-1"
FT                   /locus_tag="sync_0065"
FT   CDS_pept        complement(67336..68025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP-1"
FT                   /locus_tag="sync_0065"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="identified by similarity to SP:P19245; match to
FT                   protein family HMM PF00574; match to protein family HMM
FT                   TIGR00493"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46166"
FT                   /db_xref="GOA:Q0IE19"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE19"
FT                   /protein_id="ABI46166.1"
FT                   /translation="MINARSHHPIENRWRGTLPVSAHTPHASPGVPTVVEQSGRGERSF
FT                   DIYSRLLRERIIFLGTDVNDQVADALVAQLLFLEAEDPEKDIQVYINSPGGSITAGLAI
FT                   YDTMQQVAPDVVTICYGLAASMGAFLLSGGCKGKRLALPNARIMIHQPLGGAQGQAVDI
FT                   EIMAQEILFLKETLNGLMADHTGQPLAKITEDTERDYFLSPAEAVEYGLIDRVVDNLGG
FT                   EGIITGG"
FT   gene            complement(68072..69421)
FT                   /gene="tig"
FT                   /locus_tag="sync_0066"
FT   CDS_pept        complement(68072..69421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="sync_0066"
FT                   /product="trigger factor"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by similarity to SP:P80698; match to
FT                   protein family HMM PF00254; match to protein family HMM
FT                   PF05697; match to protein family HMM PF05698; match to
FT                   protein family HMM TIGR00115"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47177"
FT                   /db_xref="GOA:Q0IE18"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE18"
FT                   /protein_id="ABI47177.1"
FT                   /translation="MSAASLKVTSTARPGSRLAVEVAIPAERSQASYEAAISQLSRSVN
FT                   LPGFRKGKVPRSVLVQQLGGLRIRATALENLVDAIWRDTIKQETIEALGQPEVDGGYEA
FT                   LLESFEPGKPLSITFEADVAPTPTLKTTKGLKAEAESVSFDAAKVDEMLEQSRRQLATV
FT                   VPVEGRKAAQGDIAVVGFKGTYSDDGSEIEGGSSESMDVDLEHGRMIPGFIEGVVGMTV
FT                   GDSKTVACNFPEDYPKEDARGRKASFEIELKDLKTRELPDLDDDFAKQASEQETLAELR
FT                   TDLEKRLKDDAERRTTSNRRDALLAALVEQLEVELPETLVQQEVRNLVEQTAAQFSQQG
FT                   MDVKSLFTPDLVRNLMETSRPEAEERLRRSLALSALAEAESLKIEDPEIDAKVKEVTAQ
FT                   LSGERDIDPNRLRQAVIEDLLQEKLLGWLEENSTVTEKAPDKDKPSVTDA"
FT   gene            69595..70626
FT                   /gene="asd"
FT                   /locus_tag="sync_0067"
FT   CDS_pept        69595..70626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="sync_0067"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM PF02774; match to protein
FT                   family HMM TIGR01296"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47697"
FT                   /db_xref="GOA:Q0IE17"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE17"
FT                   /protein_id="ABI47697.1"
FT                   /translation="MISAAPFPNRPLTVAVLGASGAVGQELLQLLEERNFPVAELRLLA
FT                   SARSAGSRCSWKGQELIVQETTATAFQGVDLVLASAGGSVSKAWREAIVASGAVMVDNS
FT                   SAFRMEDGVPLVVPEVNPDAAHQHQGVIANPNCTTILLSLALAPLALRRPLRRVVVSTY
FT                   QSASGAGARAMDELRQLSQVVLDGGTPTSEVLPHSLAFNLFLHNSPLQANGYCEEELKM
FT                   VNETRKIMGLPDLRFTATCVRVPVLRAHSEAVNVEFHEPFSVEEARSLLAAAAGVELLD
FT                   DSAHNRFPMPTDVTGRDPVMVGRIRQDISEPNALEFWLCGDQIRKGAALNAIQIAELLL
FT                   PSV"
FT   gene            70632..71540
FT                   /gene="dapA"
FT                   /locus_tag="sync_0068"
FT   CDS_pept        70632..71540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="sync_0068"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="identified by similarity to SP:Q04796; match to
FT                   protein family HMM PF00701; match to protein family HMM
FT                   TIGR00674"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45252"
FT                   /db_xref="GOA:Q0IE16"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE16"
FT                   /protein_id="ABI45252.1"
FT                   /translation="MSPAAELSPTPFGRLLTAMVTPFDAEGRVDFALAGRLARHLVEEG
FT                   SEGLVVCGTTGESPTLSWQEQVKMLEVVRQAVGPGVKVLAGTGSNSTGEAVKATREAAA
FT                   SGADGALVVVPYYNKPPQEGLEAHFRAIANAAPELPLMLYNVPGRTGTSLAPATAAQLM
FT                   NCANVVSFKAASGSIEEVTELRLACGPRLAVYSGDDGLLLPMLSAGAVGVVSVASHVVG
FT                   RRLRHMIDAYLSGQNAVALGQHEQLTPLFQALFATSNPIPVKAALELSGWPVGAPRLPL
FT                   LPLNSAMRDSLADLLTALRQT"
FT   gene            71600..73630
FT                   /locus_tag="sync_0069"
FT   CDS_pept        71600..73630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0069"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753;
FT                   match to protein family HMM PF07521; match to protein
FT                   family HMM TIGR00649"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46772"
FT                   /db_xref="GOA:Q0IE15"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE15"
FT                   /protein_id="ABI46772.1"
FT                   /translation="MTSTLSKTKQACLRVIPLGGLHEIGKNTCVFEYGDDLMLVDAGLA
FT                   FPSDGMHGVNVVMPDTSFLRENQSRIRGMIVTHGHEDHIGGIAHHLKNFDIPVIYGPRL
FT                   ALSMLTGKMDEAGVTDRTTLQTVGPRDVVKVGQHFSVEFIRNTHSMADSFSLAITTPVG
FT                   TVIFTGDFKFDHTPVDGEHFDLARLAHYGDQGVLCLFSDSTNAEVPGYCPPERSVFPNL
FT                   DRHIAEAEGRVIITTFASSIHRVSMILELALKNGRKVGLLGRSMLNVIAKARELGYMRA
FT                   PDELFVPIKQINDVPDRETLLLMTGSQGEPLAALSRISRGDHPQVKVKTSDTIIFSASP
FT                   IPGNTISVVNTIDKLMILGAKVVYGKGEGIHVSGHGFQEDQKLMLALTRPKYFVPVHGE
FT                   HRMLVKHARTGHSMGVPEDNTLIINNGDVVELTPDSMRKGDPVKAGIELLDQSRNGIVD
FT                   ARVLKERQQLAVDGIVTILAAISTDGAMVAPPRVNLRGVVTTADARKMSLWTEREIKWV
FT                   LENRWKQLCRHVDAGSPEVDWMGVQREVEVGLGRRMRREMQVEPLILCLIQPAPGGTPV
FT                   YKGRADAEPDTRPASRGRGGRHGGPGRDSGNGHVRRDRNAAPARVVPSRVIGTPAPTAE
FT                   ATPAPTPAPVKEPVASSVVVTSAPEPEMPAGRTRRRRSAAA"
FT   gene            complement(73616..74251)
FT                   /locus_tag="sync_0070"
FT   CDS_pept        complement(73616..74251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45786"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE14"
FT                   /protein_id="ABI45786.1"
FT                   /translation="MALLLGHIHLYGKDDVSQSADFYRLVLASEPPDTLRELAQQGLNE
FT                   ALERSPVIDVAVSAPLAEELATVPFANASSQLAGNDLIRDPFLNTPAKRAEADNPEAET
FT                   IETAMPWLKDESRQPKESQQPKVLDSAEKRAEKSVNLEHAPQKASAPSLTRDFDTAPKR
FT                   LEDGLLRVNLNHISQVGSSSAQTANDDQTTSLSLQKRLGLAWRSLRRR"
FT   gene            complement(74423..75418)
FT                   /locus_tag="sync_0071"
FT   CDS_pept        complement(74423..75418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0071"
FT                   /product="possible MesJ homolog"
FT                   /note="identified by match to protein family HMM PF01171;
FT                   match to protein family HMM TIGR02432"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46081"
FT                   /db_xref="GOA:Q0IE13"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE13"
FT                   /protein_id="ABI46081.1"
FT                   /translation="MAASKSWLPWHDTLHRQLLRQPNLLPDGETLLIALSGGQDSMALL
FT                   GLLLGLQHLHHWHFQLWHGDHGWHDQSAATASELKEWCQGQELDLQISRNTRDHTGTEA
FT                   SARSWRYQELAALSQQFCCRTVLTAHTASDRAETLLLQLARGTDLAGLGSLRPIRPLQN
FT                   NDPNGTRLVRPLLTFSRDDTTQICQDLQLPVWLDPSNANPAFSRNRIRNDVLPVLEELH
FT                   PGCSQRIAQLSERVSQVEDSQRTLATLALEQLRYERGLHRKALKVLPDATRRLLLHHWL
FT                   QQQGVRTLSASQLDTLSVAIGPGRPPGSRSLAEHKTLQWTRDSVQLVSQP"
FT   gene            75518..76291
FT                   /locus_tag="sync_0072"
FT   CDS_pept        75518..76291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE20244.1; match to
FT                   protein family HMM PF04481"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46292"
FT                   /db_xref="InterPro:IPR007570"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE12"
FT                   /protein_id="ABI46292.1"
FT                   /translation="MSRLSLLPAELRRSLEQRSALKVIAGLMNFDQANVAMVAAAAGRG
FT                   GADLIDVACDAALVKLAIESSAGVPVCVSAVDPELFPAAVAAGAAMVEIGNYDAFYPQG
FT                   RLFDAAEVLAITRRTRELLPDVVMSVTVPHVLPLDQQEQLAVDLVAAGADLIQTEGGTS
FT                   AKPFSAGSLGLIEKAAPTLAASHSISAALQQAECAVPVLCASGLSAVTVPMAIASGAAG
FT                   VGVGSAVNRLNDELAMTAVVRGLREALGRPVISRV"
FT   gene            76413..76838
FT                   /locus_tag="sync_0073"
FT   CDS_pept        76413..76838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47487"
FT                   /db_xref="GOA:Q0IE11"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE11"
FT                   /protein_id="ABI47487.1"
FT                   /translation="MMGTLGWLLQWPIRALVLLVVAALPLGVELASFGTALWAAVLIGL
FT                   LGTLLILPLKVVMGPVWAITSLGGLISPVSFLFNWLITVILFGLAAWLIPGFRLKNGLI
FT                   SAIGGAVIYSVISAVVLRALGLADVDFTRAALIGSLA"
FT   gene            76950..78989
FT                   /gene="uvrB"
FT                   /locus_tag="sync_0074"
FT   CDS_pept        76950..78989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="sync_0074"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="identified by match to protein family HMM PF00271;
FT                   match to protein family HMM PF02151; match to protein
FT                   family HMM TIGR00631"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45036"
FT                   /db_xref="GOA:Q0IE10"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE10"
FT                   /protein_id="ABI45036.1"
FT                   /translation="MPAYELSAPYTPKGDQPTAISKLVEGVNGGERYQTLLGATGTGKT
FT                   FTMANVIAQTGRPALVLAHNKTLAAQLCNELREFFPHNAVEYFISYYDYYQPEAYVPVS
FT                   DTYIAKTASINEEIDMLRHSATRSLFERRDVIVVASISCIYGLGIPSEYLKAAVPFKVG
FT                   ETLNLRGSLRDLVNNQYSRNDTEAGRGRFRVKGDVLEIGPAYDDRLVRVELFGDEVEAI
FT                   RYVDPTTGEILQSLDAISIYPAKHFVTPKERLNDAVKAIRSELKERLEFLNGEGKLLEA
FT                   QRLEQRATYDLEMLQQIGYCNGVENYARHLAGREPGSAPECLIDYFPDDWLLIVDESHV
FT                   TCSQLLAMYNGDQARKKVLIDHGFRLPSAADNRPLKSEEFWSKAKQTVFVSATPGNWEM
FT                   EVSEGQVAEQVIRPTGVLDPLVEVRPTTGQVDDLLGEIRDRASKKQRVLVTTLTKRMAE
FT                   DLTDYLAENKVRVRYLHSEIHSIERIEIIQDLRLGEYDVLVGVNLLREGLDLPEVSLVA
FT                   ILDADKEGFLRAQRSLIQTIGRAARHVEGKALLYAETMTDSMAKAIEETERRRKIQHTY
FT                   NEKHGITPTAAGKKASNSILSFLELSRKLKADGPDADLVKVAGKAVQALEEDVDGLALD
FT                   ALPELIDQLELKMKESAKKLDFEEAANLRDRIKKLRQKLVGSSR"
FT   gene            complement(78990..80807)
FT                   /locus_tag="sync_0075"
FT   CDS_pept        complement(78990..80807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0075"
FT                   /product="asparate kinase, monofunctional class"
FT                   /EC_number="2.7.2.4"
FT                   /note="identified by similarity to SP:P08495; match to
FT                   protein family HMM PF00696; match to protein family HMM
FT                   PF01842; match to protein family HMM TIGR00656; match to
FT                   protein family HMM TIGR00657"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46287"
FT                   /db_xref="GOA:Q0IE09"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE09"
FT                   /protein_id="ABI46287.1"
FT                   /translation="MALLVQKFGGTSVGSVERLQTVARRIADCKEDGNDLVIVVSAMGH
FT                   TTDELTAKAKAISSDPPQREMDMLLSTGEQVSIALLSMALHELGVPAVSMTGAQVGIVT
FT                   ESAHGRARILDVRTDRLRARLAEGQVVVVAGFQGTSLSSGGTAEITTLGRGGSDTSAVA
FT                   LAAALGADACEIFTDVPGVLTTDPRKVANAQLMPQVSCDEMLELASLGAAVLHPRAVEI
FT                   ARNYGVKMVVRSSWSDAPGTTLTSRNAKPIGREGLELGRPVDGVELLEDQAVLALSHVP
FT                   DQPGVAARLFESLSAGGVNVDLIIQATHEGSSNDITFTVAETDLEQARSICTTLVDSLG
FT                   GILSSDGGMSKLSIRGAGIMGRPGIAAGLFDTLSREGINLRLIATSEVKVSCVVEASMG
FT                   SKALQAAQQAFELSTQQQHINPPASGEGEPEVRGVALDRDQAQLSVRHVPDRPGMAGSL
FT                   CSALADAGISLDAIVQSERQHGDGSRDISFIVKREDRAASDQALAPLLAQWPGAVLEDG
FT                   PAIARVSAIGAGMPATAGTAGRMFRFLAEADVNIELIATSEIRTSCVVAESDGIKALEA
FT                   VHAGFQLGGSESHQAQGTESPLELEAFKP"
FT   gene            80858..81763
FT                   /locus_tag="sync_0076"
FT   CDS_pept        80858..81763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0076"
FT                   /product="Curli production assembly/transport component
FT                   CsgG subfamily protein"
FT                   /note="identified by match to protein family HMM PF03783"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46745"
FT                   /db_xref="GOA:Q0IE08"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE08"
FT                   /protein_id="ABI46745.1"
FT                   /translation="MTIDSIYFGKAVVYILRESWLIYLLILIVMKDRTAAIFPSFFIGL
FT                   AFVGSFASIAGPTVSVPDFKNEVGQLAWWSPRVSRQLADALSNELSAAGGLTVVERQNV
FT                   RAVLSEQEMAELGIVRNNDRAAKSGQMTGSQYVILGRVSGFENNVETKQSGSGMRFLGF
FT                   GGSKDVAETKAYVSLDLRVVDTTTGEVVGYKTVEGRAKNTAKVKGSGGSLAPLAGLVGG
FT                   LTGASGTGAYGLAAAGTLSFNESSSETKKTPASKAVRAALIAASDYVSCLLVRKDQCLD
FT                   DYARGDAQRRQNTLDVLEMD"
FT   gene            complement(81808..82788)
FT                   /gene="holA"
FT                   /locus_tag="sync_0077"
FT   CDS_pept        complement(81808..82788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="sync_0077"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF06144;
FT                   match to protein family HMM TIGR01128"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45993"
FT                   /db_xref="GOA:Q0IE07"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE07"
FT                   /protein_id="ABI45993.1"
FT                   /translation="MPIHLLWGDDSAARDRAVAALIEEAIDPTWSSINLSRLDGSEAGQ
FT                   AQQALEEARTPPFGAGMRVVLLQRSPFCNACPSELADRFEAALELIPDSTQLVLTNPAK
FT                   PDGRLRTTKALQKRVKQGLASEQKFQLPAIWDGAGQRQLVERTAAGLNVDMEAEAVSAL
FT                   VDAIGNDSARLTMELQKLALHAESHGHKRISAEAVQTLIEGQATSALAVGDALLEGDAG
FT                   GAIGLLDALIDAGEPALRIVATLTGQIRGWLWVLLLEQQGERDVAVIAKAAGIGNPKRI
FT                   YVMRKQLQGGNPKRLLSLLGRLLKVEAMLKRGALAGDAFREGLLG"
FT   gene            82922..83485
FT                   /gene="cobH"
FT                   /locus_tag="sync_0078"
FT   CDS_pept        82922..83485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobH"
FT                   /locus_tag="sync_0078"
FT                   /product="precorrin-8X methylmutase"
FT                   /EC_number="5.4.1.2"
FT                   /note="identified by similarity to SP:P21638"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45267"
FT                   /db_xref="GOA:Q0IE06"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE06"
FT                   /protein_id="ABI45267.1"
FT                   /translation="MDPMSKDVLERLVHSSGDPSLAALLKFSPGACDAGFQALKAGALI
FT                   LTDTAMAAAAVRPMAARTAGNEVRCLLDWAPAQSPQGSTRSAAAMVRAWPELIQAAEIA
FT                   GQPLPLVLIGSAPTALEQLLDQLDEGAPAPSLLIGMPVGFVGVPESKRRLAQFTLDQIR
FT                   LDGTRGGAGLVAAAVNALLRQVAS"
FT   gene            complement(83470..86205)
FT                   /gene="mutS"
FT                   /locus_tag="sync_0079"
FT   CDS_pept        complement(83470..86205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="sync_0079"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="identified by match to protein family HMM PF00488;
FT                   match to protein family HMM PF01624; match to protein
FT                   family HMM PF05188; match to protein family HMM PF05190;
FT                   match to protein family HMM PF05192; match to protein
FT                   family HMM TIGR01070"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47685"
FT                   /db_xref="GOA:Q0IE05"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE05"
FT                   /protein_id="ABI47685.1"
FT                   /translation="MALQGNLFGDAEPASSAPSKGQKRQDEPDQLDDHELTQDAKQRPR
FT                   QRQGQQEHSEPSASSQSEEAHSEASTPAGKDQDNSDDDLPPWSHHSQVTPEQLTPMLRH
FT                   YVELKAAHPERILLYRLGDFFECFFEDAIHLSRLLELTLTGKEAGKQIGRVPMAGIPHH
FT                   AAERYCSELIRRGLSVALCDQLEAAPASGSAKGTLLRRDITRVLTPGTVLEEGLLSARR
FT                   NNWLAAVVVEPAQGRQPFRWGLACADVSTGEFLVREQDNSAALHQELARLDPAELIHHN
FT                   QNSVAPSWCPERLQRCDIGNTPFSQPEAEALLLERFRLQTLDGLGLQNVPLAMRAAGGL
FT                   IAYLGETCPLDDNGITPPPLERPITCFPGDALVLDAQTRRNLELIATQRDNQFQGSLLW
FT                   AIDRTLTAMGARCLRRWIEAPLMDPSIIRSRQASVSQLVSKRPLRQALRRLLRPMGDLE
FT                   RLAGRAGAGHAGARDLVAIADGLERLPQLANLITSQLDGGPSWLSDVLEPDPALAVIGA
FT                   SIRHQLMDNPPLSLSEGGLIHDGVDPLLDGLRNQLDDQESWLAEQEQLERQSSNNSNLK
FT                   LQYHRTFGYFLSVSRARSGAVPDHWIRRQTLANEERFITPDLKAREGQIFQMRARAAQR
FT                   EYELFCELRGQIGEHAEAIRRSARAIAGLDALTSLAEAAATGGWCAPEITADRSMVIEQ
FT                   GRHPVVEQLLVEDAFTPNDSNLGTGIDLVVLTGPNASGKSCYLRQIGLIQLLAQIGSWV
FT                   PAQAARIGIADRIFTRVGAVDDLAAGQSTFMVEMAETANILHHASERSLVLLDEIGRGT
FT                   ATFDGLSIAWAVSEHLAGDLQARTVFATHYHELNALAGERSNVANCQVLVEETGSDLVF
FT                   LHRVAAGGASRSYGIEAARLAGVPASVVQRARQVLDQLAT"
FT   gene            86371..86559
FT                   /gene="psbZ"
FT                   /locus_tag="sync_0080"
FT   CDS_pept        86371..86559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbZ"
FT                   /locus_tag="sync_0080"
FT                   /product="photosystem II core protein PsbZ"
FT                   /note="identified by match to protein family HMM TIGR03043"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45691"
FT                   /db_xref="GOA:Q0IE04"
FT                   /db_xref="InterPro:IPR002644"
FT                   /db_xref="InterPro:IPR036512"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE04"
FT                   /protein_id="ABI45691.1"
FT                   /translation="MQILNTLTVLALVVMSFALIVAVPVLYASNEDSGRSNRLILLGGI
FT                   AWVALVLLNWGVSYFVV"
FT   gene            86622..87104
FT                   /gene="ribH"
FT                   /locus_tag="sync_0081"
FT   CDS_pept        86622..87104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="sync_0081"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="6.3.3.-"
FT                   /note="identified by match to protein family HMM PF00885;
FT                   match to protein family HMM TIGR00114"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46309"
FT                   /db_xref="GOA:Q0IE03"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE03"
FT                   /protein_id="ABI46309.1"
FT                   /translation="MATFEGRFTDLGQVRIAVVVARFNDLVTAKLLSGCLDCLSRHGVD
FT                   TTAESSQLDVAWVPGSFELPLVSQNLARSGLYQVVITLGAVIRGDTPHFDVVVAEASKG
FT                   IAAVARDTGVPVIFGVLTTDTMQQALERAGIKSNLGWSYGLEALEMASLMKVLPGH"
FT   gene            87169..87240
FT                   /locus_tag="sync_0082"
FT   tRNA            87169..87240
FT                   /locus_tag="sync_0082"
FT                   /product="tRNA-Gly"
FT   gene            87347..87949
FT                   /locus_tag="sync_0083"
FT   CDS_pept        87347..87949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0083"
FT                   /product="glyoxalase family protein family"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47295"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE02"
FT                   /protein_id="ABI47295.1"
FT                   /translation="MGIRVWSGYVGRNVVASSVNSVLPLQPSFSHLGLYVKSLSVMERF
FT                   YCDVLGFYVTDRLRNGDQEILFLSRSLLEHHQIVLAPGRSETSASTVNQVSFEIETLPK
FT                   LIDAFQALTQLGITGMESLNHGGSWSLYVPDPEGNTIELFVRTDWYVPLHAMTGLDLNQ
FT                   PEEAIRQQTVRMVQQTPGSKTWEVWRQEFQKRMDQRG"
FT   gene            complement(88284..88739)
FT                   /gene="wecD"
FT                   /locus_tag="sync_0084"
FT   CDS_pept        complement(88284..88739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecD"
FT                   /locus_tag="sync_0084"
FT                   /product="unnamed protein product"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45302"
FT                   /db_xref="GOA:Q0IE01"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE01"
FT                   /protein_id="ABI45302.1"
FT                   /translation="MARIRLVQHAAGAPGLRWFGLGPDLKPSRSLLKLRRLLHKHAFWA
FT                   QQRNTADLKRMLAGSRVVVSLWRGKRMVGFGRATSDGIHRAVLWDVVVAGDLQGRGLGR
FT                   RVVEALLSAKAIRNAERVYLMTTNSSGFYQQLGFEPASTQQLLIRKQ"
FT   gene            88881..90002
FT                   /locus_tag="sync_0085"
FT   CDS_pept        88881..90002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0085"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47290"
FT                   /db_xref="GOA:Q0IE00"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE00"
FT                   /protein_id="ABI47290.1"
FT                   /translation="MMDSFVQLLREWPPGYGGVERVAHELASEWGATVFSFDAQSRSAD
FT                   EIDPLQVSYPRVVLPASPPFGRLLLPLPSRALWSLLRSHRPLYGHLPSPGVLLVLLLAR
FT                   LLQPRRPVFAHWHCFVAPEPGSKNRLFAVYQWLALRVVPHLTKVITTSPVLAKELIRCG
FT                   CQAARVAVLPCCLNAEQEKVLLALPSRSATGMPLRVLFIGRLDSYKRLDWLLEALSQLD
FT                   APWSLAVVGDGPRRLAFEALSAELFGVSSAVNFLGRLDETAKLAELASADVLVLPSDRS
FT                   TEAFGIVQLEAMAAGIPSLAFQNKRSGMGWVGQLSGLPWSQQPDQLSLVLNQLATSPAL
FT                   RTALSLEARDRYLYLFARKVWSEAFDSIFSSQK"
FT   gene            90095..92947
FT                   /gene="secA"
FT                   /locus_tag="sync_0086"
FT   CDS_pept        90095..92947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="sync_0086"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="identified by match to protein family HMM PF01043;
FT                   match to protein family HMM PF07516; match to protein
FT                   family HMM PF07517; match to protein family HMM TIGR00963"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45024"
FT                   /db_xref="GOA:Q0IDZ9"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDZ9"
FT                   /protein_id="ABI45024.1"
FT                   /translation="MLKLLLGDPNARKLKRYQPIVSDINLLEEEIEPLSDDDLRRRTAE
FT                   FRQRLEAAGSLDKQRPLLDDLLPEAFAVVREAGKRVLGMRHFDVQMIGGMVLHEGQIAE
FT                   MKTGEGKTLVATLPSYLNALTGRGVHVVTVNDYLARRDAEWMGQVHRFLGLSVGLIQQD
FT                   MTPAERRINYGCDITYATNSELGFDYLRDNMAADINEVVQREFQFCVIDEVDSILIDEA
FT                   RTPLIISGQVERPQEKYEKAAEVANALERAAEMGKDGIDPEGDYEVDEKQRSSTLTDEG
FT                   FTKAEALIGVADLYNPQDPWAHYITNALKAKELFVRDVNYIVRDGEAVIVDEFTGRVMP
FT                   GRRWSDGQHQAIEAKEGLAIQPETQTLASITYQNFFLLYPRLAGMTGTAKTEEVEFEKT
FT                   YSLQTAIVPTNRVRARQDWVDQVYKTETAKWRAVAKETAEVHKQGRPVLVGTTSVEKSE
FT                   LLSALLAEENIPHNLLNAKPENVEREAEIVAQAGRAGSVTIATNMAGRGTDIILGGNSD
FT                   YMARLKLREVLLPRLVRPEDDHRPPVPLQRSEEGGGGFSATAPASGPHGNAPSEAKAIG
FT                   NLYPCQLTEETDQALVELAKQLVKAWGDRALSVIELEDRIATAAEKAPTEDPEIAQLRA
FT                   SIAQVKGEYDAVVKQEEMGVREAGGLHVIGTERHESRRVDNQLRGRAGRQGDPGSTRFF
FT                   LSLGDNLLRIFGGERVAGLMNAFRVEEDMPIESGMLTRSLEGAQKKVETYYYDIRKQVF
FT                   EYDEVMNNQRKAVYTERRRVLDGRELKKQVIGYGERTMNEIVEAYVNPDLPPEEWDVSQ
FT                   LVSKVKEFVYLLEDLQPDQLQGLSMDDLKAFLQEQLRNAYDLKEGEIEELRPGLMREAE
FT                   RFFILQQIDTLWREHLQAMDALRESVGLRGYGQKDPLIEYKNEGYDMFLEMMTNMRRNV
FT                   IYSMFMFRPAPPAAAQATTA"
FT   gene            complement(92957..93703)
FT                   /gene="cysE"
FT                   /locus_tag="sync_0087"
FT   CDS_pept        complement(92957..93703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="sync_0087"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="identified by similarity to SP:Q06750; match to
FT                   protein family HMM PF00132; match to protein family HMM
FT                   TIGR01172"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46969"
FT                   /db_xref="GOA:Q0IDZ8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDZ8"
FT                   /protein_id="ABI46969.1"
FT                   /translation="MLDQIRADFAIIRERDPAARGPLEILLCYPGFQAISLHRLSHRLW
FT                   RSRLPLKLPARLLSQLGRGITGVEIHPGATIGQGVFIDHGMGVVIGETSEIGDRCLLYQ
FT                   GVTLGGTGKDSGKRHPTLANNVVVGAGAKVLGAIEVGANTRIGAGSVVVRSVEQNCTVV
FT                   GIPGRVIHQSGVRINPLAHSALPDAEANVIRNLMERIDQLENQVSELQSCLSAVAAGGT
FT                   GETIREISMGKSQNLKDREILEFLGD"
FT   gene            complement(93784..94773)
FT                   /locus_tag="sync_0088"
FT   CDS_pept        complement(93784..94773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0088"
FT                   /product="transcriptional regulator, GntR family protein"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46669"
FT                   /db_xref="GOA:Q0IDZ7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDZ7"
FT                   /protein_id="ABI46669.1"
FT                   /translation="MRFHIQQESDIPASTQLYNQICFAIAARHYPPGHRLPSTRQLAMQ
FT                   TGLHRNTISKVYRQLETDGVVEAMAGSGIYVRDQQKPREIRTPPHIRNRGVTDLDREVR
FT                   KCVDGLLNAGCTLQQTREMLTREIDWRLRCGARVLVSTPREDIGASMLIAEELEPNINV
FT                   PVEVVPMEELESVLENASNGTVVTSRYFLQPVEELAKKHGVRAVAVDLNDFKAELGMLK
FT                   ELRQGSCVGLVSISPGILRAAEVILHSMRGNDLLLMTATPDIGSRLLALLRASSHVLCD
FT                   RPSMPLVEQSLRQNRSQLMRMPQVHCAESYLSGDTIELLRKEIGLISH"
FT   gene            94883..95656
FT                   /locus_tag="sync_0089"
FT   CDS_pept        94883..95656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0089"
FT                   /product="Dienelactone hydrolase"
FT                   /EC_number="3.1.1.45"
FT                   /note="identified by match to protein family HMM PF01738"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45242"
FT                   /db_xref="GOA:Q0IDZ6"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDZ6"
FT                   /protein_id="ABI45242.1"
FT                   /translation="MSSVLPPVLPEPSPGAWVTVNTGPVPLHCWWAPTSNAKPATHAAI
FT                   VLPEIFGLNRWVRGVADRLSAAGVPALAMPLFARTAPELELGYDPESTREGRRHKETTS
FT                   TEGILTDVQASIDWLRLALASTGQPLRITVVGFCFGGHAALLAATLADVQVSLDFYGAG
FT                   VSRGRPGGGAPSLELLPSVEGELHCLCGSVDSLISDSDQQAIQSALKAGDPTGLRLRYS
FT                   VFEGADHGFMCEARDQYHQSSAQEGWRLLLDAAQS"
FT   gene            complement(95647..96285)
FT                   /gene="infC"
FT                   /locus_tag="sync_0090"
FT   CDS_pept        complement(95647..96285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="sync_0090"
FT                   /product="translation initiation factor IF-3"
FT                   /note="identified by similarity to SP:O33567; match to
FT                   protein family HMM PF00707; match to protein family HMM
FT                   PF05198; match to protein family HMM TIGR00168"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45868"
FT                   /db_xref="GOA:Q0IDZ5"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDZ5"
FT                   /protein_id="ABI45868.1"
FT                   /translation="MPPRPRFDRRAPVRELPNINDRINYPQLRVVDADGEQLGVIDREQ
FT                   ALEVARERELDLVLVSEKADPPVCRIMDYGKFKFEQEKKAKEAKKKSHQTEVKEVKMRY
FT                   KIDQHDYDVRIGQAQRFLKAGDKVKCTVIFRGREIQHTALAEVLLRRMAKDLEEPAEVQ
FT                   QPPKREGRNMIMFLTPRKAPLVKKDKDEEVVNKAVRTIPSPARRINTQD"
FT   gene            complement(96339..97271)
FT                   /gene="miaA"
FT                   /locus_tag="sync_0091"
FT   CDS_pept        complement(96339..97271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="sync_0091"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="identified by similarity to SP:P16384; match to
FT                   protein family HMM PF01715; match to protein family HMM
FT                   TIGR00174"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47681"
FT                   /db_xref="GOA:Q0IDZ4"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDZ4"
FT                   /protein_id="ABI47681.1"
FT                   /translation="MNQINSEFGPDAGAKAPLVVALVGPTASGKTALALELAEHFQLEI
FT                   LNIDSRQLYREMDIGTAKPTAEQQQRVTHHLLDLRSPDQPITLQEFQQEATAAVSQVLK
FT                   ERGVAFLAGGSGLYLKALTQGLQPPAVPPQAELRRQLSSLGQANCHQLLQQADPQAAAK
FT                   IAPADAVRTQRALEVLYSSGKPMSAQQSTNPPPWRVLELGLNPMELRSRIAQRTLQIYQ
FT                   EGLLEETRQLSQRYGPDLPMLQTIGYGEALEVLQGGLSEAQAIATTTRRTQQFAKRQRT
FT                   WFRRQHSPHWLTGQDALSEAIRLIEAGLG"
FT   gene            97390..99357
FT                   /gene="gyrB"
FT                   /locus_tag="sync_0092"
FT   CDS_pept        97390..99357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="sync_0092"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46853"
FT                   /db_xref="GOA:Q0IDZ3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDZ3"
FT                   /protein_id="ABI46853.1"
FT                   /translation="MSEAAKVQAAYGAEQIQVLEGLEPVRKRPGMYIGTTGPRGLHHLV
FT                   YEVVDNAVDEALAGHCNEITVVLGEDGSAFVSDNGRGIPTDVHPRTGKSALETVLTVLH
FT                   AGGKFGAGGYKVSGGLHGVGVSVVNALSEWVEVTVRRQGQVHRQRFERGAAIGSLASEP
FT                   QPAEEKGLTGTSVCFKPDHQIFTVGIEFDYSTLSARLRELAYLNGGVRIVFRDERQAAR
FT                   DQEGKPREELYFYEGGIKEYVAYMNAEKDPLHPEIIYVNSEKDGVSVEAALQWCVDAYS
FT                   DSILGFANNIRTVDGGTHIEGLKTVLTRTLNTFAKKRGKRKEADSNLAGENIREGLTAV
FT                   LSVKVPEPEFEGQTKTKLGNTEVRGIVDNLVGESLSQYLEFNPGVIDMILEKAIQAFNA
FT                   AEAARRARELVRRKSVLESSTLPGKLADCSSRDPSESEIYIVEGDSAGGSAKQGRDRRF
FT                   QAILPLRGKILNIEKTDDAKIYKNTEIQALITALGLGIKGEDFDVKNLRYHRVVIMTDA
FT                   DVDGAHIRTLILTFFYRYQKELVEGGYIYIACPPLYKVERGKNHTYCYNEQQLQKTLAG
FT                   FGEKANYNIQRFKGLGEMMPKQLWETTMDPSTRMMKRVEVQDALEADRIFTILMGDKVA
FT                   PRREFIETHSADLDMASLDI"
FT   gene            99381..99695
FT                   /locus_tag="sync_0093"
FT   CDS_pept        99381..99695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE20297.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46330"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDZ2"
FT                   /protein_id="ABI46330.1"
FT                   /translation="MRWGWLLGVALMAPAALPAGGAQRRLPLLRRQEGKSPLLSGECCV
FT                   LRSSPLVEAPALRRLELGTPLQLLRHWRGDDGRDWIQVQMSSGQGLPAGFQPVRGWLRG
FT                   "
FT   gene            99688..100098
FT                   /locus_tag="sync_0094"
FT   CDS_pept        99688..100098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0094"
FT                   /product="Protein CrcB homolog 1"
FT                   /note="identified by match to protein family HMM PF02537"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47338"
FT                   /db_xref="GOA:Q0IDZ1"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDZ1"
FT                   /protein_id="ABI47338.1"
FT                   /translation="MADSFTAGQVVMVGIGAIPGAWLRLRIVNHFEPMVPLKHWGTFAV
FT                   NLVAAFALGLVLGLQVNDPCSTSKAVSALTLLVAVGFFGSLSTFSTFAVELLNTLKQRN
FT                   WRESLLLGVGSILGGLIAAGLGYGLGLAEGIA"
FT   gene            100098..100493
FT                   /gene="crcB"
FT                   /locus_tag="sync_0095"
FT   CDS_pept        100098..100493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="sync_0095"
FT                   /product="crcB protein"
FT                   /note="identified by match to protein family HMM PF02537"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47095"
FT                   /db_xref="GOA:Q0IDZ0"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDZ0"
FT                   /protein_id="ABI47095.1"
FT                   /translation="MPQSSSSVTGQLSLRQDLNELALVALGAVPGAVMRWQIASHFHDK
FT                   DLIVNVLGAFILGWLVGLPLRPKRQLLIGIGFCGSLTTFSSWMVHCVTFIAQGDWLSAL
FT                   GLIGLTLGLGLGAAALGVLVGRSLVRR"
FT   gene            complement(100483..100962)
FT                   /locus_tag="sync_0096"
FT   CDS_pept        complement(100483..100962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0096"
FT                   /product="Glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /note="identified by match to protein family HMM PF00255"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46583"
FT                   /db_xref="GOA:Q0IDY9"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDY9"
FT                   /protein_id="ABI46583.1"
FT                   /translation="MAPNISNVSVNTPDGANKTLGSYSGKVLLIVNVASRCGFTRQYSG
FT                   LQALQDSYAAQGLQVLGFPCNDFGGQEPGSLEEIKSFCSTTYNASFELFDKVHATGSTT
FT                   EPYTTLNKTEPAGDVAWNFEKFLVGKDGTVIARFKSGVEPDSDELKTAIESALNA"
FT   gene            101040..102494
FT                   /gene="mgtE"
FT                   /locus_tag="sync_0097"
FT   CDS_pept        101040..102494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="sync_0097"
FT                   /product="magnesium transporter"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01769; match to protein
FT                   family HMM PF03448; match to protein family HMM TIGR00400"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46452"
FT                   /db_xref="GOA:Q0IDY8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDY8"
FT                   /protein_id="ABI46452.1"
FT                   /translation="MEEAHGRSGVSVTNDLVAEVVTQQLESMLSVGNYDGVKLLLAPVQ
FT                   PVDVAEAVGCLPRTLQALAFRLLGKDEAIEVYEYLEPAIQQSLLERLRSSEVLELVEEM
FT                   SPDDRVRLLDELPAKVVRRLLVELSPAERRVTAQLLGYAPETAGRLMTTEYIDLKEFHS
FT                   AAQALTIVRRRATETETIYSLYVTDGQRHLTGILSLRDLVTADPTDCIGDVMTREVVSV
FT                   GTDTDQEEVARAIQRYDFLAVPVVDRERRLVGIVTVDDVIDVIEQEATRDLYAAGAVEA
FT                   GDEDDYFQSNLFTVARRRVLWLAVLVIANIFTTQVIAMNDAVLREVVMLAAFIPLLIGT
FT                   GGNVGAQSSTVVIRGLSTQRIQPLGPLRAVVREALAGALLGLLMLFVVVPFAWWRGDGP
FT                   LVGMAVGISLLAITTLAATAGAALPLLFSRMGLDPALMSAPFITTATDVAGVFIYLKTA
FT                   EWLLLHAPQLLEATSISTHLLAALAF"
FT   gene            102547..103554
FT                   /locus_tag="sync_0098"
FT   CDS_pept        102547..103554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0098"
FT                   /product="Type II alternative RNA polymerase sigma factor,
FT                   sigma-70 family protein"
FT                   /note="identified by match to protein family HMM PF04539;
FT                   match to protein family HMM PF04542; match to protein
FT                   family HMM PF04545; match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46870"
FT                   /db_xref="GOA:Q0IDY7"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR017848"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDY7"
FT                   /protein_id="ABI46870.1"
FT                   /translation="MAPAAAVASRPASASTGRASGAEVDLVRSYLRDIGRVPLLSHQQE
FT                   ITLGRQVQELMDLEALEAELKDQRGGEEVAREEVAKAAGVSAAQLKRKLQAGRRAKERM
FT                   VAANLRLVVSVAKKYTKRNMELLDLIQEGTIGLVRGVEKFDPTRGYKFSTYAYWWIRQG
FT                   ITRAIAEKSRTIRLPIHITEMLNKLKKGQRELSQELGRTPSVTELASFVELPEEEVKDL
FT                   MCRARQPVSLEMKVGDGDDTELLELLAGDGELPSDQVEGECLKGDLRDLLSQLPELQGK
FT                   VLRMRYGMDGEEPMSLTGIGRIIGISRDRVRNLERDGLAGLRRLSPQVEAYVAC"
FT   gene            complement(103539..104435)
FT                   /locus_tag="sync_0099"
FT   CDS_pept        complement(103539..104435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0099"
FT                   /product="Predicted hydrolase"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45460"
FT                   /db_xref="GOA:Q0IDY6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDY6"
FT                   /protein_id="ABI45460.1"
FT                   /translation="MLWTWKSHQIGWSLVGDRTAPTAVLLIHGFGANTNHWRFNQPVLG
FT                   KQVPTYAIDLLGFGRSDQPQARLNDEPATAKTVQYCFDLWAQQVADFCHNVIDRPVVLV
FT                   GNSIGGVVALRAAQLLGEEHCKEVVLIDCAQRLMDDKQLATQPVWMAWIRPLLKTLVSQ
FT                   RWLSTTLFRNAARPALIRSVLKQAYPSGSNVDDELVSLLLRPSQRHGASEAFRGFINLF
FT                   NDHLAPDLLKNLSIPVHMIWGEADPWEPVKEAKEWKEKYECIQSLLVIPHAGHCPHDES
FT                   PKPVNKQLLLIVNQQAT"
FT   gene            complement(104459..107713)
FT                   /locus_tag="sync_0100"
FT   CDS_pept        complement(104459..107713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0100"
FT                   /product="acriflavin resistance protein acrF"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46792"
FT                   /db_xref="GOA:Q0IDY5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDY5"
FT                   /protein_id="ABI46792.1"
FT                   /translation="MAFSDNFIKRPVLTTVCSILIVLVGMISIPMLPIAYLPNIADPLI
FT                   QVIANYGGANAEVTEQAVTNPLEQQINGVPGVSYISSNTDMTGNSTVNVYFDQSTDIDI
FT                   DQVNVQNRVSLANPQLPEQVSEVGVSVKQSNPSILLAYEVSSSKGQFDAAYLNGLVYEQ
FT                   LYYPLSRVEGVATVNIIGGATPAFWLFVDPNKLAANKLTSEDVINQVKSQNSVAVGGLV
FT                   GGPPASGDQAFTYPIVVKNNGNLISIDDFNNLILNRSPSGNLLKLKDVGEVRYGSNTFS
FT                   AQAVDQNGHEALTIAVYQTPASNALDVSEAVVDQINQFRSTLPPGVTIDQIYNIGQFIE
FT                   SSVDGVIDALGLAIVLVLIILFLFLQNWRATVVPSLAIPISLVGTFAFLNVFGFSINQL
FT                   TLLGLVLATGLVVDDAIVVIEAVSTNIEKGMKPREAALACMGELFGALLATALVLMAVF
FT                   VPVAFYPGGTGIIYKQFALTIAFSVAISAFNALTFSPMLSGLILSQKKPPEPKGRSWIV
FT                   VGVIVGLAFGRFSAASFGNWTYIAGIVIGALAGSNLPLIFKVFNSNFERLETTYSKLLK
FT                   RMIQARRIVLAGLVVGIVVTSFAFTILPTAFIPDEDQGYGMGIFQLQNGASLVETKKLG
FT                   MQIAKVLSEEDDVANASIINGFGFNGSSPDQGIFFFGLQPLEERKGAEHSSDAIVDRLN
FT                   AKLIQLSDGLAKASGPPAVPGFSPQGGFYFQFNDLSNGTYSFNDLSNLSGQLIKTANAS
FT                   GDFSNVYTQFTPSAPAIGLNINREVMYALNVDFQEAMDTISALAGNNYSGITYESGQVR
FT                   NIYVQGTPNQRQNIDDILSFYVRSKDGDLVQVSQFAEAELSSAPPIISHYDLNRTVLIQ
FT                   GAEAIGKSSGQALSKIQQLFNAENYTNIGSAFTGLAALQLSAGNASILVFGLGVLIVYL
FT                   VLSAQYESYITPVIILATVPLAMLGALAFLAIRSIDLNIYAQIGLVTLIGLAAKNGILI
FT                   VEVAEQKLKEGKSTVIAVVESAESRLRPILMTAIAALAGFLPLVVANGAGANAQQSLGT
FT                   VIFGGLIVATVLSVGVVPPVYVLVKDLESRLLSPRE"
FT   gene            complement(107718..108872)
FT                   /locus_tag="sync_0101"
FT   CDS_pept        complement(107718..108872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0101"
FT                   /product="efflux transporter, RND family, MFP subunit
FT                   subfamily"
FT                   /note="identified by match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46401"
FT                   /db_xref="GOA:Q0IDY4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDY4"
FT                   /protein_id="ABI46401.1"
FT                   /translation="MVRGTIGCIVRGSFVVVLTLSVALAACGQSKKSGPTFLSINTATI
FT                   SQGNFKPSIKAVSPLESTTNVTLSPETDGRVIKKLVREGDQVQAGQVILVLDNTQLSAQ
FT                   LDASQSQARYDRVNAERYQFLYEQGAASAKRRDAYVTKAITSRDQAIADKATLNYKFVR
FT                   SPINGVIGDLDTVKIGDYVKTGDIITGIVDNSTLWTLMEIPASQASQVKVGQPVRLASQ
FT                   STPQVTGKGTITFVSPYYAIPKAGNPPNTLMVKAEFPNLTGQLKTGQYVTSEIITGSSE
FT                   RLAVPVQAVMMQAQQPFVYEVVPISKALPNIKRSPNTTAKALKTLEKLPGNTPIVLQTK
FT                   VQLGDLQNNLYPVISGLKSGDKVAISNTSRLRSGMPVKVSVGSN"
FT   gene            109043..110197
FT                   /locus_tag="sync_0102"
FT   CDS_pept        109043..110197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0102"
FT                   /product="putative A/G-specific adenine glycosylase"
FT                   /note="identified by match to protein family HMM PF00293;
FT                   match to protein family HMM PF00730; match to protein
FT                   family HMM TIGR00586"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47191"
FT                   /db_xref="GOA:Q0IDY3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDY3"
FT                   /protein_id="ABI47191.1"
FT                   /translation="MEEPSALTPELSRSLLAWWEVHGRKDPAFKPWMFTPEGKWSEPYE
FT                   HLNPYPIHVAEVMLQQTQLQVVLPYWQRWMESFPTLESLAEAEAQMVLLSWQGLGYYSR
FT                   ARRLHGSAQTLLERIGCQSCEDPLSWPQEPGFWLDLPGIGLSTAGGILSSAFNSPLAIL
FT                   DGNVRRVLARFRAHSRPPTRDLRLFWNWSEALVEAAPGRARDLNQALMDLGATVCIPRS
FT                   PNCACCPWQMHCSAYAACDVERYPVKDTPRAVPFQVIGVGVVLNDSGEVLIDQRLNEGL
FT                   LGGLWEFPGGKQEPGEAIVQTITRELQEELAIDVAVGEELISLDHAYSHKKLRFVVHLC
FT                   QWRKGEPQPLASQQVRWVRPESLVDFPFPAANARIIAALLDHLS"
FT   gene            110274..111266
FT                   /locus_tag="sync_0103"
FT   CDS_pept        110274..111266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0103"
FT                   /product="Sugar kinase, ribokinase family protein"
FT                   /EC_number="2.7.1.4"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47458"
FT                   /db_xref="GOA:Q0IDY2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDY2"
FT                   /protein_id="ABI47458.1"
FT                   /translation="MADLSALAPRVMCLGEALVDRLGPLGGDPVTAAPESCDDRLGGAP
FT                   ANVACALARLGTPVGLVGRLGEDSIGSAFRDLFQQRGVAVQALQRDVSHPSRVVLVRRH
FT                   ANGERVFQGFAGDHALGFADQMLNLGELEAVWPMVSKQARWLLVGTIPLATPTSADSLQ
FT                   WLLAQAQAASLALAVDVNWRPTFWDPEADPAAGPTADALAVIKPLLEQASLIKLAREEA
FT                   LWFFGSDDPAAVAKDLPQQPDVVVTDGANPIRWFIEHEAGSMPVFQPSQVIDTTGAGDA
FT                   FTAGLLHCWDRPVNERLYFASACGALVCSGAGAIDPQPQEQDVLTFLNR"
FT   gene            complement(111384..112280)
FT                   /locus_tag="sync_0104"
FT   CDS_pept        complement(111384..112280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0104"
FT                   /product="probable sugar kinase YPO1816 , putative"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45221"
FT                   /db_xref="GOA:Q0IDY1"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDY1"
FT                   /protein_id="ABI45221.1"
FT                   /translation="MPALPNAGQIVETSLMELCLGGCAANTAYDLAKLGVDVCLGGCIG
FT                   EDPFGDFLLRTLEEAGVQTTGVSRCSQATTATSAVINVEGGDRRLISVVGANRLFKCSM
FT                   IPEGLIESAAVIHIGGFLLLDALESVQTQERLQQARANGALVVLDVIEVKDPLAMERVQ
FT                   RVLPFTDVVLPNRDEAALLTGRKNPWDQAQMFGDAGASTVVITDGAQGTYVVTDGLRLR
FT                   SDAYSTSFLGGTGAGDAFDAGFIAGYLNGEDLKGCVRWGSAMGASCVRSTAATSSVFSK
FT                   EEALRFMGNHTLHIHEV"
FT   gene            complement(112332..113687)
FT                   /locus_tag="sync_0105"
FT   CDS_pept        complement(112332..113687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0105"
FT                   /product="putative glutamine synthetase"
FT                   /note="identified by match to protein family HMM PF00120"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45205"
FT                   /db_xref="GOA:Q0IDY0"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDY0"
FT                   /protein_id="ABI45205.1"
FT                   /translation="MSTEHDTSLEALSARGVRQIAITWDNHAGESLVKVVPLRRWQLAI
FT                   DVGVGFSPISDAFRSDGIIDPAHRLTRPDGDLRLKADPSSLAMLEPDQGWAWAAGERWN
FT                   RNSTGAYEADQRHFCRRMGETLHRKGLSLTAGFELEWVVITPDNDGSPKAVIAGGPYGA
FT                   DRLIEGLDYASALLKALDAADVDWLQFHPEYGPSQFELSFAAQAPLQAADQLIRARLVI
FT                   QRVTRRFGWFSSFSAKPRLDWVGNGGHLHFSVRDSQGPLLQEGSGPYGLRPEGEALIAG
FT                   VLEQLPGLVALASPSPVSYLRLVPSSWSAPFQVWGMENREAAVRFIPTASDQSAAHLEI
FT                   KAVDPTANPYLLLGALQAQVLDAMRHKRILPPEQIGDPALVNDHSVCRLPASLVEARIA
FT                   LERDAVLLEAMGPLLHGSLLDSLAAEIHRVETKSEEQQVSDSCWWPIVGGLV"
FT   gene            113842..115455
FT                   /locus_tag="sync_0106"
FT   CDS_pept        113842..115455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0106"
FT                   /product="transporter, solute:sodium symporter (SSS) family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00474"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47705"
FT                   /db_xref="GOA:Q0IDX9"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDX9"
FT                   /protein_id="ABI47705.1"
FT                   /translation="MVGLARCCCFGISGAFSGCIGPAVLGWPACLGVDVHRPSGGTHPD
FT                   RCLDRPPMTTTLISALISLVVYLLALLWLGAQSLGGQTNSADSYFLADRRLRAGVLFFT
FT                   LIATNFSAFFFLGFAGAGYRIGIAYYPMMAFGTGLAALSFGSLGCRVRRLSAQHGLITP
FT                   SELIGHLLPGEGVRLLVLAVMVLFTLPYLALQPLGAGYLLESLTGGVVPFEVGAVLLTV
FT                   VIVLYVVGGGMRAVARTDVLQGVLMFLLMLMAFVAVAVGVGGVQTANRTLLQQLPDLFS
FT                   GAGRNDFFTPRMMASYLLLWPLCLPMFPQMLMRFFAAGDDRSLKQSMVLYPVVAGVLFI
FT                   CPVMIGMWGHLAFPDLVGRASDQIMPLMLGRYSPEWLTGIVMVGALAAFMSTLDSQLLA
FT                   LSSMLTRDLYKRYWRPQASLPEQVRVGQLVVIALAVSGLVIALRPPEAILSLATHAFSG
FT                   LALLFPMLVGAVYGLRWSVIGAILSVIGGEAVLLGFATGVIPEVFQGGCLPLIPALVVA
FT                   CSILVVDQVISRWSSSFLQA"
FT   gene            complement(115418..115942)
FT                   /locus_tag="sync_0107"
FT   CDS_pept        complement(115418..115942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0107"
FT                   /product="conserved hypothetical protein TIGR00150"
FT                   /note="identified by similarity to GB:CAE20312.1; match to
FT                   protein family HMM PF02367; match to protein family HMM
FT                   TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46070"
FT                   /db_xref="GOA:Q0IDX8"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDX8"
FT                   /protein_id="ABI46070.1"
FT                   /translation="MNDKYFGDAEASGSLIRQSTDETRILDDLEATKDLGRMLAARLKP
FT                   HDILLLQGPLGAGKTSLVQGLADALGIQEPITSPTFALAQHYPEGTPPLIHLDLYRLEQ
FT                   AFAANDLFLQEEEEASAMGALLVVEWPERLSLSLPDAWFLDLNYAPGGGRTISLQCPNV
FT                   MPARKTTTSER"
FT   gene            115967..117397
FT                   /gene="ahcY"
FT                   /locus_tag="sync_0108"
FT   CDS_pept        115967..117397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="sync_0108"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="identified by match to protein family HMM PF00670;
FT                   match to protein family HMM PF05221; match to protein
FT                   family HMM TIGR00936"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45626"
FT                   /db_xref="GOA:Q0IDX7"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDX7"
FT                   /protein_id="ABI45626.1"
FT                   /translation="MVATAAATAELQVAKDYVIADIGLADFGRKELNIAETEMPGLMAL
FT                   RAKYGKDKPLKGARIAGSLHMTIQTAVLIETLVELGADVRWASCNIFSTQDHAAAAMAA
FT                   GGIPVFAVKGETLEEYWDYTHSILEWGDGGTPNMILDDGGDATGLVMLGSKAEQDITVL
FT                   DNPSNEEETFLFASIKKKLAKDSSFYSRIKAEIQGVTEETTTGVARLYKMQKSGELPFP
FT                   AINVNDSVTKSKFDNLYGCRESLVDSIKRATDVMVAGKQALVVGYGDVGKGSAQSLRGL
FT                   GATVCIAEVDPICALQAAMEGYRVVRLEDVVDQMDIFVTATGNYQVIRNEHLVKMKDEA
FT                   IVCNIGHFDNEIDVASLKSYEWDNIKPQVDHITLPSGNKIILLAEGRLVNLGCATGHPS
FT                   FVMSNSFTNQVLAQIELFTKGSEYGKEVYVLPKHLDEMVARLHLEKIGCKLTELSKDQA
FT                   DYINVPVEGPYKPDHYRY"
FT   gene            117857..118516
FT                   /locus_tag="sync_0109"
FT   CDS_pept        117857..118516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0109"
FT                   /product="Uncharacterized DedA family conserved membrane
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00597"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45232"
FT                   /db_xref="GOA:Q0IDX6"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDX6"
FT                   /protein_id="ABI45232.1"
FT                   /translation="MGLSELITQLPELIGQAVEANQWLGYGAIFAAMFLENLFPPIPSE
FT                   LIMPLGGFYVQQGQLQFIPVVLAGLIGTVLGALPWYGIGRLINEQRIEQWLERHGRWIG
FT                   ISPEELARSRRWFSRYGTALVFWGRLVPGIRTLISVPAGIELMPMAPFLIWTTAGSLIW
FT                   TLLLTIAGMVLGEGYSNVEVWIDPVSKVIKVGLVIAVLAGGIWVALRIWRRRQSAD"
FT   gene            complement(118594..118974)
FT                   /locus_tag="sync_0110"
FT   CDS_pept        complement(118594..118974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0110"
FT                   /product="putative single-stranded DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF00436;
FT                   match to protein family HMM TIGR00621"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46323"
FT                   /db_xref="GOA:Q0IDX5"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDX5"
FT                   /protein_id="ABI46323.1"
FT                   /translation="MSVNSVTLVGRAGRDPEVRYFESGSMVANLTIAVNRRSRDDEPDW
FT                   FNLEIWGKQAQVAADYVKKGSLLGIIGSFKLDRWTDRNSGEERSKPVVRVDRLELLGSK
FT                   RDSEAGSGGFGGGSPSDEEVPF"
FT   gene            119111..120163
FT                   /locus_tag="sync_0111"
FT   CDS_pept        119111..120163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0111"
FT                   /product="Rod shape determining protein"
FT                   /note="identified by match to protein family HMM PF06723;
FT                   match to protein family HMM TIGR00904"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46505"
FT                   /db_xref="GOA:Q0IDX4"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDX4"
FT                   /protein_id="ABI46505.1"
FT                   /translation="MLFRRFQLSRDIGIDLGTANTLIYVSGKGIVLQEPSVVAIDLERG
FT                   VPLAVGDEAKLMLGRTPGNIRAVRPLRDGVIADFDAAEQMLKSFIQKGNEGRGIIAPRL
FT                   VVGIPSGVTGVERRAVREAGLAGAREVHLIDEPVAAAIGAGLPVTEPVGTMIVDIGGGT
FT                   TEVAVLSLGGTVLSESVRVAGDEISDSIGVHLKKVHNLVVGERTAEDIKIRIGSAFPDN
FT                   DFDQTVMDVRGLHLLSGLPRTIQLQAGDLREAIAEPLNVIVEAVKRTLERTPPELAADI
FT                   VDRGIMLAGGGALVRGISDLISHETGIFTHVAEDPLLCVVNGCGQVLEDYKRLQRVLDT
FT                   PEFVRSATSL"
FT   gene            120169..120912
FT                   /gene="mreC"
FT                   /locus_tag="sync_0112"
FT   CDS_pept        120169..120912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="sync_0112"
FT                   /product="Cell shape-determining protein"
FT                   /note="identified by match to protein family HMM PF04085"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47083"
FT                   /db_xref="GOA:Q0IDX3"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDX3"
FT                   /protein_id="ABI47083.1"
FT                   /translation="MGSSPWPQGTRSRSLKRILPWLALLGVLGIVRWSKGAGFADAYAL
FT                   LSRPFWPGSAQKQWIQSAQQQNDATRLQLLEVDNARLRGLLALDRQGANNAISAAVISR
FT                   TPEGWWQQILLGKGTLDGIQKGDAVIGTGGLIGRVQSATPATSLVRLLTAPGSRIGVWV
FT                   PRTRQHALLVGMGTSRPELKFIDRDVKVRPGDLVSTSPASTLLPANLPVAVVQSLNSRE
FT                   VPAPTALVQLIAPPDAIDWVQVSRR"
FT   gene            120916..121419
FT                   /locus_tag="sync_0113"
FT   CDS_pept        120916..121419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0113"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47648"
FT                   /db_xref="GOA:Q0IDX2"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDX2"
FT                   /protein_id="ABI47648.1"
FT                   /translation="MARLHSQPICVASGLLVPLISLAAPSWLSLGGVLPSWAVLWLLPW
FT                   ALVDGPVSGLIAGAAMGLVLDGLSVGDASQVPALMLLGWWWGWLGRRGPPIQRSLNLGL
FT                   LAWIGTMLLGLTLWAQLLVQGVDAPLAQAFAFHTCLAQGLMTGLMAPMIGSWQLLIWRR
FT                   RTPA"
FT   gene            121380..122723
FT                   /locus_tag="sync_0114"
FT   CDS_pept        121380..122723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0114"
FT                   /product="Bacterial extracellular solute-binding protein,
FT                   family 1"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45680"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDX1"
FT                   /protein_id="ABI45680.1"
FT                   /translation="MATSDLATAHSRMIQHTSHRRRWLALALLSTSLLIGGCRRAAAPE
FT                   GALQLWTLQLAPKFNTYMEQVIDRWDDGHPDAPVRWTDLPWGSVERKLLAAVFARTAPD
FT                   VVNLNPPFAANLASKGGLTDLTPLLPPDAAQRYLPSVWRAARDPKAGQIAVPWYLTVRL
FT                   SLVNQKLLQQAGVNAPPRRWEDVPAFARQIRERTGRYGLFVTAVPDDSAELLESMVQMG
FT                   VVLLDDKQRAGFNSPEGRKAFAFWTDLYREGLLPREVVSQGQRRAIELYQSGQLALLAS
FT                   GAEFLRSIQTNAPGVAAVTSPQPPLTGGDGTANVALMTLAVPRQSQRAQEALSFALDLT
FT                   NGPNQARFAREARVLPSSLEALRQVRAELEAERPATPELAQVREARLLSAKTLERARVL
FT                   VPATPGVKRLQSIVYTQLQRAMLGQISSEEAVRTAAEQWNRYSEARWP"
FT   gene            122862..123629
FT                   /locus_tag="sync_0115"
FT   CDS_pept        122862..123629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0115"
FT                   /product="two-component response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46316"
FT                   /db_xref="GOA:Q0IDX0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDX0"
FT                   /protein_id="ABI46316.1"
FT                   /translation="MPTDGPSVKGTILVVDDEPAVRRVLLMRLQLAGYNVVSAEDGEEA
FT                   LEKFHSESPDLVVLDVMLPKMDGFAVCRRLRAESCVPIIFLSALESISERVAGLDLGAD
FT                   DYLPKPFSPKELEARIFTILRRVGSGSATVEPREIPSGQGVMRVGDLVVDTNRRQVNRG
FT                   TERIALTYTEFSLLELLFRDPGHVVPRAEILEQLWGYPPRRAADLRVVDVYVARLRGKL
FT                   EPDPRNPEMILTVRGIGYSSQRMGEPAGAPAAV"
FT   gene            123701..125170
FT                   /gene="lysS"
FT                   /locus_tag="sync_0116"
FT   CDS_pept        123701..125170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="sync_0116"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM TIGR00499"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47326"
FT                   /db_xref="GOA:Q0IDW9"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDW9"
FT                   /protein_id="ABI47326.1"
FT                   /translation="MSELRETRLEKANALKEQGQEPYALRFDLTDRMARLQADHADLAK
FT                   GAERDLKVSVAGRVMTRRVMGKLAFFTLADETGTIQLFLEKATLGDSFAQLSSLVDAGD
FT                   LIGVHGILRRTDRGELSVKVSKWEMLTKSLQPLPDKWHGLADVEKRYRQRYLDLIVTPQ
FT                   SRETFRRRAMAVSAIRRWLDERDFLEIETPVLQSEAGGAEARPFITHHNTLDLPLYLRI
FT                   ATELHLKRLVVGGFERVYELGRIFRNEGVSTRHNPEFTSVEVYQAYADYNDMMTLTEQL
FT                   IASVCEQVCGTTRISYQGVEVDLTPSWRRATMHELVQEATGLDFTSFETREAAVEAMRA
FT                   ANLPAPDKADTVGRLLNEAFEHAVEPNLIQPTFVLDYPQEISPLARKHRSKPGLVERFE
FT                   LFIVGRETANAFSELTDPLDQRGRMELQQERRAAGDVEASGVDEDFIQALEVGMPPTGG
FT                   LGIGIDRLVMLLTDSPSIRDVIAFPLMRPEG"
FT   gene            125216..125479
FT                   /locus_tag="sync_0117"
FT   CDS_pept        125216..125479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE20323.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46488"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDW8"
FT                   /protein_id="ABI46488.1"
FT                   /translation="MSGERVGFRFKHADAVVKRNPQGRSRRGWVMEPVEQTTSRGTKMP
FT                   AYRIRWRDSERPEIVLQHMLIADPDPTPPPENVSLEPPAPKA"
FT   gene            complement(125502..125987)
FT                   /locus_tag="sync_0118"
FT   CDS_pept        complement(125502..125987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0118"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45461"
FT                   /db_xref="InterPro:IPR030812"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDW7"
FT                   /protein_id="ABI45461.1"
FT                   /translation="MSPTWLDHLERGLEERLEQFLRSNPSQDQLLREQHLQDRQRDLHN
FT                   RRGQQQLQARELRRQLLTLAEQVQAWTTRGEKARRAGALELAQRADQHVAALMQQGREL
FT                   WEEFEALGLQFAELEEQLNSLKSQEKQSTSRRSLDEDWALFEAQQELEELRRNQGLS"
FT   gene            complement(125984..126217)
FT                   /locus_tag="sync_0119"
FT   CDS_pept        complement(125984..126217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0119"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45161"
FT                   /db_xref="InterPro:IPR030810"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDW6"
FT                   /protein_id="ABI45161.1"
FT                   /translation="MSRDEQRATVRLQRETLIEELEAVYRNAFDRLGALELGEGSVARL
FT                   TQLLLRSREGAINPLEQEIEAPLITRAPEQIP"
FT   gene            complement(126245..127156)
FT                   /locus_tag="sync_0120"
FT   CDS_pept        complement(126245..127156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45159"
FT                   /db_xref="GOA:Q0IDW5"
FT                   /db_xref="InterPro:IPR017804"
FT                   /db_xref="InterPro:IPR019257"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035094"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDW5"
FT                   /protein_id="ABI45159.1"
FT                   /translation="MGQLVRIGLNRCPRQLPAWFLYDEEGSRLFDRICQQPEYSLTRTE
FT                   IALLELRAPEIAAAIGDGVIIEFGAGSAQKVGPLLDAVRPAAYVALDISAEHLRKATTA
FT                   LQQRYPAVPMLGICCDHSTLSAVPEHPFLRDQRRIGFFPGSSLGNFEQHDAVHLLRHFK
FT                   QLLNGGPLLLGLDQPKSKIRLEAAYNDAAGISADFARNLLHRLNAELGANFDPQCFSYQ
FT                   ARWQADQQRVQMALISSCKQVVRIAGDSWTFQCDEPLITEYSLKYSPQKAVALAQQAGW
FT                   RWVRRWHDPDDDLSLHLLKAPD"
FT   gene            complement(127222..128493)
FT                   /locus_tag="sync_0121"
FT   CDS_pept        complement(127222..128493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0121"
FT                   /product="Domain of unknown function (DUF323) family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03781"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47836"
FT                   /db_xref="GOA:Q0IDW4"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDW4"
FT                   /protein_id="ABI47836.1"
FT                   /translation="MASLGSLSRATPAMESGTLLSRLMDVRRTSEVLIEPLEAEDLCLQ
FT                   GMADASPPKWHLAHTTWFFETFVLIPHCPGYEGADPSWNYLFNSYYDAVGPRQPRPQRG
FT                   LLSRPPIAEVIAWRHKVDQALENLLEHNGDFPWLGLVELGLQHEQQHQELMLMDLLDAF
FT                   SRQPLEPAYRTDWQEPAGSPNDGTAAVWLQFEGGLVEIGQNSQQNNNSNNAHPFHFDNE
FT                   EPRHRVWLEPYALADRLVSNGEYKAFIEDGGYERPELWMSEGWAICSERQWKAPRYWRQ
FT                   AQSNQQQRDQTAWEFTLAGRCPLEAHRPVRHLSWFEADAYARWAGSRLPTEAEWETAAQ
FT                   KQGLQLKQKHAELWQWTASPYRPYPGFQAAQGAVGEYNGKFMTSQFVLRGSSQLTPNGH
FT                   ARDTYRNFFAPSSRWMAAGLRLAR"
FT   gene            128551..130629
FT                   /locus_tag="sync_0122"
FT   CDS_pept        128551..130629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0122"
FT                   /product="serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="identified by match to protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45695"
FT                   /db_xref="GOA:Q0IDW3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDW3"
FT                   /protein_id="ABI45695.1"
FT                   /translation="MIGTLLSERYRLDQCLTSDQSAPQGTLWRGTDVLASDAPVALRQL
FT                   QDSEAQDRFRQLWPAMQSVLHPLIPRFGGLLEELDSLWLVREWQEGSSFGQIQQQRRER
FT                   QLVFGGGEVLLLLRQLLPVLGVLHGKGLVHGDINPSNLLRRDQDGLPVLLDFGLLQNLG
FT                   TAPLLGATASYAPRGQGRGETAAPWMDLHALGVTALTLLSGRAPEALLPADASEWQCPP
FT                   DLELHEGFRDVLERMLSEVPGRRFEKASEVLQALKVVPMPESTGPMPSSDRTVVLAPVV
FT                   LASAELPVVEPQAVGPSSPEPRRRQRADERQVAAEGRLWPVVIALLLSALVGTAIGWFL
FT                   LSRGNAPSGVPSTERDVVGRSPTASLPPAEVDQRQQLLSRLRALQVDRSWFLQLVDASL
FT                   LARFPERNGRLPSDSLEDAPLRKVWNELANEWLARVEQLPPGLRSRLGKLDQKDWQTQR
FT                   QALVAQGVNDRVVEQLVSVAANTLLPGVTYGTKPPEPFRQLWFAAALRSLEEVKIERIR
FT                   AGAEMATVLSSRVPADSARLISIQVPANRRLVLGINGTPLMQMTVYAADGSVAAERGPL
FT                   RVVTLAADVGTPVQVLVTNEGVASGLLTLSSRADLPNPNPVPKAVSKPLPRVDLNPIAD
FT                   PATGVQGPVEALPEPPGPKPAGVKEDVSQEQSLQEPSAQPEGDRVPEAASSTGLSRQ"
FT   gene            complement(130623..131117)
FT                   /gene="smpB"
FT                   /locus_tag="sync_0123"
FT   CDS_pept        complement(130623..131117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="sync_0123"
FT                   /product="SsrA-binding protein"
FT                   /note="identified by match to protein family HMM PF01668;
FT                   match to protein family HMM TIGR00086"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45450"
FT                   /db_xref="GOA:Q0IDW2"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDW2"
FT                   /protein_id="ABI45450.1"
FT                   /translation="MGKGGGKKSAAARAAANRLLADNRLARHQYEILETLETGIELLGT
FT                   EVKSVRAGQANLRDGFCLIRRGELHLHNVHISPHTHASRYFNHDPLRVRRLLAHRREID
FT                   KLRGHLEQKGLTLIPLNLHLQGSWIKVTIGLGKGRKLHDKRAAAKDKQVKKETRDAIAR
FT                   Y"
FT   gene            131182..132261
FT                   /gene="ruvB"
FT                   /locus_tag="sync_0124"
FT   CDS_pept        131182..132261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="sync_0124"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF05491; match to protein
FT                   family HMM PF05496; match to protein family HMM PF07726;
FT                   match to protein family HMM TIGR00635"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46432"
FT                   /db_xref="GOA:Q0IDW1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDW1"
FT                   /protein_id="ABI46432.1"
FT                   /translation="MAIVSSNAEPSKGAPRPKPSRVVDAARQLDDSAELSATKEDGLRP
FT                   RRLDDYIGQRELKQVLGIAIQAAMGRGEALDHVLLYGPPGLGKTTMAMVLAEELGVTCR
FT                   ITSAPALERPRDIVGLLVNLQPKEVLFIDEIHRLTRVAEELLYPAMEDRRLDLTVGKGS
FT                   TARTRALELPPFTLVGATTRAGALSSPLRDRFGLIQRLEFYGQEDLQAIVMRAAGLLTL
FT                   QLSPEACAEIARRCRGTPRIANRLLRRVRDVACVREVSGCIDVKLVDEALTLHRVDGKG
FT                   LDASDRRLLELLLQSHGGGPVGLDTLAAALGEDPTTLEAVVEPYLLQLGFLQRTPRGRV
FT                   VTAAGRGHLGWPADEGDAA"
FT   gene            132258..133067
FT                   /locus_tag="sync_0125"
FT   CDS_pept        132258..133067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0125"
FT                   /product="tetratricopeptide repeat protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46760"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDW0"
FT                   /protein_id="ABI46760.1"
FT                   /translation="MSFDPKRWLSLLLAAFGVVVLLGADPALAESLPTDQHRQLFEQAL
FT                   RFSRQGDPQKALEGWDQVLELAPDDAAAWSNRGNVRLVLGDTEGAIADQTKAIALAPEE
FT                   SDPHLNRGTAEEALQHWKEAEQDYNWILKRDPEDASALYNLGNVRGSEGDWQSAESLYG
FT                   RAAEARPGFAMARSSRALALYQLEAFDEAEREMRNLIRRYPMFADARAGLSALLWIRGS
FT                   RGEAESNWAAASGLDPSYREADWLLQVRRWPPRPVADLQRFLALESP"
FT   gene            133064..134239
FT                   /locus_tag="sync_0126"
FT   CDS_pept        133064..134239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0126"
FT                   /product="peptidase, M20D family protein"
FT                   /EC_number="3.4.17.-"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01891"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47730"
FT                   /db_xref="GOA:Q0IDV9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDV9"
FT                   /protein_id="ABI47730.1"
FT                   /translation="MTTTTPPLKQRLEAILPDLIELRRHLHAHPELSGEEHQTAALISG
FT                   ELRQCGWRVREGVGRTGVMAELGPQSGPQLGLRVDMDALPVEERTGLPYASLRQGVMHA
FT                   CGHDLHSCIGLGVARLLAQEASLPVGMRLLFQPAEELAQGARWMRADGATDGLNALFGV
FT                   HVFPTLPVGTIGLRSGSLTAAAGELEIEVIGEGGHGARPHQALDAIWIAARVVTGLQEA
FT                   ISRRLDALNPVVVSFGKIEGGKAFNVIADRVTLLGTVRCLCADLHERLPAWIEETVQGI
FT                   CGSFGATARVRYRCIAPPVRNDPALTALLERSAVEQLGADQVQRLDQPSLGAEDFAELL
FT                   QDVPGSMFRLGVAGPDGCAALHNGHFNPEEGALGVGVQVLTAAMLAWRPTP"
FT   gene            134236..134466
FT                   /locus_tag="sync_0127"
FT   CDS_pept        134236..134466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0127"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47255"
FT                   /db_xref="GOA:Q0IDV8"
FT                   /db_xref="InterPro:IPR021524"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDV8"
FT                   /protein_id="ABI47255.1"
FT                   /translation="MSRQSRTRIHIVLSLAAPLMILLGVSAMLQREGPDRWQALPAILV
FT                   GSGLVIHAVVGRRHRRHQLLIALRTTRSQED"
FT   gene            134468..135094
FT                   /locus_tag="sync_0128"
FT   CDS_pept        134468..135094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0128"
FT                   /product="CotB mutant"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46435"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDV7"
FT                   /protein_id="ABI46435.1"
FT                   /translation="MANTPEQTAPNPEELRAAIASGDPVQAMPALAKLRALPDSDNDSV
FT                   VIPLLILGSEQQAFLVRSLSCSGLGYRRNEQGWQVLSRLLLVDEDPNVRAEAANALASF
FT                   GVERSWPLLRDTFAKDGAWLVRCSILSAFAEQPGINPAWLLELGKQAIADADGTVRVSG
FT                   AEILARLVREQVGDANGSEARALLQPLQQDADHRVVAAALNGLQP"
FT   gene            135289..136686
FT                   /gene="thiC"
FT                   /locus_tag="sync_0129"
FT   CDS_pept        135289..136686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="sync_0129"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="identified by match to protein family HMM PF01964;
FT                   match to protein family HMM TIGR00190"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47377"
FT                   /db_xref="GOA:Q0IDV6"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDV6"
FT                   /protein_id="ABI47377.1"
FT                   /translation="MRTEWVSARKGQANVSQMHYARKGVVTEEMAYVAKIENLPESLVM
FT                   EEVARGRMIIPANVNHTNLEPMAIGIASKCKVNANIGASPNASDAAEEVNKLKLAVKYG
FT                   ADTVMDLSTGGVNLDEVRTSIIGASSVPIGTVPVYQALESVHGSIEKLDEDDFLHIIEK
FT                   HCQQGVDYQTIHAGLLIEHLPKVKGRLTGIVSRGGGILAQWMLYHHRQNPLFTRFDDIC
FT                   EIFKRYDCTFSLGDSLRPGCQHDASDAAQLAELKTLGDLTRRAWKHDVQVMVEGPGHVP
FT                   LDQIEFNVKKQMEECNEAPFYVLGPLVTDIAPGYDHITSAIGAAMAGWHGTAMLCYVTP
FT                   KEHLGLPNAEDVREGLIAYKIAAHAADIARHRPGARDRDDELSRARYAFDWNKQFELSL
FT                   DPERAKEYHDETLPADIYKQAEFCSMCGPKHCPMQTKITDADLDGLEQVLKSQGAAELV
FT                   GVKQDKL"
FT   gene            complement(136863..138872)
FT                   /gene="tkt"
FT                   /locus_tag="sync_0130"
FT   CDS_pept        complement(136863..138872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tkt"
FT                   /locus_tag="sync_0130"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="identified by match to protein family HMM PF00456;
FT                   match to protein family HMM PF02779; match to protein
FT                   family HMM PF02780; match to protein family HMM TIGR00232"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45379"
FT                   /db_xref="GOA:Q0IDV5"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDV5"
FT                   /protein_id="ABI45379.1"
FT                   /translation="MAAATASLDTLCVNSIRMLAVDAVNKSNSGHPGLPMGCAPMGYTL
FT                   WDKFLKHNPKNPKWFNRDRFVLSAGHGCMLQYALLHLTGYDSVTIDDIKQFRQWGSKTP
FT                   GHPETFETPGIEVTTGPLGAGISNAVGLAIAESHLGAKFNKADAKVVDHFTYVIMGDGC
FT                   NQEGVASEAASLAGHLKLGKLIALYDDNHITIDGRTDVSFTEDVLKRYEAYGWHVQHVA
FT                   DGDTDVNAIAKAIEAAKAVTNKPSIIKVTTTIGYGSPNKSDTAGVHGAPLGAEEAELTR
FT                   KQLGWTHGPFEIPQEAYDQYRQAVERGASQEAEWNQSLANYRSKYPTESAEFERMLRGE
FT                   LPQGWDKDLPTYTPDDKGLATRKHSQICLGALGANLPELIGGSADLTHSNYTDIAGETG
FT                   SYQPETPEKRYLHFGVREHAMAAVLNGIAYHNSGLIPYGGTFLVFADYMRGSMRLSALS
FT                   MLGVIYVLTHDSIGVGEDGPTHQPIETIPSLRAMPGMLVFRPGDGNETSGAYKLAIENR
FT                   NRPSAMCLSRQGMANQANSSIDKVAFGGYILEDCAGTPDLILIGTGTELDLCVQAAKQL
FT                   TSEGKNVRVVSMPCVELYDEQSDAYKEEVLPNAVRKRIVVEAAETFGWHRFIGLDGDSI
FT                   TMNRFGASAPGGTCMEKFGFTVDNVVAKSKALLG"
FT   gene            complement(138921..140168)
FT                   /gene="fabF"
FT                   /locus_tag="sync_0131"
FT   CDS_pept        complement(138921..140168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="sync_0131"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /note="identified by match to protein family HMM PF00109;
FT                   match to protein family HMM PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45982"
FT                   /db_xref="GOA:Q0IDV4"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDV4"
FT                   /protein_id="ABI45982.1"
FT                   /translation="MVEGLQRVVVTGLGAVTPIGNTVADYWEGLTSAKNGVEAITLFDA
FT                   AQHACRFAAEVKNFDPSGFIEPKDAKRWDRFCKFGVVAAKQALTDSGLTITPDNADRIG
FT                   VSIGSGVGGLLTMETQAHVLKDKAPGRVSPFTVPMMIPNMATGLAAIALGAKGPSSAVA
FT                   TACAAGSNAIGDAFQLLQLGKADAMICGGAESAITPLGVAGFASAKALSFRNDDPAGAS
FT                   RPFDKTRDGFVIGEGSGILVLETLAHAEARGATILAEIVGYGTTCDAHHITSPTPGGVG
FT                   GAAAIRLALEDGGIAADSVDYVNAHGTSTPANDSNETAAIKSALGSRAKDIPVSSTKSM
FT                   TGHLLGGSGGIEAVACVLALRNGVVPPTINYNNPDPECDLDVVPNTARELTLGTVLSNS
FT                   FGFGGHNVCLAFRRMS"
FT   gene            complement(140177..140461)
FT                   /gene="acpP"
FT                   /locus_tag="sync_0132"
FT   CDS_pept        complement(140177..140461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="sync_0132"
FT                   /product="acyl carrier protein"
FT                   /note="identified by match to protein family HMM PF00550;
FT                   match to protein family HMM TIGR00517"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46498"
FT                   /db_xref="GOA:Q0IDV3"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDV3"
FT                   /protein_id="ABI46498.1"
FT                   /translation="MGQARKMRRHVCSAMSQESILEKVRSIVTEQLSVDAGEVKPESNF
FT                   QNDLGADSLDTVELVMALEEAFDIEIPDEAAEGIATVGDAVKYIEDKQA"
FT   gene            140569..140814
FT                   /gene="psaC"
FT                   /locus_tag="sync_0133"
FT   CDS_pept        140569..140814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaC"
FT                   /locus_tag="sync_0133"
FT                   /product="photosystem I iron-sulfur protein PsaC"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM TIGR03048"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47876"
FT                   /db_xref="GOA:Q0IDV2"
FT                   /db_xref="InterPro:IPR017491"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDV2"
FT                   /protein_id="ABI47876.1"
FT                   /translation="MSHAVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAGQIASSPRT
FT                   EDCVGCKRCETACPTDFLSIRVYLGDETSRSMGLSY"
FT   gene            140865..142751
FT                   /gene="glmS"
FT                   /locus_tag="sync_0134"
FT   CDS_pept        140865..142751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="sync_0134"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /EC_number="2.6.1.16"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF01380; match to protein
FT                   family HMM TIGR01135"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45563"
FT                   /db_xref="GOA:Q0IDV1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDV1"
FT                   /protein_id="ABI45563.1"
FT                   /translation="MCGIVAVIGSRDAAPLLLEGLRQLEYRGYDSAGISTLQGKDLHCL
FT                   RAKGKLNNLTVRVDSEGAPGLCGIGHTRWATHGKPEEHNAHPHRDGSGRVAVVQNGIIE
FT                   NHRALREELTAAGVSFQSETDTEVIPHLIAAQLQLMGVSEGAGNGQILLEAVQAVLPRL
FT                   QGAYALAVLWADAPGALVVARKAAPLLIGLGEGEFLCASDTPALAGFTRTILPMEDGEV
FT                   ALLSPLGIELYDAEGARQQRTPTILSGSDHIADKRHFRHFMLKEIHEQPETARLWVDRH
FT                   LPVGLTAANPVALPFEESFYEGVDRIQILACGTSRHAALVGAYLLEQFAGLPTTVFYAS
FT                   EFRYAPPPLAPNTLTIGVTQSGETADTLAALSMDAKRRQAYGQPGYAPKQLGVTNRTES
FT                   SLARQVPHILDIGAGIEVGVAATKTFLGQLLAFYGLAVAFAARRGHRSETEISELLEEL
FT                   RALPEQLERLVDHHDKGSEALAPRFAETQDVIFLGRGINYPIALEGALKLKEISYIHAE
FT                   GYPAGEMKHGPIALLDSHVPVVSIAMPGPVFEKVLSNAQEAKARDAQMIGVAPVGPDTE
FT                   LFDALLPVPEVSEWVSPLLTVVPMQLLSYHIAAYRGLDVDQPRNLAKSVTVE"
FT   gene            complement(142873..143319)
FT                   /locus_tag="sync_0135"
FT   CDS_pept        complement(142873..143319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0135"
FT                   /product="Mycobacterium tuberculosis PIN domain family
FT                   subfamily"
FT                   /note="identified by match to protein family HMM TIGR00028"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46283"
FT                   /db_xref="GOA:Q0IDV0"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR006226"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDV0"
FT                   /protein_id="ABI46283.1"
FT                   /translation="MAEPIALLDVNVLIALIDPQHVHHEPSHRWFQAHGGDGWATCPLT
FT                   QNALLRILGNPRYPNSPGGPAVVMSFLQELLAHPAHVFWPDALSWQATGVFEAEALLHH
FT                   GQITDTYLLGLAVHHQGRLVSFDRRLSLRAVRGGEEALHLIDPG"
FT   gene            complement(143319..143564)
FT                   /locus_tag="sync_0136"
FT   CDS_pept        complement(143319..143564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0136"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01402"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46898"
FT                   /db_xref="GOA:Q0IDU9"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDU9"
FT                   /protein_id="ABI46898.1"
FT                   /translation="MRTTLRLDDDVLAAARVLARQRRRSVGDVISDLARQTLSRPADGG
FT                   SQNVLEQRSGLPQLPVKASGGAVDLELVNQLRDEEA"
FT   gene            complement(143745..144116)
FT                   /gene="citT-1"
FT                   /locus_tag="sync_0137"
FT   CDS_pept        complement(143745..144116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citT-1"
FT                   /locus_tag="sync_0137"
FT                   /product="Di/tricarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45693"
FT                   /db_xref="GOA:Q0IDU8"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDU8"
FT                   /protein_id="ABI45693.1"
FT                   /translation="MSALGTLLLLGLAIACFIGGWLAPELVALLAAGLLMGTGVLTPNE
FT                   ALAGFGSPALITLVGLFVLSNCLLHSGALDRLRELLASPRILNPSQLMLVFGFVVAPIS
FT                   GFIPNTPIVAIKSTTTFRS"
FT   gene            complement(144179..144307)
FT                   /locus_tag="sync_0138"
FT   CDS_pept        complement(144179..144307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0138"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46300"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDU7"
FT                   /protein_id="ABI46300.1"
FT                   /translation="MALQKMVMADQAPPTQWFPSAFALDGGSRALRDFVRLIYRAW"
FT   gene            complement(144595..145389)
FT                   /locus_tag="sync_0139"
FT   CDS_pept        complement(144595..145389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0139"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46949"
FT                   /db_xref="GOA:Q0IDU6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDU6"
FT                   /protein_id="ABI46949.1"
FT                   /translation="MASPRFSIITPVLNGARDVYGYIETLKKQKFSNWESIIVDDGSSD
FT                   GTTDILDDCIAGDKRFYVFCNTLVREISGPYQARNFGLKLAQGDFICFLDIDDRWFPNK
FT                   LEMQAKQLKSNPEYCLLYSPYVRGNRGASFGKVRKTPLGIAPKLLVKVSNPIPMLTSCV
FT                   SRATISDLFFAPVNHEDYLFWHFVISRLNSEQIAEYPNPLAIYCVDPSSISGNKFLAFQ
FT                   WLWRCYKRLGYGFFATLLVLFLRGMLQVFFSIKEYISPRVEF"
FT   gene            complement(145603..146538)
FT                   /locus_tag="sync_0140"
FT   CDS_pept        complement(145603..146538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0140"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47558"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDU5"
FT                   /protein_id="ABI47558.1"
FT                   /translation="MPTFTALAPRLSLLKYYILRIFIGSFYRSVSKLAPNLLELNSFFL
FT                   RMQIQREPLDTCFFRLFLQVFDLTLIDFGANHGEFTTAALPSRDSTAKLIDANYELQKR
FT                   TKKRVEKLGFFNLDFISGCVGADHTKSLYLCFEKSHTGAAEVTSDFHLYKSRGCICEPV
FT                   NSLSPHDYIDKRIKYAAKIDIEGLELDLLKELWTAQYLSSILIVGVEATYSSQLRSIYN
FT                   HLAEFEFVLYASNHLWYTGSSLIDQFSCCYANIVNNRFDLKPRNLSDVALSCPFSMVYF
FT                   INKRLLECSLASKSRTTTRILHQDFWGVTN"
FT   gene            complement(146555..147379)
FT                   /locus_tag="sync_0141"
FT   CDS_pept        complement(146555..147379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0141"
FT                   /product="Glycosyl transferase family 11"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47692"
FT                   /db_xref="GOA:Q0IDU4"
FT                   /db_xref="InterPro:IPR002516"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDU4"
FT                   /protein_id="ABI47692.1"
FT                   /translation="MIHLRMCGGLGNQLFQLSTALKLRQSIASNQSILINFAGEKYAAN
FT                   RVLAFEPLFEIPSWLLFEPVSLRDQLLKYSSVHLRVGRYTWNAYNDVFRFIPFPSSDIF
FT                   LDGYFWRKFDKPSANSFFPQLNLQSLKFDRSWLRFLRNTVAVHIRGGDFISHQKFNVCG
FT                   YQYYKEAISIAIAKGFDDFIIVSDDQKHAAMLMNQILDEMPRITYQFLPSSSPLSDFNF
FT                   LRQMPCKILSNSTYSWWSSALSIAPKITIVPSHLALGLQRPRQLHEDIIYLY"
FT   gene            complement(147550..148272)
FT                   /locus_tag="sync_0142"
FT   CDS_pept        complement(147550..148272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0142"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46402"
FT                   /db_xref="GOA:Q0IDU3"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDU3"
FT                   /protein_id="ABI46402.1"
FT                   /translation="MFVLFFLISILVFIESSTSIARSVGFSVNSPYAGITLQGSLSIVS
FT                   RFVIFLYSPLLGWLADTKKIDLNVVNSIPYLYSLVPISLLAVFVLQNQIASLYGKLITT
FT                   SLTHGRWIKQPSKGFRSTIKDITLRPITASFKFNTRLKRFSRVKCMILLLYFPYYAAWP
FT                   ITFVLIASYPDYRATFLSASTVLTALNTIGLTIWFDPILLKMQNHQRSSVLFLNSLVIT
FT                   RLWSSLLVYLILIPICFF"
FT   gene            complement(148272..149102)
FT                   /locus_tag="sync_0143"
FT   CDS_pept        complement(148272..149102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0143"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47086"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDU2"
FT                   /protein_id="ABI47086.1"
FT                   /translation="MMPCKIIIFQKDVDYRVLNYYDHLALMLGEVEIILICPDNNIHGI
FT                   NSPEFITVIHDKNILQRHKVDQMPEYLSMSGWYKQQIIKILTADYFFHLDMKNLLILDG
FT                   DTFVSPMVFKNQIYLTRKNEPNTYLNMFKFMPSISRFEGVARLLLNQKISPIVNFGIWN
FT                   RQVFENVFCCSNNWQQILVRDISNYDASNSLATPGFSEYLLMTAATIYDLSPSIGKLRY
FT                   FRRADLVYSFLINKTNPFANNCHFDMISFENTHDANTFKKFLASLAWIFGIEIV"
FT   gene            complement(149099..150211)
FT                   /locus_tag="sync_0144"
FT   CDS_pept        complement(149099..150211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0144"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46489"
FT                   /db_xref="GOA:Q0IDU1"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDU1"
FT                   /protein_id="ABI46489.1"
FT                   /translation="MHKKVSYIYPANVFIGSFALLFFCLAVPPSSELSYNTWLFTILYF
FT                   VGCSVPSIYIVLHTKQCYPLLGKNKFSPIAYDYICLIIFFSSLLSFVFGAVGSLDFQSA
FT                   GIFAELYRNGFYKGSGIYTMPCLSFSSIVLLAEIYTSSSLMSSKRFWLALIILSSASIL
FT                   LGLRVFLFATLIHLLVRLNFLNSKGIIVLLSAPILLGLVTIFYKTYLGIPYSFELWINL
FT                   FTRLNLHDTAFIITSSSNSMPFTEILFPIGDTEILKQSILSGGNKNVLYAAFPFLSKYS
FT                   GVALPAGIHFLVLGPILSIFVYTAYCLSSVKLALLKFKTDSIIKLLQIALVCVLIVGMI
FT                   EDYSNTITLLLSSIFALVVFIFPRIFKIKA"
FT   gene            complement(150622..151629)
FT                   /gene="wcaG-2"
FT                   /locus_tag="sync_0145"
FT   CDS_pept        complement(150622..151629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wcaG-2"
FT                   /locus_tag="sync_0145"
FT                   /product="GDP-L-fucose synthetase"
FT                   /EC_number="1.1.1.271"
FT                   /note="identified by match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45123"
FT                   /db_xref="GOA:Q0IDU0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDU0"
FT                   /protein_id="ABI45123.1"
FT                   /translation="MIKADDRFFVAGARGMAGSAICRALQENGYGDETKGGALLTPTRQ
FT                   ELDLLNHEVVKAWYEENKPDVVVLAAAKVGGIYANDTYPADFLLENLKIQTNVIEGAWK
FT                   AGVRRLLFLGSSCIYPKFAEQPIKEEALLTGSLEPTNEWYAIAKITGIKLCESLRQQYG
FT                   FDAISLMPTNLYGPGDNYHPENSHVLPALIRRFHEAKQAGAKSVTCWGTGSPLREFLHV
FT                   DDLGNACVFALENWSALDQDAPKDDQGKPLAFLNLGTGVDLTIQELAEQIAAVVGFEGT
FT                   IEWDTSKPDGTPKKQLDVSLMKQLNWSASIPIREGLCLVYEDFIKEGLSQNLRN"
FT   gene            complement(151635..152789)
FT                   /gene="gmd"
FT                   /locus_tag="sync_0146"
FT   CDS_pept        complement(151635..152789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmd"
FT                   /locus_tag="sync_0146"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /EC_number="4.2.1.47"
FT                   /note="identified by match to protein family HMM PF01370;
FT                   match to protein family HMM TIGR01472"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46421"
FT                   /db_xref="GOA:Q0IDT9"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDT9"
FT                   /protein_id="ABI46421.1"
FT                   /translation="MSELSHCKKALITGITGQDGSYLAELLLEKGYEVHGIKRRASSFN
FT                   TNRIDHLYQDPHVDDPRLVLHYGDLTDSSNLIRIIEQVQPDEIYNLGAQSHVAVSFEAP
FT                   EYTANSDALGTLRILEAVRMLGLTETTRIYQASTSELYGLVQEMPQKESTPFYPRSPYG
FT                   VAKLYAYWITVNYREAYGMYACNGVLFNHESPRRGETFVTRKITRGLARIDAGLEDCLY
FT                   MGNLDSLRDWGHARDYVEMQWRMLQQEGPPEDFVIATGRQESVRRFIELTALELGWGAI
FT                   EWEGKGLEETGKRSTGEVVVRIDPRYFRPAEVETLLGDPAKAKQKLGWTPTTTLEELVA
FT                   EMVATDKEEAKKEAYLKLKGFNVVGSMENPPTNPDAVKAAGGKA"
FT   gene            complement(152790..154172)
FT                   /locus_tag="sync_0147"
FT   CDS_pept        complement(152790..154172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0147"
FT                   /product="possible sugar transferase"
FT                   /EC_number="2.7.-.-"
FT                   /note="identified by match to protein family HMM PF02397;
FT                   match to protein family HMM TIGR03025"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45376"
FT                   /db_xref="GOA:Q0IDT8"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDT8"
FT                   /protein_id="ABI45376.1"
FT                   /translation="MQIRLPWLLSRRRLLAAILLDSGVCLVVYCSLFLSCFGRWPELSV
FT                   PLLILWISWLVGSYILGRYPGIDRFNLSPNSLVLIQLVVKTFLVVVFSLGGTLSYHWLL
FT                   KGASGDVLFRSFLLPYLGLLGIFSLMAQIFLRACIKRRLSDGKFWQFLGTQKAYQRLQH
FT                   HLLWSRLSARLDHFSYAQLNEVGPYPIVVDDVDSEPAPILHRLLELQQQGLIVICRHEW
FT                   CEAVLQRFPPEFLSDVELLRGEFSRPASKFETRLKRLGDVIVSALLIVLTSPLLLISAL
FT                   LIKIEDGGPILYSQTRSGFEGIPYTIWKLRSMRIDAERDGAQWVKCADSRITRVGSLLR
FT                   RTRLDELPQLWCVLSGSMSLIGPRPERPEFDQDLEKKIPHYCLRQRIRPGLSGWAQVNY
FT                   PYGSSVEDAANKLSYDLYYLRNFSFWLDLLILFKTMRLVFNAQGAIPVPSAPLNHDKIS
FT                   SF"
FT   gene            complement(154198..154335)
FT                   /locus_tag="sync_0148"
FT   CDS_pept        complement(154198..154335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0148"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47673"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDT7"
FT                   /protein_id="ABI47673.1"
FT                   /translation="MNHSELPHFDAGECQSFGEVVELLLPPASGFNKIAVSAQRTPYSC
FT                   "
FT   gene            complement(154746..155735)
FT                   /locus_tag="sync_0149"
FT   CDS_pept        complement(154746..155735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0149"
FT                   /product="gumB protein"
FT                   /note="identified by match to protein family HMM PF02563"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45861"
FT                   /db_xref="GOA:Q0IDT6"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDT6"
FT                   /protein_id="ABI45861.1"
FT                   /translation="MSADQEALQGDVYIIGPGDVLDLKLFDAPELSGPLEVLNDGSVAL
FT                   PLVGSVVLSGLTLQQASSWARQLLADQLLRPELQLQVVRPRPIRVSVVGAVERPGLYSL
FT                   TTTESVQTEGGPTTSISGLPTVVDVIQKAGGITQQANLREVQLQRRLPGTPVRFKRARL
FT                   NLLDLVLEGDQQQNPFLFDGDTIKIERAEEVPAEAIALASVNLSPKVIEVNVIGEVNSP
FT                   GRLELMANTPLVQAILASGGLKDWRANGGNVELVRINRNGTATLKRFRFDMSQGASNQA
FT                   NPPLRQGDTVRVGRSLLAKGSDAIGAVSEPVSGLVTVYSLFRLINTNN"
FT   gene            156164..158641
FT                   /locus_tag="sync_0150"
FT   CDS_pept        156164..158641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0150"
FT                   /product="Chain length determinant protein family protein"
FT                   /note="identified by match to protein family HMM PF02706"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46364"
FT                   /db_xref="GOA:Q0IDT5"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDT5"
FT                   /protein_id="ABI46364.1"
FT                   /translation="MSNLIARPGQSPDLVPQTIQDVQVRDLGLNLSNLKAEASDEIDLR
FT                   ELWRALKRRKKIVGFTAAAVLVLSGVVTTYQRLFMPVYEGSFALLITDPISNEGGNNSA
FT                   ASSAASGTVFEQLARNTTQNDIPTLIEVLESPLLLAPIAKRFDVSENELAERINITTGG
FT                   AKRKEAEGVLKVSLTGRNPKEDGQLLEAISAAYLQTALQQRQKRLTDGIAFLDLQAPAL
FT                   QAKADAIQGELAEFRRRHSLLEPAIEGTALKQREATLATQIFGFEAERSRLKRVRQDIA
FT                   SGSLSARGFQEAISTGSGGVVTGNQQSQGLAVSDADQSLLQQLLKVETELAEARSKFVN
FT                   NSSMVLSLEARLEQLQPLLRENQLEAVDAALGLNANRLATARAQERTLQDNFLKQPALI
FT                   KQYETLQTKLTLAQENLSGLVSARETFRLESAQSSVPWRVIDPPEIDPNPIKPSIPRNL
FT                   ALGAMLGLVAGVAAGLIRDRFDHVFHLPAEVKDDLNLPLLGHIPHVAFFKGVREDKRFL
FT                   LNELDQSSNNNATNAPESRKQDRYQRFFYQEAFRNLFTSLRFLNTERPLKAVALTSSLP
FT                   AEGKSLVNVLLAKTLAEMGQRVLLVDADLRKPQLHIRLGINNLQGLSNLITEDALHWRD
FT                   LCKQVPGYENWSVMTAGLRPPDPTRLLSSQRMHDLVQEITQSNDFDLVLFDTPPVLGLA
FT                   DASLVAEHCDGLMLLVSLNRVDRGLPQEAVNRIVSSGVPLLGLITNAVSTEEQSNQFGY
FT                   GKYGYGKYGYGRYGYGYGGYNSYSAALYANYADPEDSIDSSSEGAGKSLKASPTWREQL
FT                   RERSRRFMQWLDN"
FT   gene            158626..159111
FT                   /locus_tag="sync_0151"
FT   CDS_pept        158626..159111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0151"
FT                   /product="putative phosphatase"
FT                   /note="identified by match to protein family HMM PF00782"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45721"
FT                   /db_xref="GOA:Q0IDT4"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDT4"
FT                   /protein_id="ABI45721.1"
FT                   /translation="MARQLIAMQQRFHIHWILIDELAIGPAPRAERHVLRLKEAGVGSV
FT                   LSVCSEEEAPPPPSLEQHFACRRIVLPDHRSGRLPDRSELRDALALLLQLHQQQAPVFV
FT                   HCVAAMERSPLVCLAWLVERHELSPEAALDYLMQVHPGTNPLPGQLALLRSQKTGAS"
FT   gene            159111..160913
FT                   /locus_tag="sync_0152"
FT   CDS_pept        159111..160913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAQ00379.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46960"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDT3"
FT                   /protein_id="ABI46960.1"
FT                   /translation="MPILWSPPLPPPPLPSPQPPLQQRAVKPLANQAPRWELLPHPVLP
FT                   VKADAPAAALQPLTADQVEAVVNTIPLERNDFLPLLRLSPAVPTATTFLSEQWRIGFFN
FT                   ISPFDSGEASGTGNQNYAVNLDVGLSDNLLLSAFVSQADDPLSAQITGFTKQPGNFWQS
FT                   YGAAARWKWLDQDQWKLAISGSLEAWEVGSGGDDSFANKGSDSSPNIFNNSGRRVFTRN
FT                   IVGSLSLPITFQASNAWQFNLSPGVSFLPSSQGGGQGGSGTFYGTNPYISGGVLFQPFP
FT                   ELGLTASIAQPVGAGTNSFNADLQFSRVPIYSAGINWNLSPRIGLRGLLTNGFGATPAT
FT                   ALLALPSDNRLGYSASFVFTPDVPDIPQPPLTRRQRSLARGGLTVNTALVPPEDEIDAW
FT                   VNADSGGNVNPFIGYSLSNVFQLYLFSGGLYNNVPQTTPQARLYANDGAWNWRIGGKAV
FT                   AFSPLRGAPFWGGGRITLGRNSDTVNNTGQGYVFAETMFTWEASDTVALNLNPKLVLSG
FT                   AGNLWAVGVSTNVQVAPRWQLVPEGNVVVNNVAQSNGTLGLRWQTTDSLALEAYGSTAA
FT                   SILDVGQLLSAEQVRFGGRILFSF"
FT   gene            160916..161539
FT                   /locus_tag="sync_0153"
FT   CDS_pept        160916..161539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0153"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AB1913"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46090"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDT2"
FT                   /protein_id="ABI46090.1"
FT                   /translation="MLFLLLTPQPVEPPPLRPALQRVQTSSRVQLLRRGEQATLSMQVP
FT                   VPIDRAWAVLTNYARTFAAMQDVAAVQLVSRQGQKLRLKQVLQAPYTFGLRINVLLEGE
FT                   ENPQSRSLRYRLVRGENIRALSGEWTLTQDAGGTLVRHTIRLQPEIPGLLQSSFRSLHD
FT                   ASLRQSFETLRQLMLGPALSDNRVPSNSATTTTTPSPLSVKAKG"
FT   gene            complement(161437..162744)
FT                   /locus_tag="sync_0154"
FT   CDS_pept        complement(161437..162744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0154"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45956"
FT                   /db_xref="GOA:Q0IDT1"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDT1"
FT                   /protein_id="ABI45956.1"
FT                   /translation="MSANGAKGAPPNSVLFRFLWCGQLISNLGTQTSLYGIGLWLFAQS
FT                   GRLLDFGLVALVVQLARILALPLLASRLNHWPPARLMLLAHAVGALCTLALAWVLLGAA
FT                   PQAGQLPSLLPILLIQGVAAMAEATLVLRFSSLIPLLIADGPALIRANGLFATTDGLVV
FT                   TMAPFLGTWLVSALGLMGVLGLDALSFVLAMVCVLLAPWSEDILQRLPSPAPADSIGWS
FT                   SLPRRLRRFWRRRAQARQALLLSAVVMGVYAGCEILFPAWVAERWGAARMAVVLVLGCA
FT                   GYGGGFLLWRFWLGQHWRMSGRALLLGQALILVGAGVPALVAVDGLWFVGVFGFSLGLP
FT                   VVTAALHQAWVTLAQQEDPARVFALRYGCEWSSRLLAFLGVSLLADRLVKPNISSMFEA
FT                   IPGQPLAFTLSGLGVVVVVALLLGTRLSLKAGPSIN"
FT   gene            complement(162771..163802)
FT                   /locus_tag="sync_0155"
FT   CDS_pept        complement(162771..163802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0155"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45567"
FT                   /db_xref="GOA:Q0IDT0"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDT0"
FT                   /protein_id="ABI45567.1"
FT                   /translation="MLCLRGADSCLPRLLEALARQTYPGPWRLQVVVDSAADPAWTLLQ
FT                   PWLARTDTAWNELQCRTLQQRPSQGSLKCAALRQAFAGLHSDSALVVLLDADIRFAEDG
FT                   LERCARACLHPGVGAISGNRWFAPPSPGLSGLNLSSWTRAVWNAGAVVLMTLWKIPWGG
FT                   CLCVRRSVVEAGDWLELLSRGLCEDTGLLGPLRRLGLDYRFAPDLVMVDPDPAQPLLPL
FT                   SRWITRQLLTARLHHPAWGLVALHGISSAALLLLALLEGDWTTALVYELGCVGLLCWIE
FT                   QLLQPEGRPHWLGWSVGLLPGQLVDGVSTVAALLARRISWRGVDYAVRTRPARVWIQRD
FT                   RLQ"
FT   gene            complement(163949..170485)
FT                   /locus_tag="sync_0156"
FT   CDS_pept        complement(163949..170485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0156"
FT                   /product="polyketide synthase, putative"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF00107; match to protein
FT                   family HMM PF00109; match to protein family HMM PF00550;
FT                   match to protein family HMM PF01073; match to protein
FT                   family HMM PF01370; match to protein family HMM PF02801;
FT                   match to protein family HMM PF07993; match to protein
FT                   family HMM TIGR01746"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45137"
FT                   /db_xref="GOA:Q0IDS9"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDS9"
FT                   /protein_id="ABI45137.1"
FT                   /translation="MTGLDHPDKPNQQEAIAVIGMGCRLPGGVESSDDFWDLLAEGRDV
FT                   VGEIPPERWDPQRHHDPDPRRPLHQHVRRAGLVEGVDRFDPGFFGISGREAQCMDPQQR
FT                   LLLEVCWRAIEGAGHPLEQLRGRAVGVFMGISSADYSALLWASEAQYLMPDNEPFILTG
FT                   NTGCIAANRISYAFDLKGPSFTVDTACSSSLVAVHLACESLRRGESELALAGGVQALIH
FT                   PGIQMSFCKAGLLSPSGRCRSFDAEADGYVRSEGAGAVFLKPLRAALRDGDRIEAVIRG
FT                   TAVNSDGRSQGIAAPSQKAQMACVQAAYAAAGLSPAAAQYVEAHGTGTRQGDPIELRAL
FT                   GAVLGAGRSKAKPCLVGSVKSNLGHGETAAGITGLIKTVLCLKRRQIPASLHYSRPSPS
FT                   VDMLGLGLKVSDALMPFPAEDQELVASVSSFGFGGTNAHAVLSAATELDGDCAKASGSA
FT                   APALQLLWLSARSPEALAVLRRDYAEWLDSHPEVEIADLCASTHLRRSQFPHAIALIVS
FT                   SRKELLNQLLGQGAVAWSGEVPSRGQAALPASLQKIQLKMLSPGASARRMLEELVEALA
FT                   SGAQMSWSTWHEGADWCLVQPPGHPFLRSRYWWSSIETAAKDVKASLWLDHLGLTSPAP
FT                   QRQGALQLQRLDLPGETQHWNAELDADSVPDLKHHRLGGQPVFAAAGYLALVLDWLKER
FT                   KQALQLGAVQLERPLWLHDGPVRLQALLHGQELSLHSRPVSGDDSSDWQLHGQVQLAVE
FT                   AGEASLLPEQGFIPSSEAERQAPEELYGALKRLGLSYGQTYRPIREFWVDGLCAEALLI
FT                   RPEGAPDRCLIDGCFQLVAAVIAQEPAAAQLLLPTGVEAVHFGCWPLPDALRCRLQLRE
FT                   SSVEQQGAEARGHRVADLELHDVAGAPIGSIRGLQLRQLSRTMLDLMVPVAPALPAARL
FT                   LEDGWSELPAGALSEWSSVASEPISLIALGEIPETVQTWCDQQAIDPIVMEESADPATL
FT                   VPALVQTLQALPLQRPRQLFVLLPHLFSPAVGAVQAAVRSLAQDCPAWRCSTITLKGEV
FT                   LSSPQWQRLLAATGGDAELRWCGEDRIDTRCLHPMDGDRFRILADGSGRLEGLVHAPLP
FT                   LPQLLPGELELAVEATGLNFRDVLNALGLLQTHNQSLGLRADAQLPFGGEAVGRVVAVG
FT                   PGTDPSLLGSRMLAALTLGSLASHVSCRADLCVPWPESLDPVLGASLSTAYLTAEHGLE
FT                   QLAQLQQGETVLIHAAAGGVGQAALQVALRCGAHILATASAAKQAALLEQGVDAVFDSR
FT                   STAFADQVLEHTGGRGVDVVLNSLKGEWVDASFRALSEGGRFVELGKLEIWSDHQVRER
FT                   RPDVTYHRFDLLELAASDPQPLRQRLLALVEAVQQERVKALPTSVFSLAECKDAFRLMA
FT                   QGRHVGKLVITLPTQAPPCRIRSDGTYLIVGAFGGLGLRLQRWLVEQGARALLLVGRRL
FT                   PQPDSDAEQQLQRLRTQGIEVESLTWVELPRALDVLPNNQPLRGVIHAAGTLWDQRIDA
FT                   IDALGLETVLSAKWGVGEQLQQVQQLQPEAWLQVDFQLVFSSLAAGVGSPGQLVYGAAN
FT                   AALEAMCLSAEHSEQPGGPLRLAIQWGPWGGTGMAAGLEKRFEAVGLKPLQDSEAFEAL
FT                   ARLLQRGRSGVVTVMAADWPRLVSQALPRQAAWFQALLPEASGRSEAQVRAQLEALPMR
FT                   QRRPWLLATLQELLAGVMEEPSAQLDPHTSLFDLGLDSLMAAEFAAVVQEALGWRLDLA
FT                   ALSDAPCLDDLAALALERLSTDGEVSDRMALNLDQEAELPEAWSRPNLPTLEAPGEQLL
FT                   LTGASGFLGAYLLAGQLERWPELRLRCLVRAASRQQGSEKLELNLRRYGLWNPAWAERL
FT                   EVVLGDLAQPRLGLDPDQFAALGQGLGGILHNGAQLSQMASYAQLAAANVGGTRELLHL
FT                   ATAGSPVRFELISSVAVFEADVCCDQVIAEHDPLEAWTGIQLGYSQTKWVTDRMVRRAG
FT                   EAGLPVTIYRPPLIAGPSNGSSWHQGDLLQRLLQGCLALGASPDLAWELDMVPVDYVAD
FT                   AITALAWSGPAKGRCFHLQHPEPLMLNALLSQITETLSGWRIVPMQVWISEIEQSSANP
FT                   LQPLLPFLQQRWGDDGLTYPERNCRGKRARPSCASTTELLAEQGVRCPDWPQLIGPWSS
FT                   VLLQQSSGV"
FT   gene            complement(170482..171609)
FT                   /locus_tag="sync_0157"
FT   CDS_pept        complement(170482..171609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0157"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45791"
FT                   /db_xref="GOA:Q0IDS8"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDS8"
FT                   /protein_id="ABI45791.1"
FT                   /translation="MRVLIFTSSGGTAHDAAAYAIEAWLKRWDPDGEVLVEHVLENASV
FT                   FTRAGVALYNWIQRHGPWMHQIYWRVVEFEDVTKPGTLLAGRFYVIRLLRRLQPDLLIS
FT                   THPHINRGHFDLARRVCPNLRCITCCTELDGGFGFSRNWLTRSADVFWTLTPEVSADVR
FT                   RRGYKRVPVPALGPLFDPAFEEELARPERGISADQLPLLVLGAGANGANNHIRLLDVLL
FT                   PLAGRLRVVALCGRRQAALDQLRQWAEQHPQLSLKPLGFQGPAEMAKLYKQAWAMVARP
FT                   GARTATEALAAGTVLIFNGFGMTMPQELLARRYFQARQIDCCIRKPQDLLDLCSRWLDH
FT                   PERYQTLKAQVGRHPLVADREAIRSLLLDGDFAKG"
FT   gene            171847..172128
FT                   /locus_tag="sync_0158"
FT   CDS_pept        171847..172128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0158"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47431"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDS7"
FT                   /protein_id="ABI47431.1"
FT                   /translation="MQSKGRICQDDWKLRFEICLKAILLGLDLGSDHRVNAVFSSWKIL
FT                   RLNEAPGEGLKQKINPSKALGKCEGEVSRSQQIRAANHVKRYAARATP"
FT   gene            complement(172097..173050)
FT                   /gene="rfbB"
FT                   /locus_tag="sync_0159"
FT   CDS_pept        complement(172097..173050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /locus_tag="sync_0159"
FT                   /product="dTDP-glucose 4-6-dehydratase-like protein"
FT                   /EC_number="4.2.1.46"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46768"
FT                   /db_xref="GOA:Q0IDS6"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDS6"
FT                   /protein_id="ABI46768.1"
FT                   /translation="MPASLIRNLVTGGAGFLGSHLCDRLMESGEEVICLDNYFTGRKAN
FT                   IAQWMGHPRFELIRHDVTEPIKLEVDRIWHLACPASPVHYQFNPVKTAKTSFIGTYNML
FT                   GLARRVGARLLLASTSEVYGDPEVHPQPESYRGCVNPIGIRSCYDEGKRIAETLCFDYQ
FT                   RMHDLEIRVMRIFNTYGPRMLPDDGRVVSNFIVQALKGEPLTLYGDGSQSRSFCFVDDL
FT                   IEGMIRLMNGDHSGPINIGNPIEFTIRQLAELVRDKINPELELICKPLPQDDPLQRQPI
FT                   IDLAEKELGWTPEVALEKGLEPTIAYFKELLLLHNV"
FT   gene            complement(173210..174649)
FT                   /locus_tag="sync_0160"
FT   CDS_pept        complement(173210..174649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0160"
FT                   /product="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /note="identified by match to protein family HMM PF00483;
FT                   match to protein family HMM PF01050; match to protein
FT                   family HMM PF07883; match to protein family HMM TIGR01479"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47871"
FT                   /db_xref="GOA:Q0IDS5"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDS5"
FT                   /protein_id="ABI47871.1"
FT                   /translation="MITPLIPVILCGGTGTRLWPLSRASYPKQYWPLGGSGDETLLQQT
FT                   QKRLTGIKALGNPLLICNEDHRFIVAEQMRQIDVEPGAILLEPMGRNTAPAVAVAALQA
FT                   TAKGDDPLLLVLAADHVIRDRSHFQAAIAAGRKEAEVGRLVAFGIVPTAPETGYGYIEA
FT                   AEPLVPGALTPVPIARFVEKPDQATAEQFLASGRFTWNSGMFLFKASAMLAELERLTPE
FT                   VVSCCRSALEQDTADLDFLRLDRDAFAKCPNVAIDVAVMEQTELGTVLPLDAGWSDVGS
FT                   WSALWDTADRDENGNVLRGRVISEGSKNCYLRSEHRLVVGLGVENLVVVETDDAVLIAD
FT                   RSQAQNVKTVVKQLEAEGSPEGKAHRKIYRPWGAYTGVVEGTRWQVKRISVKPGASLSL
FT                   QMHHHRAEHWVVVHGTALVERNGETELIGENQSTYIPIGCKHRLSNPGRIPVEMIEVQS
FT                   GEYLGEDDIVRFEDRYGRSDL"
FT   gene            174679..174777
FT                   /locus_tag="sync_0161"
FT   CDS_pept        174679..174777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0161"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47475"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDS4"
FT                   /protein_id="ABI47475.1"
FT                   /translation="MRSLGVAYKGYGPNPDEIRIALLFLNRGLRLF"
FT   gene            174888..176024
FT                   /locus_tag="sync_0162"
FT   CDS_pept        174888..176024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0162"
FT                   /product="Chain length determinant protein family protein"
FT                   /note="identified by match to protein family HMM PF02706"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46678"
FT                   /db_xref="GOA:Q0IDS3"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDS3"
FT                   /protein_id="ABI46678.1"
FT                   /translation="MTNNNFESNALLFEDEFDLREVLAAFRRRWIWVAGGGLLGLLIAA
FT                   GVSMSRPPEKATKAIRMVVDTAQSPCTWTARKFQIFEVGEVVNIQCSGEFLTTLQVLSA
FT                   LATNEFGSDDSLSAKVQPLKFGGEKDKNLVNSNTQIELLVEVSPGKLDDAKAKLETIKD
FT                   VFSAQQLDNIGKLSTSAQAGNGWISIEDVPYNNHSKTKSSGSFALGLLGGLVAGSGAAL
FT                   IADRRSNRVFGHSRILSQLGYPLWLTLPTLPWSDPVEGSLIGQLAARLDRSLDWHVLSI
FT                   AREHEAVQPLAQALIRQNEVGLNCKSVDPLMNAIIRPGSDARPIGLLVVVESGFNSSQA
FT                   LEDARLLLSQLSCVQSIGIVLAGVPLPSELIVGEKASS"
FT   gene            complement(176150..176392)
FT                   /locus_tag="sync_0163"
FT   CDS_pept        complement(176150..176392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0163"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45406"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDS2"
FT                   /protein_id="ABI45406.1"
FT                   /translation="MRTTLELPDPLFALLKSRAEGEQITLKQHLQSYVEQGLMAPTHSA
FT                   RPTARSARQLPMVEGRLAFDFSTPSNVDLFDLHEP"
FT   gene            176414..176560
FT                   /locus_tag="sync_0164"
FT   CDS_pept        176414..176560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0164"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47282"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDS1"
FT                   /protein_id="ABI47282.1"
FT                   /translation="MRSNDLAADIRWQQRFVNYKRALEQLERFFEPPALNEREQQGLIK
FT                   AFE"
FT   gene            176597..176842
FT                   /locus_tag="sync_0165"
FT   CDS_pept        176597..176842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0165"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45047"
FT                   /db_xref="InterPro:IPR010235"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDS0"
FT                   /protein_id="ABI45047.1"
FT                   /translation="MRSQGNESLLGSRDTLREAFRLELIQNGESWMLMIQDRNLTSHTY
FT                   NRATADAIAANIQQHYLSCFQSLRTRLQIRLEQEAR"
FT   gene            176842..177183
FT                   /locus_tag="sync_0166"
FT   CDS_pept        176842..177183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0166"
FT                   /product="nucleotidyltransferase domain protein"
FT                   /note="identified by match to protein family HMM PF01909"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45659"
FT                   /db_xref="GOA:Q0IDR9"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDR9"
FT                   /protein_id="ABI45659.1"
FT                   /translation="MDATSSEKAQTVVIPGISGPQQQRLLDVLIKQADVDAMWLFGSRA
FT                   MGQERPGSDIDLCVDAARLTHLERLRLMADIDELLLPWTVDLALRHELPPDLVSHVERV
FT                   GRCLWTRTK"
FT   gene            complement(177275..177433)
FT                   /locus_tag="sync_0167"
FT   CDS_pept        complement(177275..177433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0167"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46299"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDR8"
FT                   /protein_id="ABI46299.1"
FT                   /translation="MRQVNQRLALVSSMKRCFKANPFPEPKQPGRCPAVLNAGATTQED
FT                   STAKGAG"
FT   gene            177551..177757
FT                   /locus_tag="sync_0168"
FT   CDS_pept        177551..177757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0168"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46680"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDR7"
FT                   /protein_id="ABI46680.1"
FT                   /translation="MTSVYIAKSFNYWRESDGQFLGYLNAYPDHWTQGEDLEDLKVKLL
FT                   DLYHEFFKQDLPGIRKVGELVVA"
FT   gene            complement(178589..179719)
FT                   /locus_tag="sync_0169"
FT   CDS_pept        complement(178589..179719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0169"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="identified by match to protein family HMM PF02350"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47482"
FT                   /db_xref="GOA:Q0IDR6"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR020004"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDR6"
FT                   /protein_id="ABI47482.1"
FT                   /translation="MNIHYVTGSRADFGLMSACLTSIQCSSSHNIGLVVTGQHTIAEYG
FT                   STEQDVYNSGLSIVARIPVFLQGKSGLEMAKAFSTQLSGFLDFWTVSRPDLILVLGDRG
FT                   EMLAASIAGVHLGIHIAHIHGGELSGTLDESFRHAISKLVHFHFAASEDSANRLKKLGE
FT                   NPKNIYILGAPGLVGLMPSGPRELVSPKIRANYKLYGNKVALLIFHPVVQESHLGQTHI
FT                   KTIVESLLERKISTLILRPNSDAGGCEISHYLDQLNYPGLVTVISHLARSEFIECLSGV
FT                   DFIIGNSSSGIIESASLGLPCINLGSRQSNRLRNSNTIDCEEITKSNVLKAIDDMGDAK
FT                   CDFSNSYGDGKADIRIVEILDKLDMNPSLLSKLNTF"
FT   gene            complement(179716..180408)
FT                   /gene="neuA-1"
FT                   /locus_tag="sync_0170"
FT   CDS_pept        complement(179716..180408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="neuA-1"
FT                   /locus_tag="sync_0170"
FT                   /product="CMP-N-acetylneuraminic acid synthetase"
FT                   /EC_number="2.7.7.43"
FT                   /note="identified by match to protein family HMM PF02348"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45735"
FT                   /db_xref="GOA:Q0IDR5"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDR5"
FT                   /protein_id="ABI45735.1"
FT                   /translation="MIDLAIIPARAGSKGLPGKNSADLGGYPLIAWTIRSAISANLFKR
FT                   VVVTTDSQHLADLSCKYGAEVPFLRPNDLATSEASSASVIYHCLDQTGCSGTFAFLQPT
FT                   SPFRNKDHIISAYKQFKSISPASSLISTVAGKPYQWCLESSPDQIVRPVTNSYALVSQR
FT                   QSTKPSIWPNGAIYLSDANLFRASGSFLSSHTQGFEMSEIDSIDIDYMDQLNVARAIVS
FT                   YGLRSIDK"
FT   gene            complement(180405..181898)
FT                   /gene="mviN-1"
FT                   /locus_tag="sync_0171"
FT   CDS_pept        complement(180405..181898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN-1"
FT                   /locus_tag="sync_0171"
FT                   /product="integral membrane protein MviN"
FT                   /note="identified by match to protein family HMM PF03023"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46215"
FT                   /db_xref="GOA:Q0IDR4"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDR4"
FT                   /protein_id="ABI46215.1"
FT                   /translation="MSVLSSFYLVSILLLLGRVSGFFRDWLIAYVAGAGINSDLAVVLI
FT                   TLPDLVVNLVVGGGISASLVPKYQSIGESQSSALYLSLLKSFFIGFSIIACIISVLSPS
FT                   LISFLAPSAFRMGVDNVYLYLFALSTLAIPLTALSGLNQSLLVSKRQFLFSQPGNLIFN
FT                   LSIIACVFIGLRAQFLPSVVTGILLGSLIRLGWQYIGIIRQWTLPSKNKVRKGVSIGKS
FT                   LFATTVFAGIFSFLPVIGRSYSSSLYPGALSLFNYAFRLTEIPIALVFASLSTVYLPRL
FT                   SREYNEDITSCRKSIEDLVRFSLLISLFLCLPILLLSDQILSTVFAGGALETYQVQIVS
FT                   SLIIVFIFTIPFRGLTVLSLPLLSTTKKHGLLLAVSILTAAFSIPLMNISTRMYGLVGT
FT                   CASLGFAYIMPSVILFFSIARSLKFSLFQRVFRKPIQTFLVPSIASMLSCKLCISMFSH
FT                   QLLWIPSYILSIAVFIACLALEPSLRQDYSKLVLGLFRK"
FT   gene            complement(181940..182575)
FT                   /gene="hisH-1"
FT                   /locus_tag="sync_0172"
FT   CDS_pept        complement(181940..182575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH-1"
FT                   /locus_tag="sync_0172"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /EC_number="2.4.2.-"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF07685; match to protein
FT                   family HMM TIGR01855"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47087"
FT                   /db_xref="GOA:Q0IDR3"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDR3"
FT                   /protein_id="ABI47087.1"
FT                   /translation="MKPSTCVVIDYGLGNIFSVLNALKAQGVDACLTSDRHLIQSADRV
FT                   ILPGVGAFGRAAQRLRELHLDEALKCFTGTGRPFLGICVGMQLLMTTSREFGEHDGLNL
FT                   IPGVVARISEHMNADNSMRIPIIGWHKVTGHKANLNSLAQNLDGSAYYFVHSYACQPLD
FT                   TSVVTSTVSHSETVVVSSIQHENIMGVQFHPERSSFAGQSLLSKFLSL"
FT   gene            complement(182572..183201)
FT                   /locus_tag="sync_0173"
FT   CDS_pept        complement(182572..183201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0173"
FT                   /product="pilin glycosylation protein PglB NMB1820"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47668"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDR2"
FT                   /protein_id="ABI47668.1"
FT                   /translation="MKTSSKHNLCLFGAGGHGRVLAAQIERFLHASVVFCDRSLYGQSV
FT                   AGIHVLYKEAADIDSERICISIGDNSLREELHNLLLPKISPPIIINSDYNFAASIGAGS
FT                   QILAGSVINTMSVIGSSVIVNTNAVVEHDCTVGDFCHIAPGALLGGGVSLGSSVFVGTG
FT                   AVILPGLHVQSGTIIGAGSVVTKDILDPGIWVGSPARPHLKNSQRL"
FT   gene            complement(183185..184228)
FT                   /locus_tag="sync_0174"
FT   CDS_pept        complement(183185..184228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0174"
FT                   /product="N-acetylneuraminic acid condensing enzyme"
FT                   /EC_number="4.1.3.-"
FT                   /note="identified by match to protein family HMM PF01354;
FT                   match to protein family HMM PF03102"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46784"
FT                   /db_xref="GOA:Q0IDR1"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDR1"
FT                   /protein_id="ABI46784.1"
FT                   /translation="MPPSILFNSRRISSIDPTYIVAEIGVNHNGNISLAHKLIDSAKDA
FT                   GADAVKFQTYVTDELVIRNTRTAKYQKENALFDDQYTMLEKYELSFESFHELYRHCAAA
FT                   GIDFLSTPFDPVSLRFIANLKPVAIKWASGELTNKMLLDQAAKTRLPIILSTGMSRIND
FT                   VDDAITWIGRNTPLVVLQCVSNYPAAMSDQNLRVLPFLENRYQCPVGFSDHTQGFQCAI
FT                   AAKGLGMSVLEKHFTLDRNLDGPDHKASVDFTGLKELVSEVRSIEVALGNGVKLPAPSE
FT                   LDAKTVARKSLFYARSLKAGHIITKNDLAAKRPSFGIPPSEYEAFLGKQLKIDSVKDVA
FT                   LSYEDFE"
FT   gene            complement(184234..185064)
FT                   /locus_tag="sync_0175"
FT   CDS_pept        complement(184234..185064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0175"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45832"
FT                   /db_xref="GOA:Q0IDR0"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDR0"
FT                   /protein_id="ABI45832.1"
FT                   /translation="MNMLFYFMPPSVEIAKVVAQDPDVILFVDLESLGKQKRQGHLKTW
FT                   KSKHSITHVNDIREACPDTELLVRIDPLNINSQEQVDNVIRGGANAIMLPMFHDIDEVK
FT                   AIVELVNGRTRLVPLFETISSLKILEDAIRLYDIKDLHFGLNDLSLDLGYNFLFEVISN
FT                   GILEESCSFLRSNGIDFGIGGVARSQEGVISPEYLLGEHVRLGSTRVILSQTFHRNPKD
FT                   LNAMADDMNFSEELSKLKKIYSNFSKCSDAELKTNQLMTNSRIKDVSNLIHKSK"
FT   gene            complement(185061..185828)
FT                   /locus_tag="sync_0176"
FT   CDS_pept        complement(185061..185828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0176"
FT                   /product="Imidazole glycerol phosphate synthase subunit
FT                   hisF"
FT                   /EC_number="4.1.3.-"
FT                   /note="identified by match to protein family HMM PF00977"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45117"
FT                   /db_xref="GOA:Q0IDQ9"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDQ9"
FT                   /protein_id="ABI45117.1"
FT                   /translation="MRNLRIIPRLDIKSGTLIKGVQMEGWRKVGDPILAAKRYSEYGAD
FT                   ELLFMDVVASLYERNTLHEIVEQVCSNVFIPVTVGGGIRKIKDVETLLSRGADKVSVNT
FT                   GALLKPELINEISDRYGSQATVLTVECLKCGEKSWEALTDNGRNRSGREVIEWVKEAEN
FT                   RGAGEIVLTSIDQDGRGYGFDIDLVDIVSQAVNIPIIASGGFGKPSHIVELIKSTDVSG
FT                   AAIAQALHWEKVSFSEIRDSLRDNNVFLRDIEE"
FT   gene            complement(185821..187149)
FT                   /locus_tag="sync_0177"
FT   CDS_pept        complement(185821..187149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0177"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47750"
FT                   /db_xref="InterPro:IPR020022"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDQ8"
FT                   /protein_id="ABI47750.1"
FT                   /translation="MEIKRSALSDTINLELYSPTANHNSVMPKYGLPSEVRFCSRCCIS
FT                   NQRPSSAVEFKHTKESRKKTIAFDINNVCDACLTAERKSKEIDWERRESELKALCDKYR
FT                   SQNGSYDCLVPGSGGKDSFYQSWVLKYKYGMNPLTVTWAPNIYTDWGYHNFQCWIHSGM
FT                   DNYTMTTSGRSKRLLTRLAVENIFHPFQPFILGQKCFAPKMAALFKIPLIFYGENEAEY
FT                   GNPIEDNADAQRSFEYFSSNSEDELFIGGESIKSLKENFGLTSADLQPFLPSSMQPLKD
FT                   IGAEVHYLGYYLKWHPQSAYYFAVENGGFKASPERTAGTYSKYNSIDDKIDDFHYYTTY
FT                   VKFGIGRATYDASQEVRSGDLERDEALALIKRYDGEFPERWSSEIFDYLSIDEDSFPKA
FT                   SKMFEHPLMNREYFEALSNRFRSPHLWQYSGGTWSLRKQSFNA"
FT   gene            complement(187219..189033)
FT                   /gene="asnB"
FT                   /locus_tag="sync_0178"
FT   CDS_pept        complement(187219..189033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="sync_0178"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF00733; match to protein
FT                   family HMM TIGR01536"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46358"
FT                   /db_xref="GOA:Q0IDQ7"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDQ7"
FT                   /protein_id="ABI46358.1"
FT                   /translation="MCGIFGGFSFEASAFSGELPVMMAKSILHRGPDNTGYWSNEEALL
FT                   GNCRLSIIDLSKNGNQPFYSKNKDIVVVQNGEIYNYIELRDLLIGEGACFQSDSDTEVV
FT                   LHAYAIWGPDFVSRLNGMFSIAIYDSRVSTAVLRLYRDRLGVKPLYYCIDGGCLWFGSE
FT                   IKAILAAGVKANPNYNALRSYFALNYIPPPQTAFANIYHLQPGHSAAITKSGVKLNRYW
FT                   DCNDIGLNEDITTAEAKSGIITLLDDAVRIRLRSDAPFGAFLSGGLDSSSVVGLMSLYK
FT                   ESPTKTFSIGFEDARYDETSYAEMASKRFGTYHSTKIMSENALDIWSKFIWHCDQPHGD
FT                   ISFIPTYQVSENASQEVKMVLTGDGGDELFAGYDKYASFFSGECDRSHPRWFSDYAQFT
FT                   GLIEADMAKRLFKGEIKASFEENDPYAPITESMLRFGQDDHINKVLYADTVNLLPGNNL
FT                   VKPDRMAMAHSLEVRSPFLDYRLVEYAFSLPGKMKLKGTETKYIYKMAVEELLGETLTW
FT                   RKKQMFTVPVGDWFRGHLADFCSRILLDNRSLSRGLYAESVLREVIEDHTSARKNYTRL
FT                   LRALISLEIWFRLFIDQDMSNLELITSK"
FT   gene            complement(189033..190526)
FT                   /locus_tag="sync_0179"
FT   CDS_pept        complement(189033..190526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0179"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01041"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45414"
FT                   /db_xref="GOA:Q0IDQ6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDQ6"
FT                   /protein_id="ABI45414.1"
FT                   /translation="MIKQKINTTNTCQEFDSLRAALVKLEASKVKLIVVIGEHGQIVRT
FT                   VSDGDIRRALISGMSLDDSVSKLPTRNPVVCQEDSDESEVVAAMNNNSVNTIIQVDSKD
FT                   LPVFLINKKDLEGSILLSSPHLGESETNYVQDAIDSNWIAPIGPYLNRFEQDLSAICDR
FT                   SHAIAVASGTAGLHLAIRALMIKQDKRIYVSDLTFIGSVQPILIEKHEPVFIDCEPGTW
FT                   NMSTKALERQLKLDKDRNRLPGAIIVVHLYGQPANILEICKIANAYDVPIIEDAAESLG
FT                   ATVNGEASGCHGLISVYSFNGNKIITTSSGGAVVTNCPKIASKIRYLATQGRDNCLHYQ
FT                   HSSIAYNYRMSNVLAALGVGQLEVLKDRVKARRNIFSRYVQSLTRVPGISFQQEVPDTL
FT                   GNRWITAIEIEPRSENLHPFAIMKILKSEGIDARPGWKPMHMQPICYGYDYIPHDEQTS
FT                   YSERHFMRSICLPSGSNMPSRSQDRVISAILQILTKETN"
FT   gene            complement(190550..191539)
FT                   /locus_tag="sync_0180"
FT   CDS_pept        complement(190550..191539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0180"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47679"
FT                   /db_xref="GOA:Q0IDQ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDQ5"
FT                   /protein_id="ABI47679.1"
FT                   /translation="MIALAFINATRIRSGYFDLNEINLQDGAFIQIKQTFEFIQSGGAV
FT                   TRALENPIFVTHLVRVAIFIPFSYLGSLGHGQGLEYVLLILISLPVVMRYYKRSNDIIY
FT                   LAPLVLPFLISYRSFLAALAIGYVVIAITSKGNILFLLFGVTLSLLSTAVMVQSSLLIL
FT                   IYRKKISCLLRNNPVAIVPLIAFLGITLLVTLVKIQGFVGGLDGYTSEYGSDGIQSAIT
FT                   RSTLVIGLAKGSLRGYLSLAIALLLIISLVRLGNSRNKELKTYFRILSCLAPGLLFEGL
FT                   GIVSILFPILWMVRGVHLIELGEFNRGYIRKSVKSCKATYTRDDCTSV"
FT   gene            complement(191581..192642)
FT                   /locus_tag="sync_0181"
FT   CDS_pept        complement(191581..192642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0181"
FT                   /product="NeuB family protein"
FT                   /note="identified by match to protein family HMM PF01354;
FT                   match to protein family HMM PF03102"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47387"
FT                   /db_xref="GOA:Q0IDQ4"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDQ4"
FT                   /protein_id="ABI47387.1"
FT                   /translation="MSLRDICIGTQVLGEGHLPIILPDIDMFFNGDLEIARGLIESVSK
FT                   SGLRTIKTAILEDPMVVFDTPAEERYLCRDGSYKSVNYRSLIQKKVMTLDQHRELFNLI
FT                   KSYGLNFIVSVYTLESVDFAVSEGAIAIKIASSNINFLPLIEKSARTGLPLLIDTGKST
FT                   LCEIFEARHAAYSANQDVKLIFEHSPAAPPAPIERQDLSFMNYLSNLLGEHAGLSHHSD
FT                   DLLMIIASVAIGAKVIEFGLCRDNEADDQDVFHAVKEGQLMQLVENINRVNIALGDPYS
FT                   RIDNEVMPNNGRMSLRAKQGLIAGTRMNLENVSFSFPPIGIPANEWARVQGKILKRNVQ
FT                   AGMPICNNDVEYE"
FT   gene            complement(192639..193391)
FT                   /gene="neuA-2"
FT                   /locus_tag="sync_0182"
FT   CDS_pept        complement(192639..193391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="neuA-2"
FT                   /locus_tag="sync_0182"
FT                   /product="Posttranslational flagellin modification protein
FT                   B"
FT                   /EC_number="2.7.7.43"
FT                   /note="identified by match to protein family HMM PF02348"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46379"
FT                   /db_xref="GOA:Q0IDQ3"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDQ3"
FT                   /protein_id="ABI46379.1"
FT                   /translation="MKRICTICARAGSKRLANKNIAPLNGHPLIAYAIAAAHESKLFRK
FT                   IVVTSDSREYLEIASRYGNIACVYRNAELSNSAISKTRAIYDAVLKCEQCEGIQYDTIV
FT                   DLDVTAPLRAAADVIAAVKALEKDKFAESLVSVTESKVTPFSNLFYVDQQGFLMPMLSP
FT                   EEVNEHTGSTKMCFALNAAIYAWKRDSFMEHPRTFTKKTLAFIMAEYTRFDIDGPIDLE
FT                   FVEFLILKMPNRFVRPMQIKLQGEKDRE"
FT   gene            complement(193400..193954)
FT                   /locus_tag="sync_0183"
FT   CDS_pept        complement(193400..193954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0183"
FT                   /product="undecaprenyl-phosphate glucosephosphotransferase"
FT                   /EC_number="2.7.-.-"
FT                   /note="identified by match to protein family HMM PF02397"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47167"
FT                   /db_xref="GOA:Q0IDQ2"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDQ2"
FT                   /protein_id="ABI47167.1"
FT                   /translation="MIRIADLVLSLILLMVAIPLLAVATFLISVESRGWPVFSQVRIGK
FT                   YGKEFIIYKLRTMYVNASKDGNFATKKGDKRITRVGGFLRATSIDELPQLINVIRGDMS
FT                   FVGPRPDVPTQKEMYTEREFIFRHSVQPGITGLAQIRGRSGATHEIRLKNDCEWVEKRS
FT                   FTLYLKILMITVYSVLTKLAH"
FT   gene            complement(193951..195183)
FT                   /locus_tag="sync_0184"
FT   CDS_pept        complement(193951..195183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0184"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDQ1"
FT                   /protein_id="ABI45710.1"
FT                   /translation="MKSKKVLFVAYGAAHIRSVLPIAKYLDENKNWNINPVVLALTTGY
FT                   RESLASGVETIGYKDLGVMTIEELDAGKRLVEKGNFGYSVSEEESIAYLGKNYYDLVKQ
FT                   YGKVDAASMYRQRGRSCFFPINTALIALEELMVDMVISTNAPRSEKAFLDAARRLGIPS
FT                   IVIWSSLAKHEIEWVGKESFTDYVCVDSKYSYNKMLEAGRPKEEIRITGNPQFEQLLKP
FT                   RRKNEIEKLRKRKGWGPNDRVLLFAQQNEPDEHPFTGKAGDPQLPRRLNKMLIDSMKRC
FT                   AESVKLCIRYHPNQEIIVEDEIEGLSFSDQHEDLSDLLYSVDGVFTCSSSVGYQAILLG
FT                   KPVVQGMFSMFSSDVDFKMIGNSMTINAENELDHMWYCIANDCLPKPLRNESITESPVR
FT                   SIVELIAVNFQ"
FT   gene            complement(195173..196126)
FT                   /locus_tag="sync_0185"
FT   CDS_pept        complement(195173..196126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0185"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47794"
FT                   /db_xref="GOA:Q0IDQ0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDQ0"
FT                   /protein_id="ABI47794.1"
FT                   /translation="MEIGALVVGFGSIGRKHARLLKEVGARVSVVTRSCREVERDSAYT
FT                   YFESIGDVNMKEIRYIVIAVETSRHIECMLNALRLNKRARIMVEKPLAAESKQLVDLGL
FT                   TIEDKERVFIGFNLRYLPVVKKSKELCKQQDKKFTRAEFFSHSYLPHWRDIDYRKSSSA
FT                   RWSTGGGVLRDLSHELDLMQWLCGTPHKLNIYGGHLSNLECEVEDTIYIVGSCKQAGLV
FT                   SIGLSYTQHFETRGFSLISNNETLVTDLMSGKIIKSSSNGTELIECPCEDFDDTYRKMH
FT                   RDIIQEGGGECARYIDGQLNIKCIEDLDRELGMHEK"
FT   gene            complement(196147..198279)
FT                   /locus_tag="sync_0186"
FT   CDS_pept        complement(196147..198279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0186"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45968"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDP9"
FT                   /protein_id="ABI45968.1"
FT                   /translation="MVKQENSKRKIAKLALACSSPGGAALIKETIGYLAKKRDIEIEVV
FT                   MVEEPAWRILENVCKLNNIRAAISTNARYTKHESDKKQEYMKWVLETIGDAQIDAVITG
FT                   LSGLDMGVDETLQLIGSRQRKIRYTLQDTPGWVVDGIAGPSPTYFVQIAGKEKEMTEKG
FT                   VHRSICVGELKMKEMKYKAERLLKKVGQNEITTNRVLFIGQPLWQLQGYRKTLEKLHSV
FT                   VADLGKDGIDYVSHPLEGKEQAIASGLVKVTSRGLLELVLEYKYIVTCFSTGLKEAAMI
FT                   NMAAKRKLPRLIYAIGEKDVRASYVENGQSISELVKDSWFAEVIDRELTLGDFKTEIWG
FT                   NKTIEFSEPKTEEIYKTIVRDYKKRLFLPKNYAADSQLDTSRRQLGSSHSWAEEIREAL
FT                   RKCGLGEANSEIRRLSTLHDESETVYIRGNTKESGNIFIKLIDTREVEQTKNALLMVQE
FT                   IGEGCAQVETVLTKDPVYIETKNKYMAVTQWIDSTEIDCEDEDNLKKIGSALGLLHKRM
FT                   KTLVFKRELAIERQRWIVDAWHEVAKTDLLEKKCSTLSKKIKEEISKRANRVSRETNKQ
FT                   FIHGDLNKGNILCTRQGGIIFIDFEEATSSWLPFYVDLAIVIERLCMLSGRNSIKRCRV
FT                   LLSEYFKVVEWRLPRVEALNDGRAYAIARSFGILSQSRLYGLDWPEYEWTKFCKLTKHM
FT                   IDEKKILRDLSVDFTN"
FT   gene            complement(198273..199076)
FT                   /locus_tag="sync_0187"
FT   CDS_pept        complement(198273..199076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0187"
FT                   /product="short chain dehydrogenase"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45352"
FT                   /db_xref="GOA:Q0IDP8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDP8"
FT                   /protein_id="ABI45352.1"
FT                   /translation="MADKRVLVTGAGGILGSRFADAVLSEGGKIVLAEVNSERLKEIHE
FT                   QMTARHKKENILAISCDCGNEEEVVRAFAKVEKDFGGVDVVINNATAPIKNPKEFFANL
FT                   TDFSLEEWRRQNSVNLDACFLVAREAVKSFLKKKDGSGGSLIQMSSVMGVMGHDKRIYK
FT                   NALYEGNAINTPVAYSTAKAGVLGLMRWIAVEYADKKIRSNAIAPGGIFSGQNDEFVDR
FT                   YSARVPMGRMGRDTEITGALLYLASDEASYMTGQCLLVDGGLGAW"
FT   gene            200038..200346
FT                   /locus_tag="sync_0188"
FT   CDS_pept        200038..200346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0188"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45364"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDP7"
FT                   /protein_id="ABI45364.1"
FT                   /translation="MSACPVLFSRVLDLKSKLRAGFQHCSASQLTPVCRNLKPFSSLHS
FT                   FVSLPFAVLLFSALGSGLDLWIPIPQLHCQLLDQPNARCCCCPPPPPPAEVRWTFRT"
FT   gene            200365..200559
FT                   /locus_tag="sync_0189"
FT   CDS_pept        200365..200559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0189"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46637"
FT                   /db_xref="GOA:Q0IDP6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDP6"
FT                   /protein_id="ABI46637.1"
FT                   /translation="MLWGVPAGVSFSGLTLLPLLTVVGFLDDRNKLSAGLRYGDQLATA
FT                   LFVFLVRPLMLPLLAPPLL"
FT   gene            200540..200671
FT                   /locus_tag="sync_0190"
FT   CDS_pept        200540..200671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0190"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46355"
FT                   /db_xref="GOA:Q0IDP5"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDP5"
FT                   /protein_id="ABI46355.1"
FT                   /translation="MRRPCFDRQGIIQAYVGFVVALIAQLSSYDHISIPAGINLQLQ"
FT   gene            complement(200868..200978)
FT                   /locus_tag="sync_0191"
FT   CDS_pept        complement(200868..200978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0191"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45947"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDP4"
FT                   /protein_id="ABI45947.1"
FT                   /translation="MGYGLRSRLRLAERWLRCDRIGGRTQHDYYDHLQNA"
FT   gene            201032..202978
FT                   /locus_tag="sync_0192"
FT   CDS_pept        201032..202978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0192"
FT                   /product="Putative nucleotide sugar epimerase/dehydratase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF02719; match to protein family HMM PF04321;
FT                   match to protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46597"
FT                   /db_xref="GOA:Q0IDP3"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDP3"
FT                   /protein_id="ABI46597.1"
FT                   /translation="MKFAELSRIYPVPVVNQVVRFPPRARRFLLMGIDALLLPLAVWLS
FT                   FWLRLAHPFHPVFMAAGSWLLMAVLLVGLPLYAFTGQYKGLTRYVGSADLYRLAGRNGL
FT                   LVLLLAGLGLMLGLPMPPRSSWILLWLLLTGFTGAVRFALRDLLLNLRSIHHKQQLRVA
FT                   IYGAGAAGAQLAAALRLAGNHRIITFLDDNPNYWSRSINGVGIQPPQVLKDLEDSVDQV
FT                   LLAIPSLPRSERRRIVDDLQRRGIGVLQVPSVDDLTSGHARIDALRPIAIEDLLGRDEV
FT                   PADPHLLGPGIRDAVVCVTGAGGSIGSELCRQILALSPARLVLLESSEPALYAIEQELC
FT                   SLVPGRTELKAVLGSATDTQLHRLFEDQSVELVFHAAAYKHVPLVEANPLAGLSNNVGS
FT                   TVQVCRAAMAVGVHQVVLISTDKAVRPTNVMGSSKRLAELVVQAHATEGSSTRFSMVRF
FT                   GNVLGSSGSVVPLFRRQIAAGGPITLTHPEIIRYFMTIPEAATLVLQSSVLAQGGDVFL
FT                   LDMGEPVRIKALAEQMVRLSGLSLRDAGHPDGDIEIICTGLRPGEKLYEELLIDAESQP
FT                   TAHPLIYRAEERSIPPHVLWPQLDALEAAIAAQDVEGALALLAQLVPEWQRGDGVNGAG
FT                   AAVAAAVENDLLA"
FT   gene            complement(202967..203140)
FT                   /locus_tag="sync_0193"
FT   CDS_pept        complement(202967..203140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0193"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45942"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDP2"
FT                   /protein_id="ABI45942.1"
FT                   /translation="MKQAIAAPNSSNVTRALKTASLGSATQTRPQRRTLRFKKGQLEQS
FT                   MHQGNDSPQLSQ"
FT   gene            203088..204842
FT                   /gene="citT-2"
FT                   /locus_tag="sync_0194"
FT   CDS_pept        203088..204842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citT-2"
FT                   /locus_tag="sync_0194"
FT                   /product="Di/tricarboxylate transporter"
FT                   /note="identified by match to protein family HMM PF02080"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47260"
FT                   /db_xref="GOA:Q0IDP1"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDP1"
FT                   /protein_id="ABI47260.1"
FT                   /translation="MSALVTLLLLGAAIACFIGGWLAPELVALLAAGLLMATGVLTPNE
FT                   ALAGFGSPALITLVGLFVLSNGLLHSGALDRLRELLASPRIRNPSQLMLVFGFVVAPIS
FT                   GFIPNTPIVAILLPVVQGWCQRRGISPSRVLMPLSFATLIGGTITLIGTSTSLLASDLV
FT                   TRLGYGSFELFSFTAIGIPVWLIGACYLVLAGRCLPDRGDQNDDNLQALSRDGYLTEVV
FT                   IPQRSPLCEVTLHESRLQRRFDVDVLDVHRDGQRLQPPLAQLRLQASDRLLLRCSRQEL
FT                   LRLQQDRMVDLAGTLLAEELPHIRHAEVLVPAGSLLAGATLRELRFRQRFNATVLAVNR
FT                   ANSTLRDRLGRVVLREGDMLLLQAPLDALRGLQQASDLVVLDQLDDDLPSTHRKGLAIS
FT                   VMLVVLLLAGFKVMPLVAAVLVGVGVLVIGNCLDAGTALRSIRWDLYLLLGGLYSFSVA
FT                   LQKTGLADQAASSLLTLLQHSSAYGALLVIYAITLVATELLSNAAAVALVLPIAAAVAT
FT                   GLGQPPMMFATAVVFAASQSFLSPIGYQTNLMVYAPGRYRFLDFFRFGWPLSLAYTLMV
FT                   PLLLLWFF"
FT   gene            complement(204839..205402)
FT                   /gene="rimM"
FT                   /locus_tag="sync_0195"
FT   CDS_pept        complement(204839..205402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="sync_0195"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="identified by match to protein family HMM PF01782;
FT                   match to protein family HMM PF05239; match to protein
FT                   family HMM TIGR02273"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45739"
FT                   /db_xref="GOA:Q0IDP0"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDP0"
FT                   /protein_id="ABI45739.1"
FT                   /translation="MTSTPSPSTADPNSTNDWLPVGTLVGAQGLKGELRLNPASDFPER
FT                   FTEPGTRWLQAKGSAPKEVELLEGRQLPGKSLYVVRLKGVNNRASAEALVGCTVLVPAK
FT                   DRPELAEGEFHLLDLVGLEARLAGSDEPIGTVSNLISGGNDLLEIKLNSGKTVLVPFVE
FT                   AIVPDVQLEEGWLLLTPPPGLLEL"
FT   gene            205439..205621
FT                   /locus_tag="sync_0196"
FT   CDS_pept        205439..205621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0196"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE22124.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45725"
FT                   /db_xref="GOA:Q0IDN9"
FT                   /db_xref="InterPro:IPR021659"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDN9"
FT                   /protein_id="ABI45725.1"
FT                   /translation="MASAAPILPGATVTVVDTRSIYAGYTGFVQRISGDRAAVLFEGGN
FT                   WDKLVTMRLSDLSAA"
FT   gene            205611..206435
FT                   /locus_tag="sync_0197"
FT   CDS_pept        205611..206435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0197"
FT                   /product="cation transporter, voltage-gated ion channel
FT                   (VIC) family protein"
FT                   /note="identified by match to protein family HMM PF00520;
FT                   match to protein family HMM PF07885"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46223"
FT                   /db_xref="GOA:Q0IDN8"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDN8"
FT                   /protein_id="ABI46223.1"
FT                   /translation="MPPDAMNLRLRFRRVVLDADTRAGRIYNLVIFGTILASVAGLLVE
FT                   PTPTWIAASDQAPDWTNVLERICLGVFIADFLLHLWVTPKPSNYLFSFYGLIDFSAVLF
FT                   FFIPQISSGLILWIFKFGRVLRVFKLLRFLDEAQLLGNALKASARRIGVFLFFVVMAQV
FT                   VLGYLMVLVESSHPQTQFQTVGQGVYWAIVTMTTVGYGDIVPQTVLGQLLAAGVMLLGF
FT                   GIIAIPTGIITVETMEQVRRGGRSCTSCGASAHHKKALRCDQCGSILPPLSA"
FT   gene            complement(206467..206841)
FT                   /locus_tag="sync_0198"
FT   CDS_pept        complement(206467..206841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0198"
FT                   /product="PIN domain, putative"
FT                   /note="identified by match to protein family HMM PF01850"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46877"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041705"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDN7"
FT                   /protein_id="ABI46877.1"
FT                   /translation="MRCLLDTQVMLWWLLDDPRLRAKSRELLASKPCLVSVASIWEVAI
FT                   KHRIGKLEVSPVVFRDQSIAAGADLLPVLDPHVIETAQLPLLHQDPFDRLLIAQARVEG
FT                   LMAVSSDGQWSGYDVSLHRL"
FT   gene            complement(206841..207083)
FT                   /locus_tag="sync_0199"
FT   CDS_pept        complement(206841..207083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0199"
FT                   /product="prevent-host-death family protein subfamily,
FT                   putative"
FT                   /note="identified by match to protein family HMM TIGR01552"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47678"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDN6"
FT                   /protein_id="ABI47678.1"
FT                   /translation="MLVNMLDAKSQLSRLVKAALAGEEVIIASHGKAQVKLVPCAAATG
FT                   LKEPGSLSALSLQASHVDEAFGEAVDQQVAQLFNG"
FT   gene            complement(207157..207921)
FT                   /gene="rnc"
FT                   /locus_tag="sync_0200"
FT   CDS_pept        complement(207157..207921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="sync_0200"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="identified by match to protein family HMM PF00035;
FT                   match to protein family HMM PF00636"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45604"
FT                   /db_xref="GOA:Q0IDN5"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDN5"
FT                   /protein_id="ABI45604.1"
FT                   /translation="MITRQREQQLQELWRQLVPDSSTANNNDLNREQLEHLNEALTHTS
FT                   TGLARHHEQLEFLGDAVLRLAASDFIESEHPQMPVGERSALRAQLVSDRWLAELGTTIG
FT                   IEVLLQVGSKASGDQAARSTLRAEHCEALIGAIYRISGKVSPVQCWLTPYWRETSRDVL
FT                   ADPHRGNSKSALQEWTQAQGLGLPIYECHEVNKRHGDPRRFHCQVFIQDQNSPTAEAWG
FT                   GSRRQAEQQAAKAAMQQTTFASVPSSSQTQNS"
FT   gene            208369..208442
FT                   /locus_tag="sync_0201"
FT   tRNA            208369..208442
FT                   /locus_tag="sync_0201"
FT                   /product="tRNA-Arg"
FT   gene            complement(208476..208859)
FT                   /gene="mscL"
FT                   /locus_tag="sync_0202"
FT   CDS_pept        complement(208476..208859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="sync_0202"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01741;
FT                   match to protein family HMM TIGR00220"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47563"
FT                   /db_xref="GOA:Q0IDN4"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDN4"
FT                   /protein_id="ABI47563.1"
FT                   /translation="MTRKPGLFADFKAFINKGNVVDLAIAVVIAGAFGKVVATVVTLVM
FT                   TNALEPALKAANVDSINSWPAGTVIVAIINFLVIAFVCFLIVKSIEASKRKQEVIAETK
FT                   PDPQAQLASAMTRLTDALERKGF"
FT   gene            209002..209343
FT                   /locus_tag="sync_0203"
FT   CDS_pept        209002..209343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE22122.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47757"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDN3"
FT                   /protein_id="ABI47757.1"
FT                   /translation="MTQLHELRLRLLVQQESELIAASQPTDLDLSVVQARCLCWLALLA
FT                   EAHEDQASDAESRGDTEQAMGWFADSMRLRDALNVVSSIEIPLPGVVDRDGDQLGDWSG
FT                   IDQEPPLAA"
FT   gene            209383..209838
FT                   /locus_tag="sync_0204"
FT   CDS_pept        209383..209838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE22121.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45175"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDN2"
FT                   /protein_id="ABI45175.1"
FT                   /translation="MPDEPCQCPDCQRFYREHDRLIRESPTLRQQQELSWAALQAFRTL
FT                   SGRVLEDLQKEHGTPSADSQTHATPIGGGEEPADAIHQAMADLENINAHLFSIEALMER
FT                   IFDVRVPDDIEQKFRELAGELAPDPLNADRLRLNRLLHQTPDLPDRG"
FT   gene            complement(209895..212570)
FT                   /locus_tag="sync_0205"
FT   CDS_pept        complement(209895..212570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0205"
FT                   /product="phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="identified by match to protein family HMM PF00343;
FT                   match to protein family HMM TIGR02093"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46130"
FT                   /db_xref="GOA:Q0IDN1"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDN1"
FT                   /protein_id="ABI46130.1"
FT                   /translation="MATKGEAPHASFCLTVEAEASVTVRPPFQAFFVQYHHTERKTKSN
FT                   RHIPPSMSSSEPLDLRLPTPGCYADPERAGFDADAVFDGMTEHLFFTLGKLAPSASRHD
FT                   LYMALSYAVRDRLMTRYLASLEAIRARPQKTVAYLSAEFLIGPQLANNLLNLGIQNEAE
FT                   EAVKRFGIESLQQIIEVEEEPGLGNGGLGRLAACYMESLASLQIPATGYGIRYEFGIFD
FT                   QLIRDGWQVEVTDKWLKGGWPWELPQPDQACFVGFGGRTESYLDDKGNYRSRWIPSDHA
FT                   IGVPHDVPVLGYRVNTCDRLRLWRADATESFDFYAFNIGDYYGAVEEKVGSETLSKVLY
FT                   PNDGTDEGRRLRLKQQHFFVSCSLQDMLRSLDNRGLSIDDFPEFWTVQLNDTHPAIAVA
FT                   ELMRLLIDDRHMEWDKAWDITRRSVAYTNHTLLPEALEKWDLNLFGSLLPRHLELIYEI
FT                   NRRFLQQVRLRYPGNEAIQRKLSIIDEEGGKSIRMAHLATIGAHHVNGVAALHSDLVRE
FT                   QLMPEFAELWPEKFTNVTNGVTPRRWVALSNPGLSSLLDEHVGPDWVTNMEILRKLEDR
FT                   QNDTGFLNHWEDTKLCVKRKLSTYIHRNTGVLVDPSSLFDVQVKRIHEYKRQHLNALQV
FT                   ITQYLRIKNGQADGLAPRTVIFGGKAAPGYYMAKLIIRFINGIAETINADPDMDGRLRV
FT                   VFLADYNVKLGEQVYPASDLSEQISTAGKEASGTGNMKFAMNGALTIGTLDGANVEIRE
FT                   HVGAENFFLFGKTVEEISALKQSGYRPWEVVESVPELAEAIRLVEMGHFSNGDGELFRP
FT                   LIDNLTGNDPFFVMADFADYLRAQDAVSLAWTDRQHWNRMSVLNSARSGFFSSDRSIRD
FT                   YCRDIWKVEAMPVEITCDVR"
FT   gene            212638..214044
FT                   /locus_tag="sync_0206"
FT   CDS_pept        212638..214044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0206"
FT                   /product="transporter, monovalent cation:proton
FT                   antiporter-2 (CPA2) family protein"
FT                   /note="identified by match to protein family HMM PF00999"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47199"
FT                   /db_xref="GOA:Q0IDN0"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDN0"
FT                   /protein_id="ABI47199.1"
FT                   /translation="MPIPMLAAAMPPLLTPLLAELSAHDFEMAETLIGVGRFMLIFVAA
FT                   RALAEVLVRLQLPTILGELLAGVLIGASGLHLLVPPETQVELSNGLITLLSSIGNVPPE
FT                   SVTDLYNESFPALEAVAQLGLFALLFLTGLESELDELIAVGTQAFTVAVAGVVLPFALG
FT                   TWGLMAIFHVDAIPAIFAGASMTATSIGITASVFGELGYLKTREGQIVIGAAVLDDILG
FT                   IVILAVVVALASGGSLEIGPIVKLVAAAAVFVVAAIGLSRSAAPAFDWLIDKLKAPGEV
FT                   LVASFVILALSCFTATAIGLEAALGAFAAGLILSGSKHNHAMQQAVLPIVTLFATIFFV
FT                   LVGAGMDLSVINPSDPGSRTALIIAAFLFVVAVIGKIAAGWAFVSKQPTRRLVVGLGMM
FT                   PRGEVGLIFLGLGTSAKLLSPSLEAAILLMVIGTTFLAPVLLRLVIGGDKPDDDDKVDG
FT                   EVAADPVGLI"
FT   gene            complement(214041..214385)
FT                   /locus_tag="sync_0207"
FT   CDS_pept        complement(214041..214385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47421"
FT                   /db_xref="GOA:Q0IDM9"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDM9"
FT                   /protein_id="ABI47421.1"
FT                   /translation="MLRSAGHFPTMDTYEMGPLLQSSTLSGGLFWALALYLPLSGPLQR
FT                   LETSLEDGPLSGAWRQAALVVSSLLLALAVGVITQLVLAWALGPGWASSLALIAIGWSL
FT                   FLVVARGQED"
FT   gene            214425..215348
FT                   /locus_tag="sync_0208"
FT   CDS_pept        214425..215348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0208"
FT                   /product="hydrolase, alpha/beta fold family protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47594"
FT                   /db_xref="GOA:Q0IDM8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDM8"
FT                   /protein_id="ABI47594.1"
FT                   /translation="MVSEPWWRFENHAVHGLCQMPEQPEAAAQAQARPAVLLVHGFGAS
FT                   TDHWRHNIPVLASQYEVHALDLLGFGRSAKPAGLTYGGALWRDQLVAYVQQRIGRPTVI
FT                   AGNSLGGFAALAAGAALKEQSAGVVLLNAAGPFSDEQRSKPSGWGAIARRTIASALLKS
FT                   PVLQRVLFENLRRPATIRRTLNQVYVDRTNVDDALVESIRLPSLDPGAFGVFRTVFDIP
FT                   SGQPLDELFDQLQSPLFLLWGIRDPWINAAGRRASFQRHAPENTHEVVLEAGHCPHDEV
FT                   PDQVNKALLDWLGSLQSQPTNTLQLD"
FT   gene            215406..216266
FT                   /locus_tag="sync_0209"
FT   CDS_pept        215406..216266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0209"
FT                   /product="Aldose 1-epimerase subfamily protein"
FT                   /note="identified by match to protein family HMM PF01263"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46808"
FT                   /db_xref="GOA:Q0IDM7"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDM7"
FT                   /protein_id="ABI46808.1"
FT                   /translation="MAMTLRQLSTPYAHWEYVHPQSGDRLRVVPERGGIVTEWLCNGRE
FT                   ILYFDQSRYADPTQSIRGGIPVLFPICGNLPGDRLPLKSGEATLKQHGFARGLPWQLEL
FT                   LDDQSGVRLCLTDTDETLAHYPFRFRLEMAVRPVSDALEITTTIANANEGGELMPFSFG
FT                   LHPYFNVTDLSRTSIEGLAPQCLNHLVMAEAETRDQLSRLPEGVDFLTRPAGPVTLVDE
FT                   AAGTRLQLQHQAPMDLTVVWTEPPRSMVCLEPWTGPRQSLITGDGKLELAPGDSLQLSC
FT                   RYALS"
FT   gene            complement(216241..217458)
FT                   /locus_tag="sync_0210"
FT   CDS_pept        complement(216241..217458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0210"
FT                   /product="glycolate oxidase chain"
FT                   /EC_number="1.1.3.15"
FT                   /note="identified by match to protein family HMM PF01565"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45833"
FT                   /db_xref="GOA:Q0IDM6"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDM6"
FT                   /protein_id="ABI45833.1"
FT                   /translation="MSSTAVLAPNSVEELGQLIADLHAEGRPWVPSGMGSRLHWGPPLA
FT                   ADSGPVVSMRHLSRIVDHAVDDLTITVDAGMPLADLQTALAEHQQWLPLNWPWGSNMAS
FT                   PQSAGSIGGLVARGLSGGLRQRHLGVRDQIIGISLIRSDGVSARAGGRVVKNVAGYDLM
FT                   RLLCGSWGSLALITGLTLRVQPIREPRGQLVLEGELNQLEAFRAEVVGSSFTPERIDWE
FT                   LRPDQGPRILLGVASISDGAVVDQLNRLETIAAKQGVSSERMLWENLIPEGSATSEDPP
FT                   WLLRLCLPPAELQHLFSSRECTALTGWHWQLAAGAGSGEAWQHSGAPTPEYLIEALRRR
FT                   VIALGGQLSVLIQPGAQPGALPAWLDAPSRPLIEAVKRQFDPKQQLSRGRLPGVAAPLN
FT                   SAHSGN"
FT   gene            217515..218915
FT                   /locus_tag="sync_0211"
FT   CDS_pept        217515..218915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0211"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46956"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDM5"
FT                   /protein_id="ABI46956.1"
FT                   /translation="MKIVVIDDDPTGSQTVHSCPLLLRWDQAALRRGLRHPSPLMFVLA
FT                   NTRALTPEAAASRNREIVDALVLAMAAEDLQEHELLLVSRGDSTLRGHGVLEPQVLAQA
FT                   WEGHFGVAVDATLHVPAFFEGGRTTVNGVHRLHGQPVHTTAFALDRLFGYGTSDLAEWL
FT                   EEKSAGQIAANSVLRIPLELLEPERSADLLTRLETLEANSPVVVDATRPEQLLSLGVAI
FT                   RRLQGRKRFLFRSAASLLNGLVDSGPSPLGPQLLDAQGLVSLHRRDLHGQPLPGLVVVG
FT                   SHVSLADQQLKSLLANEGCRGIELPVARIARVLEGGSPDLLLPDLEAEWRSQLEQALEE
FT                   GLTPVLFSSRGELLFGAGAAAAARRLRFGMELASLMARMLAAVAPRLGYLISKGGITTG
FT                   TLLVEGLGLEAVQLEGQLLPGLSLVRAMETATEMTEQIRALPVITFPGNLGTEHSLKDV
FT                   WQMFAGEA"
FT   gene            complement(218912..219451)
FT                   /locus_tag="sync_0212"
FT   CDS_pept        complement(218912..219451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0212"
FT                   /product="glyoxalase family protein family"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46659"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDM4"
FT                   /protein_id="ABI46659.1"
FT                   /translation="MNSFLASSRPSHFGLYVHDLELMEDFYVKKLGFCITDSWEFQGSR
FT                   MLFLSKDPKEHHQIVLATGRQMETPSQFNQISFEVSSLQDLHENYSAIQAIAPGDVVAM
FT                   NHGGSWSVYFSDPESNPIEFFAYTQTYAPPIATIPMDMEQPFETLMAETDALVHQFPES
FT                   ESWQQWRDRFSKTMAG"
FT   gene            complement(219448..220827)
FT                   /locus_tag="sync_0213"
FT   CDS_pept        complement(219448..220827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0213"
FT                   /product="Fe-S oxidoreductase"
FT                   /EC_number="1.1.3.15"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF02754"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45719"
FT                   /db_xref="GOA:Q0IDM3"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDM3"
FT                   /protein_id="ABI45719.1"
FT                   /translation="MASLTPSSSASEHQQADSGQNRPMAFVDPSDPCVHCGFCLPTCAS
FT                   YRVLGTEMDSPRGRIHTLKAIEAGELELDATVASHFDSCLGCFACVSACPSGVRYDQLI
FT                   EATRPKLNQPELRSSWQTSFRQLLLLVLPYPNRLRALLQPLRAYAGTGLQRFTRRSGLL
FT                   KLLGPQLEAMESLLPALPAEGFSDRLPRVNPAQGEQRGRVGLVLGCVQRCFDPGVNEAT
FT                   VAVLQANGFEVVIPADQGCCGAVSHHQGQLQQTQELASALVRSFRDEDLDAVLVAASGC
FT                   GHTMKAYGELLDGEDNFSAPVLDVHEFLANRGLSESFRQALTPLPCTVAYHDACHMIHG
FT                   QGIAAQPRDLLRSIPQLQLKEATEAGVCCGSAGIYNLVQPDEAAELGQLKANDLTSTGA
FT                   EIVASANIGCSLQLRRHLRSEGPDVCHPMELLARSARLSPAPAPTTGGQDSSATPPQQH
FT                   P"
FT   gene            complement(220793..222241)
FT                   /gene="icd"
FT                   /locus_tag="sync_0214"
FT   CDS_pept        complement(220793..222241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icd"
FT                   /locus_tag="sync_0214"
FT                   /product="isocitrate dehydrogenase, NADP-dependent"
FT                   /EC_number="1.1.1.42"
FT                   /note="identified by match to protein family HMM PF00180;
FT                   match to protein family HMM TIGR00183"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45038"
FT                   /db_xref="GOA:Q0IDM2"
FT                   /db_xref="InterPro:IPR004439"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDM2"
FT                   /protein_id="ABI45038.1"
FT                   /translation="MPPDGDPSMAQFEKLTAPTEGTPIRFENGQPVVANDPIIPFIRGD
FT                   GTGVDIWPATQKVLDAAVAQAYKGEKNIKWFKIYAGDEACDLYGTYQYLPEDTLEAIRS
FT                   FGVAIKGPLTTPIGGGIRSLNVALRQIFDLYCCVRPCRYYEGTPSPHKRPEDLDVIVYR
FT                   ENTEDIYMGIEWEADDPIGQELRKHLNEVVIPANGKLGKRQIPEGSGIGIKPVSKHGSQ
FT                   RHIRKAIQHALRLEGNKRHVTLVHKGNIMKFTEGAFRDWGYELATTEFRDVCITERESW
FT                   ILDNLDRDHSLSAQDNARMIEPGYDSLTPEKKEAIDSEVKEVLAAIGESHGYGKWKSMV
FT                   LVDDRIADSIFQQIQTRPQEYSILATLNLNGDYISDAAAAMVGGLGMAPGANIGETAAI
FT                   FEATHGTAPKHAGLDRINPGSVILSGVMMLEFLGWQEAADLITKGLSAAIKDKQVTYDL
FT                   ARLMEPKVDPVSCSGFADAIIERF"
FT   gene            222342..222803
FT                   /locus_tag="sync_0215"
FT   CDS_pept        222342..222803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAQ00795.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46992"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDM1"
FT                   /protein_id="ABI46992.1"
FT                   /translation="MNPVNAAAAVHSVALAQALASSITLVRRQFPAAQPNLSPWRDDPL
FT                   TRHWDEAATLDLAFHFPGWSPRLQCRSLLLQLRFNSEPWEMDMSCPSLLGVVMRGMTFD
FT                   GERWRLATLGDWLPAGPHLPQRDQVEQLQLICREMFEVFEHGVPNHTSS"
FT   gene            222877..223590
FT                   /locus_tag="sync_0216"
FT   CDS_pept        222877..223590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0216"
FT                   /product="Heme oxygenase"
FT                   /EC_number="1.14.99.3"
FT                   /note="identified by match to protein family HMM PF01126"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47778"
FT                   /db_xref="GOA:Q0IDM0"
FT                   /db_xref="InterPro:IPR002051"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDM0"
FT                   /protein_id="ABI47778.1"
FT                   /translation="MSVALATQLREGTKKSHTMAENTGFVSCFLKGVVDKLSYRKLVAD
FT                   LFFVYEAMEEEMHRLKEHPVLAPIAFEQLDRVTALEEDLAFYFGTEWRQQIEASPAAKE
FT                   YVARIREVAQTAPELLVGHHYTRYLGDLSGGQILKNIAQKAMNNPTDNGLHFYVFPEIA
FT                   DEKAFKTTYRSALDTLPIDQAMADRIVEEANQAFHLNMKMFQELEGNLVAAIGKVLFGF
FT                   LTRRQRTGSTEAVVA"
FT   gene            223594..224676
FT                   /locus_tag="sync_0217"
FT   CDS_pept        223594..224676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0217"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45983"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDL9"
FT                   /protein_id="ABI45983.1"
FT                   /translation="MIQERIQESLPLFTSIRVLVPGTGPRFRCGGLSVALQTARLLSEL
FT                   RPTEVVTYREKEPDHPFLDDLLASALESSGELWLVSWGFDVPMLLKRLRGRSVAYQAHS
FT                   TGYGFDLSPGVPVIAVSRNSLSYWADRAPRNPLYLVPNALEPQWLIRGEWSHNGRRPVD
FT                   VLVQKRKSSPYVLESLVPALRQHGLRVEVQSGWVDDLVNLFNRATVYLYDSADYWRGRG
FT                   VSEGFGLPPLEALSCGCVVFSSFNHALADLLTPGGNAHQIGQGSLVNDLVRIKAAVSDP
FT                   ETWRPQSEELKALLLDLSESRCSERWHKTLSCLDELQRHGAMVESEALRASSSRQLRWH
FT                   QRVNSFRRKVVNRFSDWPFK"
FT   gene            224707..224829
FT                   /locus_tag="sync_0218"
FT   CDS_pept        224707..224829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0218"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46500"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDL8"
FT                   /protein_id="ABI46500.1"
FT                   /translation="MVNTFDLVAPGWPAEGINADEESDLDAFARAACLLASKTQ"
FT   gene            224897..226576
FT                   /locus_tag="sync_0219"
FT   CDS_pept        224897..226576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0219"
FT                   /product="ATP-binding ABC transporter family protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47311"
FT                   /db_xref="GOA:Q0IDL7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDL7"
FT                   /protein_id="ABI47311.1"
FT                   /translation="MARLVGLLAGQRLQDKIPGINVFGGGLLDQAGWIISLLILAFWIA
FT                   SAVRFAVSLMQSLLSAEIWNDLVNSVYSTLMRQDYEFFVSGKSTGIAIQFNRIFSNISK
FT                   NIVAPLITSAGSLVSIGSLMVGIVFILGIRALMIFMLMLVAYILASRIIIPYLRLATKQ
FT                   RIRYKKKISMLMAESIHSMREVQLYGAEDFFSKRFSSDGRIAKRYDRISRLLPDVPRLI
FT                   IEPAGITILFVIGLGPAIIQGDSQAIRQVAPELSVILIALLRISGPLQSLFKGINQLRG
FT                   GLPQVKEALELLELVPVRSMLSSQGVPSPSGLMPRRFIQLESVDFHYELSDRKVIDGVD
FT                   LMIPVGSRIALVGSTGSGKTTLAHLLLGLYHPTQGALCLDGIPVTRQELPAWQGNCSFV
FT                   PQNVRLSNGSVRDNVAFGRESDEIDDDRVWAALESAQFDDVVATMPYGLYTMVGDDGAK
FT                   LSGGQRQRLALARAFYREAKVLVLDEATSALDNKTEHDVMQALDIVGRRCTTIVIAHRL
FT                   STVKKCDRIYQLEQGKIIASGAFADLCNSSNSFREMNLFDGS"
FT   gene            226619..228835
FT                   /locus_tag="sync_0220"
FT   CDS_pept        226619..228835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0220"
FT                   /product="possible glycosyltransferase family 1"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45286"
FT                   /db_xref="GOA:Q0IDL6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDL6"
FT                   /protein_id="ABI45286.1"
FT                   /translation="MNDVVIIATADWDHPIWTNKQHVARSLADLGNRVLYVESLGIRSV
FT                   QITRSSDWTKIKRRIFRALWPLRQVSPRIWVLSPLVIPGGSDGWSRRLNKLSLRLALAL
FT                   AQAHIGLRQPLLWTFNPLTRRYLNLKMFRSTVYHCVDRIQAQPGMPVELLDLEEKALCQ
FT                   ESQVVFTTAPCLQEGLQALNPATYLFGNVADAEHFAQALEPALPRPVDCPSSERPLVMF
FT                   IGAIDAYKLDMLMLEQLIQATPQWTYLLIGPIAETDSSTEISGLHRLPNVYFIGSRPYR
FT                   DLPAYLACADVALLPLQINDYTRHMYPMKFFEYLAAGCPVVATAIPSLHDQGDVAWLCD
FT                   PSCQSFKQSIQEALEGKGAPRQQRLERASMHTYQRRTEAMLECLDFHGLLLPMTGATTH
FT                   MPNARPLSCQALESLGVSLLVLLIGALRILNQNFLSGALRNAGLKRWSCNTRLLYLAAD
FT                   DAIRSGDMRDARHYMEGLWRENGQVLALHRLLLKPRRGQVVDQLALFETMMNSNVFPLH
FT                   FTGYCAVVLGDWSIEIKDPDLRDGCLNTLTTVITTLLDDPGTYHCLRPVHENRMQLLVS
FT                   AQLSRMRLLMAAQFWLELEACGPSLMRSIADYNPALIDPQSASRLTTNAVRCLAMEGLM
FT                   AWWTNDAQRFLASFSEVHRLVVAADSLSFDSDSLGGQTEAQAFAALMLKQLRGCLWRAD
FT                   LGQQRPGRGQLVGFVLLILNNHLNWKRSDKVQRLLKTLEQTKPA"
FT   gene            228848..229990
FT                   /locus_tag="sync_0221"
FT   CDS_pept        228848..229990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0221"
FT                   /product="possible glycosyltransferase group 1"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46319"
FT                   /db_xref="GOA:Q0IDL5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDL5"
FT                   /protein_id="ABI46319.1"
FT                   /translation="MQIAFYIDSLKLGGAERVLLLWAGWCVQNNWHVTVITRQGLEQDV
FT                   YPLPTGVQRRVEAPLPWGLERFGWWAFPLRVWSLRLLLKELGPLDCAVGVTTLPAIKLL
FT                   LAAHGGRIRCLVSERNFPPAKRPALPWRLLRRFTYPWADLHLVQTSETGDWLKRHCGAH
FT                   RQRLMPNPVTWPLPDRDPRLDPDDWLDADVPMLLAAGTKAHQKGFDQLMQVFALLALRH
FT                   PTLRLVILGLGNSKYHGCDQQAMLRGLLPEDGALQRQLLFPGMVGNMSSWYERATIFVL
FT                   PSLYEGFPNVLLEAMAAGCACVARDCDTGPRDLIDQNHNGVLLPSEATSNMWAETLDEL
FT                   LTQPVRRRRLADAAKGVRERYAESVLRCDFLESLKGLVYG"
FT   gene            229983..231254
FT                   /locus_tag="sync_0222"
FT   CDS_pept        229983..231254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0222"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by similarity to SP:Q9R9N1; match to
FT                   protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45426"
FT                   /db_xref="GOA:Q0IDL4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDL4"
FT                   /protein_id="ABI45426.1"
FT                   /translation="MDDLWVVLPHLGAGGAQKVALLAAEHFAAQGLRVRVITMIHGHPV
FT                   LHALPDGVRHQELSPQLEVLKPWLGDGSNRSLLARGSRYLIANLIKVYRFMIRAQMVLI
FT                   GPWLESHIRPGSSGLAAELFQLGTTTLLGDRLLQFRNLVEQEQPRRILALLTRTNIVCC
FT                   LACWDLPVHVVVSERNDPARQRLGTFWALLRRLCYRRADVVTANTDGVLKALSRIGTWQ
FT                   RLELLPNPLPFGVISSAENGSERDLEVLAVARLKIQKGLDLLIRAFASIPEVRRLGWCL
FT                   TVVGDGPERSSLENLVTKLGIDGVFFEGFRSDPQTFMQRAAIFALPSRFEGMPNALLEA
FT                   MAAGLPCVVSDASPGPLEMITDGVNGLVVPHEDWPALAKKLEMLMEDQILRFRLGEAAR
FT                   QKLRSLDWSVVEPHWRSVLALPKL"
FT   gene            231221..232429
FT                   /locus_tag="sync_0223"
FT   CDS_pept        231221..232429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0223"
FT                   /product="Glycosyl transferase, group 1"
FT                   /EC_number="2.-.-.-"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47629"
FT                   /db_xref="GOA:Q0IDL3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDL3"
FT                   /protein_id="ABI47629.1"
FT                   /translation="MALCARIAEALMSGTELNNQRLLVFAPTRRALSETFIRANLEGLP
FT                   FELSAYFGDEFQGKRPLALAYSFGITLSKVLTRLHLLRLAGLPASLVAWCLIQKHRPDL
FT                   VLAEFGFEAVRVMEAAVWAKVPLVAHFRGSDASAHDRLGLLEGRYRRLLGVVSGVIVKS
FT                   RPMAQTMERLGADPAHILISPSGANAQLFRGGNPAIAPPVLLAVGRFVAKKGPLQTVRA
FT                   FGRCSEQGGTAMKTAELWMVGDGPLLVAAQALVIQLGLQNRVRFLGPKPPVAVAALMRE
FT                   VRAFVQHSCVAPDGDSEGSPVSVMEAQLSGLPVISTFHAGIPEVVIDQTTGLLVQEGDE
FT                   RAMADCMIELLLDPSRAEALGNAGRNRVLRHYTIDHHLRDVTAFLRARMPMSFVGQELI
FT                   KHV"
FT   gene            232645..233517
FT                   /locus_tag="sync_0224"
FT   CDS_pept        232645..233517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0224"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47099"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDL2"
FT                   /protein_id="ABI47099.1"
FT                   /translation="MMALPPLYSQMPTVVYITSRGHSGSTLLSLLIGGNSKVVSGGELK
FT                   MLINSDPRRRFCSCHSLSPEQCPFWSQVQAKVIDLVGVSLCQLSLMEGGSDDMFSKHNQ
FT                   ALFEAIASVSGCSIIVDSSKSLLRLSRLLKAKEKGCAIEVQPIHLHRGPLGTVNSARKK
FT                   GHPLLSVAQNYSTAFFKTRECLSKTPSLFISYEQLACHPRRCLQRVMRWIQLPLQESQL
FT                   QWREGIRRDVGGNRMRIGESTKICLDQSWKRDLKPVEVLKLTLLTLPVRLRWRWLYRKF
FT                   HGRKIGFGL"
FT   gene            233715..234530
FT                   /locus_tag="sync_0225"
FT   CDS_pept        233715..234530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0225"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45146"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDL1"
FT                   /protein_id="ABI45146.1"
FT                   /translation="MSRWNLVYITSNSHSGSTLLDMLIGSHSSCITLGEIHKLTRKSKG
FT                   VCACGAPNYQECAFWRDVDARLQACGGPKLAQLHLDSTQKDEFQEMNYYLFRVLQEKTN
FT                   AQWFVDSSKKLSRLKSLVSDPSFNVIPIHIIRRPEGVVCSNLRKGRSFYSELHSYYYDL
FT                   WSRYKYLHCRRHVLISYESLCSQPDLVLGKIMGRLGLFFESAQLQWSKHEHHNVNGNKR
FT                   TRTSRQSSICLDERWRRELSLWQRFVVKLATVKFRLKLLLFLRIWPKPL"
FT   gene            234569..235435
FT                   /locus_tag="sync_0226"
FT   CDS_pept        234569..235435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0226"
FT                   /product="conserved hypothetical"
FT                   /note="identified by match to protein family HMM PF00685"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47258"
FT                   /db_xref="GOA:Q0IDL0"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037359"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDL0"
FT                   /protein_id="ABI47258.1"
FT                   /translation="MACLLLKDMRENGPHFIVIGAQRSGTTWLHRVMTQHDQLWLTPVK
FT                   ELHYFDKQELRLGVMSAYERNRARFWSPRRLMLDPRWYCRYWFLPRSDEWYGKLFRRAR
FT                   QKGKITGEITPAYAVLPEKEWDHLYSLFPDVRLVFIMRDPIIRTWSALRNNMKKGRLNS
FT                   ASSVDELVAQASGFSMASRSDYLRTIKTVESRFGADRVHCCFFEQLLSDPTELADSLFQ
FT                   FLGAKPMGEALNIPPAVNSAAGGDAPPFALQQALAEQYLPMVDELAERFGEVPLSWANR
FT                   YRNLLGV"
FT   gene            235916..238327
FT                   /gene="pcrA"
FT                   /locus_tag="sync_0227"
FT   CDS_pept        235916..238327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrA"
FT                   /locus_tag="sync_0227"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00580;
FT                   match to protein family HMM TIGR01073"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46752"
FT                   /db_xref="GOA:Q0IDK9"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDK9"
FT                   /protein_id="ABI46752.1"
FT                   /translation="MSFLAGLNDAQKRAVDHHEGPLLVVAGAGSGKTRALTHRIAHLIG
FT                   EHGADPAQILAVTFTNKAAREMKERLELLLAQRLAQSQFGQPWSTLPPVEQRQLRTRIY
FT                   REITKELWIGTFHALFARMLRFDIDKFKDPEGLTWTKQFSIYDEADAQSLVKEIVTQEL
FT                   QLDPKRFEPKKVRWAISNAKNQGWSPDDLEANAEGQRGKLSADVYRRYRKALAANNALD
FT                   FDDLLLLPVRLLQQNEQVRGYWFRRFRHVLVDEYQDTNRTQYELIKLLVTDGKEPQQVD
FT                   DWSGRSVFVVGDADQSIYSFRAADFTILMGFQDDFGDKAPDDVTRTMVKLEENYRSTAT
FT                   ILEAANALISNNSERIDKVLRPTRGEGELISLTRCDDEIAEAEAVVHRMRMMEAANPDL
FT                   SWKDMAVLYRTNAQSRAIEESLVRWRIPYVVVGGLRFYDRREIKDLLGYLRLLINPADT
FT                   VSLLRVINVPKRGIGKTTIQRLTDAANQLGIPLWDVVSDPEAVRSLGGRSARGLLQFCE
FT                   LINSMKERIHAATPSELIQEVMEKSGYVSELIADGSDEAEERRRNLQELVNAGLQYQEE
FT                   NEEGDLEGFLASAALASDADSKDTAADRVTLMTLHSSKGLEFPVVCLVGLEQGLFPSYR
FT                   SLDDPASLEEERRLCYVGITRAKERLFISHASERRLWGGMREPAMPSVFLSELPEGLVQ
FT                   GDVPQSGGAALRREQRLERLTRVDRDDSRRVASGGASGAPANAVRRRQAGPAPGKSWSV
FT                   GDQVVHASFGVGEITHTFGSGEKVSIAVKFAGMGPKILDPRLAPIEPAGG"
FT   gene            238263..239567
FT                   /locus_tag="sync_0228"
FT   CDS_pept        238263..239567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0228"
FT                   /product="polyA polymerase family protein"
FT                   /note="identified by match to protein family HMM PF01743"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46306"
FT                   /db_xref="GOA:Q0IDK8"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDK8"
FT                   /protein_id="ABI46306.1"
FT                   /translation="MRVWGPKFSTRAWHRSSLLEAEGVERPGLPPQLLPALQALASEVG
FT                   VSRLALVGGAVRDALLHDEHCDPWRELPDLDLVMEGSASELAAALQRHYGDERVQEVRV
FT                   HGAYGTAELSFDGVLLDLAGARQDHYPAPGENPVVESGSLERDLERRDFTVNAMALELS
FT                   LSGDREPLLLDPHGGQAHLERRELAFLHASSVADDPTRVIRAARYGARLGFVLTPSSQD
FT                   QLRTTLKRWPWSWRHGQSTEHVPPALGTRLRMELELLFENEPWLKALELLQQWGALALL
FT                   DPLLSSNATLIRRLRWAMRLKVPLILALVAAATDPCSLGQRLQLPLRQQRLLEESMSLT
FT                   NWLHSEVLPQAWVGWSAVQWTEALETRAWSPESVVLTVAMGVPCWRPMLRWWGRWRKIR
FT                   SPLSAKDLIASGIPAGPGLGLALHQARVKALDSMR"
FT   gene            complement(239623..240918)
FT                   /locus_tag="sync_0229"
FT   CDS_pept        complement(239623..240918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45657"
FT                   /db_xref="GOA:Q0IDK7"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDK7"
FT                   /protein_id="ABI45657.1"
FT                   /translation="MGSSKSHPQLSSQPLVRLTRIFQDISRNLLSNDDLINALIPFSVA
FT                   LHLTKQSRELGLISLFAWLVLQMSAAIRKLILKSSTQATLVAWGGLLGFLLLNARNVIE
FT                   RDDYRGPVQFLLILTGLLISSQFSKKQWLSLLRWLGIAIIPIATWFAWRMHLNDDWSIR
FT                   SIYRIYYEYTKQSMGSINRLATTAGLLTLSAWYSTTQMHQIPARAASLIIAFAGYLIVL
FT                   GTGSRMAIIAVPIAISIPWLWMRINNRLSAKQLIITSIATLGLTGSLAWHFVIAKGFAS
FT                   SDVMRLRMASCWIDKGMLKPTERFWIGTGFDSAKLREACEYIRPGSPFGHAHNTLANIA
FT                   GHHGLLGIIVLISFSMLVAYGLLRQQRVSTKIFSWPPFNSTSWAEISLGLNLTLLIFAA
FT                   STTIYVSSPINQVLIGLGAGSALAWQSPDQSQ"
FT   gene            complement(241055..243181)
FT                   /locus_tag="sync_0230"
FT   CDS_pept        complement(241055..243181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0230"
FT                   /product="Selenide,water dikinase"
FT                   /note="identified by match to protein family HMM PF02769"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47403"
FT                   /db_xref="GOA:Q0IDK6"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR030805"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDK6"
FT                   /protein_id="ABI47403.1"
FT                   /translation="MNPGSRPNTFITLVSRHSTALYSGMVPGLVAGLYQREELEIDLRQ
FT                   LTDQAEVALIVAEIKGLDPAKHKLWLADRPPIGYDQLSLNVGCITNNLGPIQQDTLAIK
FT                   PLEQALTAIDEADANSLTAPVRILGSGLAAIEVSLALRHRWPSRTLSLQARTDSIHPPF
FT                   QRGLALAGVSVQPASTPGGRTKPSLQGKKSLDLNCTGSCAPTWLKDSGLPVDERGRVRT
FT                   EATLEVLGHSGHFAAGDCAVIDADPRPASGVWAVRAAGPLSRNLKASCNNRPLRPWRSQ
FT                   RHAMQLVGGFSINGEPTAWALWGPICLGPHALLWKWKEHIDRRFMSRLQGTHMAEENHD
FT                   SQGAMLCRGCAAKFPADDLEAALEEAGFAKLGNTPEDAASIPETQSTDGDPVLQSVDGF
FT                   PALISDPWLNARLTALHACSDLWACGARVRSAQAVVTLPQAAQSLQRLLLSQTLAGLRS
FT                   ALEAQGAELIGGHTLESRSHTEGTLSLGVQVALNVQGSAQGPIWNKRGIQAGDQLLLSG
FT                   SLGMGVLFAAAMKGAVRPGELDKALAQMNRSQHRLVDLLRNLEKEHPGQLHAATDITGF
FT                   GLLGHLGEMLGDAPEVTAQPQVILDAEKIPALPGALELLSAGHSSSLAPANRRAFALLH
FT                   PKAQLSGHALVTLTMGQKTKNSRSSRALLDLLVDPQTCGPLLISIAPEMAKALLAQAPD
FT                   EWRSIGRAFSHSRN"
FT   gene            complement(243244..244356)
FT                   /gene="galE"
FT                   /locus_tag="sync_0231"
FT   CDS_pept        complement(243244..244356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="sync_0231"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01073; match to protein
FT                   family HMM PF01370; match to protein family HMM PF02719;
FT                   match to protein family HMM PF04321; match to protein
FT                   family HMM PF07993; match to protein family HMM TIGR01179"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46851"
FT                   /db_xref="GOA:Q0IDK5"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDK5"
FT                   /protein_id="ABI46851.1"
FT                   /translation="MAQLLITGGAGFIGSHTCLVLLEAGHQLLVLDDFSNSSAIALERV
FT                   AELAGARLQRDQPTLRAAPETLTLVEGDIRDAQCLDALFTSTKTFDQPIEAVIHFAGLK
FT                   AVGESVQQPLRYWDVNVVGSQRLLSAMDRHSCRTLVFSSSATLYGYPDQVPIPETAPIQ
FT                   PINPYGASKQAAEALFADIAGCSGKPEPIQASQGGWRIARLRYFNPVGAHPSGRIGEDP
FT                   NGIPNNLFPFITQVAIGRRPELTVFGDDWPTPDGTGVRDYIHVMDLAEGHREALHSLLN
FT                   TDPQLLTLNLGSGQGASVLDVVKAMEAASQRAIPYRIAPRRPGDAALTVANPTLAAQHL
FT                   HWRTQRSLAEICRDGWAWQQANPQGYIRQT"
FT   gene            244447..245733
FT                   /gene="hisS"
FT                   /locus_tag="sync_0232"
FT   CDS_pept        244447..245733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="sync_0232"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM TIGR00442"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47698"
FT                   /db_xref="GOA:Q0IDK4"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDK4"
FT                   /protein_id="ABI47698.1"
FT                   /translation="MSQLQTLRGMVDLLPEQTRRWQAVESVAREHFRCAGLDEIRTPLL
FT                   EFTDLFARGIGEGTDVVGKEMYTFLDRGDRSCTLRPEGTASVVRAALQHGLLSQGAQRL
FT                   WYGGPMFRYERPQAGRQRQFHQIGVEFLGASSPRSDAEVIALAWDLLTDLGIQGLNLEI
FT                   NSLGTPDDRQRFRSELVQWLEERVEQLDAESQARLTTNPLRILDSKDKGTQQLLNDAPT
FT                   LLKALSKESVDRFEQVCALLTALQIPYQLNPRLVRGLDYYGHTAFEITSDQLGAQATVC
FT                   GGGRYDGLIQQLGGPVTPAIGWALGMERLLLVISAAAQADPDGAAARLTATPSPLVYVI
FT                   NRGEQAEPQALSLARQWRGAGLAVELDGSSASFGKQFKRADRSGAPWAVVLGDEEASAG
FT                   QVRLKPLRGEGEEKQLTWEDALSYLMKQR"
FT   gene            245770..247209
FT                   /locus_tag="sync_0233"
FT   CDS_pept        245770..247209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0233"
FT                   /product="UDP-glucose dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="identified by match to protein family HMM PF00984;
FT                   match to protein family HMM PF03720; match to protein
FT                   family HMM PF03721; match to protein family HMM TIGR03026"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46864"
FT                   /db_xref="GOA:Q0IDK3"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028356"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDK3"
FT                   /protein_id="ABI46864.1"
FT                   /translation="MSSNPTIQSICCIGAGYVGGPTMAVIADRCPDVKVTVVDINQDRI
FT                   AAWNNGDLSKLPVYEPGLDAVVERARGRNLFFSTAVEETIASADMVFISVNTPTKTKGL
FT                   GAGQASDLRWVEACARTVAKAAQGYTIVVEKSTLPVRTAEAVKAILGSVDPSSELKTFS
FT                   VLSNPEFLAEGTAIRDLASPDRVLIGGDNAEAIDALAEIYQQWVPEEKILRTNLWSSEL
FT                   SKLTANAFLAQRISSINSVAALCEATGADVREVAKAIGTDSRIGPKFLSAGPGFGGSCF
FT                   QKDILNLVYLCRHFGLPDVADYWESVVLLNTWQQHRIARLVVQKLFGTVTGKRLAILGF
FT                   AFKADTNDTREAPAIRICRDLLEEGAQLAIHDPKVDPEQISRDLKLIASHAPEADAGPT
FT                   RGALSGEATWWPSPDVASALRGADAVLILTEWKQYRELDWAALAPLMRKPAWLFDARGV
FT                   ADPKQVASAGLNVWRVGEGDA"
FT   gene            247206..248246
FT                   /gene="wcaG-3"
FT                   /locus_tag="sync_0234"
FT   CDS_pept        247206..248246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wcaG-3"
FT                   /locus_tag="sync_0234"
FT                   /product="WbnF"
FT                   /EC_number="5.1.3.-"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01073; match to protein
FT                   family HMM PF01370; match to protein family HMM PF04321;
FT                   match to protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46038"
FT                   /db_xref="GOA:Q0IDK2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDK2"
FT                   /protein_id="ABI46038.1"
FT                   /translation="MSQVSLRPILVTGAAGFIGAALCERLLQRGDRVIGIDNLNDYYDP
FT                   ALKQARLARIETLAVSTAGAWSFHRLALEDGDALLKLFAAEQPRVVVNLAAQAGVRYSL
FT                   ENPAAYIQSNLVGFGHILEGCRHHGVDNLVYASSSSVYGGNRNLPFHEQQAVNHPVSLY
FT                   AASKKANELMAHTYSHLYGLPATGLRFFTVYGPWGRPDMAPMLFARAILAGEPIKVFNH
FT                   GKMQRDFTYIDDIVEGVLRCCDQPATSNLDFDPMQPDPATAAAPHRVFNIGNSQPTELL
FT                   RFIEVMEQALGREAIKDFQPMQPGDVVATAANTEALETWVGFKPSTPIEEGIQRFADWY
FT                   RKFYQP"
FT   gene            complement(248237..248689)
FT                   /locus_tag="sync_0235"
FT   CDS_pept        complement(248237..248689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46776"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDK1"
FT                   /protein_id="ABI46776.1"
FT                   /translation="MTSSVKQHQKIRRSRDRRLKGRKLVCPVHQDQIIRGNGKKYFLHL
FT                   LSAEALQRRGMASKTARLVINAYPVFVLSNEWLEELYCEQCGSNHWCHIIKHSPDEYTV
FT                   RWAPQHLWEQVAHVDPSVANPTVSEYTRKQARRHQQKRVDGKRFYG"
FT   gene            complement(248912..249112)
FT                   /gene="psbJ"
FT                   /locus_tag="sync_0236"
FT   CDS_pept        complement(248912..249112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbJ"
FT                   /locus_tag="sync_0236"
FT                   /product="photosystem II reaction center protein PsbJ"
FT                   /note="identified by match to protein family HMM PF01788"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45649"
FT                   /db_xref="GOA:Q0IDK0"
FT                   /db_xref="InterPro:IPR002682"
FT                   /db_xref="InterPro:IPR037267"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDK0"
FT                   /protein_id="ABI45649.1"
FT                   /translation="MSGKKSNLPDGRIPDRLPDGRPAVAWKSRWTEGTLPLWLVATAGG
FT                   MAVIFVVGLFFYGSYVGVGSA"
FT   gene            complement(249124..249243)
FT                   /gene="psbL"
FT                   /locus_tag="sync_0237"
FT   CDS_pept        complement(249124..249243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbL"
FT                   /locus_tag="sync_0237"
FT                   /product="photosystem II reaction center protein PsbL"
FT                   /note="identified by match to protein family HMM PF02419"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47307"
FT                   /db_xref="GOA:Q0IDJ9"
FT                   /db_xref="InterPro:IPR003372"
FT                   /db_xref="InterPro:IPR037266"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDJ9"
FT                   /protein_id="ABI47307.1"
FT                   /translation="MERNPNPNNLPVELNRTSLYLGLLIVFTTGILFSSYFFN"
FT   gene            complement(249262..249399)
FT                   /gene="psbF"
FT                   /locus_tag="sync_0238"
FT   CDS_pept        complement(249262..249399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbF"
FT                   /locus_tag="sync_0238"
FT                   /product="cytochrome b559, beta subunit"
FT                   /note="identified by match to protein family HMM PF00283;
FT                   match to protein family HMM TIGR01333"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46888"
FT                   /db_xref="GOA:Q0IDJ8"
FT                   /db_xref="InterPro:IPR006216"
FT                   /db_xref="InterPro:IPR006241"
FT                   /db_xref="InterPro:IPR013081"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDJ8"
FT                   /protein_id="ABI46888.1"
FT                   /translation="MTQTPATSTPRNYPIFTVRWLALHTLGVPTVFFLGALAAMQFIRR
FT                   "
FT   gene            complement(249403..249651)
FT                   /gene="psbE"
FT                   /locus_tag="sync_0239"
FT   CDS_pept        complement(249403..249651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbE"
FT                   /locus_tag="sync_0239"
FT                   /product="cytochrome b559, alpha subunit"
FT                   /note="identified by match to protein family HMM PF00283;
FT                   match to protein family HMM PF00284; match to protein
FT                   family HMM TIGR01332"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46397"
FT                   /db_xref="GOA:Q0IDJ7"
FT                   /db_xref="InterPro:IPR006217"
FT                   /db_xref="InterPro:IPR013081"
FT                   /db_xref="InterPro:IPR013082"
FT                   /db_xref="InterPro:IPR037025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDJ7"
FT                   /protein_id="ABI46397.1"
FT                   /translation="MAAGSTGERPFFEIITSIRYWVIHAITLPSIFLAGFLFVSTGLAY
FT                   DAFGTPRPDAYFQASESKAPVVSQRYEGKSELDLRLK"
FT   gene            complement(249761..250771)
FT                   /locus_tag="sync_0240"
FT   CDS_pept        complement(249761..250771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0240"
FT                   /product="photosystem II stability/assembly factor HCF136"
FT                   /note="identified by similarity to SP:O82660"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47168"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016705"
FT                   /db_xref="InterPro:IPR028203"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDJ6"
FT                   /protein_id="ABI47168.1"
FT                   /translation="MKQLLTPFFNLFLVACIGLGLGGCVTTRLPMAQSSPWQAIDLNTQ
FT                   ANPLDVAFTSADHGFLVGSNRLILETNDGGANWNERSLDLPEEENFRLISIAFDGDDGW
FT                   IAGQPGLLMHTTDGGNNWTRLFLDTKLPGEPYLITALGPNTAELATNVGAVYRTSDGGG
FT                   SWEAEVSDAAGAIRDLRRGPEGGYVSVSSLGNFYAGWAPGQDVWQVHQRVSSQRLQSIG
FT                   YQPDGKLWMVARGAQIRFNEDDVDNENWGKAIIPITNGYGYMDMAWSDDGAIWAGGGNG
FT                   TLLVSRDNGDSWERDPEANQTPTNFNRFVFDHSGNRLHAFLLGERGNLLRWSATS"
FT   gene            complement(250789..251229)
FT                   /locus_tag="sync_0241"
FT   CDS_pept        complement(250789..251229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0241"
FT                   /product="Rubredoxin"
FT                   /note="identified by match to protein family HMM PF00301"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47048"
FT                   /db_xref="GOA:Q0IDJ5"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDJ5"
FT                   /protein_id="ABI47048.1"
FT                   /translation="MSDEISPAAEVPADVDPLAEELIEAEPNQDEASTSTDKETTDPRT
FT                   HRFECRSCGYVYDPDEGVKKLGIVVGTAFEDLDPIRFRCPVCRSRVGAFTDIGPRSKAS
FT                   GFEENLNFGLGVNRLTPGQKNVLIFGGLALGFAFFLSLYSLR"
FT   gene            251264..251692
FT                   /locus_tag="sync_0242"
FT   CDS_pept        251264..251692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0242"
FT                   /product="NADH dehydrogenase I chain 3 (or A)"
FT                   /EC_number="1.6.5.-"
FT                   /note="identified by match to protein family HMM PF00507"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47507"
FT                   /db_xref="GOA:Q0IDJ4"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDJ4"
FT                   /protein_id="ABI47507.1"
FT                   /translation="MGLATTEVVYECQTGVQIEAALMFVLPGYDAFLGFLLIAAAVPVL
FT                   ALVTNKLLAPRSQTGERELTYESGMEPIGGAWIQFNIRYYMFALVFVIFDVETVFLYPW
FT                   AVAFHRLGLLAFIEALVFITILLVALAYAWRKGALEWS"
FT   gene            251696..252475
FT                   /locus_tag="sync_0243"
FT   CDS_pept        251696..252475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0243"
FT                   /product="NADH dehydrogenase I chain B or NdhK"
FT                   /EC_number="1.6.5.-"
FT                   /note="identified by match to protein family HMM PF01058;
FT                   match to protein family HMM TIGR01957"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46717"
FT                   /db_xref="GOA:Q0IDJ3"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDJ3"
FT                   /protein_id="ABI46717.1"
FT                   /translation="MTDPITMTSTGDSPSIQSLRDLREASCGPVGGAAEGSPTVTNDLS
FT                   ENVILTSLDDLHNWARLSSLWPLLYGTACCFIEFAALLGSRFDFDRFGLVPRSSPRQAD
FT                   LLIVAGTVTMKMGPALVRLYEQMPEPKYVIAMGACTITGGMFSADSTTAVRGVDKLIPV
FT                   DLYLPGCPPRPEAIFDAVIKLRKKVGNESVSDRRQLKQTHRYCTIDHAMVPVEPIVTGA
FT                   YLRAETQVAALSPGVGVPMAAPEQTESAEPVSSGASS"
FT   gene            252472..253023
FT                   /locus_tag="sync_0244"
FT   CDS_pept        252472..253023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0244"
FT                   /product="NADH dehydrogenase I chain J"
FT                   /EC_number="1.6.5.-"
FT                   /note="identified by match to protein family HMM PF00329"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45835"
FT                   /db_xref="GOA:Q0IDJ2"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDJ2"
FT                   /protein_id="ABI45835.1"
FT                   /translation="MSPNSSEKQSSADVPVAASPQPGPVSQWLNQQGFDHDALEPDHLG
FT                   VEQIGVEALFLQVITAALKSNGFDYLQCQGGYDEGPGERLVCFYHFVAMAELIDGKRDN
FT                   LREVRLKVFLSREGEPSLPSIYGLFRGADWQERETFDMFGIHFEGHPHPKRLLMPEDWT
FT                   GWPLRKDYVQPDFYEMQDAY"
FT   gene            complement(253025..254215)
FT                   /locus_tag="sync_0245"
FT   CDS_pept        complement(253025..254215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0245"
FT                   /product="Uncharacterized conserved membrane-associated
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01933;
FT                   match to protein family HMM TIGR01826"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45181"
FT                   /db_xref="GOA:Q0IDJ1"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDJ1"
FT                   /protein_id="ABI45181.1"
FT                   /translation="MLWAIQESLGWITRVLPGAITGPLVLLLGVGLLLWGQSQSFGSIQ
FT                   QALAPEKDTVLVDALRAKSRLNRGPSIVAIGGGTGLSTLLSGLKRYSSHITAIVTVADD
FT                   GGSSGVLRRELGVLPPGDIRNCLAALSTEEPLLTRLFQYRFSAGSGLEGHSFGNLFLSA
FT                   LSAITGSLETAITASSRVLAVQGQVVPATNADVRLWAELEDGTRIEGESAIGNARSPIV
FT                   RMGCLPEKPPALPRALEAIAHADLILLGPGSLYTSLLPNLLVPELVTAIQRSRAPRLYI
FT                   CNLMTQPGETDGLDVSGHLRAIEAQLASLGVSKRLFDCVLAQEPIRESALLAHYRKLGA
FT                   EPVICNSSHLQQEGFEVMQAPLQGSRPTATLRHDPRSLALAVMRFYRRHKRDNQNA"
FT   gene            254521..255348
FT                   /gene="mkl"
FT                   /locus_tag="sync_0246"
FT   CDS_pept        254521..255348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mkl"
FT                   /locus_tag="sync_0246"
FT                   /product="possible ABC transporter, ATP-binding component"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45597"
FT                   /db_xref="GOA:Q0IDJ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDJ0"
FT                   /protein_id="ABI45597.1"
FT                   /translation="MSQLSAISPLVNARDSSYKPVVEMRDLTMQWGSHSVLDGVNLLMK
FT                   PGERIAVVGPSGAGKSTVLRLLAGLQLPTAGELRLFGEPQPYLRLDQRRPPDVRLVFQN
FT                   PALLASLTVEENVGFLLNRLGRMRPAQVRDRVMACLEAVGLYEVAHQYPGEISGGMQKR
FT                   VSFARALIDDPDRDEAAMPLLLYDEPTAGLDPVAATRIEDLIVKTTTVAQGCSVVVSHV
FT                   HSTIERTAERIVMLYGGRFQWEGTVDDYRTTDNPYVVQFRTGNLRGPMQPAEH"
FT   gene            255352..256245
FT                   /locus_tag="sync_0247"
FT   CDS_pept        255352..256245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0247"
FT                   /product="possible ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47360"
FT                   /db_xref="GOA:Q0IDI9"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDI9"
FT                   /protein_id="ABI47360.1"
FT                   /translation="MRRSVREGLVGFSVIAAVVCFAGTMLWLRGERVLSKTWSVTADFQ
FT                   DAGGLAVRSPVTYRGIMVGNVTDIKVTPKAVRVSIEINQDDLQLTLPVQATVSSASLLG
FT                   GDSQVALSSVGPPLKKNAPMPKSQSCKGQGVLCDGATIQGSESASLASITNSFQELLHQ
FT                   AKTEQLVPKLVGSTEQFDETLRDIELLATQLREDLARAAPTISNLNEATAQAASASRHI
FT                   NNLVSAFDNPTTITDLKQTVSNARSLTATFDAVGGDVDKLTADPQFMAAVRSVTIGLGQ
FT                   FFHELYPARTPDVAKP"
FT   gene            complement(256242..258323)
FT                   /gene="chlD"
FT                   /locus_tag="sync_0248"
FT   CDS_pept        complement(256242..258323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlD"
FT                   /locus_tag="sync_0248"
FT                   /product="magnesium chelatase, ATPase subunit D"
FT                   /EC_number="6.6.1.1"
FT                   /note="identified by match to protein family HMM PF01078;
FT                   match to protein family HMM TIGR02031; match to protein
FT                   family HMM TIGR02442"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46883"
FT                   /db_xref="GOA:Q0IDI8"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011776"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="InterPro:IPR041702"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDI8"
FT                   /protein_id="ABI46883.1"
FT                   /translation="MVASGVTSNGVISTAALNQASRAFPLAAITGHGTLKLALLLAAVD
FT                   PGLGGVIIAGGRGTGKSVLARGLHALIPPIEVVDLEAAGETKLPGRNLDPQDVQDWGER
FT                   QQDPPKTVIPAPFIQIPLGVTEDRLVGSVDVTASLASGSPVFQPGLLAEAHRGVLYVDE
FT                   LNLLDDGIINLLLAAVGSGENQVEREGLSLSHPCRPLLIATYNPEEGAIRDHLLDRFAI
FT                   VLSANQIVSTEQRVEITNAVLAHGQCSRSFSDKWSEETDALATQLLLARQWLPDVQISS
FT                   NQIEYLVTEAIRGGVEGHRSELYAVRAAKAHAALSGRDQVEAEDLQVAVALVIAPRASQ
FT                   LPPPEQQMEPPPPQDQQPPPPPEGSGEEEEQESEEQESEDNSDDDDDTPEEQPPPSVPE
FT                   EFMLDPEAVAIDPDLLLFNAAKSKSGNSGSRSVVLSDSRGRYVKPMLPRGPVRRIAVDA
FT                   TLRAAAPYQKARRARQPDRIVIVEESDLRAKLLQRQAGALVIFLVDASGSMALNRMQSA
FT                   KGAVIRLLTEAYENRDEVALIPFRGDQAEVLLPPTRSITAARRRLESMPCGGGSPLAHG
FT                   LTQAARVGANALATGDLGQVVVVAITDGRGNVPLSTSLGQPVLEGEEKPDLKQEVLDVA
FT                   TRYRMLGLKLLVIDTERKFIGSGMGKDLAEAAGGKYVQLPKASDQAIAAVAMDALNTV"
FT   gene            258384..258893
FT                   /gene="folK"
FT                   /locus_tag="sync_0249"
FT   CDS_pept        258384..258893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="sync_0249"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="identified by match to protein family HMM PF01288;
FT                   match to protein family HMM TIGR01498"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46446"
FT                   /db_xref="GOA:Q0IDI7"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDI7"
FT                   /protein_id="ABI46446.1"
FT                   /translation="MALGSNQDGPCGSPLRTLMAVRPLLEGLLGLWAQSVEEISPGDTA
FT                   PNGVSSPLTFSWSPLQQTAPVGGPIDQPSYLNAVLLVKGLELCPESATALRLLDALQQL
FT                   EQSFGRNRSQEERWGPRPLDLDLLFWGDWRLDHPRLTLPHPRLHLRSFVMEPLLAAMQA
FT                   STPWLS"
FT   gene            258940..259149
FT                   /locus_tag="sync_0250"
FT   CDS_pept        258940..259149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0250"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47667"
FT                   /db_xref="GOA:Q0IDI6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDI6"
FT                   /protein_id="ABI47667.1"
FT                   /translation="MKACSICMVPLPAPEPSKLLETLETMDARKIRFERNRILLPMGVE
FT                   GTFGIIRHPGGLTGRFPSRLTARL"
FT   gene            259146..259523
FT                   /locus_tag="sync_0251"
FT   CDS_pept        259146..259523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0251"
FT                   /product="NUDIX hydrolase"
FT                   /EC_number="3.6.1.13"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45441"
FT                   /db_xref="GOA:Q0IDI5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDI5"
FT                   /protein_id="ABI45441.1"
FT                   /translation="MILRQYRFAVQARLLEFPAGTLEEGEDPLESMQRELGEEAGYSAA
FT                   RWDSLGPMLPCPGYSDEVIHCFLARDLSRLEHPPAGDDDEDLEVILMSPSELDARLASG
FT                   DEWLDGKSVTAWFRAKQLLGL"
FT   gene            259523..261001
FT                   /gene="phrB"
FT                   /locus_tag="sync_0252"
FT   CDS_pept        259523..261001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phrB"
FT                   /locus_tag="sync_0252"
FT                   /product="deoxyribodipyrimidine photolyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="identified by similarity to SP:P05327; match to
FT                   protein family HMM PF00875; match to protein family HMM
FT                   PF03441"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46348"
FT                   /db_xref="GOA:Q0IDI4"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDI4"
FT                   /protein_id="ABI46348.1"
FT                   /translation="MTASRVLFWHRRDLRLADNLGLQAAEAISPAVTGVYVLDPALIQP
FT                   PESLPPMAPARLWFLVESLRELQQRWRDVGSRLLVVAGDPVQLLPRLASLLEAPAVVWS
FT                   RDVEPYARERDRQVAKALQADGCKVLVDWDQLLLAPDLIKTGGGDPYRVFGPFLRNWRG
FT                   QVERSGPSTVDPPRALIDLEAEMLEAVLGGEGALGRLCTEGQRQLEQLQVEHGFRGTDL
FT                   CPSRPGEAAAAAQLAAFADGALLAYEPDRNFPGMPGTSYLSAGLSVGTVSPRQAWCAAQ
FT                   GVKEIARSDEQQQAITVWEQELCWREFYQQALFHFPELADGPYREQWRRFPWENNSDWF
FT                   EAWREGQTGMPIIDAAMRQLNQSGWMHNRCRMIVASFLVKDLICDWRWGERAFMELEVD
FT                   GDLAANNGGWQWSASSGMDPKPLRIFNPATQATKFDAEGEYIREWVPELRHVNTKDLIS
FT                   GEIPALERRSYPEQLINHKVQQAKFKALYATIRS"
FT   gene            complement(260980..262194)
FT                   /locus_tag="sync_0253"
FT   CDS_pept        complement(260980..262194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0253"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01041;
FT                   match to protein family HMM PF01053; match to protein
FT                   family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45556"
FT                   /db_xref="GOA:Q0IDI3"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDI3"
FT                   /protein_id="ABI45556.1"
FT                   /translation="MQVPPFSLTDQLADLGSELDNAVLRVLRSGQYIGGAEIKQFEKAF
FT                   AASVNSRHAVGCNSGTDALVLALRGLGIGSGDEVITASFSFFATAEAISAVGATPVFVD
FT                   VDPVTYLIDLNLIEAAITPATKALLPVHLFGRPVDMARIMEIAHSHGLKVVEDCAQATG
FT                   ASWDSKPVGSWGDVGCFSFFPTKNLGAAGDGGAMTCQDDDLAQRMRELAVHGMPRRYLH
FT                   TALGYNSRLDSIQAAVLNVKLPYLSGWVEKRAAIAKRYFEALKDLPGVQLPDSATDASV
FT                   GHGWNQFVVRVGLCPNNQPTCDRTCSESASTLGLPSSRCRDWLKQSLQEQGVNTIIYYP
FT                   IPIHRQPAYEGQAHAEGNLPITDQLCSEVLSLPIFPELTAEQQERVITVLREQLVAQIQ
FT                   ERMVA"
FT   gene            complement(262205..262834)
FT                   /locus_tag="sync_0254"
FT   CDS_pept        complement(262205..262834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0254"
FT                   /product="Thioredoxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47189"
FT                   /db_xref="GOA:Q0IDI2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDI2"
FT                   /protein_id="ABI47189.1"
FT                   /translation="MLDAMVLTPSTMLPLQHPLPQFSLPLVSGHPPWSSLDELVTSRDL
FT                   PGRPLLVMLICAHCPFVKHVEPEITRVESDFAGQITLLAISSNSLTTHPQDGRDGLRQQ
FT                   ADQQGWRFPYLLDEQQTLAKDLRGACTPEFYAFAPDADGTQTLRYRGQLDSSRPGNNQP
FT                   LDGADLRAALTNILAGTAVSETQLPSVGCNIKWNPGQEPPWFGQST"
FT   gene            262894..263397
FT                   /locus_tag="sync_0255"
FT   CDS_pept        262894..263397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0255"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47320"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDI1"
FT                   /protein_id="ABI47320.1"
FT                   /translation="MVRVLTMVVMAGLLSACAQKQGITWKVFPLQRNTPHDGLAVVSQP
FT                   DGYGVHLYLETDTSDPAVCSPRWLPDPARLFNGNGSVPFSSGLAPRAEFLAAVNRRDVR
FT                   NTLKQELEALCKLRAPQARWQWLEPPLKASELMPVSLPALEYPDLLTDPAEEKEREDKL
FT                   LKED"
FT   gene            complement(263394..263858)
FT                   /locus_tag="sync_0256"
FT   CDS_pept        complement(263394..263858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0256"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45890"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDI0"
FT                   /protein_id="ABI45890.1"
FT                   /translation="MPQHTPQYPAILMDPSKPILWVHEEALGPANPALQDYPNAPGLFV
FT                   FDDTWIEDQSISRKRIGFLYESALSLPLTLRRGDVAREVLGFAQRHGADAVVTSTVVDP
FT                   RLQRIAAAIDRELPLWMLDPDPFVELHKPPRLGRFSRYWREAEPVVWETF"
FT   gene            complement(263822..264769)
FT                   /locus_tag="sync_0257"
FT   CDS_pept        complement(263822..264769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0257"
FT                   /product="blue light photoreceptor cryptochrome"
FT                   /EC_number="4.1.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46662"
FT                   /db_xref="GOA:Q0IDH9"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDH9"
FT                   /protein_id="ABI46662.1"
FT                   /translation="MSRLPHAAPLSWPSESTDLPRDLLERTALNSLLSQEFPNALGELS
FT                   PIEGGRAAAERQLSAMDAKRYGRSRNHLNGSVTRLSPYIRHGILTLAEVRDAVFSQLKQ
FT                   TSQRRDNGEKLINELGWRDFWQRMWLDLGDRIHDDQEDHKTGHAASEYEQGLPDDIREG
FT                   RTNLACMDGFRNELVTQGWLHNHARMWMAAYLVHWRRVHWRVGADWFLEHLLDGDPASN
FT                   HLSWQWVASCFSHKPYFFNRQNLERYSSGRYCQECPSNESCPFDRSYEQLEQQLFKVQP
FT                   AIREVTARRSHRSGSRSSKKSSQCPSTRPSTQRF"
FT   gene            264880..265662
FT                   /locus_tag="sync_0258"
FT   CDS_pept        264880..265662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0258"
FT                   /product="enoyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.3.1.9"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47476"
FT                   /db_xref="GOA:Q0IDH8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDH8"
FT                   /protein_id="ABI47476.1"
FT                   /translation="MLLDLTGKKILVTGIANNRSIAWGIAQQLKAAGAELGITYLPDEK
FT                   GRFESKVRELTAPLEPSLFLPLNVQDAAQMETVFAEIKDKWGQLDGLVHCLAFAGKEEL
FT                   VGDFSATTAEGFARALEISAYSLAPLCRHAKPLFSEKAGVVTLTYLGAERAIPNYNVMG
FT                   VAKAALEASVRYLSAELGPEKQVRVNAISAGPIRTLASSAIGGILDMIHNVEEKAPLRR
FT                   TVTQNEVGNTAAFLLSDLSSGISGQTIYVDAGYCINGM"
FT   gene            265659..266558
FT                   /locus_tag="sync_0259"
FT   CDS_pept        265659..266558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0259"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47891"
FT                   /db_xref="GOA:Q0IDH7"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDH7"
FT                   /protein_id="ABI47891.1"
FT                   /translation="MIRPRGCLDYLKLSWWLIVHQGKSLLLATLLCAISLPLNEIISTA
FT                   LLPEALVQVLGLLLSLFLGFRYSQAYNRWLEARVLWGALVNHSRSWRDLLVRVLPRQLP
FT                   LSWKRRLLQEVVLLVWCLNAQLRSSKGSAVLLPEPVRELGVKIGLRNLSVQSLLKRMAR
FT                   EQHLLRQGGWVDSFQSSEFGLLQQAFTNVIGGLERIRHQPLPASSTFFIRGMTWVYGYL
FT                   VFLKLDALGHISAALLGWLVFLIFLMAERIGTFIERPFVDARFALPMDHFCALISLDLL
FT                   GASSPLAKPSSTKGPWLR"
FT   gene            266613..267218
FT                   /gene="hisB"
FT                   /locus_tag="sync_0260"
FT   CDS_pept        266613..267218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="sync_0260"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="identified by match to protein family HMM PF00475"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46270"
FT                   /db_xref="GOA:Q0IDH6"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDH6"
FT                   /protein_id="ABI46270.1"
FT                   /translation="MRTGEIHRVTGETDVSVRLGLDGSGRCQASTGVPFLDHMLHQISS
FT                   HGLIDLEITASGDTHIDDHHTNEDVGIAFGQALSKALGDRRGIYRFGHFVAPLDEALVQ
FT                   VVLDCSGRPHISWGLTIPTQKIGTYDTELVKEFFVAVVNNSGLTLHIRQLDGVNSHHIV
FT                   EACFKAFSRALRMATEIDPRRSGLVPSSKGVLEQAGGS"
FT   gene            267274..268788
FT                   /locus_tag="sync_0261"
FT   CDS_pept        267274..268788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0261"
FT                   /product="Retinal pigment epithelial membrane protein"
FT                   /note="identified by match to protein family HMM PF03055"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46919"
FT                   /db_xref="GOA:Q0IDH5"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDH5"
FT                   /protein_id="ABI46919.1"
FT                   /translation="MRLGSPVTVAPTSARFNRSEWSSAFRNVEEELTDVPLKPVRGAVP
FT                   DALRGTLYRNGPGRLERDGQRVHHPFDGDGMITALHFDADGVRCSNRFVRTSGWKAEEA
FT                   AGKVLFRGVFGSQKPGGPLANAFDLRLKNIANTSVVRLGDDLLALWEAAEPYALDPQTL
FT                   ETRGLSLLGGVLKRGEAFSAHPRFDPGHHGDPRMVTFGVKTGPRSTIRLMEFATEDNAA
FT                   AGIRAGDLLSDRRDTFAGFAFLHDFAITPNWAVFLQNAINFNPLPFVLGQKGAAQCLTS
FT                   NPNGKAKFWLIPRDSGTFAGQEPRVIDAPDGFVFHHLNAWEEDGDVVVESIYYSDFPSI
FT                   GPDQDFADVNFDLIPEGLLEQCRINLISEKVDTTRLSERCCEFAMVNPNQEGLPCRFAW
FT                   MAAAARERGNDPLQVVKKLDLQTGEKLIWSAAPSGFVSEPIMIPRPNASDEDDGWVLDL
FT                   VWNGARDASDLYILDARDLSEVALLELPLAIPHGLHGSWSESSLQP"
FT   gene            269019..271727
FT                   /locus_tag="sync_0262"
FT   CDS_pept        269019..271727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0262"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45999"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDH4"
FT                   /protein_id="ABI45999.1"
FT                   /translation="MLFSILFKGKLGNVYNSFLYSFWGKKSSASPYDKTSLGDNRDEPE
FT                   FDLVSSIDEKAKLALTVFSGDIKIAPNGLELNNDIELQSTGLELNSDTEFKPTSLELSN
FT                   DIELQSNGLELSNDIELQSNGLELSNDIELQSNGLELSNDIELQSNGLELNSDIKLKSV
FT                   DFFPESQFVSDGNEINVTLESSTQISGINALPTTFKIQSETGTPRANSSLISFADSSSQ
FT                   NFSAKSLLAPWLDLIKEPVVNSGSFQDAFSSVGNFNSLIKNILQLNPSSLKIQPLENLA
FT                   GVFDTADHLLAWNTLALDFATASVSGPTPCSRFFGYLNISQWDSWAVFEDTAIGSIYNK
FT                   EKQASFISLLDSFEISSNDLAEFKCLYQASTKIVQEILEHAVRQVAMDVSAFNVVSGIE
FT                   TSLFKEGIPESLVGAAQKLLAKNLDLSELGKKIGDLVVSIGTNIGETVSSSINQYALGD
FT                   GSNQLGFYADTTDYIPSPSVYDPNDPNTKIDSSWQPLEGQSALTPQWGAVTPFAIEPDN
FT                   LIPSSSIVTPYTELGELNSDFIDELMNVRDKRLNLTAEEAAIAEYYEGGPFTSFPPGLW
FT                   QQQSVDLSISRNLDLDQALKLNLGVSLALSDAGIATWNLKYSANTVRPITAIRQYKPDT
FT                   VLSDGSLAGDWEPYLDTPPFPDIASGHSAFSSSANYIFNQSFESNYFDFSVTLADDDSV
FT                   YSVDGFDGIPGVGDDVTIQAVYFTGAAAQAGDSRIYGGIHLKDGDLKGQIIGYITGLKV
FT                   SRKIDSLEQGISLEELSSLPVQSFGTMKSDILTGLSMEDFDEISVHQLYAFDGDDTLIA
FT                   KGESLWQLYGGSGMDTFQLFETGSVSLRDYERMEEIELASTIFQQGESIDDIQFTISAT
FT                   GPFTDVSINDRLLFVMDGYWISDDVSVSILA"
FT   gene            271865..273304
FT                   /locus_tag="sync_0263"
FT   CDS_pept        271865..273304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0263"
FT                   /product="two component sensor histidine kinase, putative"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46774"
FT                   /db_xref="GOA:Q0IDH3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDH3"
FT                   /protein_id="ABI46774.1"
FT                   /translation="MTQHNISIRRRLGYSLVGLFTISFGILLIATNQIIKRDRLQRHER
FT                   LVMATAMAIKTEFEDVSQKPVGQEESLDNQRYRQILNNFSATRVLVWLSRPEADPLFPN
FT                   TATVQQFFGNPKLLEAAGVNASGMQKPRSFVFDGQTYFTCSMPLPGNQGVLRFLEDVGV
FT                   SPAGRQENLIFLFVVWIFSVAIATVLIRRFLTSSLLPLIKLESVMDDMSLRPTGLVSEK
FT                   RVPIESQPNELQGIVKSYNRLADRLQESWSNQLLFIRAVSHELITPLTLINSSARRLDR
FT                   RLTDLSDSDRKLLASIRKEVWDADHLVRDLVDLARSESGSLKLKLSSVKAMDVIADLSA
FT                   ELEPLAWGNRVQTPSPENLSIVETVMISVNSDRLRQCIINVLENASKYSPEDAPIDLSV
FT                   TSDDCNIYFDVQDYGPGISQEDQRTIFKPFQRGKSDLNDVPGGGIGLALVHQIVRLMNG
FT                   SIYILSSGESGTIMRFEFPIE"
FT   gene            273633..274598
FT                   /locus_tag="sync_0264"
FT   CDS_pept        273633..274598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0264"
FT                   /product="probable transcriptional regulator, AraC family,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47227"
FT                   /db_xref="GOA:Q0IDH2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDH2"
FT                   /protein_id="ABI47227.1"
FT                   /translation="MPQQHVSGSGGIVKLELDQCLSAWVSRIDPRFHSEEDDASLEVAG
FT                   SEYLGSNLSIVKVSSRGHVKSILARNPQDLFSFGISDVGLFRGVAGNREIFSNPQRLAF
FT                   ILLPGESIKLVPAAEFFSGYIFHIKSEYLLSESIKHGTQLPSLLTLHDAIPGHEQLILA
FT                   CANQLLKFFALGDEIGSLRVLQPLEESIVSLLATLISVEPDLLVSGKQAQSQPSYVQIA
FT                   LSYMENNINKNITLSDLCIACSVSGRTLQVAFQAVMSRTPLQVLQELRLNRLRDKIIDG
FT                   MDISSACEQVGIQHSGRISAKYKQLFGELPRNTRSRRTRS"
FT   gene            274849..275259
FT                   /locus_tag="sync_0265"
FT   CDS_pept        274849..275259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0265"
FT                   /product="two-component response regulator"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45644"
FT                   /db_xref="GOA:Q0IDH1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDH1"
FT                   /protein_id="ABI45644.1"
FT                   /translation="MLSCDSIQSTKAALMSANPILIVDDDPRIRSALQVELDELGISSC
FT                   FFDNAFDLIDYASANPSAGIFVDLLLPQMNGIDCVKRLRLLGYKGCVFVCTSLCDGDIK
FT                   KQALDAGATDYFVKSDLFNDLEKIVSSCFVSA"
FT   gene            275966..276685
FT                   /locus_tag="sync_0266"
FT   CDS_pept        275966..276685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0266"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE22049.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46456"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDH0"
FT                   /protein_id="ABI46456.1"
FT                   /translation="MWRPFRKVAFIISAMITPLGFQVSFWSAAPALASVQICSGTLLEI
FT                   QVQESVTTSSDRFRFSLGLLAEAPSKAAAMALLNQRLDRARQELRPFVLDALSIPSPRS
FT                   YSYGSGSSSSPKLERASTRIGGVVSRDNYDALIQLAGRLPGVRLQDMTSLTSSSGGVAL
FT                   DDLLLKRALKEGRRRANVTARALGLARVDLLRINERGGRVRPVAYAEARMSKPAFRPDE
FT                   APKPQRTLTLGLDYCLR"
FT   gene            276764..277912
FT                   /locus_tag="sync_0267"
FT   CDS_pept        276764..277912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0267"
FT                   /product="possible transporter, MFS family protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46910"
FT                   /db_xref="GOA:Q0IDG9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDG9"
FT                   /protein_id="ABI46910.1"
FT                   /translation="MAWLIWAETSFQFYDHALGRDLQLSASRISLIAGSFLVPYGLLQI
FT                   PVGRLLDQGRVDRWIWIAALMASGFSLTFAFSTDLVGLMLSRMGTGVACAVAFPASALL
FT                   ARRALPENRFALAMGLTDSLLGWGAVFAALIPLVFPWTVWRQLVLFQALFLAVMVVVPV
FT                   MALGRGLPSPEPHSHGRLPTSVYWDRAGVGKVIKACLMYAWGGGFVFGLAQYGLISGLR
FT                   VWGSERTQWMSLTMSFGIGIGMVLAGWIGSRSSRRGLVLLIGTGMSVLALIALLQLPNQ
FT                   AGGLLLLAAFGLGLGLGSSVLAFPIAEDAAPPGQTALTIAIVNTTGTVTGGVMSIVSGL
FT                   ILEASGPGELSPVLVVYGLFGLFGVAVAAWIQFGSAPAHSAD"
FT   gene            complement(277897..279561)
FT                   /locus_tag="sync_0268"
FT   CDS_pept        complement(277897..279561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0268"
FT                   /product="Glycine betaine transporter"
FT                   /note="identified by match to protein family HMM PF02028"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47714"
FT                   /db_xref="GOA:Q0IDG8"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDG8"
FT                   /protein_id="ABI47714.1"
FT                   /translation="MILWPVLPAAINPLQTSPAGAINATPCAPESLLIRPLSESPTPVR
FT                   SSLSQPPLWVGAIPLLIFLLVSAIDLALAKHFTETGKTIVSHALGGLWQWMVMLLFLIA
FT                   LAIAISPVGKLRLGGATAKPSLKFFDWCAVLICTLLAGGGVFWSAAEPLYHFQTPSPVF
FT                   EGVVGSTAAAVDPALAVSFLHWGFLAWALVATTTTITFSILEQRGEPLWPRTLLVNILP
FT                   KGWVNGPIGDLADGLSVVAAIAGTVGPLGFLSLQLSNAAGQLPWLSDSAGLQSLVVVLL
FT                   TAVFATSTVSGIQKGIKWLSELNVWLTLVLGAGLLILGPGIWLIQHFFSGFWTYLLHLP
FT                   QMALMPRSDVTEPWLNSWTVFYWGWFLGYAPLMGLFTAGVSRGRSIRELVLAVAILCPI
FT                   VTNLWFTLLGGTGMNLELAGSGISDALAQNGAAAALLAILSALPLSGLLIPIGLLLVVL
FT                   FMCTSADSMSYAAAMVVSGRNEPSQRLRLFWALMIGSLTLVLLRIGTGLGDSTSIDALQ
FT                   AFIVITAVPVTPLVLFTLWSAPRLAFKEWQRSGQSAE"
FT   gene            complement(279473..280627)
FT                   /locus_tag="sync_0269"
FT   CDS_pept        complement(279473..280627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0269"
FT                   /product="putative sarcosine oxidase"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45383"
FT                   /db_xref="GOA:Q0IDG7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDG7"
FT                   /protein_id="ABI45383.1"
FT                   /translation="MVIIGGGMAGLSCAASLARRGISDVILLEGKTLAHARASSFGETR
FT                   MFREMYSDPVLCRLAQEANRLWREEETHAGEILRDTHGLLFYGESWDEETIEGSIPGAR
FT                   LVMDDQGIPYEALSAAQIAERFPLKPKADFTGLFEPTAGAVRSDKVIAHWVRTARTAGH
FT                   QLEEHSPVSSIDADGGGVTLEGGHHISAGHVVVACGIWSQLLLAPLGLAPKLEIWPMLW
FT                   AHYTVDPALASRYPQWFCFQKERGDDGGLYYGFPSLSTTADGRPRIKAGIDWSPKELRV
FT                   AEPNAMCTEAPARLLELLDTFLFNELDGVQERVETVMSPYSMTSDVNFVLDRLTPKLSL
FT                   FAGGSGQSFKFAPLIGDSLARLASGDQPAADISCWSHQRDAVRA"
FT   gene            complement(280657..281721)
FT                   /locus_tag="sync_0270"
FT   CDS_pept        complement(280657..281721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0270"
FT                   /product="possible leucine dehydrogenase"
FT                   /EC_number="1.4.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46415"
FT                   /db_xref="GOA:Q0IDG6"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR016211"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDG6"
FT                   /protein_id="ABI46415.1"
FT                   /translation="MTMASLQSAGPPAVSVLAQHVSDHLSVFVVAESSDTGKPANGGLR
FT                   LLNYSSDEACIADGHRLASLMTHKHDLYGTGFAGGKIVARAAEPGAVKDELINVTAELL
FT                   QSLNGAMITGCDLNTSLQDMERLMSLTPHVLAAVGSPVDASAATAFGTVGAVEAVLAQS
FT                   LTEAKPGKALVHGCGAVGGTVAKTLIQHGWDVFTVDMDPKRAGLSGATPLPPSSAWWEQ
FT                   ELDLLLPCSISGLIDPEMARSFQVRAIVPAANAPFQEPEIADDLRRRSIRVLPDPLVNA
FT                   GAVIADSIERFSPEAWGKATPQQVYDFVRHEVRQRATDFLKQRGDGLTVSDALVEVAAH
FT                   TGKDPIGLSFGIAA"
FT   gene            complement(281721..282776)
FT                   /locus_tag="sync_0271"
FT   CDS_pept        complement(281721..282776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46501"
FT                   /db_xref="GOA:Q0IDG5"
FT                   /db_xref="InterPro:IPR005299"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042086"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDG5"
FT                   /protein_id="ABI46501.1"
FT                   /translation="MLLTRSMAIAMTTGYSAQTEGARLCIDAASDWALTCVEQLTNDCS
FT                   HVLMDYGAADGGTAVGLWSQVLDRLHKRQPKAHLTLIGNDLPSNDNVALAENIAKQLGR
FT                   PPNPTVLVSARSFYEPLVAPETVSFGFSATAMHWLSESPGPLNTHTHVLASDDKEALER
FT                   FTAQAMKDWASILELRSVELAVGGRLLTVNLSRDEEGRYLGHNGGVTRNVHDQLHQIWR
FT                   SLADEGVISEEIYRKGTILNFYKSPEEFMAPLKDKTSAAYLNGLRLVDERTVHVPCPYR
FT                   KRWNEDADTAAFAEGLMATIRSWSRHSFASVAGDETADLVYERLKQRIADSPEEWSLDY
FT                   VEHHQIMERVA"
FT   gene            complement(282801..283421)
FT                   /gene="rdgB"
FT                   /locus_tag="sync_0272"
FT   CDS_pept        complement(282801..283421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgB"
FT                   /locus_tag="sync_0272"
FT                   /product="non-canonical purine NTP pyrophosphatase"
FT                   /note="identified by similarity to SP:Q8XCU5; match to
FT                   protein family HMM PF01725; match to protein family HMM
FT                   TIGR00042"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45643"
FT                   /db_xref="GOA:Q0IDG4"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDG4"
FT                   /protein_id="ABI45643.1"
FT                   /translation="MTNRVLVIASGNAGKIREFSNLLQELPLQVNPQPDGIQVEETGIT
FT                   FRDNALLKARAVAEATGHWALADDSGLSVDALGGAPGVYSARYANSDPERIERLLKELG
FT                   DRTDRQARFSAALCIAAPDGSVLAAVEGYCEGSITFSARGTQGFGYDPVFEVKNSGLTF
FT                   AEMTQDHKKQHGHRGRAFALLKPELEKLLENDPGQDAGATPIP"
FT   gene            complement(283418..284881)
FT                   /gene="pmm"
FT                   /locus_tag="sync_0273"
FT   CDS_pept        complement(283418..284881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmm"
FT                   /locus_tag="sync_0273"
FT                   /product="Phosphoglucomutase/phosphomannomutase family
FT                   protein"
FT                   /EC_number="5.4.2.8"
FT                   /note="identified by match to protein family HMM PF00408;
FT                   match to protein family HMM PF02878; match to protein
FT                   family HMM PF02879; match to protein family HMM PF02880"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46785"
FT                   /db_xref="GOA:Q0IDG3"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDG3"
FT                   /protein_id="ABI46785.1"
FT                   /translation="MVSSPLPLDASPIRFGTDGWRGILGVDITVERLLPVAVAAAQELL
FT                   HQAPEGLNSRTVVIGYDRRFLAPELAEVVAAAVRGCDLEPLLTDTAVPTPACSWAVVER
FT                   QVLGALVITASHNPPEWLGLKIKGPFGGSVEGTFTAAVERRLAAGGITVPMAGSCERFD
FT                   GRGEHLAGLRTKLDLQALTVGLRAMGLHVFVDPMHGSAAGCVEELLGDDAKDLITEIRT
FT                   NRDPLFGGCAPEPLAPHLGELIAAVKASKAAGRNAVGLVFDGDGDRIAAVDENGGFCST
FT                   QQLMPLLIDHLARAKSLPGSVVKTVSGSDLMRLVAEDLGREVLELPVGFKYIAAEMLTG
FT                   EVLIGGEESGGVGFGMHLPERDALFAAMLVLEALVEGKQPLGERMTAIQERCGGEAHYD
FT                   RLDLRLADMDSRRRLEALLADTPPQEVAGSPVVEVVTTDGVKLRLGPSHWLMLRFSGTE
FT                   PLLRLYCEAPSPSRVEEVLSWARTFAAAI"
FT   gene            284934..286436
FT                   /locus_tag="sync_0274"
FT   CDS_pept        284934..286436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0274"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46882"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR025567"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDG2"
FT                   /protein_id="ABI46882.1"
FT                   /translation="MGATPLADKPLTDRLLRSWVRCRRRAWLDRHANPDDRLYTAHRTL
FT                   QLDDQQRSFVALLPGKPGYGLAACKRGDTGVVGVRLRGVLLDDSAPKGLDLEAHPPLLE
FT                   RVKGASRWGDFAYRPVIARQGRRLNREHRLQLALAGRLLVEFQGGPVPNGLAVAGAGRR
FT                   LERERLPLGSSLNRQLEESLLRLSADINRPDPPALAADRRKCTLCSWRGLCNDVASQEG
FT                   HLSEVSGIGAKRREMLQDIGINSLQALAAANPKELGGQLKRFGDQHAAMAAPLVAQARV
FT                   QRDGVVKRLDALPALPELRNAPGVLLYDIESDPDARDDFLHGFVRLPNDGLPNDDVHSW
FT                   DLKRATYHPLLVLQEHGEKRCWQRIRKFLATYPDWLILHYGETESLALLRMAKRQGASD
FT                   QEQQALRERLIDVHARLRAHWQLPLSSYGLKAVAGWRGFKWSQSGVDGARALLWWRQWR
FT                   GEGVKARGSCHALRWILTYNRDDGLATWAVAQWLLSGDQRPA"
FT   gene            complement(286433..287287)
FT                   /locus_tag="sync_0275"
FT   CDS_pept        complement(286433..287287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0275"
FT                   /product="Glycine cleavage T-protein (aminomethyl
FT                   transferase) superfamily protein"
FT                   /note="identified by match to protein family HMM PF01571"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45090"
FT                   /db_xref="GOA:Q0IDG1"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDG1"
FT                   /protein_id="ABI45090.1"
FT                   /translation="MSQLLWDHNFPVLRLEGSGSRTFLQGQTSADVQQAEEGDLLPACW
FT                   LDATGRVQALLEIRMDATGADVLVLAGAVDAVSQGFDRVIFPADRVRLKGIRQQRRQEL
FT                   LVQAQPMEPVNVFWTEDEPSASDRFPASEAANATQLDRWRIGQGWPLSAGELDGTTNPF
FT                   ELGLSPWVHLNKGCYLGQETVAKLASKGEVKQQLRSWRAFSSELQGTVPQRGTVLRRQG
FT                   ERAGVITSALEIASAEGLPQEWIGLALVRRQALADPQLSLDNDQGSIQLFKPQAFSEPP
FT                   KRV"
FT   gene            complement(287284..287853)
FT                   /gene="pyrE"
FT                   /locus_tag="sync_0276"
FT   CDS_pept        complement(287284..287853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="sync_0276"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR00336"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45906"
FT                   /db_xref="GOA:Q0IDG0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDG0"
FT                   /protein_id="ABI45906.1"
FT                   /translation="MSQRFEHDPLLERLAKEAYRHGNFTLASGRSSHHYVNCKPVSLSG
FT                   SGLALLCPAMLALVETDAAAVGGLTLGADPLVSGVALAAAQRGRSLNALIVRKQAKGHG
FT                   TGAWLEGPLPEQGALVTVLEDVVTTGGSSIKAVEQLRAAGYIVNRVVTIVDREEGGAAA
FT                   MQAAGLELHSLYRLEEVAAQSRELQA"
FT   gene            287833..288432
FT                   /locus_tag="sync_0277"
FT   CDS_pept        287833..288432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0277"
FT                   /product="possible Occludin/ELL family protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47330"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDF9"
FT                   /protein_id="ABI47330.1"
FT                   /translation="MFKTLRHRGWCAANPLPSLRAVVTVFVRRLPFGVLVIMGPLALWQ
FT                   ADPGQANPVVCVTSLEAPSHSSSGGEVLAPVEVSRCGPVKTTESLVTERFYTWTAPFAR
FT                   GVDVMHQFTDILGIAVAGPEGNKVMGFGFPDQTIVWDGSAVQSTYQALLEEQSPAIPWR
FT                   TVDISNGFTSSLAEEGQVRMPIEWNDPPSAPIRALW"
FT   gene            288447..288519
FT                   /pseudo
FT                   /locus_tag="sync_0278"
FT   tRNA            288447..288519
FT                   /pseudo
FT                   /locus_tag="sync_0278"
FT                   /product="tRNA-OTHER"
FT                   /note="tRNA-Pseudo"
FT   gene            288534..289811
FT                   /locus_tag="sync_0279"
FT   CDS_pept        288534..289811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0279"
FT                   /product="Conserved membrane protein containing two CBS
FT                   domains"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01595; match to protein
FT                   family HMM PF03471"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46507"
FT                   /db_xref="GOA:Q0IDF8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDF8"
FT                   /protein_id="ABI46507.1"
FT                   /translation="MRNLLLIALLVLPAFFAASELALLRLRPSRVHELREEGLPGAPAV
FT                   ERLQRRLRTALLMTQFGTTLSLVALGWIARGFGQRWWPMETPAGRWWDLAWFLVLVILA
FT                   TLLSGLLPRALVLSRPEPAALELSPVLETTMQVLRPLLSVLEVIASLLLRLVGLKPRWD
FT                   ALVPALTAGELETLVESGGVTGLRPDERNILEGVFALRDMQVREVMVPRSGMVTLPVEV
FT                   RFAELMEAVHRTRHARFPVIGQSLDDVRGVLDLRRLAEPIARGELQKHSALEPYLSPAE
FT                   RVLETSNLAELLAIIRSGHPLLLVVDEHGGTEGLVTAADLTGEIVGDEPEHESAEPDLQ
FT                   AIEGEEGAWLVAGDLEILELNRQLDLDLPEASEHHTLAGFLLERLQHIPAAGEALRHNG
FT                   VQFEIITMRGPRIVQVRLVIPGVTNL"
FT   gene            289865..290869
FT                   /locus_tag="sync_0280"
FT   CDS_pept        289865..290869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0280"
FT                   /product="Predicted dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by match to protein family HMM PF01408;
FT                   match to protein family HMM PF02894"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46093"
FT                   /db_xref="GOA:Q0IDF7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDF7"
FT                   /protein_id="ABI46093.1"
FT                   /translation="MTDPMVPVKVGVIGIGNMGWHHARVLSLLKDADLVGVSDPDAKRG
FT                   ALAKDQFDCRWFADYREMLSEVEAVCIAVPTLLHHAVGLACLEAGLHVLIEKPIAASQE
FT                   EAASLSESASRVDRLLQVGHIERFNPAFRELTKVVANEEVVVLEARRHSPHSDRANDVS
FT                   VVLDLMIHDLDLVLELAGASVVHLSAAGGRSSQGPIDYVNATLGFDNGVVASLTASKMS
FT                   HRKIRSLSAHCRGSLVETDFLNHTLHIHRRAHEWYSADHGELLYRNDGFIEEVSTTSIE
FT                   PLYAELEHFLQCVRGRETPAVDGQQASRALRLADMIEQAVERPGVGIALDAPI"
FT   gene            complement(290871..293993)
FT                   /locus_tag="sync_0281"
FT   CDS_pept        complement(290871..293993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0281"
FT                   /product="phosphorylase kinase alpha chain"
FT                   /EC_number="2.7.11.19"
FT                   /note="identified by match to protein family HMM PF05682"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45270"
FT                   /db_xref="GOA:Q0IDF6"
FT                   /db_xref="InterPro:IPR008734"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDF6"
FT                   /protein_id="ABI45270.1"
FT                   /translation="MAIDAVVLQRQHPVSGLLPASTANTVHGNYGDAWVRDCVYSIQCV
FT                   WGLAIAHRRLQRGTTQRSWELEQRVLGLMRGLLNSMMRQASKVERFKHSLDPLDALHAK
FT                   YNSANGDQVVADDGWGHLQLDATSLFLLQLAQLSRGGLAVIRNRHEVAFIQNLVYYVAR
FT                   AYRVPDYGIWERGDKGNQGLPERNASSIGMAKAALEALDGVDLFSSHGDGSMQVLVPQG
FT                   AVVRLRRALQGLLPRESASKEVDSACLSVIGYPAWAVEERDLVERTIQRIRRELGGPYG
FT                   YKRFRRDGHQTVIEDVSRLHYERAELVNFEGVESEWPLFLAYEQLTACCEKRWTDAHYW
FT                   QERLKILQVECHGQQLYPELYLVPDSAVELERRAPGSQQRLANDNVPLLWTQSLAWLGE
FT                   MLIEGLIEPADLDPCGRRFQAEIGAEQVLVALAPTSSALADELKARGLPVSDPQTSLIQ
FT                   VVPSSNLNDRLSAVGGDEALRLSGQPMLRADTSDTARLYQQDDEKFAVLPAVLEEDTFF
FT                   VSHDPRQLMETVINELHLLQRHWRGEGSPLLLIPVEASLLENNPELLMDLTRRLHSGRI
FT                   EDVPVCFSDLETLAQSAQWVTLPAATARNNTHQRSDATRYLQASTDFSDLTAAQEQELD
FT                   DIPLGELRDRLWSSHSLREQAEVLELLKRQLGHRAILSGPQGTPVELVTLLEEIYHRGL
FT                   SQEDWNVARRCAGAMGLVHPQLEDAVIDLLSRQKQVVVGRNYTSDSRLSAPASSPAIAA
FT                   LIERTCGNDGRERMLQQELLVALDGLARREPEKLKGTLTLQLGQLLLLLTSELAAERQL
FT                   SQDEAFEALCSEAPHAISLRLQALLNDVDHARAALQRRELLHLRGHVQWSVPEPLEERP
FT                   SGSDWLQHRMRLGSLQQVPKEFYAGIWSLLHHCRGLVIGDKLERRNRLTSALVLEKTPG
FT                   ERNFAIQVEHLLSRIEAAEYRQLCTESLLSLMAFTMTNPDMRFEDDIALDVVIGHAVRV
FT                   GWQSTYPEQDTGAYSQHKAAAWEQFYQASPAQCRRWQIKALKELAEQEGLL"
FT   gene            293986..294897
FT                   /gene="rffM"
FT                   /locus_tag="sync_0282"
FT   CDS_pept        293986..294897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rffM"
FT                   /locus_tag="sync_0282"
FT                   /product="Glycosyl transferase WecB/TagA/CpsF family
FT                   protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF03808;
FT                   match to protein family HMM TIGR00696"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46935"
FT                   /db_xref="GOA:Q0IDF5"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDF5"
FT                   /protein_id="ABI46935.1"
FT                   /translation="MAISRLFSFSRRSSCCSLGFGCDKTVAFQATGFRFSLADELGMDI
FT                   TSTGPRDQRRFQVLGVPVDACRDVTAAAIGVHADGGGQIVTLNAEMTMAARANLRLGAV
FT                   IADADLVVPDGAGVVWALRLQGVRVRRSPGIELAWELLSYAEAHGWSVALVGSAPQVME
FT                   RLCDRLVVERPELRLVLAQHGYLTEEDWPQLEANLCELNPDLVLVALGVPRQELWVQRL
FT                   KASQTGVWMGVGGSFDVWAGLKERAPQWASRLQVEWLYRLLQEPSRWRRYLALPQFVWA
FT                   VLLSGSRRKPAKQKQATGKTTE"
FT   gene            complement(294836..294979)
FT                   /gene="psbK"
FT                   /locus_tag="sync_0283"
FT   CDS_pept        complement(294836..294979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbK"
FT                   /locus_tag="sync_0283"
FT                   /product="photosystem II reaction center protein PsbK"
FT                   /note="identified by match to protein family HMM PF02533"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46663"
FT                   /db_xref="GOA:Q0IDF4"
FT                   /db_xref="InterPro:IPR003687"
FT                   /db_xref="InterPro:IPR037270"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDF4"
FT                   /protein_id="ABI46663.1"
FT                   /translation="MAVYTLDLLAQLPEAYQAFGPLIDILPIIPLFFLLLAFVWQASVG
FT                   FR"
FT   gene            complement(295010..296128)
FT                   /gene="tgt"
FT                   /locus_tag="sync_0284"
FT   CDS_pept        complement(295010..296128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="sync_0284"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="identified by match to protein family HMM PF01702;
FT                   match to protein family HMM TIGR00430; match to protein
FT                   family HMM TIGR00449"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46127"
FT                   /db_xref="GOA:Q0IDF3"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDF3"
FT                   /protein_id="ABI46127.1"
FT                   /translation="MFQFEIQATCSNTGARCGCFHTPHGPVTTPRFMPVGTLGTVKGVT
FT                   TSQLAETGAQMVLSNTYHLHLQPGEEIVADAGGLHRFMGWDGPMLTDSGGFQVFSLGDL
FT                   NRIDDEGVDFRNPRNGSRILLTPERSMQIQMRLGADVAMAFDQCPPYPATENDVAEACR
FT                   RTHAWLGRCADAHQRDDQALFGIVQGGCFPHLRDLSARTVASFNLPGIAIGGVSVGEPV
FT                   EEMHQIVRQVTPLLPADRPRYLMGIGTLREMAVAVANGIDMFDCVLPTRLGRHGTALVG
FT                   GERWNLRNARFRHDHTPLDPNCPCIACRQHTRAYLHHLIRSEELLGLTLLSIHNLTHLI
FT                   RFTTAMGQAIRDGCFSEDFAPWEPSSRAHHTW"
FT   gene            296188..296952
FT                   /gene="cobS"
FT                   /locus_tag="sync_0285"
FT   CDS_pept        296188..296952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobS"
FT                   /locus_tag="sync_0285"
FT                   /product="cobalamin 5'-phosphate synthase"
FT                   /EC_number="2.7.8.26"
FT                   /note="identified by match to protein family HMM PF02654;
FT                   match to protein family HMM TIGR00317"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47184"
FT                   /db_xref="GOA:Q0IDF2"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDF2"
FT                   /protein_id="ABI47184.1"
FT                   /translation="MASAPSWLRDLVGAWIFYSVLPAWPWPQPRFERIARFAPWIGLVI
FT                   GGLQAGLWWFLSGLGWPHVALVPSVLALGLFLTGGLHFDGLIDTADGLAAGPERCLEAM
FT                   EDSRVGASGVQLSVVVLLLQFAALVRLGSLAPIALVVTSALARVSPLWAMARFTYLKVN
FT                   GTAGFHRRHQKGLGDAVPTLFLLVLVSPLLQQLPLLTVPICLLSALVTAEWLGRRLGGM
FT                   TGDGYGAVVMLSETSSLLLVGLLAPSLGSGGG"
FT   gene            complement(296897..297916)
FT                   /locus_tag="sync_0286"
FT   CDS_pept        complement(296897..297916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0286"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45664"
FT                   /db_xref="GOA:Q0IDF1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDF1"
FT                   /protein_id="ABI45664.1"
FT                   /translation="MLDQWPPDGGRLPEIADDPILRLPSPERHWFPLRHDDLLLGVLRA
FT                   EQHREAKWSDQLDRRLQASASALAYSLGLELERSRLLEELQQQRQQMNLVVHQLRNPLA
FT                   ALRTYAQLLLRRLGPEHLQRPLVTGLLQEQAQLDRYITSLDLIGQENLPHRPEAPAPLL
FT                   LPQVQSKGPGLTIEQVLQPLIERAAATAALQNRAWHTPPNWPAWTQEIRPDDDAVISEI
FT                   VANLLENAFRYSPTGCSLGLSLFDHSILIWDEGPPIPDQEQELIFRKGERGSSSKDQSG
FT                   SGLGLALARHLAEERGGALVLHTRPNQLDPNLPSRGNAFLLSLPPSPAKEPKGLPTTN"
FT   gene            298357..298803
FT                   /locus_tag="sync_0287"
FT   CDS_pept        298357..298803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0287"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46344"
FT                   /db_xref="InterPro:IPR021498"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDF0"
FT                   /protein_id="ABI46344.1"
FT                   /translation="MVVCRCETVPIFLDSPLSLPQQGFCSMSKKRKRISRRRLAGQRVL
FT                   AHVPTHHLETGEHKPVTAARRYIAEGVLMPPALVNVRRNEHTTDRFFWGEKGLFSAQYA
FT                   EENHFLFPSLRSIVDHVGEEVIFEGLDLASDDWEEMEEYEYAFV"
FT   gene            complement(298861..299484)
FT                   /locus_tag="sync_0288"
FT   CDS_pept        complement(298861..299484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0288"
FT                   /product="Predicted esterase"
FT                   /EC_number="3.1.2.-"
FT                   /note="identified by match to protein family HMM PF02230"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45142"
FT                   /db_xref="GOA:Q0IDE9"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDE9"
FT                   /protein_id="ABI45142.1"
FT                   /translation="MAADLLRQPSTKARARLILLHGWGADAGDLMPLGQALAETIATPL
FT                   ELVALQAPQLQTQGSGRQWYGLFPADWAAVPAAVERLKKRINNLGSTEIPLEATVLLGF
FT                   SQGGAMAMAAGCDLPLAGLIACSAYPHPKWQAPLIRPPVLLLHGRQDDVVPHSAALTLK
FT                   EELVQSNQTCDLFSFDNGHAIPVEAQAEMKKALKRWLDQPAQSA"
FT   gene            299545..301134
FT                   /gene="purH"
FT                   /locus_tag="sync_0289"
FT   CDS_pept        299545..301134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="sync_0289"
FT                   /product="bifunctional purine biosynthesis protein PurH"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="identified by match to protein family HMM PF01808;
FT                   match to protein family HMM PF02142; match to protein
FT                   family HMM TIGR00355"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46591"
FT                   /db_xref="GOA:Q0IDE8"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDE8"
FT                   /protein_id="ABI46591.1"
FT                   /translation="MAPTALLSVSDKRGVVPLAEALHRLHGYQLLSSGGTAKVLQEAGL
FT                   PVTRVADHTGAPEILGGRVKTLHPRIHGGILARRGDPAHEADLLEQQIDPIDVVVVNLY
FT                   PFRETVATPDVSWDAAIENIDIGGPTMVRSAAKNHAHVAVLTSPEQYDRFLKALSGSAG
FT                   GVNANVRRQLALEAFAHTAAYDVAISRWMQSRPELQPDVEAAAPAEALPWLEALPLRQT
FT                   LRYGENPHQKAAWFSSPMGWGGAKQLQGKALSTNNLLDLEAALATVREFGYGSSGLHPA
FT                   QQAAAVVVKHTNPCGVAVGDGVGIALTRALDGDRISAFGGIVALNAVVDGPAAKELTSL
FT                   FLECVVAPGYSSEALEILAAKGNLRLLELPPEAIDAAPKDHVRSILGGVLVQDLDDQPI
FT                   DPSAWTVASQRQPTTAETADLRFAWQLVRHVRSNAILVARDGQSLGVGAGQMNRVGSAR
FT                   IALEAAGEQAVGAVLASDGFFPFDDTVRLAASHGIKAVIHPGGSLRDADSIKACDELGL
FT                   AMVLTGRRHFLH"
FT   gene            301185..301658
FT                   /locus_tag="sync_0290"
FT   CDS_pept        301185..301658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47519"
FT                   /db_xref="GOA:Q0IDE7"
FT                   /db_xref="InterPro:IPR025067"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDE7"
FT                   /protein_id="ABI47519.1"
FT                   /translation="MTLPALPFAASFMHPLMMWVLLAAGGYSMFLGIKAKKVRTGTPEQ
FT                   RKALLPGKFAQRHYRWGSLILAVMVIGMIGGMAVTYLNNGKLFVGPHLLVGLAMTGMIA
FT                   LAAALAPFMQQGNGKGNVIARKVHVGLNMGMLTLFLWQAVSGMQIVNKIWVNR"
FT   gene            complement(301665..302291)
FT                   /locus_tag="sync_0291"
FT   CDS_pept        complement(301665..302291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0291"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45258"
FT                   /db_xref="InterPro:IPR018971"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDE6"
FT                   /protein_id="ABI45258.1"
FT                   /translation="MLLLTRPSTDTLRGSDSRQVRCYRSQFRDRMEMRADFQTVGAYLD
FT                   RHEGWFRRCATPMEVTSIDEQAYALTLGRFGNFGFEVEPTIGLRLLPQNAGNYAICTVP
FT                   LNNQDPALADLYDVDFQANLSLEDNSSSDSPEELTAVSWELDLSVWIHLPKMITLLPDG
FT                   LVQSSGDHLLRQIVRQISRRLTWKVQEDFHASHGLTCPPRRRAAF"
FT   gene            complement(302352..303548)
FT                   /gene="ispH"
FT                   /locus_tag="sync_0292"
FT   CDS_pept        complement(302352..303548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="sync_0292"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.1.2"
FT                   /note="identified by match to protein family HMM PF02401;
FT                   match to protein family HMM TIGR00216"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45510"
FT                   /db_xref="GOA:Q0IDE5"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDE5"
FT                   /protein_id="ABI45510.1"
FT                   /translation="MDTHAFKRSLHHSDRYNRRGFGRADEVAGSLEQAYQSSLIGSIRD
FT                   NGYSLTHGRLKVRLAEAFGFCWGVERAVAMAYETRRHYPQERIWITNEIIHNPSVNDHL
FT                   REMDVLFISVEGGVKDFSGVATGDVVILPAFGATVQEMQLLNERGCHIVDTTCPWVSKV
FT                   WTTVEKHKKQSFTSIIHGKVKHEETLATSSFAGTYLVVLDLEEARLVADYILGKGNRES
FT                   FMERFSKACSPGFDPDRDLEHLGVANQTTMLKSETEEIGRLFERTMLSKYGPTDLNEHF
FT                   LAFNTICDATQERQDAMFSLVDETVDLMVVIGGYNSSNTTHLQEIAVSRGIRSFHIDTP
FT                   ERIHTDNSIEHKPLGEELTVEELFLPSGPVTVGITSGASTPDRVVEHVIQRLIALSEN"
FT   gene            complement(303678..305150)
FT                   /gene="amt"
FT                   /locus_tag="sync_0293"
FT   CDS_pept        complement(303678..305150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amt"
FT                   /locus_tag="sync_0293"
FT                   /product="ammonium transporter"
FT                   /note="identified by match to protein family HMM PF00909;
FT                   match to protein family HMM TIGR00836"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47657"
FT                   /db_xref="GOA:Q0IDE4"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDE4"
FT                   /protein_id="ABI47657.1"
FT                   /translation="MTTAYESPNTRRKSRLQEASLLEGPMLLLQSIRGFKTNRSLLWLG
FT                   CVPLALFGLGLFNLSAHAAEMPELNAAFLANNLWLLVATILVIFMNAGFAMVEAGMCRQ
FT                   KNAVNILAKNLFVFALAVTAYWFVGYSLMYGNAIAAGWLYFNGLFFDPAVTPELISEAG
FT                   LVPSVDFLFQAAFAGTAATIVSGLVAERVKFGEFVVFSLILTAFIYPIAGSWEWNGGWL
FT                   NSVGDKEFIDFAGSSIVHSVGAWAGLIGAMLLGPRIGKFIDGKPQAIPGHNMAIATLGA
FT                   LILWIGWYGFNPGSQLAMDQWVPYVAVTTTLAAAGGAIGATVISTLTSGKPDLTMIING
FT                   ILAGLVSITAGCGNLTFVGSWVAGLIGGIIVVFAVSALDASGIDDPVGAFSVHGVCGVW
FT                   GTLVVGLWGFDIQGDGSPLGLLVGGGISQLGIQALGCAAYAIWTIVTCWIAWSVIGGLF
FT                   GGIRVTEKEEVEGLDIGEHGMEAYPDFVSSGR"
FT   gene            complement(305280..306032)
FT                   /gene="sfsA"
FT                   /locus_tag="sync_0294"
FT   CDS_pept        complement(305280..306032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="sync_0294"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="identified by match to protein family HMM PF03749;
FT                   match to protein family HMM TIGR00230"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45699"
FT                   /db_xref="GOA:Q0IDE3"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDE3"
FT                   /protein_id="ABI45699.1"
FT                   /translation="MTGTSILQFPVLSEGVLLKRYKRFLADVELKDGQVVTVHCANTGP
FT                   MKGVLHPGGRVRVRHAPSPKRKLAWTWEQAEIPSSDGTLCWAGINTALPNKLIRALIEA
FT                   GGLKDQLGPIKTIRAEVPYGLNRRSRIDLLLTPDDSADDQRPIYVEVKNTTWSHGDVAL
FT                   FPDTVTERGQKHLEELTALLPDARGVLVPCLSRPDVIAFAPGDSADPRYGDLFRQAMAA
FT                   GVEVLPCCFSFYEDQIQWEGVRTVCPRL"
FT   gene            306113..307720
FT                   /gene="mviN-2"
FT                   /locus_tag="sync_0295"
FT   CDS_pept        306113..307720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN-2"
FT                   /locus_tag="sync_0295"
FT                   /product="integral membrane protein MviN"
FT                   /note="identified by match to protein family HMM PF03023;
FT                   match to protein family HMM TIGR01695"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46527"
FT                   /db_xref="GOA:Q0IDE2"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDE2"
FT                   /protein_id="ABI46527.1"
FT                   /translation="MARSLKRIALVVTYGTLLSKVGGLVRQLVIAAAFGVGAAYDAYNY
FT                   AYVLPGFLLILLGGINGPFHSAMVSVLSRRPREEGAHILATLNTMVSALLLVLTIVLVL
FT                   AADPLITLVGPGLSPELHRIAAVQLQVMAPMALLAGLIGLGFGSLNAADEFWIPAISPL
FT                   MSSLALIVGIGLLWWQAGSEISTPALALWGGVVLALSTLVGAFLQWLLQLPALMKQGLV
FT                   QLRLAWDWRHPGVQEVWQVMGPATLSSGMLQINVFTDLFFASGLLGAAAGLGYANLLVQ
FT                   TPLGLISNALLVPLLPTFSRLTAAQDRPELIARIRQGLMLSTASMLPLGALFLALASPI
FT                   VALVYERGAFNQGAVELVTGLLMAYGLGMPAYLGRDVLVRVFYALGDGTTPFRLSVIGI
FT                   GLNVVFDWALVGGPTPWGAQLPFNFGAAGLVLATVLINVLTCVALLLALQHRLKILPLK
FT                   KWGLDGLRLTVAAVGAGIVAWGMSHGVRWPIDLVGRLLQVGLSGSLGVLVFMALGQAFS
FT                   VQEVREISQGLTRRFIRR"
FT   gene            complement(307707..307985)
FT                   /locus_tag="sync_0296"
FT   CDS_pept        complement(307707..307985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0296"
FT                   /product="possible Cytochrome c oxidase subunit Va"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46872"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDE1"
FT                   /protein_id="ABI46872.1"
FT                   /translation="MLDSAVLIIEVTNARDVVRQRIGRLGERLIGKVVDPEAQVEKALI
FT                   QEMETAFRDFGIEARILSVQGPQLVGRQHLELPIQVREDREVRLSDE"
FT   gene            complement(307996..308286)
FT                   /locus_tag="sync_0297"
FT   CDS_pept        complement(307996..308286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0297"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46110"
FT                   /db_xref="InterPro:IPR021518"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDE0"
FT                   /protein_id="ABI46110.1"
FT                   /translation="MTLDSADLRVLTSTLADRLYIQVAGWHLYLGDAGLAEALAIECSA
FT                   LIDQGAVVAARQALEAVQVPIGGGSARLPMARLLPSSQLSDLEEILEGHCR"
FT   gene            complement(308322..308576)
FT                   /locus_tag="sync_0298"
FT   CDS_pept        complement(308322..308576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0298"
FT                   /product="Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47334"
FT                   /db_xref="GOA:Q0IDD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDD9"
FT                   /protein_id="ABI47334.1"
FT                   /translation="MPLRWYGPADPNNATYRHFNRVVNFCLHAGGFAAVNSGLWFVQEM
FT                   RHPWNHLDLWSEAWLGVLIIHLLIVIRLRPGKDADADES"
FT   gene            308668..308741
FT                   /locus_tag="sync_0299"
FT   tRNA            308668..308741
FT                   /locus_tag="sync_0299"
FT                   /product="tRNA-Arg"
FT   gene            308836..310125
FT                   /gene="glyA"
FT                   /locus_tag="sync_0300"
FT   CDS_pept        308836..310125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="sync_0300"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="identified by similarity to SP:P39148; match to
FT                   protein family HMM PF00155; match to protein family HMM
FT                   PF00464; match to protein family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46562"
FT                   /db_xref="GOA:Q0IDD8"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDD8"
FT                   /protein_id="ABI46562.1"
FT                   /translation="MTDRSAAPINASLKAADPAIAGLIDQEQMRQETHLELIASENFTS
FT                   KAVMEAQGSVLTNKYAEGLPHKRYYGGCEHVDAIEELAITRAKQLFGAAWANVQPHSGA
FT                   QANFAVFLALLQPGDTILGMDLSHGGHLTHGSPVNVSGKWFNVVQYGVDKETQRLDMEA
FT                   IRKLALEHKPKLIICGYSAYPRSIDFAAFRSIADEVGAYLLADMAHIAGLVAAGVHASP
FT                   VPHCDVVTTTTHKTLRGPRGGLILCRDAEFARRFDKAVFPGSQGGPLEHVIAAKAVAFG
FT                   EALQPDFKAYSRQVVANAQALAARLQERKIDVVSGGTDNHVVLLDLRSIGMTGKVADLL
FT                   VSDVHITANKNTVPFDPESPFVTSGLRLGTAALTTRGFDEKAFHEVADVIADRLQNPED
FT                   DAIQARCLERVSDLCKRFPLYAPALEPALA"
FT   gene            310215..311339
FT                   /locus_tag="sync_0301"
FT   CDS_pept        310215..311339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0301"
FT                   /product="glycosyl transferase, group 4 family protein"
FT                   /EC_number="2.7.8.-"
FT                   /note="identified by match to protein family HMM PF00953"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46426"
FT                   /db_xref="GOA:Q0IDD7"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDD7"
FT                   /protein_id="ABI46426.1"
FT                   /translation="MTFASTPLAVASASLVVAAVITTLLVPLVRGLGLRLGLTDQPDSR
FT                   KQHTTPMVRLGGIALVLGFCLSLGVTWWMGGFGMLAPARDQLIWTTLAGSLCFFVIGLA
FT                   DDLFALSPWPRLAGQIAVSMVVWSQGVRIGAIDLPWVASSSEALLLPDLLSLAATVIWL
FT                   VGITNAINWLDGLDGLAAGVAGIAAVGLVSVSFSLHQSAAAFLAAALAGSCLGFLRHNF
FT                   NPARIFMGDGGSYFLGFTLAAVSIVGPAKGLTTVSLLLPLLILSLPLADMSAVIMGRLS
FT                   DGHSPFYPDRRHLHHRLLRAGFSHRRTVLLIYVFTQWLASLAMVVANVEMRFLWLGLAT
FT                   AILVATVVTINRQRHLEAAIEPSELDPSATDRHG"
FT   gene            311332..312603
FT                   /gene="cinA"
FT                   /locus_tag="sync_0302"
FT   CDS_pept        311332..312603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cinA"
FT                   /locus_tag="sync_0302"
FT                   /product="CinA-like protein"
FT                   /note="identified by match to protein family HMM PF00994;
FT                   match to protein family HMM PF02464; match to protein
FT                   family HMM TIGR00199; match to protein family HMM
FT                   TIGR00200"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45609"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="InterPro:IPR041424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDD6"
FT                   /protein_id="ABI45609.1"
FT                   /translation="MADRSERSGVEILCVGTELLLGNILNGNARWLSEELATLGLPHFR
FT                   QTVVGDNRDRLIALVQEIAQRSRVLIVTGGLGPTPDDLTTEAIAAAFSVPLEERVDVWS
FT                   DIQEKARSRGRTPSPETRRQALLPVGAEVLWNPTGTAPGMIWTPVPGFSVLTFPGVPSE
FT                   MKAMWKATAVPWFRSSGLSKGVFVSRLLHFWGIGESTLAEQVADLLEGVNPTVAPYAGR
FT                   GEVKLRITACADVSSKAWVLVDQIEQELRQRTGNLCFGVDEDSLASVVLKRLGQTGQTL
FT                   SVAESCTGGGLGAELTAVPGASSVMLGGVISYSNAVKRDLLSVPEDLLTQHGAVSAQVA
FT                   EAMALGVRRLTGSDWALSITGIAGPDGGTPEKPVGLVFVGVAGPDGCSTEMLRLGPTRG
FT                   REWIRIVSAGEVLNRLRLRLMVND"
FT   gene            312701..314107
FT                   /gene="leuC"
FT                   /locus_tag="sync_0303"
FT   CDS_pept        312701..314107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="sync_0303"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="identified by match to protein family HMM PF00330;
FT                   match to protein family HMM TIGR00170"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47164"
FT                   /db_xref="GOA:Q0IDD5"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDD5"
FT                   /protein_id="ABI47164.1"
FT                   /translation="MSSGTLYDKVWDLHRVAELSGGSTQLLIGLHLIHEVTSPQAFVAL
FT                   EDKGLKVRCPERTVATVDHIVPTTNQARPFADPLAEEMLSTLERNCSKHGIVLNGIGSG
FT                   RQGIVHVIAPELGLTQPGMTVACGDSHTSTHGAFGAIAFGIGTSQVRDVLASQSLAMNK
FT                   LKVRRLWFDNQLSPGVFAKDLILHVIRSLGVKAGVGHAYEFAGPAIDALSMEERMTLCN
FT                   MAIEGGARCGYVNPDQTTFDYLKGRPSVPSGGAWNRATRWWRSLASNADAVFDDELRFD
FT                   AATISPTVTWGITPGQGIGVDEQVPTPEQLDPADRPIAEEAYRYMDLTPGQAIAGVPVD
FT                   VCFIGSCTNGRLSDLKAAAAVARGRQVAAGIKAFVVPGSEQVARAAEAEGLDQVFRDAG
FT                   FEWREPGCSMCLAMNPDRLEGRQISASSSNRNFKGRQGSASGRTLLMSPAMVAAAAVTG
FT                   YVSDVRSLGD"
FT   gene            314180..314815
FT                   /gene="leuD"
FT                   /locus_tag="sync_0304"
FT   CDS_pept        314180..314815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="sync_0304"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="identified by similarity to SP:P94568; match to
FT                   protein family HMM PF00694; match to protein family HMM
FT                   TIGR00171"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46313"
FT                   /db_xref="GOA:Q0IDD4"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDD4"
FT                   /protein_id="ABI46313.1"
FT                   /translation="MTQTHDFPQGLITKIEGRALVLRGDDIDTDRIIPARFLKCVSFES
FT                   LGAQAFADDRKELEGGHPFDLPAHQGASILVVNDNFGCGSSREHAPQALMRWGIRALVG
FT                   VSFAEIFYGNCLALGIPCAKASQDEVRALQDAMALDPSATWTFDLETSCCSSDLGRWSF
FT                   EVDPGPRDMLLSGRWDATGQLLARDAELQSTIDRLPYLNGFCTDTADT"
FT   gene            314852..315325
FT                   /locus_tag="sync_0305"
FT   CDS_pept        314852..315325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0305"
FT                   /product="Pentapeptide repeats"
FT                   /note="identified by match to protein family HMM PF00805"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45862"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDD3"
FT                   /protein_id="ABI45862.1"
FT                   /translation="MTFLLKRIWCAFGSMALVLGPSAVEAGSVTAIAVEPFGTPLERLL
FT                   ESGACQGCDLRDADLRGRHLIGADLRDADLRGAQLSGVNLEGADLSGARLDGARLQGAM
FT                   LSNADLSDSDLRHADLRDSVVINAYAPGVQTEGMQFAGSDLTGSHLIYGGGPD"
FT   gene            complement(315338..318547)
FT                   /locus_tag="sync_0306"
FT   CDS_pept        complement(315338..318547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0306"
FT                   /product="Repeats containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46490"
FT                   /db_xref="InterPro:IPR022244"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDD2"
FT                   /protein_id="ABI46490.1"
FT                   /translation="MSALSPITRIAGSLAVAAALTGVPVRSQIVDTSLEKIETIEGQSE
FT                   NTENSLSDDGPVPIDVEPALPSPPSNPEVSTETSQPSTAKPPEEIDLKADRQSFDARRG
FT                   VFIAEGNVQAQLRGGILQADRVEFDSNFNTLFARGSVRLRRGSQYFQASSFRYSLIQNS
FT                   GELEDVYGVLELDELSEGFGPSSTVPSSSSSSNPEQLLPVMESTGLGFPTAIDLELGST
FT                   TPERVNTQGAVGNFWDEAILPLNTWTVPSTGEKSQNDKKLAEGMACPAPLPPIPDWHPH
FT                   PWAVTVWGGQMIDSNFGDTFLFNGRLREEYLLGVSMQKRIWRAGPVSLELEADLFGHQA
FT                   FEQQGGEFNQNEPNADTPEQFFGEAIVGLGVRLWVQPWLSFGFVEGISYNTSVSNYERT
FT                   FRENFSQLLNYLAFELEASVSDQLSMVGRIHHRSGAFGTYNGVKEGSNAYLLGLRYRWG
FT                   KDKIATQVTDVPPPLGCPDPDRASRQAQLSLNEELEEITLGTGGKKPIVPAEPIALSRY
FT                   SGMTPAEQEELREQAIAMIDQRISSIQFQQRLTIERRFGVPKTTNNQSVDDDNNFGGVR
FT                   SSQLQELGKTQLVTGQISRWRIQASKVSITPDGWTADRMGFTNDPFTPAQTRIDSEDVT
FT                   AKEQPNGDVLIESKRNRLIVEERLPIPVSRTQRITKEEEVENRWVFGIDNDDRDGFFVG
FT                   RDLKPIELSENTLLSLQPQILLQRAIDGETNSYVEPGSSIDSGKVSQPLEIGDIFGLEA
FT                   ELISKIWGWEVEAKADVSTFNPDNFMNGSRFSGEAKKSISLPWLGAVQLRGFSAYRFRA
FT                   FNGSLGETDVYSAFGGFLEKRGGFNVGKLSNNYIWRIGAGNYQAERFESENLTDLWRAN
FT                   FYGSLNSSYPIWRGKPAELTPLAAYRYSPVAIVPGLNFRTNIRTQLAAFGDGRRQNTIS
FT                   LTGGPTLTLGTFSKPFFDYTRISVTGGGTLKQGASPFDFDQAIDLGTLGLGLTQQIAGP
FT                   LILNAGVGLNVDPASEFYGDIINSNIELRWQRRSYDFGFYFNPYRGIGGFRFRLNDFNF
FT                   TGTGIPFVPYNPSNDLDNRLF"
FT   gene            complement(318641..318760)
FT                   /gene="psbI"
FT                   /locus_tag="sync_0307"
FT   CDS_pept        complement(318641..318760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbI"
FT                   /locus_tag="sync_0307"
FT                   /product="photosystem II reaction center I protein"
FT                   /note="identified by similarity to SP:P17747; match to
FT                   protein family HMM PF02532"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45235"
FT                   /db_xref="GOA:Q0IDD1"
FT                   /db_xref="InterPro:IPR003686"
FT                   /db_xref="InterPro:IPR037271"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDD1"
FT                   /protein_id="ABI45235.1"
FT                   /translation="MLALKISVYSVVFFFLGIFVFGFLASDPSRTPSRKDLED"
FT   gene            318823..321828
FT                   /locus_tag="sync_0308"
FT   CDS_pept        318823..321828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0308"
FT                   /product="Glycoside hydrolase family 38"
FT                   /EC_number="3.2.1.24"
FT                   /note="identified by match to protein family HMM PF01074;
FT                   match to protein family HMM PF07748"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46314"
FT                   /db_xref="GOA:Q0IDD0"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDD0"
FT                   /protein_id="ABI46314.1"
FT                   /translation="MEKPLQAPGSEWIETFRCRSRVDLLPGWWRHGDQKRQPVLADPWG
FT                   RIHRPDWAERGLLIWPRGGNWLHLEQTLICPQPWMQASSSCERLVLSWWADAVRLRIDG
FT                   VLVHEGDLFDTRCRWLLPEDWRDLSGLRIQLDLRSPCHDDGALIHSALVQEPLIAQCDT
FT                   DRALLPEALELSWARGESLPDAVLSCDPMASEAVALVDRHLAACPKPLGVVHWLGHAHL
FT                   DLAWLWPVADTWQAAVRTFCSALDLMECYPKLHFAHSTPALYAWVERHRPALHARIQQA
FT                   SREGRWEPINGPWVETDCVLVSTASLSRQFTLGQEDSQRRFPEWRHDLAWLPDSFGFAA
FT                   GLPAVAVASGVRWFCTHKLAWNATNRFPHRLFRWRSRGGAEVLALMLPGIGTDADPVAM
FT                   AKEQRDFQSATGVEQAIWLPGVGDHGGGPTAEMLEQLCLWEQQPQAVAQQPGTLRAYLD
FT                   HLEPWRSSLPVWRDELYLELHRGCATSRPDQKRHNRSLERLLREAELSAALLGTRADAL
FT                   VPSHEQASDWRPLLFQQFHDILPGTSIPEVFEQAEPIWCEARRRAARCRDQLLGHLLAS
FT                   NQDGMASDPHRSRWTWCGLQPLAHWSPLLRLPQGHWSSGGQILPVQAAPSGGVWVQLPC
FT                   SEGVCALPLRRSREPLGSAVPIRYPVSVEVVSSGVWRLSNGAVSADVSIHGLVQLRDGN
FT                   GVPQLSEPMRLLRFSDRGEFWDAWDLAADYRQHPLPMAERWSAELVESGPLTARIVLRT
FT                   VAGLSKVRLDLILQADSPWLEAQLSVQWQQTHELLRLELPLNSPAVRWAADTSGGVIER
FT                   PAEAFTPYEQERWELPVISWLAAEAEAPGGGMAVLLDGPQGVDASPNHLGVSLLRGPTW
FT                   PDPSADHGWHRHRLAFMPALLGWNRSGVAQAAIRFREPGWVGPVALEQRWQGLPSLPIG
FT                   LVPISVRPAQGAGLSGKAVQIELLNPGPARQRWLPGTDWRLSCAKSNDPRTFWEVKPGE
FT                   LITLILENVQSS"
FT   gene            complement(321816..321956)
FT                   /gene="psbN"
FT                   /locus_tag="sync_0309"
FT   CDS_pept        complement(321816..321956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbN"
FT                   /locus_tag="sync_0309"
FT                   /product="photosystem II reaction center protein PsbN"
FT                   /note="identified by match to protein family HMM PF02468"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45290"
FT                   /db_xref="GOA:Q0IDC9"
FT                   /db_xref="InterPro:IPR003398"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDC9"
FT                   /protein_id="ABI45290.1"
FT                   /translation="MESSSPAMSVAIAVLAALLGLTGFGVYTAFGPPSKNLDDPFDDHE
FT                   D"
FT   gene            322043..322249
FT                   /gene="psbH"
FT                   /locus_tag="sync_0310"
FT   CDS_pept        322043..322249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbH"
FT                   /locus_tag="sync_0310"
FT                   /product="photosystem II reaction center protein PsbH"
FT                   /note="identified by match to protein family HMM PF00737"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47145"
FT                   /db_xref="GOA:Q0IDC8"
FT                   /db_xref="InterPro:IPR001056"
FT                   /db_xref="InterPro:IPR036863"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDC8"
FT                   /protein_id="ABI47145.1"
FT                   /translation="MAQRTRLGDLLRPLNSEYGKVVPGWGTTPVMGIFMALFLVFLLII
FT                   LQLYNKSLILEGINVNWNGLGLG"
FT   gene            322259..322537
FT                   /gene="tatA"
FT                   /locus_tag="sync_0311"
FT   CDS_pept        322259..322537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="sync_0311"
FT                   /product="twin-arginine translocation protein TatA"
FT                   /note="identified by match to protein family HMM PF02416;
FT                   match to protein family HMM TIGR01411"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45131"
FT                   /db_xref="GOA:Q0IDC7"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDC7"
FT                   /protein_id="ABI45131.1"
FT                   /translation="MNVFGIGLPEMAVIAAVALLVFGPKRLPEFGRTLGKTLKGFQSAS
FT                   KEFEREINKAMAEPEPIADQAKALEAPAETVVPPTVAPKTEPTSPSD"
FT   gene            322542..323165
FT                   /gene="pth"
FT                   /locus_tag="sync_0312"
FT   CDS_pept        322542..323165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="sync_0312"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="identified by match to protein family HMM PF01195;
FT                   match to protein family HMM TIGR00447"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45940"
FT                   /db_xref="GOA:Q0IDC6"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDC6"
FT                   /protein_id="ABI45940.1"
FT                   /translation="MNRGDLRLVVGLGNPGNRYANTRHNVGFMALERLASREGGGFRSM
FT                   PKLQGQLADLGSGDKRLRLLMPQTFMNDSGRSIRAALDWFGFELHQLLVLVDDMDLPLG
FT                   RLRLRARGSAGGHNGLKSTIQHLGTQDFARLRIGIGAPGQNPSERKARTVSHVLGSFSR
FT                   DEEPLLDKVLLEVVDGLERIQLQGLDLAGNHLNGLQLAPTSTEE"
FT   gene            323165..323422
FT                   /locus_tag="sync_0313"
FT   CDS_pept        323165..323422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0313"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47226"
FT                   /db_xref="InterPro:IPR021492"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDC5"
FT                   /protein_id="ABI47226.1"
FT                   /translation="MAALPVTTAHLRVQRQSFADQCLEGDVQAGGFNWQFSWFFDRGEL
FT                   SVEPSLGRALIQDALLRFLVKSDYDLEPGGDYTFTVRARF"
FT   gene            complement(323400..323852)
FT                   /locus_tag="sync_0314"
FT   CDS_pept        complement(323400..323852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE22008.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46424"
FT                   /db_xref="GOA:Q0IDC4"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDC4"
FT                   /protein_id="ABI46424.1"
FT                   /translation="MTRVVALDPGRSKCGLLLANISTNTVLKAMVIPSAEVLDQLRAWM
FT                   EDDQGENAQIADLVIGDGTSSTIWQQQLPTSLKVHVVDETGTTLRARERYWQLWPARGW
FT                   KRLLPLGLRIPSGDLDAIAALVILEDYLDRPLQWPGPDPLKNGPSR"
FT   gene            complement(323849..324898)
FT                   /locus_tag="sync_0315"
FT   CDS_pept        complement(323849..324898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0315"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45610"
FT                   /db_xref="GOA:Q0IDC3"
FT                   /db_xref="InterPro:IPR021435"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDC3"
FT                   /protein_id="ABI45610.1"
FT                   /translation="MGKARLSLLGLRPKRTAVVITVLTGSLISALSLGLLLLVSRQLRV
FT                   GLFELNALEAKLRSSRSDLKTSKRAQKQAGKELTTAQQRAAELRRTLKPLQEQTRSLEA
FT                   ERQRLSQDVDAKDVEIQRTEQELSAVRSQIRSGEKELNELEDTLLALRRGNVAISSGQP
FT                   LTTVTLKLERPDQAKTVIDQLLRDANLQAYQQVLPGQPVERQLLLVPRPDIKRLEQTIR
FT                   KPGTWVVNIRSAANVLLGETVVYAFPEVLPNVTVTREGEILARTTVASNERNPEAVRNR
FT                   LNLLLASTLAEVQRRGSLSKGLQFDGNAINALGQELIDRNGGLATLEAVALRRSETADP
FT                   IAIQLRLSP"
FT   gene            complement(325031..325765)
FT                   /gene="ntcA"
FT                   /locus_tag="sync_0316"
FT   CDS_pept        complement(325031..325765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntcA"
FT                   /locus_tag="sync_0316"
FT                   /product="nitrogen-responsive regulatory protein"
FT                   /note="identified by match to protein family HMM PF00027;
FT                   match to protein family HMM PF00325"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46137"
FT                   /db_xref="GOA:Q0IDC2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR022299"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDC2"
FT                   /protein_id="ABI46137.1"
FT                   /translation="MAEVSRGFSRYAPPTIRPAGSSFGTPAVPSSRTLQDVIRGLDGAN
FT                   SEMVERGKTIFFPGDPAEKVYLIRRGAVRLSRVYESGEEITVALLRENSLFGVLSLLTG
FT                   HRSDRFYHSIAFTRVEMVTAPATSVRQAIEADTSVGLLLLQGLSSRILQTETMIETLTH
FT                   RDMSSRLVSFLLVLCRDFGVPGQRGITIDLRLSHQAIAEAIGSTRVTITRLLGDLKSSS
FT                   LVDIDRKKITVLDPIALAKRFS"
FT   gene            complement(325857..326582)
FT                   /gene="rph"
FT                   /locus_tag="sync_0317"
FT   CDS_pept        complement(325857..326582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="sync_0317"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="identified by similarity to SP:P28619; match to
FT                   protein family HMM PF01138; match to protein family HMM
FT                   PF03725; match to protein family HMM TIGR01966"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46502"
FT                   /db_xref="GOA:Q0IDC1"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDC1"
FT                   /protein_id="ABI46502.1"
FT                   /translation="MTDTSRNDGRRPGDLRPFSISWDPMGFALSSVIIHSGRTTVLCSV
FT                   CHQEGVPRWRKDQGKGWLSAEYRLLPGSTPERQNRELLKLSGRTQEIQRLIGRSLRAAI
FT                   DMEALGENTLRIDCDVIQADAGTRTAAISGSWVALQRACERLVQQGVLNTNPVQSQVAA
FT                   VSVGVIHKRPLLDLDYSEDSQADVDLNVVMNGEGHLLELQGTAEGAPFSRHQLNDLLDL
FT                   AEPGLKKIMDDQRAALSAG"
FT   gene            326717..327325
FT                   /locus_tag="sync_0318"
FT   CDS_pept        326717..327325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0318"
FT                   /product="putative cob(I)alamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47433"
FT                   /db_xref="GOA:Q0IDC0"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDC0"
FT                   /protein_id="ABI47433.1"
FT                   /translation="MTVSLSPTHHSRESRTVDHRTLEQAGLRRLPSVEVRPPLHLVAPE
FT                   GQLQVHTASFRGSFSGVLSQALRTAGLGSNVLIAQFLKGGVGQGPQSSLTLCDRLRWLR
FT                   PSVAECLSDAAVSRDDEVKEAVQEVWQICKTHLLEGTLDQLVLDEIGLAIELGYLIHED
FT                   VLSVLEQRPSAMDVIVTGPAIPAEMMEMADQVTELRRGF"
FT   gene            327325..327918
FT                   /gene="dcd"
FT                   /locus_tag="sync_0319"
FT   CDS_pept        327325..327918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="sync_0319"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="identified by match to protein family HMM TIGR02274"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46275"
FT                   /db_xref="GOA:Q0IDB9"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDB9"
FT                   /protein_id="ABI46275.1"
FT                   /translation="MLKNDRWITDQADAGMLEPFQNGLVRHLDPDQRQSPVLSFGCSSY
FT                   GYDLRLSPKEFLIFRHVPGTIMNPKRFNPDNLESTPIHHDEDGDYFILPAHSYGLGVAL
FT                   EKMRVPPNITVICLGKSTYARLGIIVNTTPAEAGWEGHLTLEFSNSSGADCRIYASEGI
FT                   CQLLFFEGDPCETTYSDRQGKYQHQPERVTLAKV"
FT   gene            complement(328007..328732)
FT                   /gene="thyX"
FT                   /locus_tag="sync_0320"
FT   CDS_pept        complement(328007..328732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyX"
FT                   /locus_tag="sync_0320"
FT                   /product="thymidylate synthase, flavin-dependent"
FT                   /EC_number="2.1.1.148"
FT                   /note="identified by match to protein family HMM PF02511;
FT                   match to protein family HMM TIGR02170"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46029"
FT                   /db_xref="GOA:Q0IDB8"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDB8"
FT                   /protein_id="ABI46029.1"
FT                   /translation="MDSRFRVDLIAATPNPQQCVYVGMHQDYSEGFVAADREQWPDETR
FT                   AGEICVKRLLAGERGHYGPMEHAQIVLNVGWFPHSVMQQARTHRVGVSFDVQSMRYTGD
FT                   RICRAAVGELDLEEVFYLRPVGEYSDRKGKKYLYSEAERQKDLNHCKISADRYQELLQA
FT                   GYAEEHARGILPFDYRQHFVVSFTLRAFLHFMDLRAKLDAQQEIRELCDLMWPHLKTWT
FT                   PEFAGWYEKTRLHRARLAP"
FT   gene            complement(328767..329264)
FT                   /locus_tag="sync_0321"
FT   CDS_pept        complement(328767..329264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0321"
FT                   /product="thioredoxin"
FT                   /note="identified by match to protein family HMM PF00085"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47894"
FT                   /db_xref="GOA:Q0IDB7"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDB7"
FT                   /protein_id="ABI47894.1"
FT                   /translation="MLLIAALVLAAGLFLLRNGLNQEAPLDQLARQSLDPEVALNNSRP
FT                   TILEFYADWCEACQAMAPAMLQTEQKHADQLDVVLVNIDNPRWLDLIDRYDVTGIPQLN
FT                   LFSADGVMRGRSLGARTADQLESLAVALIDNEPLPQLAGVGSISSVTPAETVSSPGPRS
FT                   HS"
FT   gene            329437..329940
FT                   /locus_tag="sync_0322"
FT   CDS_pept        329437..329940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0322"
FT                   /product="unnamed protein product"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45844"
FT                   /db_xref="GOA:Q0IDB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDB6"
FT                   /protein_id="ABI45844.1"
FT                   /translation="MLMSLLRFLVLPLRAPLLLVLFGVAVFLGHHWSIESEHLIAMQNV
FT                   SPTLFWTVEVLQSFVIVLICTMPDLLLRQLSLLMASSRVLSLISTLLLVIMVGLYLLSL
FT                   SLLSDVLILASATLLARLDLTRIKVVPPPQVMAFWLTALVLVGIWLGQDLPNPLASAVA
FT                   AVST"
FT   gene            complement(329914..331989)
FT                   /locus_tag="sync_0323"
FT   CDS_pept        complement(329914..331989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0323"
FT                   /product="transglycosylase, SLT family protein"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45427"
FT                   /db_xref="GOA:Q0IDB5"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDB5"
FT                   /protein_id="ABI45427.1"
FT                   /translation="MPPVSGRGLTVQHSRGLLLLAGTPLLTVALVLGGQTLMRRLHTPL
FT                   TPSISNADLWTHYRWSINPSERREAALLLAARSADSADRSQRLLANQGWGNDPIAAVTL
FT                   KQQALTAAKLGQPSEEQKRWQDLLQRFPDSAASADARYQLGQAHPALHTELFRQQPGHP
FT                   AALAAAAETKTESPKQAIAALHLARWGARWPGAATQLREACNRISGDGLNQDDRLTLAR
FT                   GLASLGDGGAAEACLQGTPTTPASALAIGRVLLRGTAEQQGRGKQHLLELAINNPDDPA
FT                   ALEAAALLSEPLKPDPALLDALPQALQQRSADVAAARVRLGDSANGDASNAMSVLKRWP
FT                   TNPAAWQLQWDLAREALLKDQWQTAESLLRAIPSSNLPEPLAARQQFWLGLTLSKQDQT
FT                   TQAQQVWQHLVKTHPRSYYTWRAEVRLGRGDLPDLHQASASRSAGLGDSFQSPWEPLQS
FT                   GDSFVDRLWRLGQTQEAWETWRNQQPPSDQPTNPEQKLVEGRLRIAVGDSWTGLSRLWR
FT                   ASLRLVNQSCEERQLLHRSQHPRLLSQVFERASQQEAVRNELLMAIAKQESRFSPGVSS
FT                   PVGAVGLLQLMPATAEELAGDALSQDQLREPTRNARLGARYLGHLLEQWQGDIVLAVAS
FT                   YNAGPGAASQWVTPALKNDPELWIERIPYPETRLYTKKVLGNLWAYLGSGTDRCDS"
FT   gene            331951..332430
FT                   /locus_tag="sync_0324"
FT   CDS_pept        331951..332430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0324"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47042"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDB4"
FT                   /protein_id="ABI47042.1"
FT                   /translation="MLNGQASAGNWWHSVPSARHSDGKGARAAAPRERATAPLCDCHWP
FT                   GFAGLGIALALASASRAWLAGGRAVGLGVLGSGSAIAGSASMALEPAIRLKIEFRIEFS
FT                   WLKLPSILWGNSQSHRRSALGPMACVVGWTPCSLRPWLFRLGTGVDACFKPRGLC"
FT   gene            332286..333653
FT                   /locus_tag="sync_0325"
FT   CDS_pept        332286..333653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0325"
FT                   /product="Phosphotransferase superclass"
FT                   /EC_number="5.4.2.3"
FT                   /note="identified by match to protein family HMM PF00408;
FT                   match to protein family HMM PF02878; match to protein
FT                   family HMM PF02879; match to protein family HMM PF02880"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47426"
FT                   /db_xref="GOA:Q0IDB3"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDB3"
FT                   /protein_id="ABI47426.1"
FT                   /translation="MGQLPKPSKISFGTDGLRGRVDTMLTPALALQVGYWCGRVLQAEG
FT                   PVLIGMDSRSSGSMLVAALTAGLTASGREVWTLGLCPTPAVPGLIRRYSAAGGLMVSAS
FT                   HNPPEDNGIKVFGATGSKLSPERQQAIEAGLCGGDGSGMALAASGAARHRPELLDDYRA
FT                   SLLSSVGQHRLDGVPIVLDLCWGSATACGAEVFSALGADLTVLHGDPDGTRINVNCGST
FT                   HLEALRRAVIEKGAAMGFGFDGDADRMLAVDGQGRVVDGDHVLFLWGSVLQEQGQLPDQ
FT                   RLVATVMSNLGFERAWQARGGLLDRTPVGDQHVHAEMVRTGAALGGEQSGHILSSAHGL
FT                   AGDGVLTALQIASLCHAQQLSLAEWVDQSFQAYPQKLVNVRVENRERRKGWADCAPLSS
FT                   LVQEAEASMAEDGRVLVRASGTEPLLRVMVEAADQAVVDHWTSSLAAAAELHLNAS"
FT   gene            complement(333648..334640)
FT                   /locus_tag="sync_0326"
FT   CDS_pept        complement(333648..334640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0326"
FT                   /product="BadF/BadG/BcrA/BcrD ATPase family superfamily"
FT                   /note="identified by match to protein family HMM PF01869"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47590"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDB2"
FT                   /protein_id="ABI47590.1"
FT                   /translation="MVLPGNPESGPTSHPDRPMSDALILAGFDAGQTHCRCKLSRWHNG
FT                   NWQPLGEGKGSGVSHLQANEGETRFVEAIRSSLDAANPSGLEINAAAVGASGVEQGTAL
FT                   QDRASELLAASLALPIEHCIATGDERIALRGAFPNDAGIVLISGTGMIVVGRNASGLEQ
FT                   RCGGWGWQLDGAGAAFDLGHQGLQLSLRMADGRLPDGPLRNQLWQVLGCRTAAAIKAFV
FT                   VQPNYQPAQLAQLAPLVSAAAEAGNIEAKAILDRSGDALAEAVQAVASSLGLTQPVLCA
FT                   RGGALLNLAPLQQAVNTSLRRRQVDARWDDRSGDACDGALTLALERCRS"
FT   gene            complement(334583..335926)
FT                   /locus_tag="sync_0327"
FT   CDS_pept        complement(334583..335926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0327"
FT                   /product="putative inorganic carbon transporter/0-antigen
FT                   polymerase (ICT/OAP) family protein"
FT                   /note="identified by match to protein family HMM PF04932"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46943"
FT                   /db_xref="GOA:Q0IDB1"
FT                   /db_xref="InterPro:IPR006007"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDB1"
FT                   /protein_id="ABI46943.1"
FT                   /translation="MIIPKTLHPHLMAEAPAPPPLLLSWQGVLPASEQQRRRLSWLASI
FT                   LLMVLLAGLPFLTRTGLGLVVLACGALWILWSSVSQPQRIGAISAWVLLFLGIALLATG
FT                   FSPVPAAATKGLIKLLSYLGVYALMRQLLAERPDWWDRLVAALLGGELLTSVMALRQLY
FT                   GPTEELARWADPNSVAAGTIRIYGPLGNPNLLAGYLVPILPLALVALIRWNGWGARCYA
FT                   AVALGLGATATLFSYSRGGWLGMLAALGVLLLLLVLRAIRNWPKLWRRLVPIALLVLAG
FT                   VALAIAVTQVDPIRTRVASLLAGRGDSSNNFRINVWLAAVEMIQDRPWLGIGPGNAAFN
FT                   AVYPLYQQPKFNALSAYSVPLELLVETGIPGLIAALGLAGASLRNGLRALRSTAALALP
FT                   WLGCLAAIAGLVIQGATDTIFFRPEVQIIGWFCLATLSQAQQATQTDP"
FT   gene            complement(335886..336599)
FT                   /gene="trmB"
FT                   /locus_tag="sync_0328"
FT   CDS_pept        complement(335886..336599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="sync_0328"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="identified by match to protein family HMM PF02390;
FT                   match to protein family HMM TIGR00091"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47587"
FT                   /db_xref="GOA:Q0IDB0"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDB0"
FT                   /protein_id="ABI47587.1"
FT                   /translation="MRQHVNPLSRFFQLPLELPAPHELFEHPNLPIHLDIGCARGFFLL
FT                   ELAAMQPERNHLGVEIRRPLVQAAQHDRDRQEQHNLHFLFCNANISLEAWMAALPPDQL
FT                   QLVSIQFPDPWFKQRHRKRRVLQPALLLAIAAALHPGRHLFLQSDVLAVIEPMVALVEL
FT                   SNCFARPKDDPQPWRSSNPLPVATERERYVQEQGQPTYRVLFERTQAELPALRDLEMAW
FT                   QQVDNSKDAAPTPHG"
FT   gene            complement(336599..337858)
FT                   /locus_tag="sync_0329"
FT   CDS_pept        complement(336599..337858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0329"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47538"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR016741"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDA9"
FT                   /protein_id="ABI47538.1"
FT                   /translation="MVPFNPLDWFRGSGAQAKCRTALSGCASLEEATKDVSNQLGSEKG
FT                   DLALVFVSSHFASDLPRLLPLLSQRLQAEHWIGFVGGGVVGTDSAGRSQELEQTTALSI
FT                   TLLNLPGAQLKPFQLDTGSLPDLDGPVQNWQDWVSVDPTNSRSLLLFIDPSCGAINDLI
FT                   SGLDYAYPNAAIIGGIAAPHNASHGSLLLNGQIINGAAGVSIGGDWVLDPVVAQGCRPI
FT                   GPVFAIEQAQRNVLLELSDGDRRDNPVACLQRVLADLNAEDRELVQHSLFLGVERRNLM
FT                   QECPSDFLVRNLIGVDPRNGAVAVAERVRPGQHVQFQLREAQSSRQEARQLLEVSQERC
FT                   PFPPPLCGLLFACLGRGSGLFGEANGDVSIARDVMPNLPIAGAFCNGEIGPLSNTTYLH
FT                   GYTACWGLLRHAPLAESTEG"
FT   gene            337929..338540
FT                   /locus_tag="sync_0330"
FT   CDS_pept        337929..338540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45757"
FT                   /db_xref="GOA:Q0IDA8"
FT                   /db_xref="InterPro:IPR021515"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDA8"
FT                   /protein_id="ABI45757.1"
FT                   /translation="MPDLPYRSLVWLTYRLGATFALGVPLVLLIWAGVRREPAMVRLLS
FT                   LYWKVASLLPISVLLLTDRRPIGYVMAFIAPVLMVVSVWFWVDLNEELADSAPGSALPL
FT                   TVRIWRWALSGFALLAAGMSATALRCANQLSGPECMAWLEGPQGLHRVAERLFDFVFGG
FT                   QWSEAVAAFIGYVALVAYVVGLLQWLLVRLPRQGRVAGEF"
FT   gene            338530..338841
FT                   /locus_tag="sync_0331"
FT   CDS_pept        338530..338841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47127"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDA7"
FT                   /protein_id="ABI47127.1"
FT                   /translation="MSSDPFLPVLEAISRDHPDRVLRLRGTVQTSEREEEVLEVLIFRG
FT                   FSSCTTHSTDFDPDRTVLPDGAVLETGELLLGPLDPQQEQLLVGPLPADVLMDRDLWA"
FT   gene            339322..340038
FT                   /locus_tag="sync_0332"
FT   CDS_pept        339322..340038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0332"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47770"
FT                   /db_xref="GOA:Q0IDA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDA6"
FT                   /protein_id="ABI47770.1"
FT                   /translation="MHSFLAGLKVARVKGLNLTQRSYGLYVFVLAAIFFGLLMSNSLIL
FT                   LNISGEDGLIENATAGILLGSACLSISQFFIKSSDKKVFLTLSVLGLIGFLDEVSFGDR
FT                   AFKGMYFFRVHGVKIDGIHDVAEVFANLIKTNIVYHALETLGVLAVVFVILICAFAKRA
FT                   PLVKNCTRKIFAYCSSKQILGYWLVIFLCILVSQSIDIFRIKIFSYQAIEEFLELIAAG
FT                   GFMACVISLARGDARG"
FT   gene            complement(340540..343446)
FT                   /gene="ileS"
FT                   /locus_tag="sync_0333"
FT   CDS_pept        complement(340540..343446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="sync_0333"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF06827; match to protein
FT                   family HMM TIGR00392"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45549"
FT                   /db_xref="GOA:Q0IDA5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDA5"
FT                   /protein_id="ABI45549.1"
FT                   /translation="MTQQTGQDADQRPSYKDTLNLLETGFGMRANAIHREPELQAFWKE
FT                   KGIDLDLGRNNPGPVFTLHDGPPYANGALHMGHALNKVLKDIINKHRLMQGRKVRFVPG
FT                   WDCHGLPIELKVLQAMNQEQRQALTPIKLRKKAAAYAHKQVAGQRAGFQRWGIWADWDH
FT                   PYLTLQKDYEAAQIDVFGTMALKGHIYRGLKPVHWSPSSRTALAEAELEYPDGHTSPSV
FT                   YVGFPVVDLPESLRSKLNAQGLDVPAASDTLSQCLQVAIWTTTPWTLPANLAVSVNDRL
FT                   DYCLADDGNGQLLIVAAELCDSIASKLERPLQAKATVKGADLAGITYSHPLLERRSAIV
FT                   VGGEYITTESGTGLVHTAPGHGVDDFNTGRKHGLPVLCPVDEAGTLTAEAGPFEGLNVL
FT                   KDANAKIIAALEDSGSLLLQESYSHRYPYDWRTKKPTIFRATEQWFASVEGFRTEALTA
FT                   IDGVQWLPASGRNRIESMVSERGDWCISRQRTWGVPIPVFYQRETGEVLLNSDSIAHVK
FT                   ALIAEHGADIWWEKDEVDLLPSSHKAEAHLWRKGTDTMDVWFDSGSSWASVSSQRDGLS
FT                   YPADLYLEGSDQHRGWFQSSLLTSVAVNGTAPYRTVLTHGFALDEKGRKMSKSLGNVVD
FT                   PMVIIEGGKNQKQEPAYGADVLRLWVSSVDYSADVPIGAGILRQLSDVYRKVRNTSRYL
FT                   LGNLHDFIPSRDAISISDLPLLDRWMLQRTATVLDQISEAFERYEFFRFFQLLQNFCVA
FT                   DLSNFYLDIAKDRLYVSAPNDKRRRSCQTVMALIIERLAAAIAPVLCHMAEDIWQNIPY
FT                   PTGTESVFLSGWPSVPEEWRDDSLRDPMQELRELRAAVNKVLEECRSKRKLGSSLEAAV
FT                   RLEARTPALQDALQWLQSKGDQEVDGLRDWLLVSQLQIGGEPWAELLASDDNELAVIEV
FT                   ALSRGQKCERCWHYEADIGQYSDHPGLCGRCVSVLERR"
FT   gene            complement(343473..344234)
FT                   /locus_tag="sync_0334"
FT   CDS_pept        complement(343473..344234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0334"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47830"
FT                   /db_xref="GOA:Q0IDA4"
FT                   /db_xref="InterPro:IPR010004"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDA4"
FT                   /protein_id="ABI47830.1"
FT                   /translation="MLATLIGDLCLLAGLAVLLLPLLATELSRPRDGAWGAVILLLGLV
FT                   LVTSSDRLRGAPMLGVACAGLLISRLGAEVGQARWQQLSDEEQQRLGSRERWTTSLQQL
FT                   TSVLASLVNATADTLKSLKPAAKTGTNKLWIRPEQPSADADINTPPSDEISEKSEKSEQ
FT                   PGTNEASHDNDTTTEAQGTKQQHKKSWVRPDSPEPSLGTHEVSSTSSSDETQTDATRAE
FT                   TSMDSHADGTPGSAIDTASNTAPNTTRTDED"
FT   gene            344293..344374
FT                   /locus_tag="sync_0335"
FT   tRNA            344293..344374
FT                   /locus_tag="sync_0335"
FT                   /product="tRNA-Leu"
FT   gene            344430..345449
FT                   /locus_tag="sync_0336"
FT   CDS_pept        344430..345449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0336"
FT                   /product="beta-carotene hydroxylase"
FT                   /note="identified by match to protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46685"
FT                   /db_xref="GOA:Q0IDA3"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDA3"
FT                   /protein_id="ABI46685.1"
FT                   /translation="MTQALAQPESQGSTPLLRSVPKEFVDPPSAWNPTVALFLGGYGLA
FT                   ALTIWGWFVGGWPLPLLLICGFLALHLEGTVVHDACHKAAHPVPWVNQTMGHGSALLLG
FT                   FSFPVFTRVHLQHHSHVNDPKHDPDHIVSTFGPLWLIAPRFFYHEFFFFQRKLWKRWEL
FT                   MQWGFERAIFFTIIVAAIRFDFLPFIFNCWFAPALMVGVTLGLFFDYLPHRPFLSRNRW
FT                   QNARVYPGRTMNWLIMGQNYHLVHHLWPSIPWFEYKPAYEATKSLLDAKESPQRLGIFE
FT                   TRSDVVNFFYDILIGVRSHKPRGSKMRPIAKFLPSRRLRRGWLSLLKRTAVTPARQRY"
FT   gene            complement(345486..345779)
FT                   /gene="gatC"
FT                   /locus_tag="sync_0337"
FT   CDS_pept        complement(345486..345779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="sync_0337"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF02686;
FT                   match to protein family HMM TIGR00135"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46216"
FT                   /db_xref="GOA:Q0IDA2"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDA2"
FT                   /protein_id="ABI46216.1"
FT                   /translation="MSKITADDVRKVAKLARLDLPEDTIATYTGQLERILDYVDQLQAV
FT                   DTEGVPPTTRAVEVVNATREDSVVATDVRQELLDQAPQREGDFFRVPKILAD"
FT   gene            complement(345776..346564)
FT                   /locus_tag="sync_0338"
FT   CDS_pept        complement(345776..346564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0338"
FT                   /product="creatininase"
FT                   /EC_number="3.5.2.10"
FT                   /note="identified by match to protein family HMM PF02633"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45727"
FT                   /db_xref="GOA:Q0IDA1"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDA1"
FT                   /protein_id="ABI45727.1"
FT                   /translation="MNATLPGPAANTEAIRLALQSWPDVEAYLKGCKGIIIPLGSTEQH
FT                   GPTGAIGTDALTAEAVALELGRRSGVLVTPAQAYGMAEHHLGFAGTMSLQPATLMAVMH
FT                   DLVLSLATHGFERIFVVNGHGGNMATTKAAFAQAYGTAASRGLPVAPKLRCRLSNWFMA
FT                   GAVMRQARELYGNREGQHATPSEIAVTLHLHDSLVTKQRPLPEAAPCGAIHGPADFRRR
FT                   YPDGRMGSDPYLAKPEHGAELLDTAATALREDLETFLSAA"
FT   gene            complement(346606..346749)
FT                   /locus_tag="sync_0339"
FT   CDS_pept        complement(346606..346749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0339"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAP99777.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47848"
FT                   /db_xref="GOA:Q0IDA0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDA0"
FT                   /protein_id="ABI47848.1"
FT                   /translation="MDAALSGFNLGTVLVFGSGLFVIATFYFGTRGGYYNTDKYDGNGT
FT                   AH"
FT   gene            complement(346837..347472)
FT                   /locus_tag="sync_0340"
FT   CDS_pept        complement(346837..347472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0340"
FT                   /product="Transporter"
FT                   /note="identified by match to protein family HMM PF02592"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45905"
FT                   /db_xref="GOA:Q0ID99"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID99"
FT                   /protein_id="ABI45905.1"
FT                   /translation="MLNILGLTRFLTLGQIGAWPIVVAVGALPYPVTFLCTDLISELWG
FT                   EEKATQVVWVGLLLNGWVVLILWLGGLLPGLNGAPESTFFEIQRLAFGSVGASMVAYLT
FT                   AQFVDVRLFHFWKERTNGKALWLRNNGSTLVSQLVDTSAVVLISHYAAHVLPIRAGEAV
FT                   LPQLGAFIASGYLFKALAAFADTLPFIWLTTWLRDWLDIQGDGKEIIP"
FT   gene            347465..347665
FT                   /locus_tag="sync_0341"
FT   CDS_pept        347465..347665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0341"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45092"
FT                   /db_xref="GOA:Q0ID98"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID98"
FT                   /protein_id="ABI45092.1"
FT                   /translation="MSIPRVPRKSPASTRNARSRLALIWLVVIVGDADMGFVVHRLRLD
FT                   SLVIRVVLTCHLEWRGWIALS"
FT   gene            347720..348358
FT                   /locus_tag="sync_0342"
FT   CDS_pept        347720..348358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0342"
FT                   /product="possible Methylpurine-DNA glycosylase"
FT                   /note="identified by match to protein family HMM PF02245;
FT                   match to protein family HMM TIGR00567"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45185"
FT                   /db_xref="GOA:Q0ID97"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID97"
FT                   /protein_id="ABI45185.1"
FT                   /translation="MSHPAHPRRFSALPQAFFCRPAEVVGPELIGCFLVKRQNDGSLLW
FT                   GVIVETEAYSQDDPACHGYRRRSPQNETLFGEPGRFYVYVSYGIHHCVNVVTDRSDWAN
FT                   GVLLRAVAMPGEPERVAAGPGLLARRFGLNRTHDSQAVCGENEFWLASRPSVLNVPELV
FT                   TTTRIGISQAQDLPWRWYLQDSRSVSRRARGDRMPALSQAFIPTLEWKR"
FT   gene            348355..349404
FT                   /gene="pyrB"
FT                   /locus_tag="sync_0343"
FT   CDS_pept        348355..349404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="sync_0343"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="identified by match to protein family HMM PF00185;
FT                   match to protein family HMM PF02729; match to protein
FT                   family HMM TIGR00670"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46806"
FT                   /db_xref="GOA:Q0ID96"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID96"
FT                   /protein_id="ABI46806.1"
FT                   /translation="MSGWSHRHVLDLASFSRDDYATVLELAHRFRSMPVTGARKLPALQ
FT                   GRLVATLFFEPSTRTRSSFELAAKRLSADVQSFSPSSSSLSKGESLLDTARTYVAMGAD
FT                   VLVIRHRCTDVPAQLASELDQAGERTVVLNGGDGQHSHPSQGLLDLYTLAHHFDPRNSQ
FT                   LDALQGKRIVIVGDVVHSRVARSNLWALSACGADVVLCGPPSLVPDAFAAFLDAPPPGQ
FT                   ASDPVRERGTVQISRSLDDCLSGADAVMTLRLQKERMTDHLLTNLDRYHRDFGLTHERL
FT                   RRCAFSGPVLHPGPVNRGVEMSGGLLDDRSICLVEDQVRNGIPIRMALLYLMAASDPVA
FT                   ESSRASAPS"
FT   gene            complement(349344..350858)
FT                   /locus_tag="sync_0344"
FT   CDS_pept        complement(349344..350858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0344"
FT                   /product="NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47422"
FT                   /db_xref="GOA:Q0ID95"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID95"
FT                   /protein_id="ABI47422.1"
FT                   /translation="MAAEHFFLELEPPEERLRDAPHVVIVGGGFAGVRACKALAQADVR
FT                   ITLIDKRNFNLFQPLLYQVATGLVAPGDVATPLRQLVGKQRNVQVLLGEVTGLDAKKQQ
FT                   INFSEKILTYDHLVLATGSGSTYFGHEEWRTFAPPMKILEHAQEIRRRLLMAMEQAEQT
FT                   PDPAARKFLQTVVIVGGGPTGCEMAGATSELMRNAMRREFKQLDPDDSRIIVIDPGDRL
FT                   LRAMPESLSASAQKTLESLGVETLFKGRVQSMKPGEVSVGTPDGEQTIQAATVIWTAGV
FT                   RPSHLGKTLAGSIDCELDRGGRVIVEPDFSVKDHPEIRVVGDLCSYKHTSTGNPLPGMA
FT                   GPATQAGGFVGKDIAAIMSGGNRPNFKWFDFGSMAVLDRVAAVADLRGFKFSGSPGWAV
FT                   WAAAHLAFMPDRENRWSLLIKWMFAVLSQQRSSMLLTGMPSQHIGLDSADAPFPMNSGS
FT                   GPSIAAPDAALKAAMNYYANSVSGVSAQDGAEARDDSATGSDAAIK"
FT   gene            complement(350929..351270)
FT                   /locus_tag="sync_0345"
FT   CDS_pept        complement(350929..351270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0345"
FT                   /product="Uncharacterized secreted or membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47058"
FT                   /db_xref="GOA:Q0ID94"
FT                   /db_xref="InterPro:IPR007572"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID94"
FT                   /protein_id="ABI47058.1"
FT                   /translation="MTARLQKTRLQISFGEATSRLDQWAVNPWRRASLMLIALGASFAL
FT                   GNSIGAIAGALALMDPVAALVTVAIWELMVRTRRHWARDRQKHLGRDLLDMSRIGLLYG
FT                   LLLEGFKLL"
FT   gene            complement(351455..351655)
FT                   /locus_tag="sync_0346"
FT   CDS_pept        complement(351455..351655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0346"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47885"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID93"
FT                   /protein_id="ABI47885.1"
FT                   /translation="MSQSKREQVVSHLRYIRQELREMHQGVMEDGLLPEAGEVRGVMAQ
FT                   MEALLELLEGKSSRKAKADSD"
FT   gene            complement(351709..351855)
FT                   /locus_tag="sync_0347"
FT   CDS_pept        complement(351709..351855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0347"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47043"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID92"
FT                   /protein_id="ABI47043.1"
FT                   /translation="MFSTSTHFTRRLPLFVGLSALVLVSTLARPSALITYGLIALAGGL
FT                   GRR"
FT   gene            complement(352088..352378)
FT                   /locus_tag="sync_0348"
FT   CDS_pept        complement(352088..352378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0348"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46244"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID91"
FT                   /protein_id="ABI46244.1"
FT                   /translation="MLSKFFQRISHLFMDVIDLFPRSIVQGGLDLKLLNQCLLHGEDVL
FT                   RNPGANPDASMLLAGQLNQQRELNPTHPAVRELCESVLLGSGRRRTLDSRL"
FT   gene            complement(352723..354570)
FT                   /locus_tag="sync_0349"
FT   CDS_pept        complement(352723..354570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0349"
FT                   /product="beta-lactamase, putative"
FT                   /note="identified by match to protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45463"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID90"
FT                   /protein_id="ABI45463.1"
FT                   /translation="MIHSALDLNNIFLKINQKAKDGIKKATTISAIAATGMVLTTALPS
FT                   SASEWTARHGLSSSSYQQTFNNYTKKGYCLKSISGYQQAGKANYAAIWSKNECKPFIAR
FT                   HGLSPQKYQAAFNAFNKKGYRLTYINGYEIGGKPFYAAIWEKTSGPAYEARHGLTEKQY
FT                   QSQVTSMSGKGYGIKHVSAFSLKGSPRFAVIFEKNMPTWKARHGLTHSQYQKEFNKSAK
FT                   EGYRLKVVTGYRKGNSDRYAAVWTKEGGQYYQARHSIPTKNYQHIFDNYRYQSYEPKYI
FT                   EAFNSASGVKFNGVWENKKFASKSLRSIERKVGQYMRDNNIKGLSIAISKNNKLVYARG
FT                   FGKADITKGIAVGPKHRFRIASVSKLVTQAAIKKLLKETSLNSNSKVFGKNSILGDDYP
FT                   TPSTNPNIDKITIQHLLNHHAGLTNINKNGDKKDPMFSYSGSTFTGLINWTLSNYPLAS
FT                   NPGQKKQYSNFGYSLLGRVIEKATNADYDSYVKNKILNPAGAKGMVIGRDKKNQQLRNE
FT                   ATYYGGGAYSSVKPQRFDSHGGWIATPIDLLRFMRHNNDHGSSHYGLMDGTAAVYKKNY
FT                   NSNFGYAAATNSRKDPAVLNSLMQDIVNSTSSWPSVNMF"
FT   gene            complement(354855..354927)
FT                   /locus_tag="sync_0350"
FT   tRNA            complement(354855..354927)
FT                   /locus_tag="sync_0350"
FT                   /product="tRNA-Ala"
FT   gene            354973..355203
FT                   /locus_tag="sync_0351"
FT   CDS_pept        354973..355203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE06815.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46518"
FT                   /db_xref="InterPro:IPR019678"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID89"
FT                   /protein_id="ABI46518.1"
FT                   /translation="MGSSLQGASMPITPESLDAFDDDKVALLAQRLEDDDYPTPFDGLS
FT                   DWHLLRALAIHRPELTGPYVHLVDQEPFDED"
FT   gene            355193..356503
FT                   /gene="coaBC"
FT                   /locus_tag="sync_0352"
FT   CDS_pept        355193..356503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="sync_0352"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="identified by match to protein family HMM PF02441;
FT                   match to protein family HMM PF04127; match to protein
FT                   family HMM TIGR00521"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45953"
FT                   /db_xref="GOA:Q0ID88"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID88"
FT                   /protein_id="ABI45953.1"
FT                   /translation="MKIEASRPLEGRRLVVAASGSIAAVKTPLLVSALVKAGAEVRCVI
FT                   TSSASRLVSPVALASLSRHPCLQDQDQWDPSQSRPLHVELAEWADLVVVAPLSATSLAR
FT                   WTQGLGDGLLASLLLACERPVVAASAMNTGMWSNPAVRRNWDLLQRDQRVLCLGPEPGL
FT                   LACDRIGEGRMADPALIQLAVLHALQQGSQKRQLTRDWSGRSLLVTAGPTVEALDPARI
FT                   VSNRSSGRMGVMLAQAARWRGARVDLIHGPLQLPNAWLEGLSCHPVESAQAMESALIEL
FT                   QPDVDAVAMAAAVADLRRRGGALPEKPAKAALESVLSDQMEPVPDLLAGLAERRPPGQV
FT                   LLGFAALSGHVDSLLERARHKLSAKQCDLLFANPIDQPNQGFGSHRNGGWLLRRDGSQQ
FT                   PFLPQCKLELANRLLDEIAMQRTALHGLHSQDVISDV"
FT   gene            356701..357522
FT                   /gene="psbO"
FT                   /locus_tag="sync_0353"
FT   CDS_pept        356701..357522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbO"
FT                   /locus_tag="sync_0353"
FT                   /product="photosystem II manganese-stabilizing protein"
FT                   /note="identified by match to protein family HMM PF01716"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45616"
FT                   /db_xref="GOA:Q0ID87"
FT                   /db_xref="InterPro:IPR002628"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID87"
FT                   /protein_id="ABI45616.1"
FT                   /translation="MRIRPLLAMVLALCLFVVTACSGGAEAIDRSNVTYDDIRNTGKAN
FT                   DCPTLPDSARGSISLTAGSAYELRGICMHPSQVFVKGEPANKRQEAQFVEGKILTRYTS
FT                   SLDEVFGDLSVGANGLSFSEKGGIDFQPITVLVPGGEEFPFTFSSKNLQATADGSSLTT
FT                   STDFNGTYRTPSYRTSNFIDPKGRALTTGVDYPQGLVGLGGDYEELESENVKRYIDGTG
FT                   EMSFSITKVDPETGEFAGVFTAIQPSDSDMGGREIVDVKISGEVFGRLEEA"
FT   gene            357627..358796
FT                   /gene="sat"
FT                   /locus_tag="sync_0354"
FT   CDS_pept        357627..358796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sat"
FT                   /locus_tag="sync_0354"
FT                   /product="sulfate adenylyltransferase"
FT                   /EC_number="2.7.7.4"
FT                   /note="identified by match to protein family HMM PF01747;
FT                   match to protein family HMM TIGR00339"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47244"
FT                   /db_xref="GOA:Q0ID86"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID86"
FT                   /protein_id="ABI47244.1"
FT                   /translation="MTASSSSSQRSGVIAPYGGTLVDLMASATEHAALKASATTSIECS
FT                   DRNACDVELLVVGGFSPERGFMHQADYDSVVAGHRTTSGYLFGLPIVMDTDREDVAVGD
FT                   KVLLTYKGQDLAVLTVGDKWEPDKVVEAKGCYGTTSLEHPAVRMIATERRRYYLGGLIQ
FT                   GLQLPERVFPCKTPAEVRAGLPDGEDVVAFQCRNPIHRAHYELFTRALHAQNVSENAVV
FT                   LVHPTCGPTQQDDIPGAVRFQTYERLAAEVDNSRIRWAYLPYAMHMAGPREALQHMIIR
FT                   RNYGCTHFIIGRDMAGCKSSLSGDDFYGPYDAQNFAKECAPELTMETVPSLNLVFTDEE
FT                   GYVTAEHAEARGLHVKKLSGTQFRKMLRSGEEIPEWFAFRSVVEVLRAS"
FT   gene            358842..360695
FT                   /gene="hflB"
FT                   /locus_tag="sync_0355"
FT   CDS_pept        358842..360695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflB"
FT                   /locus_tag="sync_0355"
FT                   /product="cell division protein FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF01434; match to protein
FT                   family HMM PF06480; match to protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45642"
FT                   /db_xref="GOA:Q0ID85"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID85"
FT                   /protein_id="ABI45642.1"
FT                   /translation="MNKRWRNVGLYVLLVVVVIVVGTAFLDRPDPATAARTLRYSDFVE
FT                   SVQEDQVSRVLLSPDRGTAQIVETDGRRAEVNLAPDKDLLKMLTDHNVDIAVQPSRQPG
FT                   AWQQAATSLIFPLLLLGGLFFLFRRAQGGGGGGGNQAMNFGKSKARVQMEPTTQVTFGD
FT                   VAGIEGAKLELTEVVDFLKNPDRFTAVGAKIPKGCLLVGPPGTGKTLLAKAVAGEAGVP
FT                   FFSISGSEFVEMFVGVGASRVRDLFEQAKKNAPCIVFIDEIDAVGRQRGAGLGGGNDER
FT                   EQTLNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALMRPGRFDRQVTVDRPDYAGRLQI
FT                   LGVHARSKTLSKDVDLDKVARRTPGYTGADLANLLNEAAILAARRQLTEVSNDEISDAI
FT                   ERIMVGPEKKDRVMSERRKRLVAYHEAGHALVGALMPDYDAVQKISIIPRGNAGGLTFF
FT                   TPSEERMESGLYSRTYLQNQMAVALGGRVAEEIVYGEDEVTTGASNDLQQVASVARQMV
FT                   TRFGMSDKLGPVALGRAQGGMFLGRDIAAERDFSEDTAATIDSEVSDLVDVAYHRATKV
FT                   LNDNRSVLDELAEMLVESETVDSQELQDLLIRRDVRIAEYV"
FT   gene            360670..361320
FT                   /gene="eda"
FT                   /locus_tag="sync_0356"
FT   CDS_pept        360670..361320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eda"
FT                   /locus_tag="sync_0356"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /EC_number="4.1.3.16"
FT                   /note="identified by similarity to SP:P50846; match to
FT                   protein family HMM PF01081"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45750"
FT                   /db_xref="GOA:Q0ID84"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID84"
FT                   /protein_id="ABI45750.1"
FT                   /translation="MYELLSTSDRQQWLMASLRRQPLIVVLRPKESDLLGPFLQSLLCQ
FT                   RLDQLVDLGVHHIEIAWMDHSHWSDLITAIRLRHPALQLGVASVTSERGLQAVIDLDLP
FT                   YAMSPLLDQGLVLMAHQHNCCFVPGVMTPTEIRQAFVLGCHVVKLFPAVVLGLDYHRQI
FT                   SAPMGDLPFMIAAGGLTVADLDPWLSAGYDAIALGRGVLSTTDAIADLRDWLT"
FT   gene            361360..361968
FT                   /locus_tag="sync_0357"
FT   CDS_pept        361360..361968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0357"
FT                   /product="Predicted protein family PM-3"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47851"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID83"
FT                   /protein_id="ABI47851.1"
FT                   /translation="MSQLSIKLSDKADALIAQLQKEIFNRRRKKVTAAGVVETLVESGA
FT                   RSQSDKRFATSWVNLIEDIEKAAKLATAHGSKPSSLTDEEWVMVLSHRNRQVSKPRQAS
FT                   KTSKASKAVQADKPAAAGPTASTKTKQASSSSRVAKARVTKTTKTSTTSLASVGKPRKA
FT                   RRARKSSTDSTSARSTAGRMAKAAAQLASNNGIKSPARS"
FT   gene            complement(361981..363069)
FT                   /gene="aroC"
FT                   /locus_tag="sync_0358"
FT   CDS_pept        complement(361981..363069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="sync_0358"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="identified by similarity to SP:P23353; match to
FT                   protein family HMM PF01264; match to protein family HMM
FT                   TIGR00033"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46915"
FT                   /db_xref="GOA:Q0ID82"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID82"
FT                   /protein_id="ABI46915.1"
FT                   /translation="MGSSFGKLFRISTFGESHGGGVGVIVDGCPPRLKLDLEAIQADLD
FT                   RRRPGQSRITTPRKEADQVEILSGLLDGVTLGTPIAMVVRNKDQRPQDYKDMEVAFRPS
FT                   HADATYQVKYGIQARSGGGRASARETIGRVAAGAIARQLLKQANGTEVIAWVKQIHDLE
FT                   ASVDPSSVTPEQVEGNIVRCPDAGMAEQMIQRIEAIGQEGDSCGGVIECVVRKASTGLG
FT                   MPVFDKLEADLAKAVMSLPATKGFEIGSGFAGTLLKGSAHNDAFLPTQDGTLHTATNYS
FT                   GGIQGGISNGEPILIRVAFKPTATIRKEQQTINAAGEATTLSAKGRHDPCVLPRAVPMV
FT                   EAMVSLVLADHLLRQQGQCSLW"
FT   gene            complement(363124..363600)
FT                   /locus_tag="sync_0359"
FT   CDS_pept        complement(363124..363600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0359"
FT                   /product="Cupin superfamily (DUF985) superfamily"
FT                   /note="identified by match to protein family HMM PF06172"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46254"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID81"
FT                   /protein_id="ABI46254.1"
FT                   /translation="MNKRNPSEVVEKLVEEWKLQPHPEGGWYRELHRSSVLVIRPDQQQ
FT                   RCAISTILYLLDSGSLSRWHRVSHADEVWTHLQGAPLSLWCLKPKADQATREVLSMHNP
FT                   VQVIPADHWQAAKAEGPYSLVSCCVGPGFSFEDFTMLRDLPESERPTAALPDLI"
FT   gene            complement(363762..365108)
FT                   /locus_tag="sync_0360"
FT   CDS_pept        complement(363762..365108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0360"
FT                   /product="possible Vng0271c"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47417"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID80"
FT                   /protein_id="ABI47417.1"
FT                   /translation="MPLPSASGMEQSSANCCRIDHRMDFQQGLIATIHDYGLGKLDLPD
FT                   FRRQLRQRPTSLLIPCLMEEFSRPALGLIREVLAELSGLEELVIALSAETSDDVAAAEA
FT                   FFSDMPFPVRVHWTNGPAVAESLQSLQTLGLNVTGPPGKGWAVWQGLGVACRNAEIVGL
FT                   FDADIRTFSPAYPQRMLRPLLDPSLGVAYVKAFYSRLSLETQSLHGRATRLFVGPLLTS
FT                   LEQIFGPMPYLRYLQSFRYPLAGEFAFTRDLAMNLRIPSDWGLEIGLLSEVYRHVAPRR
FT                   IAQVDLGLFDHKHKTLGNAPSEGLQRMAGEIFATVLRGLMEHEGRMLSPDQIPTLEVLF
FT                   RRVGEDRVQQFGLDSAINRLPYNRHSEELAVQSFATLLRPKVEDLMAAPVAHQLPSWSR
FT                   LLCCTERLQADLAEAGQKRNITAAPNRTPRRHHHRPLMACPPRRPATAA"
FT   gene            365053..366873
FT                   /locus_tag="sync_0361"
FT   CDS_pept        365053..366873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0361"
FT                   /product="Glycosidase"
FT                   /EC_number="2.4.1.7"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45857"
FT                   /db_xref="GOA:Q0ID79"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016377"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID79"
FT                   /protein_id="ABI45857.1"
FT                   /translation="MRQQFAELCSIPDALGKGTVSKLLMAHKWLPSLLTELYEHHSSED
FT                   LNLLSSQLLHSERSASEKAVSESLDVGSADATATGARWDSSSCVLIAYADTVSADDQPG
FT                   LRCLQALLHEHFNGLSSVVHVLPFLRSTSDGGFAVASHEEIEQRFGDWNDLAALAEGRQ
FT                   LMADLVLNHISASHPWVRAFLKGEQPGARCVLAAAPNPCWDNVVRPRSSALFTTLATDR
FT                   GPETVWTTFGPDQVDVNWREPEVLLGFTRLLDLFCSYGVQWLRLDAVGFVWKEPLSDCI
FT                   HQPQAHRLVEVLRLLLESRCPQGVVVTETNVPEQENLSYLTTGSEAHLAYNFPLPPLVL
FT                   EACLSRRADLLNNWLARWPQLPQGTGLLNFTACHDGIGLRPLEGLMESDRLLQLLKQCE
FT                   QRGGLVSHRRLADGLEVPYEINISWWSAMAAPGRDPSHHQRARFLLTQLLLLTLPGVPA
FT                   FYLPALLATPNDNARFLLSGHRRDLNRPQFQLDRLERLLVDVESDTPQVVASLQQAMAV
FT                   RRGQAALDPFAPMKVLSEGRSDLVILQRGEGASTLFAIHNFSDVRLSFPLSTLANATGC
FT                   VWHDVLKGHSLVAGQTALDLEPFAVHWLTR"
FT   gene            366858..367679
FT                   /locus_tag="sync_0362"
FT   CDS_pept        366858..367679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0362"
FT                   /product="mannosyl-3-phosphoglycerate phosphatase homolog"
FT                   /EC_number="3.1.3.-"
FT                   /note="identified by match to protein family HMM TIGR01484;
FT                   match to protein family HMM TIGR01486; match to protein
FT                   family HMM TIGR02461"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45573"
FT                   /db_xref="GOA:Q0ID78"
FT                   /db_xref="InterPro:IPR006380"
FT                   /db_xref="InterPro:IPR006381"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID78"
FT                   /protein_id="ABI45573.1"
FT                   /translation="MVNSMTKTDALCSIPWWVVTDLDGTLMDHDYNWEPAREAIRGLQL
FT                   KGIPVIPCTSKTAVEVKHFRAAVGLKDPYIVENGGAIHGETSDGEPWELVLGCPVAELR
FT                   PVLLELEQLLSEPLQPIDALSDQEAFDLLGLQGKALQLACTRCWSLPFVPPSASARQRL
FT                   PDLANRLGFAVVQGNRMGHLLGVDVSKGRALEVLKQRRAGSPVRVLALGDSPNDQPLLD
FT                   AGDLSVVVPGANGPHPVFAEAIAQGRYQLASACHAQGWAEAVFQYILNEQS"
FT   gene            367769..368191
FT                   /locus_tag="sync_0363"
FT   CDS_pept        367769..368191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0363"
FT                   /product="Predicted redox protein"
FT                   /note="identified by match to protein family HMM PF02566"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45825"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID77"
FT                   /protein_id="ABI45825.1"
FT                   /translation="MTAIQCRYTGDLHCTAQHGPSGSVLNTDAPTDHDGLGESFSPTDL
FT                   LATALGTCILTIMGLAARRRGWDLVDASVIVEKTMTTEGPRRIESLQAQISLPVALSQE
FT                   QKTLLKRVANDCPVKRNLDTSITIDLIWNDASSTAL"
FT   gene            complement(368452..369906)
FT                   /locus_tag="sync_0364"
FT   CDS_pept        complement(368452..369906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0364"
FT                   /product="PyrF/pyrE bifunctional enzyme"
FT                   /EC_number="4.1.1.23"
FT                   /EC_number="2.4.2.10"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR00336"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45025"
FT                   /db_xref="GOA:Q0ID76"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID76"
FT                   /protein_id="ABI45025.1"
FT                   /translation="MLRSWADLRGLNGRSLLSQARSWCKSVIEETADHVCAYKPSLGFY
FT                   QAMGSAGVELLLEVRELLPPDLPLIIDIKHGDLNSSSAIAAYLFQSLHADAVTLNPFAG
FT                   QDIAAPFLLYPGKGVFINCHSSNPAAHDLQHHPNDHNPFYLKVVRESQSWGTPEQLLLE
FT                   VGTSDPAILADVRQAAPERFVMLRSLWGEEGNLQCLLKNGLNKMGDGLLIPLPQNLLNG
FT                   NNINEQTSTLKGRINRIRDQHLQERAHTDAIHPEQCRIWPHSDQSNQDDSITTVREDGV
FT                   KPIDQDLWDLVIDLYDIRCLLFGEFKQASGEIFNYYIDLRQIISDPALFHRVLDCYAQV
FT                   LRPLRFDRIAGIPYGSLPTATGLSLQLHKPLIYPRKEVKAHGTRRMVEGEFKKGETVAV
FT                   VDDILITGGSVMEGISKLESSGLNVRDVVVFLDHGGIHDLRAKQRLQSHGVKLQAVLTL
FT                   DTISHVLETSDRISPDQAQELRHTEK"
FT   gene            369965..370219
FT                   /locus_tag="sync_0365"
FT   CDS_pept        369965..370219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0365"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46703"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID75"
FT                   /protein_id="ABI46703.1"
FT                   /translation="MSAVKKPMALGIDSSRMGSDQIVRDSDPSNEAFDDGSDVDGVVWP
FT                   EWLRSAYSINSVQINTFLNLIDSQPVMAGDQLSLAHEGG"
FT   gene            complement(370193..371431)
FT                   /locus_tag="sync_0366"
FT   CDS_pept        complement(370193..371431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0366"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF03458"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47517"
FT                   /db_xref="GOA:Q0ID74"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID74"
FT                   /protein_id="ABI47517.1"
FT                   /translation="MRDVAGGAFITPERERYAYFSAPYRNEDIILISRRSESSAIAMLR
FT                   PDVFKQSFPSSKLRLGVVSGYYYGDAIDRFLKDQSNQNRWTSVKTDIENLQNLVNGKVD
FT                   LVAIDRLVGSTLIWEESLSRDLIAGKDHIFSGPIVALFSRRTTSPALVSAFDQAMQKLK
FT                   GDGRYNQIVRDYLFPSLLAMTAGQPWFFILETIGTAAFAFSGILLARRDRFSLFGALVL
FT                   ASLPAFGGGIIRDLIANRDQPAVLQSTHNMMIVIALVLISHLIARLTNLRGLPSQLSKF
FT                   HFGEKAVQVLDALGLSAFTVVGVIVAVEEKCNPLLLWGPIFSAMTGAGGAILRDVIRAD
FT                   ASHPTLRHDFYAELSFFWGLMLSIFISMYANSNNLHTLPMNLAVLFTTLGCLLSRLVVM
FT                   QRGIKSSTFMSKT"
FT   gene            371613..371738
FT                   /locus_tag="sync_0367"
FT   CDS_pept        371613..371738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0367"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47559"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID73"
FT                   /protein_id="ABI47559.1"
FT                   /translation="MTFSSEAETEVVTLMTRTIDTNAMANVLSFTDPFVLILMLL"
FT   gene            complement(371860..372939)
FT                   /gene="psbA-1"
FT                   /locus_tag="sync_0368"
FT   CDS_pept        complement(371860..372939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbA-1"
FT                   /locus_tag="sync_0368"
FT                   /product="photosystem II protein D1"
FT                   /note="identified by match to protein family HMM PF00124;
FT                   match to protein family HMM TIGR01151"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46731"
FT                   /db_xref="GOA:Q0I7J2"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005867"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I7J2"
FT                   /protein_id="ABI46731.1"
FT                   /translation="MTTTIQQRSGANGWQQFCDWVTSTNNRLYVGWFGVLMIPTLLAAT
FT                   TCFIVAFIAAPPVDIDGIREPVAGSLMYGNNIISGAVVPSSNAIGLHFYPIWEAASLDE
FT                   WLYNGGPFQLVVFHFLIGIYAYMGREWELSYRLGMRPWICVAYSAPVAAASAVFLVYPF
FT                   GQGSFSDAMPLGISGTFNYMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSS
FT                   LVRETTETESQNYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVV
FT                   GIWFTALGVSTMAFNLNGFNFNQSILDGQGRVLNTWADVLNRAGLGMEVMHERNAHNFP
FT                   LDLAAAESTPVALQAPAIG"
FT   gene            373103..374707
FT                   /locus_tag="sync_0369"
FT   CDS_pept        373103..374707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0369"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45492"
FT                   /db_xref="GOA:Q0ID71"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID71"
FT                   /protein_id="ABI45492.1"
FT                   /translation="MSNAVSIKGSRAAGERVLFVRLPCNPIFPIGPIYLADHLHKCFPD
FT                   LPQRILDLAALPVLDVEGVLLNVVDQFRPTLLVFSWRDIQIYAPVDGRGGNPLQNSFEV
FT                   FYARNPLKRVKGALGGLRLMTSHYGELHRNQKLVRHGLKRARRHSPEARAVLGGGAVSV
FT                   FYEQLGRSLPKGTIISIGEGEPLLEKLLAQQPLDGERCFVVGEAPRPGLIHEQPESRPK
FT                   TACDYNYISSIWPQLDWYLEGGDFYVGVQTKRGCPHNCCYCVYTVVEGKQVRVNPVQEV
FT                   VAEMRQLYDRGVRGFWFTDAQFIPARKYIEDAKELLRAIKAEGLTGIRWAAYIRADNLD
FT                   PELAQLMVETGMSYFEIGITSGSQELVRKMRMGYNLRTVLDSCRMLAEAGFHDHVSVNY
FT                   SFNVIDERPETIRQTVAYHRELEAIFGEDRVEPAIFFIGLQPHTHLEQYGFDQGLIKPG
FT                   YNPMSMMPWTARKLLWNPEPMGSTFGRVCLEAFDRDPGRFGKTVMELLERDYGVAPLDQ
FT                   ALRAPVQGRAALAKAVS"
FT   gene            complement(374671..375501)
FT                   /locus_tag="sync_0370"
FT   CDS_pept        complement(374671..375501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0370"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46301"
FT                   /db_xref="GOA:Q0ID70"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID70"
FT                   /protein_id="ABI46301.1"
FT                   /translation="MRTSWFTLKPRWIPTITLIPALYALGWLLLQPISLLVPGRSIPSQ
FT                   DLIGTGISVLLFLLILPSWTRTRWETRHPWRQLGLKAAARGPSSRRSLLNGLGWAASLL
FT                   LIICLISLGGQWGQWLGDFSAAKLINALLLCFGVGLIEELLFRGWLLGELNLLIGAKRA
FT                   VPAQAVIFSLVHTRFNLGFWPMLSLLIGLFLLGMALATRRQLDGGSLWGCIGLHGGLVG
FT                   GWFALQSGLIQWSPESPFWLTGPGDNPLGGMVGIACFAALLSFQLTALAKAARP"
FT   gene            complement(375522..375833)
FT                   /gene="clpS-1"
FT                   /locus_tag="sync_0371"
FT   CDS_pept        complement(375522..375833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpS-1"
FT                   /locus_tag="sync_0371"
FT                   /product="ATP-dependent Clp protease adaptor protein ClpS"
FT                   /note="identified by match to protein family HMM PF02617"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46551"
FT                   /db_xref="GOA:Q0ID69"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID69"
FT                   /protein_id="ABI46551.1"
FT                   /translation="MVDTPSRSPGGAAVLDKQTERVRKTSPRYKVLLHNDPVNSMEYVV
FT                   VTLQQVVPQLSEQDAMAVMLETHNTGIGLVIVCDIEPAEFYCETLKNKGLTSTIEPES"
FT   gene            complement(375875..377209)
FT                   /gene="aspB"
FT                   /locus_tag="sync_0372"
FT   CDS_pept        complement(375875..377209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspB"
FT                   /locus_tag="sync_0372"
FT                   /product="aminotransferase, classes I and II"
FT                   /EC_number="2.6.1.-"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45974"
FT                   /db_xref="GOA:Q0ID68"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019942"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID68"
FT                   /protein_id="ABI45974.1"
FT                   /translation="MGIWILLRVGRGDNHDHQGLLLSSYVAGCPQQPQSFVVKVNGNYL
FT                   KLKAGYLFPEIGRRVKAFSSANPEAQLIRLGIGDVTEPLPQACRDAMKSAIDEMGTAEG
FT                   FHGYGPEQGYAWLREAIARDDFQARGCEISAEEIFVSDGSKCDSSNILDILGSGNRIAV
FT                   TDPVYPVYVDSNVMAGRTGESGDDGRYGGLTYLPISADNGFAAQIPSEPVDLIYLCYPN
FT                   NPTGAVATKAQLKKWVDYARANKALILFDAAYEAFIQDPELPHSIYEIEGARDCAIEFR
FT                   SFSKNAGFTGTRCALTVVPKGLKGKADDGSEVELWGLWNRRQSTKFNGVSYIIQRGAEA
FT                   VYSDAGKQEVKALVSFYMENAAIIRRELSAAGIEVHGGQHAPYVWLKTPSGMDSWSFFD
FT                   HLLQKANVVGTPGSGFGAAGEGYFRLSAFNSRSNVDEAMARIRNL"
FT   gene            377216..379855
FT                   /locus_tag="sync_0373"
FT   CDS_pept        377216..379855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0373"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45415"
FT                   /db_xref="GOA:Q0ID67"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR018768"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023862"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID67"
FT                   /protein_id="ABI45415.1"
FT                   /translation="MAFDQLVDASINRPARYMGYELGVEPRDWETARVRWALTYPEIYE
FT                   VGSSNLGHIILYSILNAVPGQLCDRAYLPAADLSERLKERNQALFAVESRRPLPAFDIL
FT                   GFSLSYELGATNILAMLDLAKVPLYAAQRGDLPLSHPESPPLIFAGGPTATSNPEPYAA
FT                   FFDFIALGDGEELLPEIGLVVSEAKAAGLSRTDLLRDLAAVPGVYVPSLYEPDQQGITV
FT                   EPLEPGLPVRLLRRVATPMPHYATGLVPHVETVHDRLTVEIRRGCTRGCRFCQPGMLTR
FT                   PARDVEPEAVIEAIETGMQRTGYSDFSLLSLSCSDYLALPAVGVELRNRLADRNVTLQL
FT                   PSQRVDRFDDDIAHILGGSRQAGLTFAPEAGTQRLRDIVNKGLTDADLVDGIRTAMQNG
FT                   FRKVKLYFMIGLPGETDADVLGIVETCRMLLDRCRDLGRLNLNITISNFTPKPHTPFQW
FT                   HSVSTAEFLRRQQLLREAGKRLRGVRFNFTDVRLSAMEDFVGRGDRSLAPVIEAAWRAG
FT                   AGMDAWFEALDRTYEAWTGAIAAAGLEGRYRALELGGWGRANALSEEGLDAFCAQPLPW
FT                   DHIDTGIDKRWLAEDLKRALEAAVVPDCSFEGCSSCGVCGPDLGHNVVIPPPEIPVQKP
FT                   RQAPPSDRVCRIRFRFSKTGAMALLSHLDLVRLFERALRRAELPMSFTGGFHPLPRLQL
FT                   ALALPLGVQGEGEWMDLEFIEQVEALQVLKRWQKTLPPGLVLLEAYEVPVSGQSLSQQL
FT                   ESARWSFELTSQAGDPSISLEQWQQVVDALLSRDSLVWDDTDKKGRPRQRDCKPVLEML
FT                   EIVSPVDDGASLNREPVDGVRLELLAHIDHQGRSLKPAQLQHWLSEALAQSLHLKNVRR
FT                   LELRLVRC"
FT   gene            380117..382120
FT                   /locus_tag="sync_0374"
FT   CDS_pept        380117..382120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0374"
FT                   /product="ribonuclease, Rne/Rng family protein"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM TIGR00757"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46252"
FT                   /db_xref="GOA:Q0ID66"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID66"
FT                   /protein_id="ABI46252.1"
FT                   /translation="MPQQIVIAEQLRIAAVLTDECVDELIVAQGRYQIGDVYLGTVENV
FT                   LPGIDAAFVNIGESEKNGFIHVTDLGPLRLKKGAAGITELLEPRQKVLVQVMKEPTGTK
FT                   GPRLTGNLALPGRYLVLQPSGQGVNISRRIGSEGERNRLRALGVLVKPPGAGLLIRTEA
FT                   DGISEELLIDDLESLLRQWEAIQKASEAASPPVLLNRDEDFIHRILRDHTGLDLDRVVV
FT                   ESPAAVERVRSFLGDEGSHVVVEAHPEPSELLEDYKVNGAIRDALKPRVDLPSGGYVII
FT                   EPTEALTVIDVNSGSFTRSANARETVLWTNCEAAIEIARQLRLRNIGGVIIVDFIDMDS
FT                   RRDQLQLLEHFTGAIRDDAARPQIAQLTELGLVELTRKRQGQNIYELFGRACPSCGGLG
FT                   HVAVLPGKDLMQPLATATGLVRSAASARAEVPQAGEASNARRRRGGRGKVISASGPADR
FT                   GDAPLEEVESATGAATSAAIEPASVSRRQDPELVAVPMDEDEEQVYGWLGLNPALLLDS
FT                   QPELDNLMVRIVRPGEDPEQVLEQARQQMSANSGRRRRRGPRGNGRSAGTGTGRSAASG
FT                   SGDESAPTTPVAPLDRDDPSQPLLVEIVPLIETPVPVMSPEPLAVSVAEPVSVSISEPV
FT                   VSSEPEVTAEPADTSESRPGRRRRRSSASTSE"
FT   gene            382146..382739
FT                   /gene="rnhB"
FT                   /locus_tag="sync_0375"
FT   CDS_pept        382146..382739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="sync_0375"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="identified by similarity to SP:O31744; match to
FT                   protein family HMM PF01351"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46246"
FT                   /db_xref="GOA:Q0ID65"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID65"
FT                   /protein_id="ABI46246.1"
FT                   /translation="MIASDGLGIAGVDEVGRGCLFGPVFAAAVVLSDHAAEHLQAAGLT
FT                   DSKALTPSRRAALVPLIEAHAHAWGLGQSSARAVDRDGIRSATEQAMLCALQRLPCRPQ
FT                   LVLVDGVLPLRLWEGSQRTIVRGDSSHAAIAAASVLAKEARDALIRRLSNRFPGYGLER
FT                   HAGYGTAQHRAALLACGPTPLHRHSFLRKLFATV"
FT   gene            complement(382722..383297)
FT                   /locus_tag="sync_0376"
FT   CDS_pept        complement(382722..383297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0376"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45437"
FT                   /db_xref="InterPro:IPR018971"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID64"
FT                   /protein_id="ABI45437.1"
FT                   /translation="MPRQDTVMPLAFRASQHLDLPIADESERLRAYLHEHDRVVKALLD
FT                   PNQLTAFAPGRYRYTVTTLHVFQLQVKPVVSLEVDEVSGQLRIRALDADLEGLGLVDDF
FT                   QLSLEALLEATPRGLQGEAMLSVEVSQPPLLRLIPKRVLESTGESILNGILLTIKGRVG
FT                   RQLVADFQSWAKDLDTPPPSKSALHSGK"
FT   gene            383329..384168
FT                   /locus_tag="sync_0377"
FT   CDS_pept        383329..384168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0377"
FT                   /product="prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="identified by match to protein family HMM PF00800;
FT                   match to protein family HMM PF01842"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47165"
FT                   /db_xref="GOA:Q0ID63"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID63"
FT                   /protein_id="ABI47165.1"
FT                   /translation="MPMRVAFLGPEGTYGERAARSLMRLEAIENPELVACLGLRSVVEH
FT                   VADGRCESAVVPVENSVEGGVTAILDALWSYSNLRIRRAVVLPIRHALLSSGTLDGISE
FT                   VLSHPQALAQCSGWLARHLPQAVQLPASSTAEAARMVRGSHFRAAIADRSLAGQQGLQE
FT                   LAYPVNDVAGNRTRFLLLQNGEVSREGDVASLALSLHQNTPGALIEALEVIAQLGLNMS
FT                   RIESRPSKRELGEYVFFVDVELPGKETSELLEQLTTSLQPLCEHLLHFGAYPSSVLE"
FT   gene            complement(384200..385144)
FT                   /locus_tag="sync_0378"
FT   CDS_pept        complement(384200..385144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0378"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF02353"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47237"
FT                   /db_xref="GOA:Q0ID62"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR025774"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID62"
FT                   /protein_id="ABI47237.1"
FT                   /translation="MPSPTVLIPTAAGLLLLGCAYQLWNRRNRAYHSSESVAAAYDAWT
FT                   DDQLLESLWGEHVHLGHYGSPPQPRDFRQAKSDFVHELVHWSGFDQLPPGSRVLDVGCG
FT                   IGGSARILSRDYGLDVLGISISPAQVNRATHLTPDSLPCRFAVMDALNLQLEDQSFDAV
FT                   WTVEAGPHMPDKQRFANELLRVLKPGGRLAVADWNRRDPVDGALNRRERWVMHQLLTQW
FT                   AHPEFASIRGFRQNLENSPHHRGTISTDDWTDATLPSWNESILEGIRRPNAILRLGPKA
FT                   VLQGLRETPTLLLMRWAFARGMMQFGVFKTNHC"
FT   gene            complement(385144..385806)
FT                   /locus_tag="sync_0379"
FT   CDS_pept        complement(385144..385806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0379"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="identified by match to protein family HMM PF02190"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45107"
FT                   /db_xref="GOA:Q0ID61"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID61"
FT                   /protein_id="ABI45107.1"
FT                   /translation="MVDLSVRELPLFPLPDVVLFPSDVLPLHIFESRYRMMLQSVLETD
FT                   RRFGVVRWDPNQQTMAAVGCCAEVIQHQTGDDGRSNIVTLGQQRFRVLNVTREMPFRSA
FT                   MVSWIEDEPVDNTSELESLAATVTQALKDVVELTGKLTDSKSSLPDDLPDLPRELSFWI
FT                   GAHLGGPVADQQQDLLELTSTRTRLEQEFEMLDETRRQLAARTVLRDTLTETDPSNG"
FT   gene            complement(385863..386183)
FT                   /gene="rpsJ"
FT                   /locus_tag="sync_0380"
FT   CDS_pept        complement(385863..386183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="sync_0380"
FT                   /product="ribosomal protein S10"
FT                   /note="identified by match to protein family HMM PF00338;
FT                   match to protein family HMM TIGR01049"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46021"
FT                   /db_xref="GOA:Q0ID60"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID60"
FT                   /protein_id="ABI46021.1"
FT                   /translation="MSTAIAQQKIRIRLKAFDRRMLDLSCDKIIETADNTAATAIGPIP
FT                   LPTKRKIYCVLRSPHVDKDSREHFETRTHRRIIDIYSPSAKTIDALMKLDLPSGVDIEV
FT                   KL"
FT   gene            complement(386339..387538)
FT                   /gene="tuf"
FT                   /locus_tag="sync_0381"
FT   CDS_pept        complement(386339..387538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="sync_0381"
FT                   /product="translation elongation factor Tu"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF03143; match to protein
FT                   family HMM PF03144; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR00485"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47605"
FT                   /db_xref="GOA:Q0ID59"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID59"
FT                   /protein_id="ABI47605.1"
FT                   /translation="MAREKFERNKPHVNIGTIGHVDHGKTTLTAAITNVLAKKGQAEVQ
FT                   NYADIDGAPEERERGITINTAHVEYETDSRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCAATDGPMAQTKEHILLAKQVGVPALVVALNKCDMVDDEEIIELVELEIRELLSSYDF
FT                   PGDDIPVVQVSGLKAIEGEAEWEAKIEELMAAVDASIPEPEREVDKPFLMAIEDVFSIT
FT                   GRGTVATGRIERGIVKVGEEVEVVGIREPRKTTVTGVEMFRKLLDEGMAGDNVGLLLRG
FT                   IQKEDIERGMVLVKPGSITPHTKFEGQVYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTG
FT                   QITAFTAEDGSNVEMVMPGDNIQMTGELICPVAMELGMRFAIREGGRTIGAGVVSKIIE
FT                   "
FT   gene            complement(387580..389655)
FT                   /gene="fusA"
FT                   /locus_tag="sync_0382"
FT   CDS_pept        complement(387580..389655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="sync_0382"
FT                   /product="translation elongation factor G"
FT                   /note="identified by similarity to SP:P80868; match to
FT                   protein family HMM PF00009; match to protein family HMM
FT                   PF00679; match to protein family HMM PF03144; match to
FT                   protein family HMM PF03764; match to protein family HMM
FT                   TIGR00231; match to protein family HMM TIGR00484"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47418"
FT                   /db_xref="GOA:Q0ID58"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID58"
FT                   /protein_id="ABI47418.1"
FT                   /translation="MARDFPLERVRNIGIAAHIDAGKTTTTERILFYSGVVHKIGEVHD
FT                   GAAVTDWMAQERERGITITAAAISTSWNNHRINIIDTPGHVDFTIEVERSMRVLDGVIA
FT                   VFCAVGGVQPQSETVWRQADRYSVPRMVFVNKMDRTGADFLKVFGQIKDRLKANAVPIQ
FT                   LPIGAEGELSGIIDLVENKAHIYKDDLGQDIEVTDVPADMKDEADKWRNVLMETIAEND
FT                   EDLIEKFLESGELSNSDLKRGIRTGVLKHNLVPVLCGSAFKNKGVQLVLDAVVDYLPAP
FT                   IDVPPIQGLLPNGKEAVRPSDDNAPFSALAFKVMADPYGKLTFVRMYSGVLEKGSYVLN
FT                   STKDTKERISRLVVLKADDREEVDALRAGDLGAVLGLKNTTTGDTLCATDDPIVLETLF
FT                   VPEPVISVAVEPKTKGDMEKLSKALVSLAEEDPTFRVRTDQETGQTVIAGMGELHLEIL
FT                   VDRMLREFKVEANIGAPQVSYRETIRGSSKGEGKFSRQTGGKGQYGHVVIEMEPGEPES
FT                   GFEFINKIVGGIVPKEYIKPAEQGMKETCESGVIAGYPLIDVKCTMVDGSYHDVDSSEM
FT                   AFKIAGSMAFKDAVKKCNPVLLEPMMKVEVEIPEDFLGSVIGDLSSRRGQVEGQSVDDG
FT                   TSKVSSKVPLAEMFGYATELRSMTQGRGIFSMEFSHYEDVPRNVAEAIISKNQGNS"
FT   gene            complement(389733..390203)
FT                   /gene="rpsG"
FT                   /locus_tag="sync_0383"
FT   CDS_pept        complement(389733..390203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="sync_0383"
FT                   /product="ribosomal protein S7"
FT                   /note="identified by match to protein family HMM PF00177;
FT                   match to protein family HMM TIGR01029"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47000"
FT                   /db_xref="GOA:Q0ID57"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID57"
FT                   /protein_id="ABI47000.1"
FT                   /translation="MSRRNAAVKRPILPDPQFNNRLATMMVARLMKHGKKSTAQRILSD
FT                   AFGMIGERTGGDPVELFETAVKNATPLVEVRARRVGGATYQVPMEVRQERGTAMALRWL
FT                   VNFSRARNGRSMAQKLAGELMDAANEAGSAVRKREETHKMAEANKAFAHYRY"
FT   gene            complement(390253..390627)
FT                   /gene="rpsL"
FT                   /locus_tag="sync_0384"
FT   CDS_pept        complement(390253..390627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="sync_0384"
FT                   /product="ribosomal protein S12"
FT                   /note="identified by match to protein family HMM PF00164;
FT                   match to protein family HMM TIGR00981"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47627"
FT                   /db_xref="GOA:Q0ID56"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID56"
FT                   /protein_id="ABI47627.1"
FT                   /translation="MPTIQQLIRHERQTLKAKTKSPALRACPERRGVCTRVYTSTPKKP
FT                   NSALRKVARVRLTSGFEVTAYIGGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDT
FT                   AGVKDRRQSRSKYGAKAPKE"
FT   gene            complement(390705..391031)
FT                   /locus_tag="sync_0385"
FT   CDS_pept        complement(390705..391031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0385"
FT                   /product="Uncharacterized HesB family conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45254"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID55"
FT                   /protein_id="ABI45254.1"
FT                   /translation="MGATFSISASAAAELGRQAAIAGTPGLMHLDLVSGSCEQHVIRLR
FT                   PGHLAGIAMARADGVTLHAPEEQLHLLEGLCLDYRGDLSGGGFLISPQDNVRCCLCGSA
FT                   FSRC"
FT   gene            complement(391054..392610)
FT                   /locus_tag="sync_0386"
FT   CDS_pept        complement(391054..392610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0386"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45990"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID54"
FT                   /protein_id="ABI45990.1"
FT                   /translation="MLVGQMGFQRQANRDGEQLEWYGFQLPLSGVQQRTIGDEVALDAL
FT                   PWLNALGVQVNRSKNSLRVDLPKPHLKTLRQGKGGSANRLVMDLSGPALVQRQGDDLLL
FT                   QMKVTPAQESQLRSIGLQTRQEAGGLKLLGQSSKLSTLTLKGPWRVVLDGITSTKPAIR
FT                   RRQVQAFQSALLAPEMQALIKKGLVVDQRVVQVGVKRIQLYRASVQHNTSALLLRPLAP
FT                   SHAQPGLRYLNQLARPAKALVAVNGGFFNRVRQLPLGAVRLNNTWLSGPILNRGAIGWD
FT                   RNGPLIFGRLQLIQDMTVAGRRRWPLGMLNSGYVQRGLSRYTRAWGPTYRALSGEEQAL
FT                   TLKEGRVDAVYDQSALVRGVPLPLKGDLIVARGGIALPAQVGDAVTIKIRSSNPLGERP
FT                   QVMGGGPLLLQNGRVVLNGRQEGFSPGFLAVSAPRTVVAQDKERVWLLTAKGANGSDPT
FT                   LLETSLALRQLDLTDALNLDGGGSTTMLIANTTVMTGRGITPRVQNGLGFVSGGSMVLA
FT                   N"
FT   gene            392797..397479
FT                   /locus_tag="sync_0387"
FT   CDS_pept        392797..397479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0387"
FT                   /product="Ferredoxin-dependent glutamate synthase,
FT                   Fd-GOGAT"
FT                   /EC_number="1.4.7.1"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF00478; match to protein
FT                   family HMM PF01493; match to protein family HMM PF01645;
FT                   match to protein family HMM PF04898"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45120"
FT                   /db_xref="GOA:Q0ID53"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID53"
FT                   /protein_id="ABI45120.1"
FT                   /translation="MGESLGSEIAQPATECERRCCCTSRLQVMTQLTGSDWPYCDSSAP
FT                   AAVAGEKDACGVGFLAQLQGERSYWVLQQALRGLGCMEHRGGCGGDGDSGDGAGVLCEI
FT                   PWDYLRAIWPEAANGNGLGMMFLPKDPSLRAEVQRFCDQEAQSLGLMSIGWREVPIDSA
FT                   VLGPLARETAPVIQQWLVQRDVDADALESLLLRLRRRVGARVRKEFGAEGAREFYVASL
FT                   SGRTVVYKGMVRSEVLAQYYADLRDPRFAVSFAVYHRRFSTNTLPRWPLAQPMRLLGHN
FT                   GEINTLLGNLNWAKASEAGLEDVWGDAAADLIPVVNPDFSDSANLDATLELMVRSGRSI
FT                   TDSLITLVPEAFRNQPDLESRPDVTAMYEFNAGIQEPWDGPALLVFADGKRVGATLDRN
FT                   GLRPARWCTTADGFVIMGSETGVVDLSGKTVVEKGRLGPGQMVAVDLERGELLTNWAVK
FT                   EDAAQRFPYGDWLKQHRRSVSAQPWTQDCQISELDLLRLQTAMGFTAEDLDLVIEDMAG
FT                   LGKEPTYCMGDDIPLAVLSDKPHLLYDYFKQRFAQVTNPPIDPLREKLVMSLEMHLGQR
FT                   RPAVKPQAAAAALIHLDTPVLNEAELSALSDQGLAVRSLSTQVAVEACAGGLQSAVDAL
FT                   CLKAEDAVRKGAQVLVLSDRVNAEEQPAELMATTVAMPALLAVGAVHHHLLRQKLRLHC
FT                   SLVSETAQCWSTHHMACLIGYGASAVCPWLTWETTRHWLAHPKTQKRIEQGKLQPLDAN
FT                   KAQANVRLSLENGLRKILSKIGISLLASYHGAQIFEAIGLGADVIQKAFAGTTSRVAGM
FT                   TLLELANETLSLHAKAFPELNRSKLEFMGFVQYRTGGEYHLNSPEMSKALHSAVKAGPG
FT                   YDHFSTYKTLLENRPVTALRDLLEFKLAATPLPLDQVESAESLCTRFCTGGMSLGALSR
FT                   EAHEVLAVAMNRIGGKSNSGEGGEDPIRFQILKDVDGDGRSSSFPSIGGLRNGDTACSA
FT                   IKQIASGRFGVTAEYLRSGKQLEIKVAQGAKPGEGGQLPGPKVDEYIAGLRNSKAGVAL
FT                   ISPPPHHDIYSIEDLAQLIHDLHQVHPKAPVSVKLVAEIGIGTIAAGVAKANADVIQIS
FT                   GHDGGTGASPLSSIKHAGSPWELGLTEVHRSLLENGLRDRVLLRADGGLKTGWDVVVAA
FT                   LLGAEEYGFGSVAMIAEGCIMARVCHTNNCPVGVATQKAALRKRFTGVPEHVVNFFWYV
FT                   AEEVRQLMSVLGVARLEDLIGRSDLLQPRSVELEKTKCVDLSSLLAPVGDANDRSWLKH
FT                   SSEAHGNGPILEDHLLADADFMDAVENHGSLSRTIEIVNTDRSVGARFAGEIAQRHGNR
FT                   GFKGQLNLNFRGAAGQSFAAFLVQGMTMRLEGEANDYVGKGMNSGRISLVPDDGVANPG
FT                   DQVILGNTCLYGATGGELFANGRAGERFGVRNSGARAVVEGAGDHCCEYMTGGVIVVLG
FT                   GTGRNVGAGMTGGVAFLLDEAGGVKARVNPEIVEVVGITTPQQESLLKSLLEAHVSTTS
FT                   SEKAKALLADWTNAKSSFKLLVPPSERAAMGLEAREVVAA"
FT   gene            397495..397803
FT                   /locus_tag="sync_0388"
FT   CDS_pept        397495..397803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0388"
FT                   /product="uncharacterized ycii family conserved protein"
FT                   /note="identified by match to protein family HMM PF03795"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45760"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID52"
FT                   /protein_id="ABI45760.1"
FT                   /translation="MPWFIKQETFTDAMTSLSAEERRIHCNDHRRWVEAQRRAGLAMAS
FT                   GFLVDDQHKPGGGGLLVFEAESFEAAKAFIAADPMISRNLVDWTLHEWKPVEGSLQA"
FT   gene            complement(397849..398727)
FT                   /gene="lipA-1"
FT                   /locus_tag="sync_0389"
FT   CDS_pept        complement(397849..398727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA-1"
FT                   /locus_tag="sync_0389"
FT                   /product="lipoic acid synthetase"
FT                   /EC_number="2.8.1.-"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR00510"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47455"
FT                   /db_xref="GOA:Q0ID51"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID51"
FT                   /protein_id="ABI47455.1"
FT                   /translation="MTSIQKPDWLRVKAPQRERIGEVADLLLDLKLNTVCQEASCPNIG
FT                   ECFAGGTATFLIMGPGCTRACPYCDIDFDKSVRALDPTEPQRLGEAVSRLGLKHVVITS
FT                   VNRDDLEDGGASQFVACIEQVKQHSPLTTIELLIPDFCGNWDALATVMEASPHVLNHNI
FT                   ETVPRLYRQARPQGVYERSLELLKRVRDGWSRAYSKSGLMVGLGESDSEVIEVLRDLRE
FT                   HRVDIVTIGQYLSPGPKHLRVDRFVTPEQFESYRLKGEQELGFLQVVSTPLTRSSYHAG
FT                   EVQKLMTIHPR"
FT   gene            398746..398819
FT                   /locus_tag="sync_0390"
FT   tRNA            398746..398819
FT                   /locus_tag="sync_0390"
FT                   /product="tRNA-Pro"
FT   gene            complement(398835..400511)
FT                   /gene="cbiG/cobJ"
FT                   /locus_tag="sync_0391"
FT   CDS_pept        complement(398835..400511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiG/cobJ"
FT                   /locus_tag="sync_0391"
FT                   /product="cbiG protein/precorrin-3B C17-methyltransferase"
FT                   /EC_number="2.1.1.131"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM PF01890; match to protein
FT                   family HMM TIGR01466"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45574"
FT                   /db_xref="GOA:Q0ID50"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID50"
FT                   /protein_id="ABI45574.1"
FT                   /translation="MIQQYWQEGGVLMVIGATGAVTRLIAPLLTDKKRDPAVLVLDAEG
FT                   QRVIPLLGGHQAGAEQLSREVAAALGGEAVLSGDSAVSGRLATDAFGHAWGWKRGGTSA
FT                   NWTELMKAQARGEATRLIQTMGSKLWQSSSAAQASHLLGLDAEADSAIQTLEISTTMPH
FT                   AGACTWHPALLWLGIGCERDTSLNLVQRAVRSALEEAGLAEDAVAGISSIDRKGDERAL
FT                   QELAQLHHWPFRLHTATALDGVPVPTPSKVVAAEMGTGSVAEAAALLSAGDKGQLKLHK
FT                   RITHANDDERGAVTVAIAESMEAHSPQQGELHLIGSGPGDLGLLTPEARSALERCPAWV
FT                   GYGLYLDLLEPLRRPDQIRLDGQLTMERDRCQQALSLARQGVRVALVSSGDSGIYGMAG
FT                   LALELWLDLPEDERPRFAVHPGISALQLAAAKAGAPLMHDFCTVSLSDRLTPWEVIERR
FT                   LEGAAKGDFVVALYNPRSKGRDWQLQRAKEILLTERPASTPVVMARQLGRQEEHVSFCR
FT                   LDSLPVDSIDMLTVLVIGNSSSRLEGGRMVTPRGYPGAELS"
FT   gene            complement(400712..402157)
FT                   /locus_tag="sync_0392"
FT   CDS_pept        complement(400712..402157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0392"
FT                   /product="Proline-rich region"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46408"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID49"
FT                   /protein_id="ABI46408.1"
FT                   /translation="MDKSGRRHASIRWFAALFALILLCGLGQPVLAIPSLPWANQPNSG
FT                   SAPNQGKNLPTQNPSGRIREVEPPGAVQQLHQALAKHHPRLSLISPLDGSQLKGGPLNL
FT                   ELKIEDWPLANDRELGLGAHVAIQIDDQAPIRLSEQNGNRVTIELPALSPGSHRFTAYA
FT                   AYPWGEAVKTPGASLHWSVDQLRPLMGTQPKRDAPWLAVVSPAELGGDSPLLLDWLVWN
FT                   APLQNLRAGDARWRLRITVNEDSFVVDQQDALWLQGIDNRKGINTVQMELLNGIGESLE
FT                   PMFNNQLREVPELKNPKPIWLQSTLNDTELARLLGETKPEDPSATQEFGLKKDILEAED
FT                   AEKAASKKQDFKEEPLKEKAMQEGALDEKTMSEQDKDEKALDKAVLGEELAEPEDLKTN
FT                   ATRKTSFQEEALPEKGVNTAEGTISKAGPSAEPSPESSKPVPPETPPPSRTPIISKEPE
FT                   RISPTSTLGGSARELLNPDGTQR"
FT   gene            402563..404866
FT                   /gene="psaA"
FT                   /locus_tag="sync_0393"
FT   CDS_pept        402563..404866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaA"
FT                   /locus_tag="sync_0393"
FT                   /product="photosystem I core protein PsaA"
FT                   /note="identified by match to protein family HMM PF00223;
FT                   match to protein family HMM TIGR01335"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47329"
FT                   /db_xref="GOA:Q0ID48"
FT                   /db_xref="InterPro:IPR001280"
FT                   /db_xref="InterPro:IPR006243"
FT                   /db_xref="InterPro:IPR020586"
FT                   /db_xref="InterPro:IPR036408"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID48"
FT                   /protein_id="ABI47329.1"
FT                   /translation="MTISPPERGSTAKSQVEKVDNPATFELFGKPGHFDRALAKGPKTT
FT                   TWVWNLHANAHDFDSHTSDLEEVSRKIFSAHFGHLAVIFIWLSGAFFHGARFSNFSGWL
FT                   ADPTHVKPSAQVVWPVFGQEILNGDMGAGFQGIQITSGLFHVWRAWGITNETQLMSLAI
FT                   GALVMAGLMLNAGVFHYHKAAPKLEWFQNVESMLNHHLAGLLGLGSLSWTGHLLHVSLP
FT                   TTKLMDAIDAGQPLVLNGKTIASVADIPLPHEFFNQDLIAQLYPGFGAGIGAFFSGDWA
FT                   AYSDFLTFKGGINPVTGSMWMSDIAHHHLAIAVLFIVAGHMYRTNWGIGHSIKEILEGQ
FT                   KGDPLLFPATKGHDGLFEFMTTSWHAQLGVNLAMLGSLSIIVAQHMYAMPPYPYMAIDY
FT                   PTQIGLFTHHMWIGGFLIVGAAAHAAIAMIRDYDPAKHVDNVLDRVLKARDAIISHLNW
FT                   VCIWLGAHSFGLYVHNDTMRALGRPQDMFSDSAISIQPVFAQWIQGIHAGAAGSTAPNA
FT                   LAGVSEVFNGSTIAVGGKVAAAAIPLGTADFMVHHIHAFTIHVTVLILLKGVLYARSSR
FT                   LVPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSLSVVIFHFSWKMQSDVWG
FT                   TVNADGSVQHITNGNFANSAITINGWLRDFLWAQAAQVINSYGSNTSAYGLMFLGAHFV
FT                   WAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIA
FT                   TTWAFFHAHILVVG"
FT   gene            404888..407104
FT                   /gene="psaB"
FT                   /locus_tag="sync_0394"
FT   CDS_pept        404888..407104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaB"
FT                   /locus_tag="sync_0394"
FT                   /product="photosystem I core protein PsaB"
FT                   /note="identified by match to protein family HMM PF00223;
FT                   match to protein family HMM TIGR01336"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45613"
FT                   /db_xref="GOA:Q0ID47"
FT                   /db_xref="InterPro:IPR001280"
FT                   /db_xref="InterPro:IPR006244"
FT                   /db_xref="InterPro:IPR020586"
FT                   /db_xref="InterPro:IPR036408"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID47"
FT                   /protein_id="ABI45613.1"
FT                   /translation="MATKFPSFSQGLAQDPTTRRIWYGIATAHDFESHDGMTEEKLYQK
FT                   LFSTHFGHLAIIGLWVSGNLFHIAWQGNFEQWVSDPLHVRPIAHAIWDPHFGQGAIDAF
FT                   TQAGASSPVNIAYSGLYHWFYTIGMTTNAELYQGSIFMMILSAWALFAGWLHLQPKFRP
FT                   SLAWFKNAESRLNHHLAVLFGFSSIAWTGHLVHVAIPESRGQHVGWDNFLSVMPHPAGL
FT                   GPFFTGNWGVYAQNPDTTGQIFGTAEGSGTAILTFLGGFHPQTEALWLTDIAHHHLAIG
FT                   VIFVIAGHMYRTNFGIGHSIREILEAHNPPTGTPGDLGAGHKGLYDTINNSLHFQLGLA
FT                   LASLGVITSLVAQHMYAMPSYAFIAKDYTTQAALYTHHQYIAIALMCGAFAHGAIFFIR
FT                   DYDPEANKDNVLGRMLEHKEAIISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILV
FT                   EPVFAQFVQAASGKAIYGFDVLLANAGGAAANANAAYMGGWMDAINGVRGSNDLFLPIG
FT                   PGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISA
FT                   WDAFYLAVFWALNTVGWVTFYWHWKHLAIWQGNVAQFNESSTYLMGWFRDYLWLNSSQL
FT                   INGYNPFGSNNLAVWSWMFLFGHLVWATGFMFLISWRGYWQELIETIVWAHERSPIANM
FT                   MGWRDKPVALSIVQARVVGLAHFTVGYVLTYGAFLIASTSGKFG"
FT   gene            complement(407252..408205)
FT                   /locus_tag="sync_0395"
FT   CDS_pept        complement(407252..408205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0395"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46400"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID46"
FT                   /protein_id="ABI46400.1"
FT                   /translation="MRLVEVNTLLAPALHQASSEQAHFFDYRSAANPQQSGLINAIPYR
FT                   SFSPDFFDQSGCDVLPLDLSEMLGCSGPATGPSLCANFVRLDRGQQRTSAVATSQLFFI
FT                   TNGEGETQACGRTFQWSKGDILVLPAGGDAIHSSIEKAGLYWVHDAPLLRYLGVEPAQA
FT                   RFEPSFYSHQDSKRHLDAIAKSPNGARANRVSVLLGNSNFPQTRTITHTLWAMLGILPA
FT                   GQIQRPHRHQSIALDFAVDCQPGCYTMIGTELDAKGMIINGHREDWAPGAAFVTPPGYW
FT                   HSHHNESGADAYVLPIQDAGLHTYLRTLDIAFSGGN"
FT   gene            complement(408306..409505)
FT                   /locus_tag="sync_0396"
FT   CDS_pept        complement(408306..409505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0396"
FT                   /product="possible fatty acid desaturase"
FT                   /note="identified by match to protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46894"
FT                   /db_xref="GOA:Q0ID45"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID45"
FT                   /protein_id="ABI46894.1"
FT                   /translation="MQQKRDRFTHQADRGTPRGSCMTTTTQTISQDMAPSAYPKRIDFK
FT                   LAPFMASDDRIASWQILNTVVPIIAVAIAMSAVTTSFNTTAIVLTPLLLVLMVLLLSRS
FT                   FSLMHDCGHQSLFSSKRSNRIAAFGLSLIHGMPQHPWSRGHAFHHKHNGNWDRYRGPSA
FT                   LITREQYEARSPRSQWLYRVLRHPLLLFPGGFFYLIIKPRLALLLSFFEFIGHSIKSTI
FT                   KMVRTGSWISPKHVCLNYKSSFFYTSGECVDMVANTAVVGLLWWWIGSSIGYAHFWILY
FT                   SVVMSCSAAVMIAVFFIQHNFPDSYTSDEDNWSYFRGAISGSSFLQMPAVLNWFTADIA
FT                   YHHIHHLSERIPNYRLKECHEANIHLVDNVHKLYLYQIGDCFSLILWDRERFKLVSPFA
FT                   "
FT   gene            complement(409514..412651)
FT                   /locus_tag="sync_0397"
FT   CDS_pept        complement(409514..412651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0397"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family protein"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47707"
FT                   /db_xref="GOA:Q0ID44"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID44"
FT                   /protein_id="ABI47707.1"
FT                   /translation="MRSISQPFLRRPVLTVVCSLLVLLAGLVSLFGLGLEDLPQLAPTQ
FT                   VSVTARFPAASPDVVEQSVTTVLEQQLNGLSDLDSIQSTSSEGQSRISLRFKKGSPELN
FT                   AIKVQNEVNLALRRLPQAVTRQGLSVNRSSSDLLMILGFSHPQDLYVPTFLPGWLEQSL
FT                   RESLRSVSGVGDIRVFGSSELAYRLWMDPQKLEQANLTITDVSTALIEQNVLAAIGALG
FT                   SAPAPSGQLLSLPVEAEGRLRSQDELENLVIKRLANGGLIRLSDVGRVSLGQRSYGRAA
FT                   INLQGERSVAVGIYQRDGANALALSRSIRRNLAKLESGFPPGITMQTIVDTADTIQANL
FT                   DRTITTLRDAILLVLVVLVLFLGRWRLAMVPGIAVPISLVGSLLVIRLSGSDINSLILF
FT                   GLILATGIVVDDAIVVSEEIADRIEKGDPPLKAAETAMQELAGAIVATSLVLVAVFVPV
FT                   LLIPGSIGRLYEPIALTITAAIVFSTLNALTFTPMASARVLTPGNGRLPGPIRRLSDRL
FT                   RKTMQSTEGHYSRTLRKLLMRPNWVGIVLIICLMLTGVVLRTTPTAFIPNEDQGQIRGY
FT                   FTLSEGASLERSMASMDSIRAVVEQEPLIRSGNFYAGSSFGQSGEDKGSFYLRLKPLQE
FT                   RRRADQSDQAIKRRLQKALNRSITDARVVLITPPTVRGFSGDSALNIELLDRSGGQLNL
FT                   VQFEQVAKAFIASAKETGKFERVSTRFDASAPRWRLVLDRDQMAALNLPYRETLNSIGM
FT                   AVGGRYLDDTYADGEIRSIWIQMEGSDRNRPEDIESLMLRNRDGELVSAESVARLEQVE
FT                   GTGSIDHYALNRSIRISALPGKETSSGQAINILEAAGEQIGGGNIGLAFTGLAEEERVA
FT                   EGVTWAFFGLSVVVVYLLLAGLYESFLDPLVILLTVPLALLGALIGIKLRGLPLDVYGQ
FT                   MGLLVLVSLAAKNGILIVEFANQRLRAGLPLREAITDAAEERMRPIVLTAITSLAGFLP
FT                   LLLASGTGSASRISIGTVVFSGLLISTLLSLFVVPAVYLSLKGWREKTHIQSSPGN"
FT   gene            complement(412763..413254)
FT                   /gene="psaL"
FT                   /locus_tag="sync_0398"
FT   CDS_pept        complement(412763..413254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaL"
FT                   /locus_tag="sync_0398"
FT                   /product="photosystem I reaction center subunit XI"
FT                   /note="identified by match to protein family HMM PF02605"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45715"
FT                   /db_xref="GOA:Q0ID43"
FT                   /db_xref="InterPro:IPR003757"
FT                   /db_xref="InterPro:IPR022980"
FT                   /db_xref="InterPro:IPR036592"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID43"
FT                   /protein_id="ABI45715.1"
FT                   /translation="MTVTPAADPCVGNLATPVNSGYFMKWLINNLPFYRQGISPNFRGI
FT                   ETGAAFGYLLYGPYTICGPLRNTDYSATAGLLAAIGAVHLLTLLFLLYNQPGKQPHIPP
FT                   ADVTVDNPPADLFTRNGWSEFTSGFWLGGCGGAVFAWLLCDTLHVQELVKIAAGVWSVS
FT                   "
FT   gene            complement(413299..413415)
FT                   /gene="psaI"
FT                   /locus_tag="sync_0399"
FT   CDS_pept        complement(413299..413415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaI"
FT                   /locus_tag="sync_0399"
FT                   /product="photosystem I reaction center subunit VIII"
FT                   /note="identified by match to protein family HMM TIGR03052"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46384"
FT                   /db_xref="GOA:Q0ID42"
FT                   /db_xref="InterPro:IPR001302"
FT                   /db_xref="InterPro:IPR036357"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID42"
FT                   /protein_id="ABI46384.1"
FT                   /translation="MTGDFAAAWLPVLFVPMIGIVFPAVFIILVGRAITAAD"
FT   gene            413542..414009
FT                   /locus_tag="sync_0400"
FT   CDS_pept        413542..414009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAQ00721.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47708"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID41"
FT                   /protein_id="ABI47708.1"
FT                   /translation="MTQLFAGVATIVLAIILYGLGRKPHKPILRSTDVSEVVALNRAQV
FT                   ELVQVSEVEEVAESAPVLAWQAPSTSAERLELQQYLRRSMDDGPDLRLQAIKLAGQWGH
FT                   QSVLPILRRGLHDSDSRVVEAAAAAIERHRSGPYRASAHPVRPPRNVARMR"
FT   gene            complement(413967..414971)
FT                   /locus_tag="sync_0401"
FT   CDS_pept        complement(413967..414971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0401"
FT                   /product="Glycosyl transferase, family 2"
FT                   /EC_number="2.-.-.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46925"
FT                   /db_xref="GOA:Q0ID40"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID40"
FT                   /protein_id="ABI46925.1"
FT                   /translation="MSLSPAAPSNASANEESSLDVSVVVPLYNEEESLPELVEQLLSSL
FT                   RPSGERFELVLVNDGSSDQTAAVLQQVSQEVPELVGVLLRKNYGQTAAMAAGFDVARGR
FT                   IIVSLDGDLQNDPADIPLLLAKLREGYDLVSGWRHQRQDAELQRKLPSRIANRLIGKVT
FT                   GVKLHDYGCSLKAYDRAVLSDMRLYGELHRFLPALAFIEGARITEVKVNHRARQYGSSK
FT                   YGIDRTFRVLMDLLTVWFMKRFLTRPMYVFGFAGLIAIALSLISSSYLLMIKLQGADIG
FT                   NRPLLTLAVVLGLAGIQLFCFGLLAELLIRTYHESQGRPIYRIRATLRGGRTG"
FT   gene            complement(415021..415758)
FT                   /locus_tag="sync_0402"
FT   CDS_pept        complement(415021..415758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0402"
FT                   /product="Cell wall-associated hydrolase"
FT                   /note="identified by match to protein family HMM PF00877"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46051"
FT                   /db_xref="GOA:Q0ID39"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR041382"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID39"
FT                   /protein_id="ABI46051.1"
FT                   /translation="MPTLGTALTPEQLNKGSCWTLNTDVQGYARSHGSGLATQACAGRG
FT                   FRVLADPHPSARRVRTALIEDGYPCWMAIDELNNQAVARSNWSPRLLDTASIQGRLPLV
FT                   LHWLKNAAKIPNTYLWGGTIGPDLDCSGLVQTAFASQSIWLPRDAYQQERFCSPVAVRA
FT                   GNDQLLRPGDLLFFGTAQRCTHVAIHLEQGRYMHSSGQEHGRNGIGIDSIHPSDQHPVA
FT                   CHYRSELRGAGRVTRCHDGTTLP"
FT   gene            415776..416675
FT                   /locus_tag="sync_0403"
FT   CDS_pept        415776..416675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0403"
FT                   /product="Beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46362"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID38"
FT                   /protein_id="ABI46362.1"
FT                   /translation="MAFYRAEPAMQEYLVGLIDRFADQDRPGLHEQIAVNWVRYDQFNL
FT                   SPGSGLGAAWADQKPLYPASVVKLVYAVAVEDWLQKGLLLETAELRRAVNDMIALSSND
FT                   ATGLVVDCLTGTSSGPDLQGEAWVNWQRQRQLVNEWLSDFGWAEFERVNCCQKTWGDGP
FT                   YGREQRFYGENNSNRNALTTAAVSRLLEAVMTDGLLSPPACHRLRSALARSLSQCERSA
FT                   DPENQVDGFLGEGLPENSRLWSKAGWMSQARHDAAWWSEPEGATQLLVVFSVGAERAND
FT                   NQLLPGIARELAAFSQDR"
FT   gene            417199..417294
FT                   /locus_tag="sync_0404"
FT   CDS_pept        417199..417294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0404"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47393"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID37"
FT                   /protein_id="ABI47393.1"
FT                   /translation="MALEYEADHRCVKSSVPNFSCFNAWIESEVK"
FT   gene            complement(417315..417403)
FT                   /locus_tag="sync_0405"
FT   tRNA            complement(417315..417403)
FT                   /locus_tag="sync_0405"
FT                   /product="tRNA-Ser"
FT   gene            complement(417442..418623)
FT                   /gene="alr"
FT                   /locus_tag="sync_0406"
FT   CDS_pept        complement(417442..418623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="sync_0406"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="identified by match to protein family HMM PF00842;
FT                   match to protein family HMM PF01168; match to protein
FT                   family HMM TIGR00492"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45550"
FT                   /db_xref="GOA:Q0ID36"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID36"
FT                   /protein_id="ABI45550.1"
FT                   /translation="MRDQIADDRNAPWILNPVEANPRQRAWLEVSDSAIEANARSLKRH
FT                   LGPHCDLMAVVKADGYGHGAETVAKASVRGGATSFGVATLQEGIDLRNAGLDQPVLVLG
FT                   HLSQPDDLRACLQWRLMPTLSSMREALLCQNLADSSGRRFPVQLKVDTGMTRLGCDWKD
FT                   GKRLAHAIQQLDQLSLSGIYSHLALADGERDGPAAQVTKLQEDRFESITRELRSPTLKR
FT                   HLANSAGTLRDTGLHHDLVRVGLALYGHCPSEHLDGILNLEPAMSVKAKVSLIREVPAG
FT                   VGVSYGHRFVTQRPSRLAVVSIGYADGVSRCLSGRIHALHAGQTLPQVGAITMDQLILD
FT                   ATEHRGLESGDVVTLLGRDGEETISPRTWAQLADSIPWEVLCSFKHRLPRLVI"
FT   gene            418698..419198
FT                   /locus_tag="sync_0407"
FT   CDS_pept        418698..419198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0407"
FT                   /product="HNH endonuclease family protein"
FT                   /EC_number="3.1.21.-"
FT                   /note="identified by match to protein family HMM PF01844"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45782"
FT                   /db_xref="GOA:Q0ID35"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID35"
FT                   /protein_id="ABI45782.1"
FT                   /translation="MGQVLVLNASYEPLNITTWRRAMVMLMKGKAEGLEHDQSKLIRQG
FT                   THLPTVIRLVQFVRVPFRQLPLTRRNVFQRDNHCCQYCGSRTEQLSIDHVMPRSRGGGD
FT                   SWDNITTACLSCNVRKGSRTPEEAGMPLNRVPRRPHSSLSFEAVRQIDSGRYLEWAKYV
FT                   IGA"
FT   gene            complement(419209..420303)
FT                   /gene="prfA"
FT                   /locus_tag="sync_0408"
FT   CDS_pept        complement(419209..420303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="sync_0408"
FT                   /product="peptide chain release factor 1"
FT                   /note="identified by match to protein family HMM PF00472;
FT                   match to protein family HMM PF03462; match to protein
FT                   family HMM TIGR00019"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46749"
FT                   /db_xref="GOA:Q0ID34"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID34"
FT                   /protein_id="ABI46749.1"
FT                   /translation="MDTTTLISRLEAASSSFHNLERQLADPDVAADPQRLETIARERSR
FT                   LEPLVLDYTSLQKVEAEQVQAKSLLKESRGDAAMEELAQQELQELDRHHADLIQRITLA
FT                   LLPKDPRDERSVMLEIRAGAGGDEACLWAGDLARMYERFSSRRGWSVTPVSANEADLGG
FT                   YKELILSVKGDAVFSELKFEAGVHRVQRVPSTESQGRVHTSTATVAVMPEADPVEVQID
FT                   PRDLDISTARSGGAGGQNVNKVETAVDLMHKPTGIRVFCTQERSQMQNRERALEILRAK
FT                   LYERQLAEANASERSARRSQVGTGDRSEKIRTYNAKDNRMTDHRLGRNFSLDPVLEGQM
FT                   DDVIDACIAEEQRGKLADLSEQAD"
FT   gene            complement(420406..420672)
FT                   /gene="rpmE"
FT                   /locus_tag="sync_0409"
FT   CDS_pept        complement(420406..420672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="sync_0409"
FT                   /product="ribosomal protein L31"
FT                   /note="identified by match to protein family HMM PF01197;
FT                   match to protein family HMM TIGR00105"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45194"
FT                   /db_xref="GOA:Q0ID33"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID33"
FT                   /protein_id="ABI45194.1"
FT                   /translation="MPKPDIHPTWYPDAKVICNGEVVMTTGSTQPEINVDVWSGNHPFF
FT                   TGTQKILDTEGRVDRFMRKYGMGSVDNATSEKKSATDETSKES"
FT   gene            complement(420705..421112)
FT                   /gene="rpsI"
FT                   /locus_tag="sync_0410"
FT   CDS_pept        complement(420705..421112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="sync_0410"
FT                   /product="ribosomal protein S9"
FT                   /note="identified by match to protein family HMM PF00380"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45794"
FT                   /db_xref="GOA:Q0ID32"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID32"
FT                   /protein_id="ABI45794.1"
FT                   /translation="MSSSNNTVVYWGTGRRKTSVARVRLVPGNGTITINGRPGDNYLNY
FT                   NPAYLAAVKAPLQTLGLSTEYDVLVNVRGGGLTGQADAIKQGAARALCELSVDNRKPLK
FT                   TEGHLSRDPRAKERRKYGLKKARKAPQFSKR"
FT   gene            complement(421109..421561)
FT                   /gene="rplM"
FT                   /locus_tag="sync_0411"
FT   CDS_pept        complement(421109..421561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="sync_0411"
FT                   /product="ribosomal protein L13"
FT                   /note="identified by match to protein family HMM PF00572;
FT                   match to protein family HMM TIGR01066"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46449"
FT                   /db_xref="GOA:Q0ID31"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID31"
FT                   /protein_id="ABI46449.1"
FT                   /translation="MNKTSVPSIDSIDRQWYLVDAENQTLGRLATEVASVLRGKNKASF
FT                   TPHLDTGDFVIVVNADKIRVSGKKPQQKLYRRHSGRPGGMKVETFEHLQERLPERIVEK
FT                   AIKGMLPHNALGRQLFRKLKVYKGTEHPHAAQQPKTLQLDPAASAQ"
FT   gene            complement(421731..422630)
FT                   /gene="truA"
FT                   /locus_tag="sync_0412"
FT   CDS_pept        complement(421731..422630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="sync_0412"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /note="identified by match to protein family HMM PF01416;
FT                   match to protein family HMM TIGR00071"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47122"
FT                   /db_xref="GOA:Q0ID30"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID30"
FT                   /protein_id="ABI47122.1"
FT                   /translation="MLPVVQDPSSEAERQILQRIAICLQYEGSFFCGWQRQTQGRGQSV
FT                   QAVLEKAIAALDPHRPIKAIAAGRTDSGVHASGQVVHFDCSGPIPASRWAPALNGRLPA
FT                   CIRVREAIERPLSWHACYSASYRRYRYTIYNGRRPNLFLAPWSWHRYHKRLDEQAMAQA
FT                   LAGLMGEHDFAAFQRAGSRRSHSRTTIQDVNIERDGDLLSVEIQASGFLYGMVRLLMGQ
FT                   LIAVGEHRLTPQQFEQRWQERRRDEVREAAPPHGLCLLRAGYPEDLFSKGGWYDCQPRF
FT                   ALATRDPPPDPPPWPQNQ"
FT   gene            complement(422657..423007)
FT                   /gene="rplQ"
FT                   /locus_tag="sync_0413"
FT   CDS_pept        complement(422657..423007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="sync_0413"
FT                   /product="ribosomal protein L17"
FT                   /note="identified by match to protein family HMM PF01196;
FT                   match to protein family HMM TIGR00059"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47173"
FT                   /db_xref="GOA:Q0ID29"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID29"
FT                   /protein_id="ABI47173.1"
FT                   /translation="MRHQCRVPLLGRPADQRKALLRGLTTQLIREGRVTTTKARAKALR
FT                   DEAERMITLAKNGSLASRRRVLGYVYDKQLVHALFDKAPTRYGDRNGGYTRITRTVPRR
FT                   GDNAEMAIIELV"
FT   gene            complement(423039..423977)
FT                   /gene="rpoA"
FT                   /locus_tag="sync_0414"
FT   CDS_pept        complement(423039..423977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="sync_0414"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF01000;
FT                   match to protein family HMM PF01193; match to protein
FT                   family HMM PF03118; match to protein family HMM TIGR02027"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47852"
FT                   /db_xref="GOA:Q0ID28"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID28"
FT                   /protein_id="ABI47852.1"
FT                   /translation="MLQYQIDRIEHQITDDRSQTGVFLIGPLERGQATTLGNSLRRMLM
FT                   GNLAGTAVTAVRIAGVNHEYATIPGVREDVLDILLNCKQLTVTSRTDELEIGRLIVSGP
FT                   AVVKAKDLQFSSQVQVVDGERPIATVSEGHSLELEVHVERGVGYRPVDRHNEDTSAIDL
FT                   LQIDAVFMPVHRVNFTTDETAVAEGGSARERLRMEVVTDGSMTPDDAIAQAANQLIELF
FT                   QPLATVTMVEEPGIEPEPSAEAQIPLEELNLSVRAYNCLKRAQVNSVSDLMGFSYEDLL
FT                   EIKNFGSKSADEVIEALERIGISIPQSRTSV"
FT   gene            complement(424028..424420)
FT                   /gene="rpsK"
FT                   /locus_tag="sync_0415"
FT   CDS_pept        complement(424028..424420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="sync_0415"
FT                   /product="ribosomal protein S11"
FT                   /note="identified by match to protein family HMM PF00411"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46132"
FT                   /db_xref="GOA:Q0ID27"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID27"
FT                   /protein_id="ABI46132.1"
FT                   /translation="MAKPAKKSGPKKAKRNVPNGVAHIQSTFNNTIVSITDTTGEVISW
FT                   SSAGASGFKGARKGTPFAAQTAAEAAARRALEQGMRQIEVLVRGPGSGRETAIRALQVA
FT                   GLEITLIRDVTPLPHNGCRRSKRRRV"
FT   gene            complement(424487..424852)
FT                   /gene="rpsM"
FT                   /locus_tag="sync_0416"
FT   CDS_pept        complement(424487..424852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="sync_0416"
FT                   /product="ribosomal protein S13"
FT                   /note="identified by match to protein family HMM PF00416"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46073"
FT                   /db_xref="GOA:Q0ID26"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID26"
FT                   /protein_id="ABI46073.1"
FT                   /translation="MARIAGVDIPRDKRIEVALTYIYGIGSTRAKTILTKAGVNPDIRV
FT                   KDLEDNDVQKLRNATESFTIEGDLRRQEGMALKRLQDIGCLRGRRHRMSLPVRGQRTRT
FT                   NARTRRGARKTVAGKKK"
FT   gene            complement(424929..425042)
FT                   /gene="rpmJ"
FT                   /locus_tag="sync_0417"
FT   CDS_pept        complement(424929..425042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="sync_0417"
FT                   /product="ribosomal protein L36"
FT                   /note="identified by match to protein family HMM PF00444;
FT                   match to protein family HMM TIGR01022"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45472"
FT                   /db_xref="GOA:Q0ID25"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID25"
FT                   /protein_id="ABI45472.1"
FT                   /translation="MKVRASVKKMCEKCRVIRRHGRVMVICPNPKHKQRQG"
FT   gene            complement(425090..425641)
FT                   /gene="adk"
FT                   /locus_tag="sync_0418"
FT   CDS_pept        complement(425090..425641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="sync_0418"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="identified by match to protein family HMM PF00406;
FT                   match to protein family HMM TIGR01351"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47824"
FT                   /db_xref="GOA:Q0ID24"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID24"
FT                   /protein_id="ABI47824.1"
FT                   /translation="MKQRLLFLGPPGAGKGTQAALLCDRHGLRHLSTGDLLRAEVSAGS
FT                   ALGQEAESVMNRGELVSDSLVLAIVKAQLGALNGQGWLLDGFPRNVAQAEALDPLLQEL
FT                   NQPIEAVVLLELDDAVLIERLLSRGRDDDNEAVIRNRLVVYADKTEPLIEHYRQRGLLQ
FT                   SVEAHGSIEAITERIEGVLA"
FT   gene            complement(425670..426989)
FT                   /gene="secY"
FT                   /locus_tag="sync_0419"
FT   CDS_pept        complement(425670..426989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="sync_0419"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="identified by similarity to SP:P03844; match to
FT                   protein family HMM PF00344; match to protein family HMM
FT                   TIGR00967"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47075"
FT                   /db_xref="GOA:Q0ID23"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID23"
FT                   /protein_id="ABI47075.1"
FT                   /translation="MLVSRGRNPSATEVITQLVQNPELRGRVLTTLGLLMLVRLGIYIP
FT                   MPGIDRVAFEQFIEQGGTLIGFLDIFTGGGISTLGVFALGILPFINASIIIQLLTASLP
FT                   QLEDLQKNEGEAGRRKIAQITRYVALGWGTIQSVIFAMILRQYAVEGLSDVVFVFQTAL
FT                   ALVTGSMIVMWLSEVITERGIGQGASLVIFLNIVATLPKALGSTIEKAQTGDRGDVVGI
FT                   IILVLVFLITIVGIIFVQEGARRLPIVSAKRQVGGTALLPSRQSYLPLKLNAGGVMPII
FT                   FASALIFLPITIANVTNNPILIRAASALNPSAANPWPYAILFFSLILGFSYFYSSLSLN
FT                   PSDMATNLKRGGVAIPGVRPGSATAAYLEGVKNRLTLLGGLFLGAVAIIPSAVERATGV
FT                   TTFQGLGATSLLILVGVAIDTAKQVQTYVISQRYEGLVRQ"
FT   gene            complement(427099..427551)
FT                   /gene="rplO"
FT                   /locus_tag="sync_0420"
FT   CDS_pept        complement(427099..427551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="sync_0420"
FT                   /product="ribosomal protein L15"
FT                   /note="identified by match to protein family HMM PF00256;
FT                   match to protein family HMM PF01305; match to protein
FT                   family HMM TIGR01071"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45898"
FT                   /db_xref="GOA:Q0ID22"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID22"
FT                   /protein_id="ABI45898.1"
FT                   /translation="MTLRLESLKPNKGARRRKLRKGRGIAAGQGASCGFGMRGQKSRSG
FT                   RPTRPGFEGGQMPLYRRVPKLKHFTLVNPKSFTVLNVSALNEIKAGSTVNLDSLVKDGI
FT                   VTSPKSPLKILGNGELKAKLTVQAAAFTASARAKIEAAGGTCEVLD"
FT   gene            complement(427560..428252)
FT                   /gene="rpsE"
FT                   /locus_tag="sync_0421"
FT   CDS_pept        complement(427560..428252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="sync_0421"
FT                   /product="ribosomal protein S5"
FT                   /note="identified by match to protein family HMM PF00333;
FT                   match to protein family HMM PF03719; match to protein
FT                   family HMM TIGR01021"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45077"
FT                   /db_xref="GOA:Q0ID21"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID21"
FT                   /protein_id="ABI45077.1"
FT                   /translation="MPPGKRAFSSDPALTMTTEPNNQTTSNDVPSASDVPAAAEGQGQQ
FT                   QEQRRGGGRGDRRGGRGDRRRGQERDSEWQERVVQIRRVSKTVKGGKKMSFRAIVVVGN
FT                   ERGQVGVGVGKAGDVIGAVRKGVADGKKHLVKVPLTRHNSIPTLSNGRDGAASVLIRPA
FT                   APGTGVIAGGSIRTVLELAGIKNVLAKRLGSKTPLNNARAAMVALQLLRTHKETAKERG
FT                   ISLEQIYS"
FT   gene            complement(428221..428589)
FT                   /gene="rplR"
FT                   /locus_tag="sync_0422"
FT   CDS_pept        complement(428221..428589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="sync_0422"
FT                   /product="ribosomal protein L18"
FT                   /note="identified by match to protein family HMM PF00861;
FT                   match to protein family HMM TIGR00060"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47544"
FT                   /db_xref="GOA:Q0ID20"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID20"
FT                   /protein_id="ABI47544.1"
FT                   /translation="MSTLSRKQQTQKRHRRLRRHLSGTANRPRLAVFRSNSHIYAQLID
FT                   DEAQSTLCSASTLDKDLRSSLKTNCSSCDASVAVGDLVAKRAIAKGIQQVVFDRGGNLY
FT                   HGRVKALADAAREAGLQF"
FT   gene            complement(428623..429162)
FT                   /gene="rplF"
FT                   /locus_tag="sync_0423"
FT   CDS_pept        complement(428623..429162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="sync_0423"
FT                   /product="ribosomal protein L6"
FT                   /note="identified by match to protein family HMM PF00347"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46694"
FT                   /db_xref="GOA:Q0ID19"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID19"
FT                   /protein_id="ABI46694.1"
FT                   /translation="MSRIGKNPIPIPDKVNVTLSGLAVTVKGPKGELKRTLPSGVSVNQ
FT                   VDNSIVVAPTSTKRSSRERHGLCRTLVANMVIGVSQGYSKKLEIVGVGSRAQVKGKTLV
FT                   VSAGYSHPVEVVPPEGITFTVENNTNVTVSGTDKELVGNEAAKIRAIRPPEPYKGKGIK
FT                   YAGERILRKAGKSGKK"
FT   gene            complement(429178..429579)
FT                   /gene="rpsH"
FT                   /locus_tag="sync_0424"
FT   CDS_pept        complement(429178..429579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="sync_0424"
FT                   /product="ribosomal protein S8"
FT                   /note="identified by match to protein family HMM PF00410"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46346"
FT                   /db_xref="GOA:Q0ID18"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID18"
FT                   /protein_id="ABI46346.1"
FT                   /translation="MANHDPISDMLTRIRNASEKRHESTKVPASRMSRSIAKVLQQEGF
FT                   IAEISEQGEGVRTELVLGLKYSGKHRQPTIRSMQRVSKPGLRIYKNTRGLPKVLGGLGV
FT                   AIISTSKGVMSDRDARKQGVGGEVLCYVY"
FT   gene            complement(429599..430138)
FT                   /gene="rplE"
FT                   /locus_tag="sync_0425"
FT   CDS_pept        complement(429599..430138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="sync_0425"
FT                   /product="ribosomal protein L5"
FT                   /note="identified by match to protein family HMM PF00281;
FT                   match to protein family HMM PF00673"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45541"
FT                   /db_xref="GOA:Q0ID17"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID17"
FT                   /protein_id="ABI45541.1"
FT                   /translation="MSLKQRYRETIQPKLLKDLSLSNIHEVPKVLKVTVNRGLGEAATN
FT                   AKSLEASVNELAQITGQKVVITRAKKAIAAFKIRQGMPIGCAVTLRGDRMYAFLERFIN
FT                   LALPRIRDFRGVSPKSFDGRGNYTVGVREQIIFPEISFDKIDAIRGMDITIVTSARTDE
FT                   EGRALLREMGMPFRSN"
FT   gene            complement(430188..430499)
FT                   /gene="rplX"
FT                   /locus_tag="sync_0426"
FT   CDS_pept        complement(430188..430499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="sync_0426"
FT                   /product="ribosomal protein L24"
FT                   /note="identified by match to protein family HMM PF00467;
FT                   match to protein family HMM TIGR01079"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47032"
FT                   /db_xref="GOA:Q0ID16"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID16"
FT                   /protein_id="ABI47032.1"
FT                   /translation="MRLRKGDTVQVIAGKDKGKTGEVLRTLPNENRVIVEGLNMRTRHV
FT                   KPTQEGETGRIVTEEASLHASNVMFYSTAKKVASRIELITEKDGSKKRRLKKTGEVID"
FT   gene            complement(430546..430911)
FT                   /gene="rplN"
FT                   /locus_tag="sync_0427"
FT   CDS_pept        complement(430546..430911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="sync_0427"
FT                   /product="ribosomal protein L14"
FT                   /note="identified by match to protein family HMM PF00238;
FT                   match to protein family HMM TIGR01067"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47567"
FT                   /db_xref="GOA:Q0ID15"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID15"
FT                   /protein_id="ABI47567.1"
FT                   /translation="MIQQETFLTVADNSGAKRIQCIRVLGTNRRYAHVGDVIVATVKDA
FT                   MPNMGVKKSDIVKAVVVRTKATMRRDTGNSIRFDDNAAVIINDDKNPKGTRVFGPVARE
FT                   LRERSFTKIVSLAPEVI"
FT   gene            complement(430908..431174)
FT                   /gene="rpsQ"
FT                   /locus_tag="sync_0428"
FT   CDS_pept        complement(430908..431174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="sync_0428"
FT                   /product="ribosomal protein S17"
FT                   /note="identified by match to protein family HMM PF00366"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47423"
FT                   /db_xref="GOA:Q0ID14"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID14"
FT                   /protein_id="ABI47423.1"
FT                   /translation="MALKERVGTVVSDKMDKTVVVAVENRFPHPIYQKTVSRTTRYKAH
FT                   DEDNACRVGDRVRITETRPLSRHKRWAIAEVLSQSPKAEEVTK"
FT   gene            complement(431194..431403)
FT                   /gene="rpmC"
FT                   /locus_tag="sync_0429"
FT   CDS_pept        complement(431194..431403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="sync_0429"
FT                   /product="ribosomal protein L29"
FT                   /note="identified by match to protein family HMM PF00831;
FT                   match to protein family HMM TIGR00012"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45169"
FT                   /db_xref="GOA:Q0ID13"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID13"
FT                   /protein_id="ABI45169.1"
FT                   /translation="MARPTASDLRQLSDADVTEQIDGLRRELFELRFQQATRQLGNTHR
FT                   FKESRLKLAQLLTVQSERKRSAAS"
FT   gene            complement(431406..431873)
FT                   /gene="rplP"
FT                   /locus_tag="sync_0430"
FT   CDS_pept        complement(431406..431873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="sync_0430"
FT                   /product="ribosomal protein L16"
FT                   /note="identified by match to protein family HMM PF00252;
FT                   match to protein family HMM TIGR01164"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45536"
FT                   /db_xref="GOA:Q0ID12"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID12"
FT                   /protein_id="ABI45536.1"
FT                   /translation="MLSPKRVKFRKQQRGRMRGVATRGNTIAFGQFALQAQECGWITSR
FT                   QIEASRRAMTRYVKRGGKIWIRIFPDKPVTMRPAETRMGSGKGNPEFWVAVIKPGRILF
FT                   EMGGEEITPEIAKEAMRLAQYKLPLKTKFICLDEQEQPAGTKAAASSTVES"
FT   gene            complement(431890..432621)
FT                   /gene="rpsC"
FT                   /locus_tag="sync_0431"
FT   CDS_pept        complement(431890..432621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="sync_0431"
FT                   /product="ribosomal protein S3"
FT                   /note="identified by match to protein family HMM PF00189;
FT                   match to protein family HMM PF00417; match to protein
FT                   family HMM PF07650; match to protein family HMM TIGR01009"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47631"
FT                   /db_xref="GOA:Q0ID11"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID11"
FT                   /protein_id="ABI47631.1"
FT                   /translation="MGHKIHPTGLRLGITQEHRSRWYASSKSYPALLQEDDRIRKFIHK
FT                   KYGSAGISDVLIARKADQLEVELKTARPGVLVGRQGSGIEDLRSGIQKTVGDSSRQVRI
FT                   NVVEVERVDADAFLLAEYIAQQLEKRVAFRRTIRMAVQRAQRAGVLGLKIQVSGRLNGA
FT                   EIARTEWTREGRVPLHTLRAEIDYATKVASTTYGVLGIKVWVFKGEVLSDDSQQQIPVG
FT                   ANPRRRAGRRPQQFEDRSNEG"
FT   gene            complement(432643..433008)
FT                   /gene="rplV"
FT                   /locus_tag="sync_0432"
FT   CDS_pept        complement(432643..433008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="sync_0432"
FT                   /product="ribosomal protein L22"
FT                   /note="identified by match to protein family HMM PF00237;
FT                   match to protein family HMM TIGR01044"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46042"
FT                   /db_xref="GOA:Q0ID10"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID10"
FT                   /protein_id="ABI46042.1"
FT                   /translation="MTTSSPTATTAQAHGRFIRGSVSKVRRVLDQIRGRTYRDALIMLE
FT                   FMPYRSTGPITKVLRSAVANAEHNLGLDPASLIISQATADMGPSMKRYRPRAQGRAYAI
FT                   KKQTCHISIAVAAQTDS"
FT   gene            complement(433013..433288)
FT                   /gene="rpsS"
FT                   /locus_tag="sync_0433"
FT   CDS_pept        complement(433013..433288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="sync_0433"
FT                   /product="ribosomal protein S19"
FT                   /note="identified by match to protein family HMM PF00203;
FT                   match to protein family HMM TIGR01050"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45542"
FT                   /db_xref="GOA:Q0ID09"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID09"
FT                   /protein_id="ABI45542.1"
FT                   /translation="MGRSLKKGPFIADSLLRKVEKQNAADDKSVIKTWSRASTILPMMI
FT                   GHTIAVHNGRTHVPVFVTEQMVGHKLGEFAPTRTFKGHIKDKKGGR"
FT   gene            complement(433324..434187)
FT                   /gene="rplB"
FT                   /locus_tag="sync_0434"
FT   CDS_pept        complement(433324..434187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="sync_0434"
FT                   /product="ribosomal protein L2"
FT                   /note="identified by similarity to SP:Q9Z9L1; match to
FT                   protein family HMM PF00181; match to protein family HMM
FT                   PF03947; match to protein family HMM TIGR01171"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45224"
FT                   /db_xref="GOA:Q0ID08"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID08"
FT                   /protein_id="ABI45224.1"
FT                   /translation="MAIRTFRPYTPGTRTRVVTDFSEVTGRKPERSLVVSKHRRKGRNN
FT                   RGVITCRHRGGGHKRQYRLVDFRRNKHGVTAKVAAIHYDPHRNARLALLFYADGEKRYI
FT                   LAPAGISIGQTVVSGTEVPIEIGNAMPLSAIPLGSSVHCVELYAGRGGQMVRTAGASAQ
FT                   VMAKEGDYVALKLPSTEVRLVRRECFATLGEVGNAEIRNTSLGKAGRRRWLGRRPQVRG
FT                   SVMNPCDHPHGGGEGRAPIGRSGPVTPWGKPALGLKTRKRNKPSNKFVLRKRRKTSKRS
FT                   RGGRDS"
FT   gene            complement(434203..434505)
FT                   /gene="rplW"
FT                   /locus_tag="sync_0435"
FT   CDS_pept        complement(434203..434505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="sync_0435"
FT                   /product="ribosomal protein L23"
FT                   /note="identified by match to protein family HMM PF00276"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46523"
FT                   /db_xref="GOA:Q0ID07"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID07"
FT                   /protein_id="ABI46523.1"
FT                   /translation="MTERFTGRLADVIRRPLITEKATRALEQNQYTFEVDHRAAKPDIK
FT                   AAVEQLFDVKVTGISTMNPPRRSRRIGRFAGKRAQVKKAVVRLAEGNSIQLFPES"
FT   gene            complement(434498..435133)
FT                   /gene="rplD"
FT                   /locus_tag="sync_0436"
FT   CDS_pept        complement(434498..435133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="sync_0436"
FT                   /product="ribosomal protein L4"
FT                   /note="identified by match to protein family HMM PF00573"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45086"
FT                   /db_xref="GOA:Q0ID06"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID06"
FT                   /protein_id="ABI45086.1"
FT                   /translation="MANCIVRDWQGKEAGKASLDLKVAKEASALDLMHRAVLRQQAHSR
FT                   QGTASTLTRSEVRGGGRKPYKQKGTGRARQGSVRTPLRPGGGIIFGPKPRSYNLAMNRK
FT                   ERRSALRTALMARIEDLVVVKDFATTLTTPKTKEIIDALGRLDVSATSKVLIILTNPSE
FT                   AVRRSIRNLETVKLIAADQLNVFDLLHANKLVVGEDALAKIQEVYGDD"
FT   gene            complement(435133..435789)
FT                   /gene="rplC"
FT                   /locus_tag="sync_0437"
FT   CDS_pept        complement(435133..435789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="sync_0437"
FT                   /product="ribosomal protein L3"
FT                   /note="identified by match to protein family HMM PF00297"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45670"
FT                   /db_xref="GOA:Q0ID05"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID05"
FT                   /protein_id="ABI45670.1"
FT                   /translation="MSIGILGKKLGMSQFFDEQGKAVPVTLIEAGPCRITQLKSSETDG
FT                   YQAVQIGFGEIREKLINKPAKGHLAKSGEDLVRHLCEYRVDDLDGIQLGGAVTVGDFAA
FT                   GQKVDVSGDTMGRGFAGLQKRHGFSRGPMTHGSKNHRQPGSIGAGTTPGRIYPGKRMSG
FT                   RYGGKKITTRGLTILKIDSERNLLVVKGSVPGKPGSLLNIRPANRVGAKPAKGGK"
FT   gene            436179..436640
FT                   /locus_tag="sync_0438"
FT   CDS_pept        436179..436640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0438"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47819"
FT                   /db_xref="GOA:Q0ID04"
FT                   /db_xref="InterPro:IPR020874"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID04"
FT                   /protein_id="ABI47819.1"
FT                   /translation="MPLLLSGRGFRRELESAGCMAVFAPLEGGAETRLLRRLRGAGYRT
FT                   QLSSARGLGDPEVFLFQKHGIRPPHLGHQSVGRGAAVGEVQEVMPLLGESMLGTKPVVL
FT                   WLLEGQVLSRSELSALCDLCRREPRLKVVVEMGGARSLRWQPLKELLSN"
FT   gene            436607..437680
FT                   /locus_tag="sync_0439"
FT   CDS_pept        436607..437680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0439"
FT                   /product="Fe-S cluster containing protein"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46995"
FT                   /db_xref="InterPro:IPR013283"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID03"
FT                   /protein_id="ABI46995.1"
FT                   /translation="MATLEGAFEQLNLTVKAALQRADAGELALGNGSWVKLICGASNQD
FT                   SATIGDLCALFAVAGVHCVDVAADIAVVRAAREGLDWAWEHTRRRPWLMVSVSDGNDAH
FT                   FRKAVFDPGLCPPDCSRPCERVCPADAIRAAVGVDEQLCYGCGRCWPACPSQLIQSMDR
FT                   RVGLNDLASLLHNLRPDALEIHTAPGRLNAFQATLEQVRLANVPLRRLSVSCGLEGHHV
FT                   TVESLSKELWQRHQALRAFQQRPLWQLDGRPMSGDLGVGTAHAAVGLWQRLHPLAPPGP
FT                   LQLAGGTNTATLGLLPREGRAIGPAGVAFGGVARTLVQPFFQAAQDRGCRLRDWPDGWA
FT                   QSLRAARALIAPWLRRS"
FT   gene            437747..439393
FT                   /locus_tag="sync_0440"
FT   CDS_pept        437747..439393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0440"
FT                   /product="R3H domain protein"
FT                   /note="identified by match to protein family HMM PF01424"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47302"
FT                   /db_xref="GOA:Q0ID02"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034081"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID02"
FT                   /protein_id="ABI47302.1"
FT                   /translation="MTTERITDDLNRLVSLLPAELQSSLASTESRDQLLEVVLDLGRVP
FT                   EARYSGWSTALGSTSVTHADLQAMVERLGQFGSDNRAGIERTLHRISAIRNRRGEVVGL
FT                   TCRVGRAVFGTVAMVRDLLDSGESLLLMGRPGVGKTTALREIARVLADDLGKRVVVIDT
FT                   SNEIAGDGDIPHPAIGRARRMQVARPELQHQVMIEAVENHMPEVIVIDEIGTELEARAA
FT                   RTIAERGVTLVATAHGNALSNLIKNPTLCDLIGGIESVTLGDDEARRRRSQKTVLERAA
FT                   EPTFSMAVEMHSRSRWAVYREVGRAVDALLRGQLPSPEERKMASDGRVLRVEPQLSTSP
FT                   LRRPSLAPVPLPSPLDPIPLQPVGMGGSTQSELKPSQAPSKMFQVLCCGLSEQRLDEAV
FT                   RRHDWSIQAVDDLVQADVVLSVRQGLGRQPELRRQAREAGVPILVIKSDTLPQVERALE
FT                   RLLMRRDSGLPHRDSADSGDGDGDQSDASAALEECRLAIEQVVVPQGRPVELLPRTEEV
FT                   RQMQSDLVTRYRLRSDVYGTSGQRRLRVFPP"
FT   gene            439501..439572
FT                   /locus_tag="sync_0441"
FT   tRNA            439501..439572
FT                   /locus_tag="sync_0441"
FT                   /product="tRNA-Gln"
FT   gene            439589..440353
FT                   /locus_tag="sync_0442"
FT   CDS_pept        439589..440353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0442"
FT                   /product="HAD hydrolase homolog"
FT                   /note="identified by match to protein family HMM PF00702"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45176"
FT                   /db_xref="GOA:Q0ID01"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID01"
FT                   /protein_id="ABI45176.1"
FT                   /translation="MSLQPLLVFDFDGVILDGMDEYWSSSRAACRSLLQGVLLPEQTPT
FT                   SFRHLRPWVHHGWEMVLIAALLQESDGPLQCLGVDAFAADYDQQLRAGLDRFGWQSSQL
FT                   QDSLERVRRQAVSDDRAGWVALHRPFDGVTERLLRLEDEGVAWSVLTTKGRDFTAELLE
FT                   AFQLRPIRLDGRESGPKPEVLLRLCREWVLKGFVEDRRATLEAVLETPGLEDMNCFLAD
FT                   WGYLRPADREGLPQGIDLLSTSKFASPLAIWL"
FT   gene            440506..441654
FT                   /gene="recA"
FT                   /locus_tag="sync_0443"
FT   CDS_pept        440506..441654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="sync_0443"
FT                   /product="recA protein"
FT                   /note="identified by match to protein family HMM PF00154;
FT                   match to protein family HMM TIGR02012"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46005"
FT                   /db_xref="GOA:Q0ID00"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID00"
FT                   /protein_id="ABI46005.1"
FT                   /translation="MPADVKAAQSSAGDSRPGERDKALDLVLGQIERNFGKGSIMRLGD
FT                   ASRMRVETISTGALTLDLALGGGYPKGRVVEVYGPESSGKTTLTLHAIAEVQKRGGVAA
FT                   FVDAEHALDPVYAASLGVDIENLLVSQPDTGEMALEIVDQLVRSAAVDIVVVDSVAALT
FT                   PRAEIEGEMGDLAVGAQARLMSQAMRKITGNIGKSGCTVIFLNQLRLKIGVTYGNPETT
FT                   TGGNALKFYASVRLDIRRIQTLKRGTEEYGIRAKVKVAKNKVAPPFRIAEFDILFGRGI
FT                   STLGCVLDLAEETGVVTRKGAWYSYEGDNIGQGRDNTIGWLEQNPEAKDAIEVLVRQKL
FT                   TEGSEVTANSMRPLAAAARSAAAKPSAKTADTDKKLVADGAA"
FT   gene            complement(441651..442001)
FT                   /locus_tag="sync_0444"
FT   CDS_pept        complement(441651..442001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0444"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47554"
FT                   /db_xref="InterPro:IPR014943"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICZ9"
FT                   /protein_id="ABI47554.1"
FT                   /translation="MFSRLADQYRSVVQDLVMSLHALASSLQKQGIVATCYSCDEGDGR
FT                   DGKTASFVAELGDQHLVRFLVSDFGISWVESRNGRELVKFEGAEAIQELQRIATSIQER
FT                   SATGSTPEIASR"
FT   gene            complement(442093..442332)
FT                   /locus_tag="sync_0445"
FT   CDS_pept        complement(442093..442332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0445"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46730"
FT                   /db_xref="GOA:Q0ICZ8"
FT                   /db_xref="InterPro:IPR021262"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICZ8"
FT                   /protein_id="ABI46730.1"
FT                   /translation="MGEARRRNSQGLPPKQRKPDPKDSERIVAWLPLTRSQSQRFVALT
FT                   TRGAWIGIGALVLFWIVVRFIGPAAGWWTLADTP"
FT   gene            complement(442374..443828)
FT                   /locus_tag="sync_0446"
FT   CDS_pept        complement(442374..443828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE21900.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45393"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICZ7"
FT                   /protein_id="ABI45393.1"
FT                   /translation="MLEVQAHQQLKQLLHLEEMPWEHHLTLSRLIGRSLRRQDRTRIRL
FT                   SAGERDRWWLGLLVPLCLQSQDCVLVLDERQRQRFLQVELPRLRQGGLRLACWSGSTAP
FT                   PDSQLWLLSPSELVNVHRRRGFKHSHQLIIPEAESLAHHLRQAMELSIETQDWDRLRQA
FT                   YPTAGPALLDLHERLSRQLFAASSRSTCDLPMPSSALVSLRDLIGLLGPAPEPWAELLT
FT                   LQSSQWASWAHLDQNLLQWTWTLQPLEPLQTLHCLLNQHPSILLQTDGVFLERKRRTDE
FT                   RSTESGPLVDIQLHDRIRTEPLRLFAPRRQPLPNTASYAEHLLDQCRRLILGRRGLTLV
FT                   LLDDPGLRQKLTTELAGEFGSRVIHQDTAPEVNGVICCSWSWWMDHQNQLPALDQLIVA
FT                   LLPVSSLEDPLTAARVESLKKLGKDWFRDLLLPEALAKLVPAVAPLRQSGGRLAILDGR
FT                   VRGRSWGKQVLRALEPWSPLQRLLPD"
FT   gene            443913..444791
FT                   /gene="tyrA"
FT                   /locus_tag="sync_0447"
FT   CDS_pept        443913..444791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrA"
FT                   /locus_tag="sync_0447"
FT                   /product="prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /note="identified by match to protein family HMM PF02153;
FT                   match to protein family HMM PF02558; match to protein
FT                   family HMM PF02737; match to protein family HMM PF03807"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45874"
FT                   /db_xref="GOA:Q0ICZ6"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICZ6"
FT                   /protein_id="ABI45874.1"
FT                   /translation="MDQGQVAQPWSIDRVGVVGMGLIGGSIALDLTQQGVEVHGLVHRE
FT                   VTAQRARSRGLASLISTDPSCLHDCDLVILALPLESLLSPAESLLKALPEQAVVTDVGS
FT                   VKAEVLAVWRDLHPRFVGSHPMAGTAQAGVDAGLTGLFRDRPWVATPESSTDPSALEVI
FT                   HQLAVRLGSHWLTADAARHDQAVALISHLPVIVSAALLRAVGEERDPAVLDLARTLASS
FT                   GFADTSRVGGGNPALGTAMASRNTQAVLRSLAAYRWSLEQLEEAILEGHWAQLEKELER
FT                   TQLLRPQFLSD"
FT   gene            complement(444801..446330)
FT                   /gene="crtD"
FT                   /locus_tag="sync_0448"
FT   CDS_pept        complement(444801..446330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtD"
FT                   /locus_tag="sync_0448"
FT                   /product="C-3',4' desaturase CrtD"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01593; match to protein
FT                   family HMM TIGR02733"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46695"
FT                   /db_xref="GOA:Q0ICZ5"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014104"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICZ5"
FT                   /protein_id="ABI46695.1"
FT                   /translation="MQKRDDVIVVGGGIAGLTAAALLARDGVSVTLLEAHYQPGGCAGT
FT                   FRRGEYIFDVGATQVAGLEPGGSHARIFQHLDLPLPEAELLDPGCVVDLADGSSPVRLW
FT                   HDPLRWQQERQQQFPGSERFWQICSFLHQSNWQFAAADPVLPIRNGWDFQQTLAAINPG
FT                   NLLSAPLSFCTVKDLLNLSGCGSDQRLRRFLDLQLRLYSQQPADQTAALYGATVLQMTQ
FT                   APLGLWHLHGSMQVLSELLASGLKRDGGTMLLRHRVQQLQHNSDGSGWQLRVEGPDRKE
FT                   QIFQADDVISTLPPQCLPELIAPEGSADQTPMPAPYRQHLKELKAPSGALVFYGAIDRD
FT                   CLPDDCPGHCQRDASDPGSVFISISREGDGRAPKGQATVIASVFTTPNGWFSCSEPEYQ
FT                   SKKKACQAKIRNEVEVALSLSDHTWRHQELATPRGFLRWTNRPNGIVGGLGQSPSRFGP
FT                   FGLASRTPMPGLWLCGDSIHPGEGTAGVTLSALMACRQLLAQRGQTLQLHS"
FT   gene            446367..447239
FT                   /locus_tag="sync_0449"
FT   CDS_pept        446367..447239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0449"
FT                   /product="fructosamine kinase family protein"
FT                   /note="identified by match to protein family HMM PF01636;
FT                   match to protein family HMM PF03881"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45638"
FT                   /db_xref="GOA:Q0ICZ4"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016477"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICZ4"
FT                   /protein_id="ABI45638.1"
FT                   /translation="MRTQLLEALQTDFCERQGCQCKTLEPVGSASTWRADLSDGRSLFL
FT                   KLASPVMLNVEARGLRSLQQWADPTLLLIPDPLGIVPVGELAALILPWLDTGRGNQYDL
FT                   GRGLALLHRTSADAGKERFGWDEEGFIGLGPQPAGWLTAWGDAFVTLRLTPQLQLARNW
FT                   GLALDQLEPLLAATRIWLDQHQPLPCLVHGDLWGGNASVLADGRGALIDPACWWADREV
FT                   DLAMTRLFGGFSARFYEGYQKEWPLDPNYCDRIDVYNLYHLLNHANLFGGGYKKKCLTA
FT                   INAMRSMLL"
FT   gene            complement(447264..447650)
FT                   /locus_tag="sync_0450"
FT   CDS_pept        complement(447264..447650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0450"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46451"
FT                   /db_xref="GOA:Q0ICZ3"
FT                   /db_xref="InterPro:IPR025564"
FT                   /db_xref="InterPro:IPR033344"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICZ3"
FT                   /protein_id="ABI46451.1"
FT                   /translation="MSEESTTPASESTWTANTSEPSTSAETTNFSERYSEILGKVNETL
FT                   DKVDWSQAGRIGKVVGIFAAVIVAQILIKGILDTINLLPVVPGLLELLGVVVVGQWSWK
FT                   NLTTSEKRSALVNRVQTIRSEYLG"
FT   gene            447674..448285
FT                   /locus_tag="sync_0451"
FT   CDS_pept        447674..448285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46891"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICZ2"
FT                   /protein_id="ABI46891.1"
FT                   /translation="MAEIIGLSSQAPSQLIIGAECLMVLRQDLLAPAPAEGCALLLGQG
FT                   HGAPDSASDDWSVQLIWPCRNMVEQQVHDRFELDPREQIAAQRWARSRSLKVLGSAHSH
FT                   PTASVVPSRRDRLWAVSSGLMLIMGNNHAVAAWWLEVEAPRCALAEVHPLSIQVMRETS
FT                   LKSFPGELGIRHEGSGGYSSAQWRGEDQICPPHHAPRGGS"
FT   gene            448197..449360
FT                   /locus_tag="sync_0452"
FT   CDS_pept        448197..449360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0452"
FT                   /product="putative molybdopterin biosynthesis protein MoeB"
FT                   /note="identified by match to protein family HMM PF00581;
FT                   match to protein family HMM PF00899; match to protein
FT                   family HMM PF05237"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47739"
FT                   /db_xref="GOA:Q0ICZ1"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICZ1"
FT                   /protein_id="ABI47739.1"
FT                   /translation="MKEAGGTPQLSGEEKTRYARHITLPEVGVEGQQRLKAASVLCIGA
FT                   GGLGSPLLLYLAAAGVGRIGVVDDDLVEPSNLQRQVIHGTETVGQAKTSSARSRIEDLN
FT                   PFCRVEDHCFRLSANNALELFAAYDVVVDGTDNFASRYLINDACVLTKRPFVYGSVQRF
FT                   EGQVSVFNLGSQSPDYRDLVPEPPPQELVPSCADGGVMGVMPGLIGLIQAAEVIKLITG
FT                   IGTPLDGRLLLVDGLSMRFRELTLKRRPSRAPIEKLIDYQAFCTVGRSISGGKLKVMKS
FT                   ISVLELKAMLDQGHDLALIDVRNPAEAEVAVIAGSELIPLATLDSEEVIDRIKAIAASK
FT                   TVYVHCKLGGRSAKAVEFLANHGIDAVNVQGGIDAWSEQIDPSVPRY"
FT   gene            complement(449370..450563)
FT                   /gene="cobO-1"
FT                   /locus_tag="sync_0453"
FT   CDS_pept        complement(449370..450563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobO-1"
FT                   /locus_tag="sync_0453"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="identified by match to protein family HMM PF02572"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45225"
FT                   /db_xref="GOA:Q0ICZ0"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICZ0"
FT                   /protein_id="ABI45225.1"
FT                   /translation="MDAVSSGTSQANRARSNRGVGIVTAADSRERSLGQLHVYDGEGKG
FT                   KSQAALGVVLRTIGLGICEQRRTRVLLLRFLKGPGRAYDEDAAIEALQQGFPHLIDQVR
FT                   TGRGDYFSVDEVKRFDRQEAQRGWDIAKGAIASALYSVVVLDELNPVLDLGLLETEDVI
FT                   RSLKSRPEGMEIIVTGRGAPRRLVEIADLHSEMRAHRRPEVDNNAALSFVTAGGIEIYT
FT                   GEGKGKSTSALGKALQAIGRGISQDKSHRVLILQWLKGGSGYTEDAAIAALRESYPHLV
FT                   DHLRSGRDAIVWRGQQQPIDYVEAERAWEIARAAIASGLYKTVILDELNPTVDLELLPV
FT                   EPIVQALLRKPTETEVIITGRCKHQPAYFDLASVHSEMVCHKHYAEQGVDLKRGVDY"
FT   gene            450636..451463
FT                   /locus_tag="sync_0454"
FT   CDS_pept        450636..451463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0454"
FT                   /product="PP-loop family protein"
FT                   /note="identified by match to protein family HMM PF00733;
FT                   match to protein family HMM TIGR00268"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46050"
FT                   /db_xref="GOA:Q0ICY9"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICY9"
FT                   /protein_id="ABI46050.1"
FT                   /translation="MFRQLESLSELEHDVLKRLRDSLASQQQVCVAYSGGVDSSLVAAI
FT                   AHEQLGEQALAITGVSPSLAPHLLLEARQQAAWLGMRHQEVLTLELEDPDYTSNPQDRC
FT                   YACKRELHRHLAPIAAEANGALVLDGVNQDDLGDHRPGIAAAKEAGVRSPLAELGITKA
FT                   TVRRLSWALGFPWWDKPAQPCLASRFPYGDSISRERLQRVGQAEAWLIQQGFDQVRVRS
FT                   HGLAARVEVPEERITDLLQPWLRRELVKSLLGFGFTSVSVDVEGLVSGKLNRV"
FT   gene            451611..452942
FT                   /locus_tag="sync_0455"
FT   CDS_pept        451611..452942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0455"
FT                   /product="glutamate decarboxylase"
FT                   /EC_number="4.1.1.15"
FT                   /note="identified by match to protein family HMM PF00282;
FT                   match to protein family HMM TIGR01788"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47454"
FT                   /db_xref="GOA:Q0ICY8"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010107"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICY8"
FT                   /protein_id="ABI47454.1"
FT                   /translation="MLTPLPKHHFPGEGREGNSTVQLLREELLLDGNSKQNLATFCQTY
FT                   QAQSAMELMTLGVDKNLIDKDEYPQTAELEGRCVSMMADLWNAPGAAVGCSTIGSSEAA
FT                   MLGGMAAKWRWRKRREAAGLPTDKPNMVCGSVQICWKKFARYWDIEMRELEMLTGELCV
FT                   SPERVLEAVDENTIFVVPTLGVTYHGLYEDIESISKALDDLQARTGLDVPIHVDAASGG
FT                   FLAPFCAPDLPLWDFRLERVKSINASGHKFGLAPLGVGWVLWRSQEDLPDELVFHVTYL
FT                   GGDMPTFQINFSRPAGQVIAQYHEFVRLGREGYRMLHMASHANAQYFAEKLREMDLFRI
FT                   IHDGTPDKGIPTVVWTLDDNPKYGFNLYDFADRLRMRGWQVPAYPFTGELESTAFQRIL
FT                   VKRDFTRDMADLLLEDIRQAIQHFQKHPITSNLAATEGASYNHL"
FT   gene            complement(452957..453442)
FT                   /gene="speD"
FT                   /locus_tag="sync_0456"
FT   CDS_pept        complement(452957..453442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="sync_0456"
FT                   /product="DUF206"
FT                   /note="identified by match to protein family HMM PF02675"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46188"
FT                   /db_xref="GOA:Q0ICY7"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICY7"
FT                   /protein_id="ABI46188.1"
FT                   /translation="MEQSLSSLHPNPGWATTERTTQSCATDTSATDMVGKHCILELYDC
FT                   DPSKLDDETFLRHTITTAAQRAGATLLNLITHRFEPQGVTGLALLAESHISIHTWPENG
FT                   YAAVDVFTCGDHTMPEKACEVLSEELSAGRHALRSFLRETPAALGTTERMPAIPIAA"
FT   gene            complement(453473..454510)
FT                   /gene="recF"
FT                   /locus_tag="sync_0457"
FT   CDS_pept        complement(453473..454510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="sync_0457"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by match to protein family HMM TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45500"
FT                   /db_xref="GOA:Q0ICY6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICY6"
FT                   /protein_id="ABI45500.1"
FT                   /translation="MIGSNGVGKSNLLESVELLGSLRSHRSSQDGDLIHWDASRALLKA
FT                   TCADQQILELELRRRGGRQAKRNGKSLQRQLDLIGPLRCVGFSALDLHLVRGEPALRRQ
FT                   WLDRVVLQLEPVYADLISRYGRLLRQRAQFWRRGGLSSGMEPQALLESFDTQMALVSTR
FT                   IHRRRLRALARLEPLAAVWQDRLSEGREHLQLGYSPGSALIGEEQEESWRLSIEQQLRE
FT                   QRSEEERLGSCRVGPHRDEIEMRINGTAARRFGSAGQQRTLVLALKMAELQLVGELCGE
FT                   PPLLLLDDVLAELDPTRQLALLEAVGENHQCLVSATHLDAFEGGWREQSQILDADSLRS
FT                   QSGAR"
FT   gene            454675..454751
FT                   /locus_tag="sync_0458"
FT   tRNA            454675..454751
FT                   /locus_tag="sync_0458"
FT                   /product="tRNA-Arg"
FT   gene            complement(454770..455231)
FT                   /locus_tag="sync_0459"
FT   CDS_pept        complement(454770..455231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0459"
FT                   /product="GNAT family acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47411"
FT                   /db_xref="GOA:Q0ICY5"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICY5"
FT                   /protein_id="ABI47411.1"
FT                   /translation="MSPLPFRQQAAAPRLPAHYRLQTAPDPSGDAINALLMSCGEPAHP
FT                   LERWSLALSRSLWQLSIIDERDQALVGFIRATSDLALNANLWNLAACPGDDQKLLLNAL
FT                   LHHSLALLKKELPGCSISISAPAIALEGLKKQGFILDPGGIRAMGLRLR"
FT   gene            complement(455232..458237)
FT                   /gene="ppc"
FT                   /locus_tag="sync_0460"
FT   CDS_pept        complement(455232..458237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /locus_tag="sync_0460"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="identified by match to protein family HMM PF00311"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46533"
FT                   /db_xref="GOA:Q0ICY4"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICY4"
FT                   /protein_id="ABI46533.1"
FT                   /translation="MIPSDSGFPSMHSSSALIPESTQPRADGNEAGGGQLLQQRLALVE
FT                   DLWRTVLRSECPPEQAEQLLRMKQLSDPVLPGEHPAGTDALIDLIKGMDLAEAIAAARA
FT                   FSLYFQLVNILEQRIEEDTYLESINRSQDQAEQFDPFAPPLATQTEPATFRELFERLRR
FT                   LNVPPAQLEALLQELDIRLVFTAHPTEIVRHTVRHKQRRVASLLQQLETQPPTPSGATD
FT                   SVRLQLEEEIRLWWRTDELHQFKPSVLDEVDYALHYFQQVLFNAMPQLRRRIVASLAAS
FT                   YPDVRVPSSSFCTFGSWVGSDRDGNPSVTTEITWRTACYQRQLMLDRYISAVQHLRNQL
FT                   SISMQWSQVSPPLLESLEMDRLRFPDVYEERATRYRLEPYRLKLSFVLERLRLTQLRNQ
FT                   QLADAGWRTPPEGLPSFTPGNAPGDALHYGSIAEFRSELELIRTSLVNTDLSCEPLDTL
FT                   LTQVHIFGFSLAGLDIRQESTRHSDALDELSRYINPDRAYGAMDEAERVAWLMEELQTR
FT                   RPLIPPAVSWSAATAETVDVFRMLHRLQDEFGSRICGTYVISMSHSVSDLLEVLLLAKE
FT                   AGLVDPSARHADLLVVPLFETVEDLQRAPEVMEHLFQTPLYRDLLPKVGTQGLLLQELM
FT                   LGYSDSNKDSGFLSSNWEIHQAQIALQDLASRQGIALRLFHGRGGSVGRGGGPAYQAIL
FT                   AQPSGTLQGRIKITEQGEVLASKYSLPELALYNLETVTTAVIQNSLVTNQLDATPSWNK
FT                   LMSRVAKSSRRNYRALVHDNPDLVAFFQQVTPIEEISKLQISSRPARRKTGTRDLSSLR
FT                   AIPWVFGWTQSRFLLPSWFGVGSALSEELEADPDQLTLLRTLHQRWPFFRMLISKVEMT
FT                   LSKVDLDLARHYVTSLGSAEHHEAFEKIYATVAEEYARTKELVLAITGQERLLDADPAL
FT                   QLSVDLRNRTIVPLGFLQVALLRRLRDQNRQPPMSESPSSDGDGRTYSRSELLRGALLT
FT                   INGIAAGMRNTG"
FT   gene            complement(458240..459385)
FT                   /locus_tag="sync_0461"
FT   CDS_pept        complement(458240..459385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0461"
FT                   /product="putative glutamate--cysteine ligase"
FT                   /note="identified by match to protein family HMM PF04107;
FT                   match to protein family HMM TIGR02048"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47790"
FT                   /db_xref="GOA:Q0ICY3"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011792"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICY3"
FT                   /protein_id="ABI47790.1"
FT                   /translation="MIQKLRLKGFEVELFTGRSSGENVGVAELVKQDLTEFCVEPDHRN
FT                   LEYITNPESDYGKLKEALLAPRRRLRTWLAERNLTLLPGSTLTLGDATQFERSNPNDPY
FT                   HDLIEATYGTTVVTASIHINLGISEPADLFAALRLVRCEAALLLALSASSPFLNRQITG
FT                   AHSQRWLQFPLTPKQVPLFRDLEHFVEWTDTQLMEGRMHNVRHLWTSVRPNGPQRPFDL
FT                   NRLELRICDLVTNPDLLLAITALMELRVLMLLREPNQLDPFKASDLSADQLMVLSDTND
FT                   ATAARHSLDAQLRDWRDGRQRLCRNWLRDMINDVMPLAHELELTSYLLPLESVLAEGNQ
FT                   AMRWLKGIENGRSLEEEFRTGILEMEQEEQPIDRSLADALG"
FT   gene            complement(459382..460914)
FT                   /locus_tag="sync_0462"
FT   CDS_pept        complement(459382..460914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0462"
FT                   /product="putative anthranilate synthase component I"
FT                   /note="identified by similarity to SP:P20579; match to
FT                   protein family HMM PF00425; match to protein family HMM
FT                   PF04715"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47155"
FT                   /db_xref="GOA:Q0ICY2"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICY2"
FT                   /protein_id="ABI47155.1"
FT                   /translation="MLSPDRSAFLEAARCGATFIPVAHSWPADLETPLTTWLKVGEGHP
FT                   PGVLLESVEGGENLGRWSVIACDPLWTLSARGDVLTRRWRDGYEESFQGNPLEVLRECT
FT                   NAYRPVSLPGLPPLGQLYGMWGYELIRWIEPSVPVHKADENAPPDGVWMLMDSILIIDQ
FT                   VKRLITAVAYGDLSNTRAAAKSADQAWDGAMGRILGLENRMASPLPQVRPLRWKPAARP
FT                   TPETESNRSPENYQEAVATAQEHIAAGDAFQLVISQRLETRVSQPPLEVYRSLRMVNPS
FT                   PYMAFFDFGDWYLIGSSPEVMVKAEPDQGGIRASLRPIAGTRPRGRNELEDRNFEVDLL
FT                   ADPKERAEHVMLVDLGRNDLGRVCTAGTVDVKELMVIERYSHVMHIVSQVEGRLAQGRD
FT                   IWDLLMASFPAGTVSGAPKIRAMQLIHQLEPDARGPYSGVYGSVDLAGALNTAITIRTM
FT                   VVRPHPEGGWNIQVQAGAGVVADSDPASEYQETLNKARAMLTALACLEDPKS"
FT   gene            complement(460962..461393)
FT                   /gene="psaD"
FT                   /locus_tag="sync_0463"
FT   CDS_pept        complement(460962..461393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaD"
FT                   /locus_tag="sync_0463"
FT                   /product="photosystem I reaction center subunit II"
FT                   /note="identified by match to protein family HMM PF02531"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46131"
FT                   /db_xref="GOA:Q0ICY1"
FT                   /db_xref="InterPro:IPR003685"
FT                   /db_xref="InterPro:IPR036579"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICY1"
FT                   /protein_id="ABI46131.1"
FT                   /translation="MTASALTGQLPQYIGSTGGLLNSAETEEKYAITWTSKSEQAFELP
FT                   TGGAAMMSSGENIMYFARKEQCLALGTQLRTKFKPRIEDFKIYRIFPGGDTEFLHPLDG
FT                   VFPEKVNEGRPMVGHNPRRIGANTNPANIKFSGRNTYDS"
FT   gene            complement(461487..462896)
FT                   /locus_tag="sync_0464"
FT   CDS_pept        complement(461487..462896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0464"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45485"
FT                   /db_xref="GOA:Q0ICY0"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICY0"
FT                   /protein_id="ABI45485.1"
FT                   /translation="MLLQTIHQQMAQGVSSGCSDDSTARRMWWAALETLQETLLQNEET
FT                   PAGVWLAAPLPALYSPQLLSSLQGWVWAPKALGALTSPSTSLLPPDLLRARQSHGGATY
FT                   SLQSSTFRRLPLHEDDCHDPLLVVITAKVQIALALHGGASQRQLLMRSEPETLGSVLGL
FT                   IEQRLKLDAPDQALALHQALEALGPLESSSALGQTFWPSLAVRLASMAPTVTLQASTSA
FT                   PAQSHQQPQTTSEQGSAASKADEELSLLEAIAHEVRTPLSTIRTLIRSLLRRNDLPETA
FT                   IKRLEMIDTECSEQIDRFGLIFQAAELQRQPESPSVLAHTDLGSMIGLLTPSWEQQLQR
FT                   RGIELSLAIASNLPSVLSDPSRLEPMLGGLVDRCSRGLPSGSQLVLTLQPAGARLKLQL
FT                   HGQSPAERGEGVASPEPIAQLGPVLSWNPDTGSLQLSQTATRRLLARLGGRLTQRRDRG
FT                   LTVFFPLAPHC"
FT   gene            complement(462904..464175)
FT                   /locus_tag="sync_0465"
FT   CDS_pept        complement(462904..464175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0465"
FT                   /product="putative rod shape-determining protein RodA"
FT                   /note="identified by match to protein family HMM PF01098;
FT                   match to protein family HMM TIGR02210"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45291"
FT                   /db_xref="GOA:Q0ICX9"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICX9"
FT                   /protein_id="ABI45291.1"
FT                   /translation="MKIGPMSREHSPFTLNRRRKGWRLKEPVLWGIPLAMVMVAGLLIA
FT                   STQRQADYADWYHHWITAAVGVVIALVTARLPLLRLKPLLIPIYAITVISLVAVRLIGT
FT                   TALGAQRWISIGGVHVQPSEFAKLSAILLLAAVLDRHPVERPVDLLRPLGIISIPWLLV
FT                   FIQPDLGTSLVFGALLLTMLYWSGMPIEWLVLLLSPLATALLAGLFPWGLAAWIPLTMI
FT                   ISYSSLPWKRVALALVLIVQSAAALVTPWMWMHGLQDYQRDRLVLFLDPAKDPLGGGYH
FT                   LLQSTVGIGSGGLFGMGLLQGQLTKLRFIPEQHTDFIFSALGEETGFLGTILVVVGFAL
FT                   LMGRLLQLAGQSRSDFESLVVIGVATMLMFQVVVNIFMTIGLGPVTGIPLPFMSYGRSA
FT                   MVVNFLALGLCLSVSRRSQRALNR"
FT   gene            complement(464178..465254)
FT                   /gene="mpr"
FT                   /locus_tag="sync_0466"
FT   CDS_pept        complement(464178..465254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpr"
FT                   /locus_tag="sync_0466"
FT                   /product="MRP protein homolog"
FT                   /note="identified by match to protein family HMM PF01883"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47144"
FT                   /db_xref="GOA:Q0ICX8"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICX8"
FT                   /protein_id="ABI47144.1"
FT                   /translation="MATAEQAAELLKGIVDAGSNRSVMDLGWLDRVRVDPPRAVLRLNL
FT                   PGFAQGQRERIVSEARERLLGLEAIQDVQIEVGTPPSQGGIGQAGHGQAAERQPIPGVK
FT                   QVIAVSSGKGGVGKSTVAVNLACSLAKQGLRVGLLDADIYGPNAPIMLGVADQSPEVSG
FT                   SGDDQRMIPLESCGVAMVSMGLLIEENQPVIWRGPMLNGIIRQFLYQVDWTERDVLIVD
FT                   LPPGTGDAQLSLAQAVPMAGVVIVTTPQKVALQDARRGLAMFLQMGVPVLGVVENMSAF
FT                   IPPDQPDKSYALFGSGGGQTLAEAFDVPLLAQIPMEMSVQEGGDQGQPISISHPNSASA
FT                   QAFKELAETLGNSLQAIG"
FT   gene            465408..466454
FT                   /gene="hemF"
FT                   /locus_tag="sync_0467"
FT   CDS_pept        465408..466454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="sync_0467"
FT                   /product="coproporphyrinogen III oxidase, aerobic"
FT                   /EC_number="1.3.3.3"
FT                   /note="identified by match to protein family HMM PF01218"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46588"
FT                   /db_xref="GOA:Q0ICX7"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICX7"
FT                   /protein_id="ABI46588.1"
FT                   /translation="MLSSDATGERPPSDSRTRARALVQGLQNEICAGLEQLDGSAHFQE
FT                   ESWDRPEGGGGRSRVMTEGRVFEQGGVNFSEVHGKELPPSILKQRPDAKGHPWFATGTS
FT                   MVLHPRNPFIPTVHLNYRYFEAGPVWWFGGGADLTPFYPFLEDARHFHREHKRACDSID
FT                   PKLYTVFKPWCDEYFFLKHRKETRGIGGIFYDYQDGSGRLYRGQDPEGPAARQAADIGS
FT                   FRLGWDQLHDLARACGQAFLPAYTPIVEKRNPLPYGERERQFQLYRRGRYVEFNLVWDR
FT                   GTIFGLQTNGRTESILMSLPPMARWQYGYRAPEGSREELLTDLFTRPQDWFGDPTLEDR
FT                   CRPHQAID"
FT   gene            complement(466381..467280)
FT                   /locus_tag="sync_0468"
FT   CDS_pept        complement(466381..467280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0468"
FT                   /product="possible N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47275"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICX6"
FT                   /protein_id="ABI47275.1"
FT                   /translation="MPLIPAWMQRKRVTIPISVTLLSVVALVLTQAKEHSLSIQASDAA
FT                   KSDGTLPKRSVCPTPSNPDPLLGARTRRPGRWVGTTPIAKDTPIVVMAGHADSQGMDSA
FT                   GTPGFAVGVQKQAPMDARMRDELYWNLKVQKAVVRLGKARSLNISAYNPPALTIRNDNH
FT                   PKTNWSQARVRSAKGEYILEIHFDAYSPYGFGSGLIPAINRPLNTIDESLGKAFGRFPR
FT                   LFRGGLGGPRRGIGILEIGMLEPPLEQKLRNPKTQRQTIDCLALRVVDALEQGVNRSPD
FT                   GGGNGPPGSDPQTNPADG"
FT   gene            complement(467292..467846)
FT                   /locus_tag="sync_0469"
FT   CDS_pept        complement(467292..467846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE21879.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46315"
FT                   /db_xref="GOA:Q0ICX5"
FT                   /db_xref="InterPro:IPR021919"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICX5"
FT                   /protein_id="ABI46315.1"
FT                   /translation="MPTTQTSTLLLTLLLAIGLVFFLRAASKDRTTVVEVHSPKPALEV
FT                   MEGLCTWLESRGWIRDGGDAERCLLEYRGRVASSNPLAALLSLLGGVGAGCLGLVLREL
FT                   NPSLGWWPVSLVLLGPLAGWVYSRRAARQEGIQIRLIEPAPQEGSTLRLRAHRDELIAL
FT                   ELALGEPLDLASDGSLLSSPI"
FT   gene            complement(467878..468261)
FT                   /locus_tag="sync_0470"
FT   CDS_pept        complement(467878..468261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0470"
FT                   /product="possible Pex protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45684"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICX4"
FT                   /protein_id="ABI45684.1"
FT                   /translation="MLHRRNATQNCLADIEHYFQQPPPLFLDLELAVCWIVDCLLQHDS
FT                   YPSGLLQRLQREHPQLRVSETVLHQAVDFLNQQELLDCYSKRCPSRGRPRRMLHLHEEA
FT                   RAEAERLMEPWHRWLHEHEPMTT"
FT   gene            468387..469031
FT                   /locus_tag="sync_0471"
FT   CDS_pept        468387..469031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0471"
FT                   /product="3'-5' exonuclease family protein"
FT                   /note="identified by match to protein family HMM PF01612"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47566"
FT                   /db_xref="GOA:Q0ICX3"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICX3"
FT                   /protein_id="ABI47566.1"
FT                   /translation="MTDISAQPRAFAVFDGDLDADWAERYSHATALAVDTEAMGLIHGR
FT                   DRLCLVQICDAEDQVSCVRIALGQTEAPRLKELMERASIEKVFHFARFDVAALATGLGI
FT                   RVNPIFCTKVGSRLARTYSPRHGLKEVVMELVGVELDKQAQSSDWGRVDELSETQLAYA
FT                   ANDARYLLPARDRLKEMLQREGRWELAERCFECIPVMSDLDRFRFNQTFEH"
FT   gene            complement(469068..469337)
FT                   /locus_tag="sync_0472"
FT   CDS_pept        complement(469068..469337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0472"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46982"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICX2"
FT                   /protein_id="ABI46982.1"
FT                   /translation="MPAIQDHDYLRLCAELATELGISQSSARRRVELAANKTGAKDLTS
FT                   RKEVATTLLADAQNERSKGEHDQGQVLDRLLEAEPLDEKFMVED"
FT   gene            complement(469358..470587)
FT                   /locus_tag="sync_0473"
FT   CDS_pept        complement(469358..470587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0473"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45243"
FT                   /db_xref="InterPro:IPR019994"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICX1"
FT                   /protein_id="ABI45243.1"
FT                   /translation="MLLISNGHGEDIIALKIIEALHNQRPQLRLKVLPLVGEGGSFRTA
FT                   TEQGWVQQIGPSAPLPSGGFSNQSLRGLLADVIAGLPLLTWQQWRCLRKHRAQVDAVLA
FT                   VGDLLPLLMAWGSGRPFGFVGTPKSDYTWCSGPGQDLSDNYHALKGSEWDPWEWLLMRN
FT                   KRCHLVFTRDRLTARGLRRHGVRAEAPGNPMMDGLSNASVPASLSRCRRILLLCGSRIP
FT                   EAERNFSRLLLGLAPLPSDRPIAVLVALGSTPGLPALGAELKRQGFRSSPPPSDALQAG
FT                   ACWLKGHVLVLLGTGQLELWAPWAEVGVATAGTATEQLVGLGIPALSLPGKGPQFTQGF
FT                   AKRQSRLLGGAVRPCQSSHELNTRLNQLLEDPSLRLQMGRKGRQRMGPAGGSEAIAKRV
FT                   LIQLPLGHGY"
FT   gene            470642..470712
FT                   /locus_tag="sync_0474"
FT   tRNA            470642..470712
FT                   /locus_tag="sync_0474"
FT                   /product="tRNA-Cys"
FT   gene            complement(470766..471152)
FT                   /locus_tag="sync_0475"
FT   CDS_pept        complement(470766..471152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0475"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45061"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICX0"
FT                   /protein_id="ABI45061.1"
FT                   /translation="MRPRATEPQLTAFRKHKYSETCLERRGRMRTTQASGDRTLLGLFF
FT                   ASPLTLSATFIRTAVPDATVIPDLIAALCQAQNNRMIKTFSSRRSGKMSERRTSANSLR
FT                   ALQQQDHNPSPMRRTLSKKFEGFA"
FT   gene            471307..472014
FT                   /locus_tag="sync_0476"
FT   CDS_pept        471307..472014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0476"
FT                   /product="cation transporter, voltage-gated ion channel
FT                   (VIC) family protein"
FT                   /note="identified by match to protein family HMM PF00520;
FT                   match to protein family HMM PF07885"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46023"
FT                   /db_xref="GOA:Q0ICW9"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICW9"
FT                   /protein_id="ABI46023.1"
FT                   /translation="MIVKVIGVLIVFSIVLAILATEPVIRGPHLDLLAKLDLIVAILFL
FT                   AEYLSRLWIAPLRDGARSGVRGVLDFAITPMAILDLVAIAPTILGFISPELYLLRIIRL
FT                   VRIGRIGRSKRFQKSVRHFNYAITSKREELQISAIYSAVVISISSALMYLVEGSIQAEQ
FT                   FGSIPRCLWWSIITVTTVGYGDVSPETAAGKIVAAMTALFGIAVIAIPIGIISSGFTDS
FT                   LKLEKINIGSGND"
FT   gene            complement(472098..472613)
FT                   /locus_tag="sync_0477"
FT   CDS_pept        complement(472098..472613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45310"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICW8"
FT                   /protein_id="ABI45310.1"
FT                   /translation="MDCSPSLRLSPLILILLSSMLIFQMKGSADPNLKVGRYETDTKKC
FT                   SFIDSTQKIAACITLQLKGRSPSVVAVRLIGHGTTKNSRRQLTFVTFTTQGESPLKCST
FT                   GTCRLDAGSWQSKVSSVAEASFNPNGIATGLPKAWAAKNGECSLKNRVLRCSALHFNGE
FT                   IYKAEAYL"
FT   gene            complement(472621..472887)
FT                   /locus_tag="sync_0478"
FT   CDS_pept        complement(472621..472887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0478"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46575"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICW7"
FT                   /protein_id="ABI46575.1"
FT                   /translation="MPHAQVPNPIPVTPTFHSARHDRRKAALAMASNAESIISTSKPSG
FT                   DEANGAGDGMTPGQSEKVLCPHCRRTASNGIRCMGICVADNDY"
FT   gene            472850..473809
FT                   /locus_tag="sync_0479"
FT   CDS_pept        472850..473809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0479"
FT                   /product="Predicted oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45728"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICW6"
FT                   /protein_id="ABI45728.1"
FT                   /translation="MTGIGFGTWAWGNQLLWGYQPERDDPDLAATLSAAVQGGLSLVDT
FT                   ADSYGTGRLNGRSELLLGQFLRAMKPAQSQQLKVATKLAPFPWRLGRGGFKRAFVASKK
FT                   RLGGHLDRIQLHWSTARYAPWQELPLLDGLGDLVEQGLVPELGLSNVGPKRLRFLHGHL
FT                   LTRGIRLQSVQVQLSLLAPEPVLNGQLAQVCQELGVELLAYSPLALGVLAIPPGVQGTS
FT                   STVLRSRLFQRLLPASEDLRSVMVEIASQRRASMAQVALNWCRAHGACPIPGLRRPTQA
FT                   HDAAKALRWSLSATERQALDQLSQRTLARMPANPFQSA"
FT   gene            complement(473797..474423)
FT                   /locus_tag="sync_0480"
FT   CDS_pept        complement(473797..474423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0480"
FT                   /product="possible Hpt domain"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46336"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICW5"
FT                   /protein_id="ABI46336.1"
FT                   /translation="MAFDRIQRTTRRRSSAGPTPPRRPLGGSYDRASGHRQGPRPTFLA
FT                   LKDHGKVFVADMPFLSDGQLANITKEASEVLESLERRIVELEEIADQPIADRDTLIKAC
FT                   TKRDVTHRFLRAIEDEQQQRRENPAVLSAAGESLPRTFLEIARHRLPGATFDSLLQEAL
FT                   NACEQSKAQEESSNPSPVKVIPFQGKPSSLPVVVSPDPDPADQAL"
FT   gene            complement(474562..475602)
FT                   /gene="purM"
FT                   /locus_tag="sync_0481"
FT   CDS_pept        complement(474562..475602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="sync_0481"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR00878"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47623"
FT                   /db_xref="GOA:Q0ICW4"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICW4"
FT                   /protein_id="ABI47623.1"
FT                   /translation="MDYKTAGVDVEAGRAFVNRIRKSVEATHRPEVVGGLGGFGGLMRL
FT                   PAGLKKPLLVSGTDGVGTKLELAQDHGGHHNVGIDLVAMCVNDVITSGAEPLFFLDYMA
FT                   TGALSPEAMATVVEGIAEGCRGSGCALLGGETAEMPGFYPSGRYDLAGFCVAVVEEEQL
FT                   IDGRQIRAGDRILGIASSGIHSNGFSLVRRVLTHAGANAETTFGPSNQPLIESLLTPTQ
FT                   LYGRLVKTLLETGTPIHGMAHITGGGLPENLPRCLPEGLQAIVTPSSWTRPAIYDWLQS
FT                   HGDIPERDLWHTFNLGIGYCLIVPEEGVSIAEKACESEGMQAWTIGRIEASSGGDGKGS
FT                   VLGLPA"
FT   gene            475944..476453
FT                   /gene="rlpA"
FT                   /locus_tag="sync_0482"
FT   CDS_pept        475944..476453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlpA"
FT                   /locus_tag="sync_0482"
FT                   /product="possible rare lipoprotein A"
FT                   /note="identified by match to protein family HMM PF03330;
FT                   match to protein family HMM TIGR00413"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47021"
FT                   /db_xref="GOA:Q0ICW3"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICW3"
FT                   /protein_id="ABI47021.1"
FT                   /translation="MHRSFPFASLATGLFATGCALFPVLARDVATTEFYDPFEPLVPES
FT                   VQASTPTAPAVAPPPIEVPPNPPKTMVVSTSTGEASWYGPGFFGNRTANGEVFRPGTMT
FT                   AAHRTLPFGTKVKVTNLRNGKETIVRINDRGPFSGHRVIDIAHGAAHHLGLVSSGIAQV
FT                   RLEVLR"
FT   gene            476516..478000
FT                   /gene="panC/cmk"
FT                   /locus_tag="sync_0483"
FT   CDS_pept        476516..478000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC/cmk"
FT                   /locus_tag="sync_0483"
FT                   /product="pantoate--beta-alanine ligase/cytidylate kinase"
FT                   /EC_number="6.3.2.1"
FT                   /EC_number="2.7.4.14"
FT                   /note="identified by match to protein family HMM PF02224;
FT                   match to protein family HMM PF02569; match to protein
FT                   family HMM TIGR00017; match to protein family HMM
FT                   TIGR00018"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45138"
FT                   /db_xref="GOA:Q0ICW2"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024894"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICW2"
FT                   /protein_id="ABI45138.1"
FT                   /translation="MHFVPTMGGLHHGHASLISAASCHKSGDVETLVSVFVNPLQFGPN
FT                   EDFARYPRTFEADCELAELSGASAIWCPDESQIYPGGSAESWRIQAPKSLQSRLCGSTR
FT                   PGHFDGVVTVVCRLLALAKPHQLFLGEKDWQQLTILRRMVLDLGLAVRVRGVPTVRDGD
FT                   GLASSSRNRYLNAQQRQQGVLFAQVLSDARSACLHGGTALKPGEVKRRLEEVGLSVEYV
FT                   DVVDPWFLQPSKSNQSSLTLLAAAVRCGSTRLIDHAFLMTRSPLVAIDGPAGAGKSTVT
FT                   RAFAERLGLVYLDTGAMYRAVTWLVLEQGGDPGDSEAVDLVLNDLKVELEPLQQGVQVV
FT                   RVNGHEVTDAIRDPRVTASVSAVASHACVRAAMTAQQQRMGKAGGLVAEGRDIGTAVFP
FT                   DAELKVFLTATPKERARRRALDLEARGHEVPALPELEAQIVERDRLDSTREVAPLLQAD
FT                   DAIELISDGMSIDQVIDALEDLFRRRVGEEVWPTPV"
FT   gene            complement(478014..478502)
FT                   /locus_tag="sync_0484"
FT   CDS_pept        complement(478014..478502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0484"
FT                   /product="low molecular weight phosphotyrosine protein
FT                   phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF01451"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45763"
FT                   /db_xref="GOA:Q0ICW1"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICW1"
FT                   /protein_id="ABI45763.1"
FT                   /translation="MTTKVLFVCLGNICRSPAAEGVFLHLIEQRQLMDQFLVDSAGTGG
FT                   WHVGNPADRRMQAAATQRGIHLPSRARQLERGDFDSFDHILAMDQDNLHNVSSMAKEFG
FT                   QRSTVNIRLMLSHARRADTLEVPDPYYGGEQGFEHVLDLLEDACAGLLEDLLAPATKR"
FT   gene            complement(478499..479128)
FT                   /gene="cpcF"
FT                   /locus_tag="sync_0485"
FT   CDS_pept        complement(478499..479128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpcF"
FT                   /locus_tag="sync_0485"
FT                   /product="phycocyanin alpha subunit phycocyanobilin lyase,
FT                   CpcF subunit"
FT                   /EC_number="4.-.-.-"
FT                   /note="identified by match to protein family HMM PF03130"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45480"
FT                   /db_xref="GOA:Q0ICW0"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICW0"
FT                   /protein_id="ABI45480.1"
FT                   /translation="MTNVSPLEGAIADLQAAKTTPELIRATKNLCNLRTIEAISTLIEV
FT                   LGFNNPAVASVATAGLIELGSQAVPSLLVSLDEKNYGSRAWVVRALASIRDPRSLDLLE
FT                   HALATDIAPSVRRSAARGLAELNLIYPEDSSKLNRCLLALLAAIKDDEWVVRYSAIFGI
FT                   ELHLLKYNSTYKNLCILGLKQLSSNSESIKVIRLRATLALQRLNPS"
FT   gene            complement(479125..479922)
FT                   /gene="cpcE"
FT                   /locus_tag="sync_0486"
FT   CDS_pept        complement(479125..479922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpcE"
FT                   /locus_tag="sync_0486"
FT                   /product="phycocyanin alpha subunit phycocyanobilin lyase,
FT                   CpcE subunit"
FT                   /EC_number="4.-.-.-"
FT                   /note="identified by match to protein family HMM PF03130"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47764"
FT                   /db_xref="GOA:Q0ICV9"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICV9"
FT                   /protein_id="ABI47764.1"
FT                   /translation="MKDPSPENLKPPLTEEQVIVNLRQTEDLSDQYYAAWWVGRMRSRH
FT                   PETLPLLLAALDPLHSNPINKERRAVALNAIRALGILQERSAEEDLRRLLKKNDYSIRE
FT                   ESARSLGMIQAKDAVPDLCKLLSGSTDEVEQIQSGSTKLKEPYESVLEALGAIGVASRS
FT                   VISMIKPFTKHSRPLIRASACRALLLLTDDQAWAPPLIELLQHDDPLIRRGVLLDLGAT
FT                   GWMPALPAIQAAAIENSLKLVALRGLAEKSEDISVLDAMDALL"
FT   gene            complement(479924..480514)
FT                   /locus_tag="sync_0487"
FT   CDS_pept        complement(479924..480514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0487"
FT                   /product="Protein of unknown function (DUF1001) superfamily
FT                   protein"
FT                   /note="identified by match to protein family HMM PF06206"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46022"
FT                   /db_xref="GOA:Q0ICV8"
FT                   /db_xref="InterPro:IPR010404"
FT                   /db_xref="InterPro:IPR038672"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICV8"
FT                   /protein_id="ABI46022.1"
FT                   /translation="MTATIGNFLKNLCGEYSNQKQAFDNPPLFAHIFLRYKPIEHLQPG
FT                   SILLEQTYAVDPKHPYRLRVIRAEEVTSGIIKLWNHTFKAPENFSSATFDDEQRKTIKE
FT                   EDLILLDHCHYQVRQLDNGFFGELEPGCRCIVHRNGKETYLVSSFHLEGDELTTLDRGH
FT                   DPQTHERCWGSIAGEFHFQRISNWAENIPEKWL"
FT   gene            complement(480605..481093)
FT                   /gene="cpcA"
FT                   /locus_tag="sync_0488"
FT   CDS_pept        complement(480605..481093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpcA"
FT                   /locus_tag="sync_0488"
FT                   /product="phycocyanin, alpha subunit"
FT                   /note="identified by match to protein family HMM PF00502;
FT                   match to protein family HMM TIGR01338"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45378"
FT                   /db_xref="GOA:Q0ICV7"
FT                   /db_xref="InterPro:IPR006246"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICV7"
FT                   /protein_id="ABI45378.1"
FT                   /translation="MKTPLTEAVAAADSQGRFLSNTEVQAASGRFNRAKASLDAAKGLT
FT                   AKADALVSSATQAVYTKFPYTTQMEGPNYSATSEGKAKCSRDIGYYLRMITYCLVAGGT
FT                   GPMDDYLIAGLDEINRTFELSPSWYVEALKHIQSNHGLSGDAATEANSYINYAINALT"
FT   gene            complement(481134..481652)
FT                   /gene="cpcB"
FT                   /locus_tag="sync_0489"
FT   CDS_pept        complement(481134..481652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpcB"
FT                   /locus_tag="sync_0489"
FT                   /product="phycocyanin, beta subunit"
FT                   /note="identified by match to protein family HMM PF00502;
FT                   match to protein family HMM TIGR01339"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47294"
FT                   /db_xref="GOA:Q0ICV6"
FT                   /db_xref="InterPro:IPR006247"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICV6"
FT                   /protein_id="ABI47294.1"
FT                   /translation="MFDAFTKVVAQADARGQFISASEIDALAAMVSGSNKRLDAVSRIS
FT                   NNASTIVANAARELFAQQPALISPGGNAYTSRRMAACLRDMEIILRYVTYSAFTGDASV
FT                   LEDRCLNGLRETYLALGTPGTSVATGVNLMKDAALSIVNDSAGISSGDCASLSSEIGTY
FT                   FDRAAASVA"
FT   gene            complement(481841..482614)
FT                   /gene="pebB"
FT                   /locus_tag="sync_0490"
FT   CDS_pept        complement(481841..482614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pebB"
FT                   /locus_tag="sync_0490"
FT                   /product="Phycoerythrobilin:ferredoxin oxidoreductase"
FT                   /EC_number="1.3.7.3"
FT                   /note="identified by match to protein family HMM PF05996"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46568"
FT                   /db_xref="GOA:Q0ICV5"
FT                   /db_xref="InterPro:IPR009249"
FT                   /db_xref="InterPro:IPR022827"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICV5"
FT                   /protein_id="ABI46568.1"
FT                   /translation="MTIQRLKSTDPVSIEGWSWQPFLEDAIKSLGGLNFEPYPVPDRFL
FT                   QREDQTGSKSKPISVTTATWACKTEKFRQVRAACVSAGSAASVLNFVINPNSTYDLPFF
FT                   GGDLVTLPSGHLLALDLQPAIKTDEVHTTHVWDQLIPIFERWRDQLPYGGPIPEEAQPF
FT                   FSPGFLWTRLPLGEEGDDLIQSVVRPAFNEYLELYLQLAASAERVNAERSDFLLQGQRK
FT                   YTDYRAEKDPARGMLTRFHGSEWTEAYIHTVLFDL"
FT   gene            complement(482611..483357)
FT                   /locus_tag="sync_0491"
FT   CDS_pept        complement(482611..483357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0491"
FT                   /product="15,16-dihydrobiliverdin:ferredoxin
FT                   oxidoreductase"
FT                   /EC_number="1.3.7.2"
FT                   /note="identified by match to protein family HMM PF05996"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46433"
FT                   /db_xref="GOA:Q0ICV4"
FT                   /db_xref="InterPro:IPR009249"
FT                   /db_xref="InterPro:IPR023658"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICV4"
FT                   /protein_id="ABI46433.1"
FT                   /translation="MLRLILCKDIYTMFDSFLNELHSDITKRGGSALPLPEGLEECRSL
FT                   KTSSVIKSWLWDVPGFRRWRVTRLDAGDSLQVFNSVAYPDYNYDHPLMGVDLLWFGARQ
FT                   KLVAVLDFQPLIQDKDYLDRYFYGLKDLNQRFPDLNSEETMRSFDPNQYFSSWLLFCRG
FT                   GAEQADVSLPNAFSAFLKAYWELHDNAKSIASTIPPEEVKNLQEKYDIYSAERDPAHGL
FT                   FTSHFGKDWSNRFLHEFLFPASSPNK"
FT   gene            complement(483335..483937)
FT                   /locus_tag="sync_0492"
FT   CDS_pept        complement(483335..483937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0492"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45499"
FT                   /db_xref="GOA:Q0ICV3"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR018536"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICV3"
FT                   /protein_id="ABI45499.1"
FT                   /translation="MTLMDNPPVTMEDFFEASRGLWLNRRVVHHLDSQDDEAADSNLVI
FT                   EPFNASDDAVEKVCKVFGIEAKEANGGARFWWESNLLAEKRNDDYAAIVIDVPKPEHPD
FT                   QGYLLRDVGYVEKKPALSTYEFTPDGVLTIKTRYDTNFGIERCWFVNDQIRMRVSSVQF
FT                   LNGAAMTTYCTEFRCPSKADIEQIASQAKTFAQTNPL"
FT   gene            complement(483934..484206)
FT                   /locus_tag="sync_0493"
FT   CDS_pept        complement(483934..484206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0493"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46113"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICV2"
FT                   /protein_id="ABI46113.1"
FT                   /translation="MVTRSVCCKSQVDMTEQTSQAPSLEELIETITELTAYRERLYDDV
FT                   VGLGKKLRLSQKKIDATIKEHPELTRIDAILTQLKVQRDTQESQT"
FT   gene            complement(484353..484550)
FT                   /locus_tag="sync_0494"
FT   CDS_pept        complement(484353..484550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0494"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47002"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICV1"
FT                   /protein_id="ABI47002.1"
FT                   /translation="MGQTNLEGRGFSIPVKAKPEDSTLERNPLPGLAFSGEALNKPKRK
FT                   LLMGEQVSADHARVRHFDDW"
FT   gene            484551..485105
FT                   /gene="cpaB-1"
FT                   /locus_tag="sync_0495"
FT   CDS_pept        484551..485105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaB-1"
FT                   /locus_tag="sync_0495"
FT                   /product="C-phycoerythrin class I beta chain"
FT                   /note="identified by match to protein family HMM PF00502"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46374"
FT                   /db_xref="GOA:Q0ICV0"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICV0"
FT                   /protein_id="ABI46374.1"
FT                   /translation="MLDAFSRSVVSADAKTAPVGGSDLAGLRSYVRDGNKRLDAVNAIT
FT                   SNASCIVSDAVTGMICENTGLIQAGGNCYPNRRMAACLRDGEIVLRYISYALLAGDASV
FT                   LDDRCLNGLKETYIALGVPTQSAGRAVAIMKASATAHIGETNTPGLGGKRFRKMETTQG
FT                   DCASLVAEAGAYFDRVIGAIS"
FT   gene            485165..485659
FT                   /gene="cpaA-1"
FT                   /locus_tag="sync_0496"
FT   CDS_pept        485165..485659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaA-1"
FT                   /locus_tag="sync_0496"
FT                   /product="C-phycoerythrin class I alpha chain"
FT                   /note="identified by match to protein family HMM PF00502"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45327"
FT                   /db_xref="GOA:Q0ICU9"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICU9"
FT                   /protein_id="ABI45327.1"
FT                   /translation="MKSVVTTVVTAADAAGRFPSQNDLEAVQGNIQRAAARLEAADKLA
FT                   AGLDAVTREAGDACFSKYSYLKQAGEAGDSQVKVDKCYRDLGHYLRLINYCLVVGGTGP
FT                   LDEWGIAGAREVYRSLSLPTGPYVEALTYTRDRACAPRDMSPQALNEFKSYLDYVINAL
FT                   S"
FT   gene            complement(485735..486640)
FT                   /locus_tag="sync_0497"
FT   CDS_pept        complement(485735..486640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0497"
FT                   /product="Bilin biosynthesis protein mpeV"
FT                   /note="identified by match to protein family HMM PF03130"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47613"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICU8"
FT                   /protein_id="ABI47613.1"
FT                   /translation="MTESNPIKNSSDSQRLNKLSEEEALVLSEHLKEQRNSGIPLDSDQ
FT                   KSISRMVAGLGDPRGLLRLRFADSLGSVGQAAVPALCDAMLSSDNVTVRRAAAKTLTLI
FT                   EDPNSLPDLVCAFLNDQDSVVQGSAMGAMAAIGEEAVTPILNLLSNPETSEMQIGLANW
FT                   ALAFIGDRGSRTLKDASSSSNSTIRKAAIAALTSRIDTLNEDENKHLLSNASKDDDSEI
FT                   RAEVATLLGAMEDVDWAKPLLISNLDDPDSWVRKNSALSLIKLNAKEAIAPLEERETQE
FT                   EDKIVANVIKLAIQKLKQID"
FT   gene            486701..487132
FT                   /locus_tag="sync_0498"
FT   CDS_pept        486701..487132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAC90888.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45494"
FT                   /db_xref="InterPro:IPR020325"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICU7"
FT                   /protein_id="ABI45494.1"
FT                   /translation="MFTMQFFVLSHNLQIRSESVPSFTSEELAEGLSLHSEHIKANALK
FT                   HPHWMVLVESDLSVQELAVEVVNSWKKYRNALGHSMNHSLIALGGRKDSATTSSSPLQE
FT                   GYWGVDVVECSDPDVFLESINWDALKSARPEDSVFEYRA"
FT   gene            487619..488947
FT                   /locus_tag="sync_0499"
FT   CDS_pept        487619..488947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0499"
FT                   /product="Bilin biosynthesis protein cpeY"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45513"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICU6"
FT                   /protein_id="ABI45513.1"
FT                   /translation="MHTSARFDNIHPGLTCEHARQLLMKSVNEQESESDFYTAAAHLIN
FT                   CPCEETQKALIEFLQYRDSSCQSVKITKRKIVEVLARLGCIDAIPAIGKCLWSDDIYLV
FT                   ENTVWSLQTLKCQDRVFVDKIIDILEADVANQRIIIQFLASMGISSSVDIIRSFQSNSI
FT                   PGIKGAAISAIAKLTHDCERVPEISSNLLLPNQMDRHSAIQDLIDANAVDQIAEIFSAP
FT                   VSPVFKLRAVRKLYDENLAESVDSCLLSSLDSLLSCDLSSINCVHRYDEVPSCEYLIRD
FT                   LYNTDFSRCYLALEHLSSHSASEIFPLLKNSWIEEANNDYGAHYCFICLFGSIPVWPGE
FT                   FEPWIIDILVSSIFNIRPQFQKSRAASVLSLAKLHPGILDECMEEILATRGSLPWDMRY
FT                   SLIQAMDHYTDLDMASKSKMILEISDDDKDLFVQARARMALGL"
FT   gene            488981..489652
FT                   /locus_tag="sync_0500"
FT   CDS_pept        488981..489652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0500"
FT                   /product="Bilin biosynthesis protein cpeZ"
FT                   /note="identified by match to protein family HMM PF02985"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46258"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICU5"
FT                   /protein_id="ABI46258.1"
FT                   /translation="MLLSPAKIVKSSSCVVSSIISLDDLFLDLSHPNPNIRMDACVLMS
FT                   ENYYDEALPRLLDLLNDPDPVVYRTAVKGLGVFGHRVLPPLLDLFNGTSNCTVKACCIK
FT                   AFVQVAVNFPDNAFPEQAINALKLALEDSNPVVSQSALMTLGYFSKQEHEKGRVIPILI
FT                   QVCNSANIAHVQSAVMSLAEVESTQVDQCFASMINNDSTDVLIKEILESSISRRQSLFG
FT                   D"
FT   gene            complement(489649..490524)
FT                   /locus_tag="sync_0501"
FT   CDS_pept        complement(489649..490524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0501"
FT                   /product="Bilin biosynthesis protein mpeU"
FT                   /note="identified by match to protein family HMM PF03130"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45797"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICU4"
FT                   /protein_id="ABI45797.1"
FT                   /translation="MKSETLTQEEALELATALKQQLSHGELPNSDLESINKMVAGLGDN
FT                   RGELRLTFAKSLGSVGEEAIPILCEALKNSQNVIIRRASAKTLNIIGSKKALPNLIEAF
FT                   ETDEDPVVQGSSAGAMATIGEPSIEPLLKILTESKCTAFQIGLINLALGFIGSRTPTAL
FT                   HSATNSTNPEIRIAALSALAEQAQKCENAEVRLLVLNALKDPDSEVRAEAATIVGKSMD
FT                   QEEAAHQLHELLRDNNAQVRKNTALSLMKMESVISIDSIENAIHKETDEQVKGVLIVAR
FT                   NQLINRRDTI"
FT   gene            complement(490716..491444)
FT                   /gene="mpeC"
FT                   /locus_tag="sync_0502"
FT   CDS_pept        complement(490716..491444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpeC"
FT                   /locus_tag="sync_0502"
FT                   /product="Phycoerythrin class II gamma chain, linker
FT                   polypeptide"
FT                   /note="identified by match to protein family HMM PF00427"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47888"
FT                   /db_xref="GOA:Q0ICU3"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR016470"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICU3"
FT                   /protein_id="ABI47888.1"
FT                   /translation="MGIGIGPRLLSECPFAVTFDQYSPASSAALERVIVAAYRQVLGNL
FT                   PPTDNQRETSLEVRLMNGEITVRDFVNGLAKSDFYKDNFFHAVGAQRGIELNFKHLLGR
FT                   APLNQQEVQNHIKLQAEEGFDALIDTLTDSAEYTEVFGADIVPYDRTKDSYAGMYTRSF
FT                   NMMRDLGGMKVAISDNAQGRQSKTVNGLASALRESTKPQPFSYVSVSKIAVKLPQQQYT
FT                   GHNPPAMSDYVPFRPFGIFF"
FT   gene            491491..491625
FT                   /locus_tag="sync_0503"
FT   CDS_pept        491491..491625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0503"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45195"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICU2"
FT                   /protein_id="ABI45195.1"
FT                   /translation="MRGTVFLPALLFVEKAAGPVLVAEVRAFRLVSAPSMMKMGGVVV"
FT   gene            complement(491835..492332)
FT                   /gene="cpaA-2"
FT                   /locus_tag="sync_0504"
FT   CDS_pept        complement(491835..492332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaA-2"
FT                   /locus_tag="sync_0504"
FT                   /product="C-phycoerythrin class II alpha chain"
FT                   /note="identified by match to protein family HMM PF00502"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45816"
FT                   /db_xref="GOA:Q0ICU1"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICU1"
FT                   /protein_id="ABI45816.1"
FT                   /translation="MKSVITTVVGAADSASRFPSASDMESVQGSIQRAAARLEAAEKLS
FT                   ANYDAIAQRAVDAVYAQYPNGATGRQPRQCATEGKEKCKRDFVHYLRLINYCLVTGGTG
FT                   PLDELAINGQKEVYKALSIDAGTYVAGFSNMRNDGCSPRDMSAQALTAYNTLLDYVINS
FT                   LG"
FT   gene            complement(492376..492963)
FT                   /gene="cpaB-2"
FT                   /locus_tag="sync_0505"
FT   CDS_pept        complement(492376..492963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaB-2"
FT                   /locus_tag="sync_0505"
FT                   /product="C-phycoerythrin class II beta chain"
FT                   /note="identified by match to protein family HMM PF00502"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45939"
FT                   /db_xref="GOA:Q0ICU0"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICU0"
FT                   /protein_id="ABI45939.1"
FT                   /translation="MSFWRIRIPPKNSSQLLMLDAFSRKAVSADSSGAFIGGGELASLK
FT                   SFIADGNKRLDAVNALSSNAACIVSDAVAGICCENTGLTAPNGGVYTNRKMAACLRDGE
FT                   IVLRYVSYALLAGDASVLQDRCLNGLRETYAALGVPTGSAARAVAIMKAASAALITNTN
FT                   SQPKKAAVTQGDCASLAGEAGSYFDAVISAIS"
FT   gene            complement(493107..494303)
FT                   /locus_tag="sync_0506"
FT   CDS_pept        complement(493107..494303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0506"
FT                   /product="CpeY protein"
FT                   /note="identified by similarity to GB:CAA28262.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46546"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICT9"
FT                   /protein_id="ABI46546.1"
FT                   /translation="MAERFDVLFEGLSEESSLKILLSDPRDLPNPVDKYMAATRLAACS
FT                   SEESLQGLISAVDLDPEDLFNRITRRKAIEALGRRKNARALDCLFKALHFDDEPSVINA
FT                   ADSITQISAPLTESQCDSLLKALKGNDPQKRAVIQAHTRLGLKSGTSFIQTLIHDENPL
FT                   ISGAARAFCARVEGDLDQLQPLIPQLHDLQAGRRRSAVIDLGDSGDINMLQYLIKSAVS
FT                   MPLRAKSAFQLVDPRKKAGVPEEHNKTITTLLQDDPRSLSMREEWLSQADPIEIEKNLQ
FT                   HRDEGKQYGAALSLLKMPKNQQIEIIDGIHSRLWSDYGANYLLTSLIGLASINERKELI
FT                   KTSLAETLPQYAKSRVAAAWGCLKLDLIDQLDLLKEISTSSQWVPLKWSCSQVLKKFS"
FT   gene            494479..494799
FT                   /locus_tag="sync_0507"
FT   CDS_pept        494479..494799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46360"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICT8"
FT                   /protein_id="ABI46360.1"
FT                   /translation="MTVSIEAEKALPRFVQLISQNIDLQDRLNSVTDINSLRSLIQSVE
FT                   PLLTGAALIPLEQATRPPKILVDSGHTSQKIPWRLLRCTGGPLVLQLICMNSNFAIWIE
FT                   SC"
FT   gene            494793..495101
FT                   /locus_tag="sync_0508"
FT   CDS_pept        494793..495101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0508"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47897"
FT                   /db_xref="InterPro:IPR012903"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICT7"
FT                   /protein_id="ABI47897.1"
FT                   /translation="MLNSSSSEIIQQFIHSVVQSHEIATGLKKLTSHEQIVDYASSKGF
FT                   SFTKAEWDEFVRLDSESLSSQAKQASHFHETNHWSWAFRQVSSWRAMLMEGADQGSS"
FT   gene            complement(495665..496291)
FT                   /locus_tag="sync_0509"
FT   CDS_pept        complement(495665..496291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAB52704.1; match to
FT                   protein family HMM PF06206"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47049"
FT                   /db_xref="GOA:Q0ICT6"
FT                   /db_xref="InterPro:IPR010404"
FT                   /db_xref="InterPro:IPR038672"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICT6"
FT                   /protein_id="ABI47049.1"
FT                   /translation="MESILKFAQTISGIYDNFAQSQENPKDFARINIIFRPLPWKIFNG
FT                   PGFYSEQHYDYAPWSPYRQGIHRLINHRELSNTFIMENFGCANPMRIAGAGRTPELLDS
FT                   LKKENLKKRCGCAMHFETKADRKYIGSVEPGKKCMIPRDGQLTYLVSEVEVTQDSWTSR
FT                   DRGYDPDTNKQIWGSEHGQLIFKKVEDIGEIITNDWINKQFNHER"
FT   gene            complement(496306..496845)
FT                   /locus_tag="sync_0510"
FT   CDS_pept        complement(496306..496845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0510"
FT                   /product="phycoerythrin linker protein CpeS"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45963"
FT                   /db_xref="GOA:Q0ICT5"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR018536"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICT5"
FT                   /protein_id="ABI45963.1"
FT                   /translation="MNIEQFVAQTEGEWRSMRSAHSLAFQQFEDVLSEISVERIDKSDS
FT                   DLQAILKQEGDLSVSDIESPFLMKWAAESDWEPDDPNDVASGQCIIVPIPNNQQSGVLL
FT                   RSVGYAESIAAKSEYNFLDDGTFVLKTRYDQSIAEERIWFVSENVRCRSSVLKTSEGSG
FT                   ILQTSFSSEVRRLVKS"
FT   gene            complement(497117..497851)
FT                   /gene="cpeD-1"
FT                   /locus_tag="sync_0511"
FT   CDS_pept        complement(497117..497851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpeD-1"
FT                   /locus_tag="sync_0511"
FT                   /product="possible phycobilisome linker polypeptide"
FT                   /note="identified by match to protein family HMM PF00427"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47671"
FT                   /db_xref="GOA:Q0ICT4"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR008213"
FT                   /db_xref="InterPro:IPR016470"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICT4"
FT                   /protein_id="ABI47671.1"
FT                   /translation="MSQPLTLATKANIDLDHSNDVIKRIYRQVFGNRHLMELDINQSLE
FT                   ALFINGDLTVQGFVTALAQSDTYKKLFLETNSPYKFVELNFKHLLGRAPHDQSEIMEHV
FT                   KLLSEEGYENEIASYTYSEEYLTAFGIDQVPYSRGSNTMQGGSTINYTRTNASEVGYAG
FT                   YDGAQKSSRLLQSLTTGSIPDISQRKGVGNGGALTISWTSRKQIGANRRVGQKSVVSQA
FT                   SMSSTIKSILAQGGKILSITKA"
FT   gene            complement(497929..499437)
FT                   /locus_tag="sync_0512"
FT   CDS_pept        complement(497929..499437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0512"
FT                   /product="phycobilisome linker polypeptide"
FT                   /note="identified by similarity to SP:P11398; match to
FT                   protein family HMM PF00427; match to protein family HMM
FT                   PF01383"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45417"
FT                   /db_xref="GOA:Q0ICT3"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR008213"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICT3"
FT                   /protein_id="ABI45417.1"
FT                   /translation="MAIGVGPRSHADCPHRVTSECYSPDDNSSLDDVIAAAYRQVFGNA
FT                   HVMDFERSKELEAQLRNGELTVRDFVRGLAKSSFYKQRFFTAVGPQRGIDLNIKHLLGR
FT                   APHSQAEISAKISLQAEHGQEAVIDSIVDSAEYLEVFGSDVVPYARAWSSPADLATSAF
FT                   PLLAAIQKSFAGSDSARGGSSNLISSYASGHAPRINVPSESIGVKPTPSYAAGRFASRA
FT                   PGVTSGKDGAPMRGDSYVFFGLGQREQETFQRCPGDSNDQLNALIRASYKQVMGNPHLM
FT                   EFERAISAESKYVDGYLSTREFVRALGLSAEYKRRFFETNAPYRFIELNFKHFLGRAPK
FT                   SQAEISEHTKILAESGYEAEICSYVDSVEYQTIFGEDTVPFARILSENGRSQIAFNRHL
FT                   KLAEGYAASDTVQTGSSLVTSVATDTVPGGWSSTTTRINRTGTQSGAADPTKKRFRIVV
FT                   SAQAARSRQRTAGNTYLVSGKDMSSQMKYIHSRGGKILSITEVM"
FT   gene            complement(499633..500517)
FT                   /gene="cpeC"
FT                   /locus_tag="sync_0513"
FT   CDS_pept        complement(499633..500517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpeC"
FT                   /locus_tag="sync_0513"
FT                   /product="phycobilisome linker polypeptide"
FT                   /note="identified by match to protein family HMM PF00427;
FT                   match to protein family HMM PF01383"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45980"
FT                   /db_xref="GOA:Q0ICT2"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR008213"
FT                   /db_xref="InterPro:IPR016470"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICT2"
FT                   /protein_id="ABI45980.1"
FT                   /translation="MPFGPASLLGVERFSAESEAPLELLPGDDDTQKEALIRAIYKQVL
FT                   GNAYVMESERQLIAESQFKLGEISVRELIRRIAKSDLYRSRFFESCPRYRYIELAFRHF
FT                   LGRAPVDFDEMRAHAERLDSLGFEADIDSYLDSDDYQNSYGEWIVPYQRGWKTESCKTL
FT                   QEFTWSFQLLRGNSSSSLKGDLSGITAKLGGAAYQNLPLAVVPPSSKEATGWSFRRAKN
FT                   LQDAPTRLGVGAGQEGTTYRVEVTGYRANNVRRISRYTKSNRVFYIPFDKLSEQFIRIH
FT                   REGGKISSITPVT"
FT   gene            complement(500678..501367)
FT                   /locus_tag="sync_0514"
FT   CDS_pept        complement(500678..501367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0514"
FT                   /product="pentapeptide repeat family protein"
FT                   /note="identified by match to protein family HMM PF00805"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47767"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICT1"
FT                   /protein_id="ABI47767.1"
FT                   /translation="MNFDINNWRPPELASPENITHYPVDARGADWQNKDIGNLDLREAN
FT                   LCRADLRGANLSGCQIENVDMRLAKYDNKTQLPEGFNIRTSGAIGPGAQLNGAFLNNAD
FT                   LRGIDLRKGSLMGAYLSGADLSGALLDNISMAGADLRNAILRGAMCRRTRFGTSELNMA
FT                   DLRGADLTEASLETVESIKGSDFSMCKGMKPNIQLLLERPAIELDHWNPLTRSSARSSL
FT                   ESLLLEA"
FT   gene            complement(501372..502130)
FT                   /locus_tag="sync_0515"
FT   CDS_pept        complement(501372..502130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0515"
FT                   /product="possible phycobilisome rod-core linker
FT                   polypeptide (L-RC 28.5)"
FT                   /note="identified by match to protein family HMM PF00427"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47163"
FT                   /db_xref="GOA:Q0ICT0"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICT0"
FT                   /protein_id="ABI47163.1"
FT                   /translation="MAIPVRNYSLKSQNSRVNNLAGNNDSIKYQVTGETSASSIAARRD
FT                   VDSLIEQTYKQIFFHAMSCDRDIYLESQLRSGYITMRDFIRGLLLSERFQQGYYQCSSN
FT                   YRMVEQVVGRVLGRSVSGEGERLAWSIVIAEKGFANFVDQILESDEYMSNFGYDGTPAQ
FT                   RGRLIPGRPSGDMPIYQRFPRYGEEWRNSLISREVVNKTFTTGGVKSEMNSIVGKPPAW
FT                   LIKSWLVLFAIGGFEISRVIITIGISMVRN"
FT   gene            complement(502383..503213)
FT                   /locus_tag="sync_0516"
FT   CDS_pept        complement(502383..503213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0516"
FT                   /product="Possible phycobilisome linker polypeptide"
FT                   /note="identified by match to protein family HMM PF00427"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46867"
FT                   /db_xref="GOA:Q0ICS9"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR016470"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICS9"
FT                   /protein_id="ABI46867.1"
FT                   /translation="MVAIKPTRDFTNNTRTSFTATNKKAKEAAALTVERFKENQCKSMG
FT                   IGIGPRHHGECPFGVTAEEYSATGNSALETAISSAYKQVMGNANPTDSQRCKELESQLR
FT                   DGRITTRDFVAGLAKSEFYRQNYYHKVSPIRGVEHNFKHLLGRPPINQSEISACISLIA
FT                   DQGYDVFINRMTSSGEYLEVFGTDTVPYDRAWKSEAGFYCSTFVNMCSVSTGNASSDKI
FT                   VGGRSQLVMTLANARELSTSTGNFDVSGFSYSKAVRDPSSGAFQRMFTPQTTKR"
FT   gene            complement(503415..503933)
FT                   /locus_tag="sync_0517"
FT   CDS_pept        complement(503415..503933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0517"
FT                   /product="possible Phycobilisome polypeptide"
FT                   /note="identified by match to protein family HMM PF00502"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46014"
FT                   /db_xref="GOA:Q0ICS8"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICS8"
FT                   /protein_id="ABI46014.1"
FT                   /translation="MHKSSLILEKNQKILDLANREKRLLSTIELNSLCEQSRCDSIKLE
FT                   ELQHRLPELINNAKETLIRKIPNITEPGGSLYPKERAEACWRDCFHFARISIYGTAAGY
FT                   TNITDKEGVKAIQELYKILEVPIDALIICLKELQENCKKVYSERKEKKDLKLLDGCFNH
FT                   LVEKIECIK"
FT   gene            complement(503983..504435)
FT                   /locus_tag="sync_0518"
FT   CDS_pept        complement(503983..504435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0518"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45316"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICS7"
FT                   /protein_id="ABI45316.1"
FT                   /translation="MESTVEQTLSNLLKNSSEEKEVHYNIGNEILRLNLKPEDIMLWRE
FT                   TLKNISNPGNVLLACESNQVDLSTTKLTWIVGAAIRSTKIGKTSEIANLLKSLDIPNDI
FT                   AEAVCKYCPGLGSEVTWAFYLERHGWLTASPIIDIKQLGNWQKDGK"
FT   gene            505038..505466
FT                   /locus_tag="sync_0519"
FT   CDS_pept        505038..505466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0519"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47354"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICS6"
FT                   /protein_id="ABI47354.1"
FT                   /translation="MANSSHDTIPQLSGQLHMISEIAESLTLRLLALEERHNELASRLE
FT                   SVEPDQDENSDSFLLLADSSDRLVQLRGLLSEQVEEDAHVENPRLGVVIDSHDDSENYE
FT                   DEPENFDLEQTEYVNDSQEPPLETLDLDLDQSDELLSA"
FT   gene            complement(505458..505784)
FT                   /locus_tag="sync_0520"
FT   CDS_pept        complement(505458..505784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45197"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICS5"
FT                   /protein_id="ABI45197.1"
FT                   /translation="MLRVANCRKASRSNLDSEIYIQNPMIRVPIDDDRTFNNPDGFAMV
FT                   FDRTWKQSANAEEFAELSIDQRIDTVIKKMDDHPFLKTEPEQARQIAIFRVRLLNLDGS
FT                   NQSG"
FT   gene            complement(507171..507710)
FT                   /locus_tag="sync_0521"
FT   CDS_pept        complement(507171..507710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0521"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46495"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICS4"
FT                   /protein_id="ABI46495.1"
FT                   /translation="MHSKLNKELESRSIQLAALAEMQPDDRIARITWDRIQDDLEQSDS
FT                   MVYGMRFCIANITTFIKTSFKENEHTIAAQKSCHQLIIRLGWGKEEVLSKEQSSKVFID
FT                   YIKDVVSMYNDIKQKHCENAQCILAMNMNSMLLQDLEYLMKQSPQRQRSLTPALETTAQ
FT                   LRAQMVQVFGWDSLEA"
FT   gene            complement(507721..507894)
FT                   /locus_tag="sync_0522"
FT   CDS_pept        complement(507721..507894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0522"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45672"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICS3"
FT                   /protein_id="ABI45672.1"
FT                   /translation="MGHIKPSTLKGNSSVKNLMQDWIGTETKQSDNSPPAQTLHTQSKS
FT                   AYPHEKYQQLFL"
FT   gene            complement(508104..508289)
FT                   /locus_tag="sync_0523"
FT   CDS_pept        complement(508104..508289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0523"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47735"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICS2"
FT                   /protein_id="ABI47735.1"
FT                   /translation="MLPPILRPIEQLIKFLGRHFFVKTAKGSLDGALNDDLLLVCHEAN
FT                   AEAAILPKRLHRLIPD"
FT   gene            complement(508476..508548)
FT                   /locus_tag="sync_0524"
FT   tRNA            complement(508476..508548)
FT                   /locus_tag="sync_0524"
FT                   /product="tRNA-Phe"
FT   gene            complement(508579..509208)
FT                   /locus_tag="sync_0525"
FT   CDS_pept        complement(508579..509208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE21848.1; match to
FT                   protein family HMM TIGR00201"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45884"
FT                   /db_xref="GOA:Q0ICS1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICS1"
FT                   /protein_id="ABI45884.1"
FT                   /translation="MLTALQDCLQDLFVVPSCPICKKVIQSHQQADHPCNECTQKLGLM
FT                   KLGLRGITPVRFNAAGWYRGELRSEILRLRRNQDLSGLKAITFALQRILPANALLVPIP
FT                   SWKADKRSNPLPRLICRSLERTTKTLLERCRPTVGQHHLSRSQRLVNMQSAFAIHPDQR
FT                   SRCISATPTWIVDDILTSGATAQEAIKTLKNAGWEVRGLICLGRTP"
FT   gene            complement(509228..509515)
FT                   /locus_tag="sync_0526"
FT   CDS_pept        complement(509228..509515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE08505.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46387"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICS0"
FT                   /protein_id="ABI46387.1"
FT                   /translation="MTADPLTPAVSERICRHMNDDHGDAVLQFALHYGGVSAANIATMT
FT                   AVNADAMSLEVDGKPLRIPFDHTLTDSEDAHRTMVAMLRAMPSDGSKGES"
FT   gene            complement(509549..509662)
FT                   /locus_tag="sync_0527"
FT   CDS_pept        complement(509549..509662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0527"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45577"
FT                   /db_xref="GOA:Q0ICR9"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICR9"
FT                   /protein_id="ABI45577.1"
FT                   /translation="MPNRLRDGLALGLFIVLAGYVGFSGFRLAILLWQRFS"
FT   gene            complement(509681..510958)
FT                   /locus_tag="sync_0528"
FT   CDS_pept        complement(509681..510958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0528"
FT                   /product="Carbohydrate kinase, FGGY family protein"
FT                   /note="identified by match to protein family HMM PF00370"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45208"
FT                   /db_xref="GOA:Q0ICR8"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICR8"
FT                   /protein_id="ABI45208.1"
FT                   /translation="MSQDPLVLGIDLGTSGVRIAVIDSNFALLQTESSPYQIGLINPFD
FT                   WRERCCTLIGRLKPDYRHRLKAIAVDGTSGTLLACDQQGLPLADALPYSFSCSTFADQL
FT                   EKLSPQGGPASSTSGSLARALHLFDQHKTKAPLLLRHQADWISGWLLDNWSYGEEGNNL
FT                   RLGWNLSKRAWPDSFISQPWWDALPEIRASGSVLGPLSSQRAKDLDLPEDLLVVAGTTD
FT                   SNAAVLTADAEDDEGITVLGSTLVLKRFTDQPLAPWAGTSNHRVGGRWLCGGASNAGAA
FT                   VLKQLFPDIDLAELSRQIDPDQNSGLQLRPLPRCGERFPVDDPQLKPILTPRPVSDSLY
FT                   LHGLLEGLTQIEHAGWQRLTSLGADPPRKIVTLGGGARNPQWRRLRERQLGVPIRSCNT
FT                   PPAAGVARLALQAVKAPDKTHHLREN"
FT   gene            complement(510969..512228)
FT                   /gene="metK"
FT                   /locus_tag="sync_0529"
FT   CDS_pept        complement(510969..512228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="sync_0529"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="identified by match to protein family HMM PF00438;
FT                   match to protein family HMM PF02772; match to protein
FT                   family HMM PF02773; match to protein family HMM TIGR01034"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47314"
FT                   /db_xref="GOA:Q0ICR7"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICR7"
FT                   /protein_id="ABI47314.1"
FT                   /translation="MSRYVFTSESVTEGHPDKICDQVSDAVLDALLAQDSTSRVACETV
FT                   VNTGLCMITGEVTSKAQVDFIHLVRDVIRDIGYSGARAGGFDATSCAVLVALDQQSPDI
FT                   AQGVDEADDHAGDPLDKVGAGDQGIMFGYACNETPELMPLPISLAHRLARRLAEVRHNG
FT                   TLDYLLPDGKTQVSVVYENDKPVEIDTILISTQHTAEVTGLTDEQEVRNRISEDLWTHV
FT                   VLPATADLPLKPDRANCRYLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAF
FT                   SGKDPTKVDRSAAYAARYVAKALVAAGLANRAEVQLSYAIGVAKPVSILVESFGSGKVS
FT                   NAELTDLVQEHFDLRPGAIIEQFKLREMPSLNGGRFYRDTAAYGHFGRPDLNLPWEDVG
FT                   DKAASLKQAEANRIQSGSSL"
FT   gene            complement(512266..513057)
FT                   /gene="gph"
FT                   /locus_tag="sync_0530"
FT   CDS_pept        complement(512266..513057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gph"
FT                   /locus_tag="sync_0530"
FT                   /product="Haloacid dehalogenase/epoxide hydrolase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46880"
FT                   /db_xref="GOA:Q0ICR6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICR6"
FT                   /protein_id="ABI46880.1"
FT                   /translation="MAHLSLRGHSLGLIHGVLFDKDGTLSHSEPHLIELADARIEEIIR
FT                   VFASRGASTDVQSQLEGLLKRAMGRCDSGLIPDGPLAVASRQHNLLSTATLFCLFDLSW
FT                   PQALVLAEEIFDSVDRLHKHNATKESLSARNPLPHSRELLNELHSAGVICAVISNDTQH
FT                   GIEQFLQDHGLSDFITGIWSADDTPCKPDPGAVHGLCRQLHLDPSQCALIGDADSDLLM
FT                   ARRAGIGYALGYVAGWHRPPDLTSHQYLIHHWQELRVEQAL"
FT   gene            complement(513071..513988)
FT                   /gene="rpsA"
FT                   /locus_tag="sync_0531"
FT   CDS_pept        complement(513071..513988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="sync_0531"
FT                   /product="ribosomal protein S1"
FT                   /note="identified by similarity to SP:P46228; match to
FT                   protein family HMM PF00575"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47704"
FT                   /db_xref="GOA:Q0ICR5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICR5"
FT                   /protein_id="ABI47704.1"
FT                   /translation="MDGAGFTIDDFASLLSKYDYNFKPGDIVNGTVFALETKGAMIDIG
FT                   AKTAAFMPLQEVSINRVEGLSDVLQPGEIREFFIMSEENEDGQLSLSVRRIEYQRAWER
FT                   VRQLQKEDATIYSEVFATNRGGALVRVEGLRGFIPGSHISTRKPKEELVADFLPLKFLE
FT                   VDEERNRLVLSHRRALVERKMNRLEVGEVVIGTVRGIKPYGAFIDIGGVSGLLHISEIS
FT                   HEHIETPHSVLNVNDQMKVMIIDLDAERGRISLSTKALEPEPGDMLTDPQKVFDKAEEM
FT                   AARYKQMLLEQAEEGEEPLSSMMV"
FT   gene            complement(514273..514749)
FT                   /gene="nrdR"
FT                   /locus_tag="sync_0532"
FT   CDS_pept        complement(514273..514749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdR"
FT                   /locus_tag="sync_0532"
FT                   /product="transcriptional regulator, NrdR family protein"
FT                   /note="identified by match to protein family HMM PF03477;
FT                   match to protein family HMM TIGR00244"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47722"
FT                   /db_xref="GOA:Q0ICR4"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICR4"
FT                   /protein_id="ABI47722.1"
FT                   /translation="MQCPSCQNTDSRVLESRAAEGGRSVRRRRECLNCEFRFTTYERVE
FT                   MVPITVIKRNGHREIFNRSKLLHGLSRACEKTGLTPSKLEEIVDNLELSLQQSSSREIT
FT                   SSEIGELVLSHLKGLSEVAYVRFASVYRHFRSVSDFVSTLEGMNADKAELAALV"
FT   gene            complement(514885..514980)
FT                   /locus_tag="sync_0533"
FT   CDS_pept        complement(514885..514980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0533"
FT                   /product="Photosystem II reaction centre T protein
FT                   superfamily protein"
FT                   /note="identified by match to protein family HMM PF01405"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46886"
FT                   /db_xref="GOA:Q0ICR3"
FT                   /db_xref="InterPro:IPR001743"
FT                   /db_xref="InterPro:IPR037268"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICR3"
FT                   /protein_id="ABI46886.1"
FT                   /translation="MESFAYILILGLAIATLFFAIAFRDPPKIGK"
FT   gene            complement(515002..516564)
FT                   /gene="psbB"
FT                   /locus_tag="sync_0534"
FT   CDS_pept        complement(515002..516564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbB"
FT                   /locus_tag="sync_0534"
FT                   /product="photosystem II P680 chlorophyll A apoprotein"
FT                   /note="identified by match to protein family HMM PF00421;
FT                   match to protein family HMM TIGR03039"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45633"
FT                   /db_xref="GOA:Q0ICR2"
FT                   /db_xref="InterPro:IPR000932"
FT                   /db_xref="InterPro:IPR017486"
FT                   /db_xref="InterPro:IPR036001"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICR2"
FT                   /protein_id="ABI45633.1"
FT                   /translation="MGLPWYRVHTVVINDPGRLLAVHLMHTALVAGWAGSMALYELAIF
FT                   DPSDPVLNPMWRQGMFVMPFMSRLGVTGSWGGWSITGETGVDPGFWSFEGVAAAHIVFS
FT                   GLLMLAAIWHWTYWDLEIWQDPRTGEPALDLPKIFGIHLLLAGLGCFGFGAFHLTGVFG
FT                   PGMWISDPYSLTGHLEAVQPSWGPEGFNPFNPGGIVAHHIAAGIVGIIAGIFHITTRPP
FT                   ERLYKALRMGNIETVLASAIAAVFFAAFIVAGTMWYGAAATPVELFGPTRYQWDQSYFK
FT                   TEINRRVQTALDEGASIDEAYAAIPEKLAFYDYVGNSPAKGGLFRVGPMVNGDGLATGW
FT                   IGHPVFTDKEGRELQVRRLPNFFENFPVVLEDNDGIVRADIPFRRAEAKYSFEQKGVTA
FT                   TVYGGSLDGKVFTDPADVKRLARKAQLGEGFEFDRETYNSDGTFRSSPRGWFTFGHATF
FT                   ALLFFFGHIWHGARTLYRDVFAGIDPDLGEQVEFGLFQKLGDKSTRRLPEGYVPPTGST
FT                   PLS"
FT   gene            516682..517275
FT                   /locus_tag="sync_0535"
FT   CDS_pept        516682..517275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0535"
FT                   /product="possible ferredoxin (2Fe-2S)"
FT                   /note="identified by match to protein family HMM PF00111"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47720"
FT                   /db_xref="GOA:Q0ICR1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICR1"
FT                   /protein_id="ABI47720.1"
FT                   /translation="MICFPRSPVSASVPCLPHSGLAEGVTKRNLWAQSGRLLLGHSMPV
FT                   IRFLREGRDVECYPGENLRDVALRENIELYGLKGQLGNCGGCGQCITCFVDVVGSDADA
FT                   PLTARTVVEDNKLRRRPESWRLACQALVEQSVIVLTRPQVRLAELDKKKAAARSEALPA
FT                   GPTAWPFVEGAEDAEEGSKQETDSASAATPSDEG"
FT   gene            517336..517446
FT                   /gene="psbM"
FT                   /locus_tag="sync_0536"
FT   CDS_pept        517336..517446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbM"
FT                   /locus_tag="sync_0536"
FT                   /product="photosystem II reaction center protein PsbM"
FT                   /note="identified by match to protein family HMM PF05151;
FT                   match to protein family HMM TIGR03038"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47346"
FT                   /db_xref="GOA:Q0ICR0"
FT                   /db_xref="InterPro:IPR007826"
FT                   /db_xref="InterPro:IPR037269"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICR0"
FT                   /protein_id="ABI47346.1"
FT                   /translation="METNDLGFVASLMFVLVPTVFLIVLFIQTNSREGSS"
FT   gene            complement(517475..518323)
FT                   /locus_tag="sync_0537"
FT   CDS_pept        complement(517475..518323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0537"
FT                   /product="universal stress protein family protein"
FT                   /note="identified by match to protein family HMM PF00582"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45058"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICQ9"
FT                   /protein_id="ABI45058.1"
FT                   /translation="MFKNLLIADSGKGHVGEMVRMLRDLPGFRTARINLLHVVSEQGKV
FT                   NAEDHWTTAGSLLAKAVSQLGLDPNEVNSIIRQGDAKQTVLKVAEEINADLIVMGSRGL
FT                   GRLQSILSNSTSQYVFQLSTRPMLLVRDDLYVRHVNRLMVTIDGTGVGDDALRIACEMV
FT                   RDIPGGQLTGVHIARQDLSASRGGDNKADGLLAAAVQRARSLGVELKPMHMANPDIGRG
FT                   VCQAAEEIGADLVVIASQDRRPLVARGLVDLDKLLGGSISDYIRVHAPAPVLLVREPEK
FT                   N"
FT   gene            518376..518825
FT                   /locus_tag="sync_0538"
FT   CDS_pept        518376..518825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0538"
FT                   /product="Predicted thioesterase"
FT                   /note="identified by match to protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47053"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICQ8"
FT                   /protein_id="ABI47053.1"
FT                   /translation="MVTESVTRLPWQLHKRVLPQHTDHGGVMWHGAYVGWLEEARVEAL
FT                   AAVGLPYRVMALEGLEMPVVRLEMSYKRALLHGDQVVLESHALPPEGPRWRWRTRLLVA
FT                   DGDCAFEADVELVLVRLDGGRRQVLRRPPPSVATALQRLTQGPDR"
FT   gene            518855..519961
FT                   /locus_tag="sync_0539"
FT   CDS_pept        518855..519961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0539"
FT                   /product="putative DNA protecting protein DprA"
FT                   /note="identified by match to protein family HMM PF02481"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45303"
FT                   /db_xref="GOA:Q0ICQ7"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICQ7"
FT                   /protein_id="ABI45303.1"
FT                   /translation="MLGERGWWWLWISCPGLGVARIRALRAVANAHQVTLADLWSWPLV
FT                   RLQGALRWPDSLMARVESYRLSKGALPSLLVPDNALFPLDLDWPIAFDSLQRPPLAVHW
FT                   SGQKACWPFLSAQKAVAVVGTRRPSDHGCRMAHALGQCLARAGWPVVSGLAEGIDAASH
FT                   HGCLAASGLPVGVLGTPLDRVYPPEHEALQAQVESAGLLLSEWPRGARVQRSNFALRNR
FT                   LLVSVSCALVVVECPETSGSLLSAQIAHTQDCPVWVVPGDALRWSCKGSNGLLQEGATP
FT                   LLSPESLIAALGPGPLAAARTASMTLDRSRFSVDRNHSLLRGVDQGLTLEQLSAALSCS
FT                   PTQLAHELLQLELAGVIEPKPGLRWRSV"
FT   gene            519971..520891
FT                   /locus_tag="sync_0540"
FT   CDS_pept        519971..520891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0540"
FT                   /product="methyltransferase, HemK family protein"
FT                   /note="identified by match to protein family HMM PF05175;
FT                   match to protein family HMM TIGR00536"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45391"
FT                   /db_xref="GOA:Q0ICQ6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICQ6"
FT                   /protein_id="ABI45391.1"
FT                   /translation="MGVIRCKGTDLLVWRRELIRQGGRPVDLDWLLSIAADCSWSDLQK
FT                   LRICPDVEIELSSSLHHLTDLWAQHRDHHIPLQHLVGICPWRDLELEVSSDALIPRQET
FT                   ELLIELALQCLPEDARDVEGIWADLGTGSGALAAALARVFPSWQGHAVDSSGSALALAE
FT                   RNLIALAGKSDWQLHLGSWWEPLKPWWGQIDLVLSNPPYIPTAVMDELAPVVKDHEPHL
FT                   ALCGGEDGLDCCRQIIRDASRALAPGGWILLEHHHDQSAMVLKLLSDAGLERPEARYDL
FT                   QGIPRFALAQRSCEPIAYDQQRDER"
FT   gene            520888..521505
FT                   /locus_tag="sync_0541"
FT   CDS_pept        520888..521505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0541"
FT                   /product="yrdC domain, putative"
FT                   /note="identified by match to protein family HMM PF01300"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46566"
FT                   /db_xref="GOA:Q0ICQ5"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICQ5"
FT                   /protein_id="ABI46566.1"
FT                   /translation="MTINPLNLFDRDRTEAHLRAGGAALLPTDTLPALASMPEQAAQIW
FT                   RLKKRPQDKPLILMGADVDALLCHVSPVARADASALAQRHWPGALTLVLPAFGPCAETL
FT                   NPGCATLGLRIPACKPMLDLLRCSGPLATTSANLSGEPASRTETEAAGAFPDLPLLAPI
FT                   PWPAPSCQASSVIAWRGPQDWHCLRRGAVMPVGVVSLPECSG"
FT   gene            complement(521701..521775)
FT                   /locus_tag="sync_0542"
FT   tRNA            complement(521701..521775)
FT                   /locus_tag="sync_0542"
FT                   /product="tRNA-Thr"
FT   gene            complement(521766..522035)
FT                   /locus_tag="sync_0543"
FT   CDS_pept        complement(521766..522035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0543"
FT                   /product="possible transcriptional regulator, luxR family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45557"
FT                   /db_xref="GOA:Q0ICQ4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICQ4"
FT                   /protein_id="ABI45557.1"
FT                   /translation="MVLEASPDLMAEQGFTPAETAVVQLLLEGLSNRAIASRLVVSIRT
FT                   VESHISNALDKSGCRSRLELSMWWLRNHSESTRTRSVKLPTMPA"
FT   gene            complement(522042..522326)
FT                   /gene="minE"
FT                   /locus_tag="sync_0544"
FT   CDS_pept        complement(522042..522326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minE"
FT                   /locus_tag="sync_0544"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /note="identified by match to protein family HMM PF03776;
FT                   match to protein family HMM TIGR01215"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45767"
FT                   /db_xref="GOA:Q0ICQ3"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICQ3"
FT                   /protein_id="ABI45767.1"
FT                   /translation="MTLRDLVDKLLGRQPASASTARDRLQLVLAHDRSDLSPELLDQMR
FT                   REIFEVVAKYVDIDLEEGDVSLETEDRVTALVANLPFRRPITSAPPKSD"
FT   gene            complement(522331..523146)
FT                   /gene="minD"
FT                   /locus_tag="sync_0545"
FT   CDS_pept        complement(522331..523146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minD"
FT                   /locus_tag="sync_0545"
FT                   /product="septum site-determining protein MinD"
FT                   /note="identified by match to protein family HMM TIGR01968"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45875"
FT                   /db_xref="GOA:Q0ICQ2"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICQ2"
FT                   /protein_id="ABI45875.1"
FT                   /translation="MTSNSRTILICSGKGGVGKTTLTANLGIALAQRGSSTVVLDADFG
FT                   LRNLDLLLGLENRIVYTAQEVLAETCRLDQALVKHKQVPNLALLPAGNPRMLEWLKPED
FT                   MQAIASMLEKRFEYVLIDCPAGIEDGFKNAVAAAREAIVITTPEVSAVRDADRVIGLLN
FT                   THGVNPVQLVLNRVRPKMMANQEMLAVDDVTDILALPLLGLVLEDEQVIVSTNRGEPLT
FT                   LNGTKSPAAKAYGNIAGRLQGEDIPLLDPSKERSGLRATVRRLMQTKIF"
FT   gene            complement(523187..523900)
FT                   /gene="minC"
FT                   /locus_tag="sync_0546"
FT   CDS_pept        complement(523187..523900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minC"
FT                   /locus_tag="sync_0546"
FT                   /product="septum site-determining protein MinC"
FT                   /note="identified by match to protein family HMM PF03775;
FT                   match to protein family HMM TIGR01222"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45059"
FT                   /db_xref="GOA:Q0ICQ1"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICQ1"
FT                   /protein_id="ABI45059.1"
FT                   /translation="MITSVALTQGTFQTACHRLVLPTNRHIPWQDTLADQLNGLEGKDL
FT                   ELDSGEWLLNCRVLAAFQAQLEERQCRLLSIKSCNPHTVVSANALGIPAQLMTPQPTDP
FT                   RPESREEQQAPALLIHRATLRSGDHLKARHHVLLIGDVNPGAQISAGGNVLIWGRLRGC
FT                   AHAGVQGDLNARITALQLRPLQLRIADLVARGPEEKPQPGLAEEARIVDGEIAIEPADP
FT                   RSDLTIQELSFDLNN"
FT   gene            complement(523916..525172)
FT                   /locus_tag="sync_0547"
FT   CDS_pept        complement(523916..525172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0547"
FT                   /product="HD domain protein"
FT                   /note="identified by match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47898"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICQ0"
FT                   /protein_id="ABI47898.1"
FT                   /translation="MSSRTYHDPLHGGIALNTDDPAEALVLELVDAAPFQRLRRIRQLG
FT                   PAFLTFHGAESSRFTHSLGVFHIARQAFQSLLAMDPSLELHRGVLYAAALLHDLGHAPL
FT                   SHTGEEMFGTHHEHWSARIVREHPAIQEPLERFQPGSSEAVAALLEHGSTQRRVIKDLV
FT                   SSQLDCDRLDYLLRDSYSTGTSYGQLDLERILAALTLAPDGELAIHPKGLMAVEHYLVV
FT                   RNLMYRSVYNHRLNVVCNWLLEQMIRLARELGPNDVWTDSTMHSWLWSAHELDLESYLA
FT                   NDDLRTGYHLLRWREEAPRPLADLCDRFLNRRLFKALDVDSLSKEKQLECLAQARGLAE
FT                   AKGLDPSLCCGLRHQQLRGYHPYRGGLRLWNGQQLQALEQSSALVRSLSTPASTSWLIY
FT                   PKQIGQELKRKVGQYLAHI"
FT   gene            complement(525169..526467)
FT                   /locus_tag="sync_0548"
FT   CDS_pept        complement(525169..526467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0548"
FT                   /product="carboxyl-terminal processing proteinase"
FT                   /EC_number="3.4.21.102"
FT                   /note="identified by match to protein family HMM PF00595;
FT                   match to protein family HMM PF03572; match to protein
FT                   family HMM TIGR00225"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47092"
FT                   /db_xref="GOA:Q0ICP9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICP9"
FT                   /protein_id="ABI47092.1"
FT                   /translation="MLPIVNYMRKGLRQLASGLASLLLCSLLIPAPALALNDAQQLVVE
FT                   TWRLVNQSYVDPSTFDRIHWKRLRQKALEKTIETSEQAYSAIEAMLEPLDDPYTRLLRP
FT                   DDYSVMKSSNSGSLSGVGLQLGHHNDEDSVVVIAALEGSPAADAGVVSGAALLAVNGES
FT                   TALLGLETTAARLRGDVGTQVLLTVQPPNGEPEELTLERRNVDLRPVRTRRLRSDTHTL
FT                   GHLRITQFSEGVPNQVQEALQELTDKGVEGVVLDLRNNSGGLVSGGLAVADAFLNQEPI
FT                   VETRNRDGIADPIQSNPITLYDGPMVTLVNAGTASASEILAGALQDNDRSLLLGSETFG
FT                   KGLIQTLTNLSDGSGLAVTVAGYVTPSGRDIQGQGITPDRLLDQPEPLNPGGEGDRWLT
FT                   DAARVLEAIIDRQTAESPPTTDLSNEEEMAATA"
FT   gene            526535..527191
FT                   /gene="petB"
FT                   /locus_tag="sync_0549"
FT   CDS_pept        526535..527191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petB"
FT                   /locus_tag="sync_0549"
FT                   /product="cytochrome b6"
FT                   /EC_number="1.10.9.1"
FT                   /note="identified by match to protein family HMM PF00033"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45627"
FT                   /db_xref="GOA:Q0ICP8"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR023530"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICP8"
FT                   /protein_id="ABI45627.1"
FT                   /translation="MANSSPVYDWFQERLEIQDIADDFSTKYVPPHVNIFYCLGGITLV
FT                   CFLIQFATGFAMTFYYKPTVAEAYSSVQYLMTDVSFGWLIRSVHRWSASMMVLMLILHV
FT                   FRVYLTGGFKRPRELTWVTGVTMAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPAAIPV
FT                   VGDFMVELLRGGESVGQSTLTRFYSLHTFVMPWLLAVFMLMHFLMIRKQGISGPL"
FT   gene            527269..527751
FT                   /gene="petD"
FT                   /locus_tag="sync_0550"
FT   CDS_pept        527269..527751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petD"
FT                   /locus_tag="sync_0550"
FT                   /product="cytochrome b6-f complex, subunit IV"
FT                   /note="identified by match to protein family HMM PF00032;
FT                   match to protein family HMM TIGR01156"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47740"
FT                   /db_xref="GOA:Q0ICP7"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR005870"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICP7"
FT                   /protein_id="ABI47740.1"
FT                   /translation="MHILKKPDLTDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVIL
FT                   GTIACIVGLSVLDPAMLGDKADPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLV
FT                   PLGLMLIPFIESFNKFQNPFRRPIAMAVFLFGTATTIYLGIGAAMPIDKSLTLGLF"
FT   gene            complement(527828..529306)
FT                   /locus_tag="sync_0551"
FT   CDS_pept        complement(527828..529306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0551"
FT                   /product="neutral invertase like protein"
FT                   /note="identified by match to protein family HMM PF04853"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47501"
FT                   /db_xref="GOA:Q0ICP6"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024746"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICP6"
FT                   /protein_id="ABI47501.1"
FT                   /translation="MNNGRKSTMAERFSQQNQRVRPSSKEDQVVQKAKEHFERTLIPIA
FT                   GSLAGSVAALQHPRDDEALNYGEIFLRDNVPVMVYLLTQKRFKVVKQFLKICLDLQSTT
FT                   YQTRGVFPTSFVEENGELIADYGQRSIGRITSVDASLWWPVLCWMYVKASGDEQFGSTP
FT                   GVQRGVQLLLDLVLHPTFEGTPVLFVPDCAFMIDRPMDVWGAPLEVEVLLYASLRCCSQ
FT                   LMELGLRNQSSRLLDQRLVLTRQWIHDLRKFLLKHYWVTSKTMQVLRRRPTEQYGDNQH
FT                   QNEFNVQPQVIPDWLQDWLENRGGYLIGNIRTGRPDFRFYSLGNSLGCLFGLLTAPQQR
FT                   ALFRLTLHNRNHLMAQMPMRICHPPMETLEWQNKTGSDPKNWPWSYHNGGHWPSLLWYF
FT                   GASILLHERRHPNADILLMGQMKAMLEDCYWSQLNQLPRQQWAEYFDGPTGTWMGQQSR
FT                   TYQTWTIVGFLLLHHFLRVNPDDVDMLDLDGPSG"
FT   gene            529313..529477
FT                   /locus_tag="sync_0552"
FT   CDS_pept        529313..529477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0552"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46699"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICP5"
FT                   /protein_id="ABI46699.1"
FT                   /translation="MMDFALASGSKSGDALIPPRLQRGCVLGYGFGLRGGVTLRGAAEG
FT                   CKERKLEVF"
FT   gene            529961..531437
FT                   /gene="rrsA"
FT                   /locus_tag="sync_0553"
FT   rRNA            529961..531437
FT                   /gene="rrsA"
FT                   /locus_tag="sync_0553"
FT                   /product="16S ribosomal RNA"
FT   gene            531624..531697
FT                   /locus_tag="sync_0554"
FT   tRNA            531624..531697
FT                   /locus_tag="sync_0554"
FT                   /product="tRNA-Ile"
FT   gene            531707..531779
FT                   /locus_tag="sync_0555"
FT   tRNA            531707..531779
FT                   /locus_tag="sync_0555"
FT                   /product="tRNA-Ala"
FT   gene            532200..535063
FT                   /gene="rrlA"
FT                   /locus_tag="sync_0556"
FT   rRNA            532200..535063
FT                   /gene="rrlA"
FT                   /locus_tag="sync_0556"
FT                   /product="23S ribosomal RNA"
FT   gene            535179..535295
FT                   /gene="rrfA"
FT                   /locus_tag="sync_0557"
FT   rRNA            535179..535295
FT                   /gene="rrfA"
FT                   /locus_tag="sync_0557"
FT                   /product="5S ribosomal RNA"
FT   gene            535377..535592
FT                   /locus_tag="sync_0558"
FT   CDS_pept        535377..535592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0558"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47815"
FT                   /db_xref="GOA:Q0ICP4"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICP4"
FT                   /protein_id="ABI47815.1"
FT                   /translation="MVPAAAMAKQIRLRRLVRSLWRACLRWAKCDCVDLSAAFAYYTLQ
FT                   SIFPILLISLSIASTPSPSFKLSRCF"
FT   gene            complement(535589..536875)
FT                   /locus_tag="sync_0559"
FT   CDS_pept        complement(535589..536875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0559"
FT                   /product="Sulfate permease"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM PF00916"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45731"
FT                   /db_xref="GOA:Q0ICP3"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICP3"
FT                   /protein_id="ABI45731.1"
FT                   /translation="MPSLRQKINSLAIAPLPNLLAGLVMALVLIPEAIGFAGVAGVPPE
FT                   LGLYGAIFLTITIAFTGSRIAMITSASGSTAVLMTGLAAQGNNFADNKGIIFLLTASML
FT                   AGLLQIIWSLLNISALMKYIPKPVVSGFVNALALLILQAELPQLGFEQLLGLERHQVTY
FT                   LPTVKELPTVWALTAIGLLIIYSFPYITKKIPSQLISISVVTILAWTMRFDVPRVSDLG
FT                   SLPQGIHLPEIPFLINGANNIAGLDLIWTTAPIAIAISLVGLLETFLTVDYIDTLTETT
FT                   ADKRSEGIGQGIANIITSLFGGMAGCALVGESVMNVKNGAKSRLSTLSTGLFIVTILIF
FT                   ARSILGLIPLAAVAAVMISIAVATADSDSLRRIGRLPKIDTLLMIATFLATMLTHPHNL
FT                   AVGVIVGVSTSQLYGYIRRKANLRSDKSD"
FT   gene            536914..537039
FT                   /locus_tag="sync_0560"
FT   CDS_pept        536914..537039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0560"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46496"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICP2"
FT                   /protein_id="ABI46496.1"
FT                   /translation="MSSIALSETFFIVILLASLAWYLFCYSLESLVTPGDSCDSD"
FT   gene            complement(537077..537949)
FT                   /gene="mutM"
FT                   /locus_tag="sync_0561"
FT   CDS_pept        complement(537077..537949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="sync_0561"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="identified by match to protein family HMM PF01149;
FT                   match to protein family HMM PF06827; match to protein
FT                   family HMM PF06831; match to protein family HMM TIGR00577"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46475"
FT                   /db_xref="GOA:Q0ICP1"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICP1"
FT                   /protein_id="ABI46475.1"
FT                   /translation="MPELPEVETVRRGLANRLDQFVISDLEVCRDRAIASPGGPECFES
FT                   GLLNCRVGNWMRRGKYLYSELYRPGSAEANSAEESAGYWGVHLRMTGQFQWIEDDTPPC
FT                   KHTRVRFWNAKGQELRFVDLRSFAEMWWVPPDTAVESIITGLKKLGPEPFSQDFKTQYL
FT                   QERFKGSTRSIKAALLDQSIVAGTGNIYADESLFAAGICPQTPAGQLNRKQLEKLRECL
FT                   IEILELSIGAGGTTFSDFRDLEGVNGNYGGQAAVYRRTGQPCPKCGKAIERIKLAGRST
FT                   HWCSSCQTS"
FT   gene            complement(537955..538164)
FT                   /gene="psaE"
FT                   /locus_tag="sync_0562"
FT   CDS_pept        complement(537955..538164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaE"
FT                   /locus_tag="sync_0562"
FT                   /product="photosystem I reaction center subunit IV"
FT                   /note="identified by match to protein family HMM PF02427"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47445"
FT                   /db_xref="GOA:Q0ICP0"
FT                   /db_xref="InterPro:IPR003375"
FT                   /db_xref="InterPro:IPR008990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICP0"
FT                   /protein_id="ABI47445.1"
FT                   /translation="MAISRGDKVRIKRPESYWYNDVGTVASIDTSGIRYPVVVRFEKVN
FT                   YNGISGSEGGINTNNFAQAELEPA"
FT   gene            538310..539347
FT                   /locus_tag="sync_0563"
FT   CDS_pept        538310..539347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0563"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45350"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICN9"
FT                   /protein_id="ABI45350.1"
FT                   /translation="MTSLSSEAPTFNLDLPDPERDDISTMEFLARLEQAWDVCDKFDLQ
FT                   TEIWRGRILKSVRDREKRGGEGRGAGFLQWLREREISKTRAYGLIQLAESEQGLVGEGL
FT                   LEQSSVNQFSKRAFLETALAAPEVQVMIAEAANEGQEITRKQVRRLTDDFTSATSPLLP
FT                   DEIRQRAQENLLPSKVVAPLVRELSKLPEVQQEDFRKVLRDEPELDRIKDVTHTARWIT
FT                   KATESGVAVRAFQQGELDLEKAMQEAQRLDALGLLADAVGQAQALESAVLKLHTSWRRL
FT                   GGLHERLWVESGSSTPYLRDVLTALQTLSGATMRVSLGELAGGKRVRLQLVEEAPDQLE
FT                   PPITL"
FT   gene            539398..540888
FT                   /gene="recQ"
FT                   /locus_tag="sync_0564"
FT   CDS_pept        539398..540888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="sync_0564"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by similarity to SP:P15043; match to
FT                   protein family HMM PF00270; match to protein family HMM
FT                   PF00271; match to protein family HMM TIGR00614; match to
FT                   protein family HMM TIGR01389"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46197"
FT                   /db_xref="GOA:Q0ICN8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICN8"
FT                   /protein_id="ABI46197.1"
FT                   /translation="MDSLLEALHRHYGWDSFRSGQRPVIEALLSGRDCLAVLPTGGGKS
FT                   LCFQLPALVRQGLVVVISPLVALMDDQVLQLQRRGIAAACLHRGIQPEQRRLIQTQLSA
FT                   GSLRLLYLAPERLQGEAARDMLSAYARDGRLVALAVDEAHCISAWGHDFRPDYRRLGQL
FT                   RALCPGVPLVALSATAAPRVRADILRLLGLCKPLIQVSSAQRTNLKYTMRRRPSDPLPD
FT                   VLEALQDSRGATLIYARTRRSVELWAERLQAQGIPAITYHAGLEPERREEALMHFLEAD
FT                   APVLVATVAFGMGVDRPDVGLVLHLDLPATPEGYLQESGRAGRDGRPAHCLVLFSPGDR
FT                   TSLGWAMQSTLRRASESKVSDDDVWRVEFSQQQLRRMEAVAEGEICREQALLLSVGELT
FT                   SPCGRCDRCLAQVRPKDWSDRAQELLEVIDAGQGADIRSLTERLRELDGSEERWGWLAR
FT                   RLVQEELIRESNDGAQRLSLRDSGRQFLHAPWPLHYAA"
FT   gene            complement(540890..541954)
FT                   /locus_tag="sync_0565"
FT   CDS_pept        complement(540890..541954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0565"
FT                   /product="possible LysM domain"
FT                   /note="identified by match to protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46528"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICN7"
FT                   /protein_id="ABI46528.1"
FT                   /translation="MGKTPYLSPSTERSMRSIVAAALTLSALMPLQAGAASITVKPGDT
FT                   ISGLADRYGVSVKSLMKANGIRNSNHVEVGQTLRLPSGARGVVSAGQGRHIVQGGDTLG
FT                   GIAARYRVSERDLIAINNLPSADHVEVGQTLKLPTSALLPKPKSVAKAKPTPIKANPNA
FT                   TSHTVARGQTLTQIARAYEVPVASLIDLNTINDPNRVTIGTKLMLRDIRRSETTESVST
FT                   AVPTSTTPVVKPVLTATASQSTKTVQVKPVQSTTTPTKAAPAKTTTTPSVEAKPAAWRT
FT                   YGPLQVDWSNWQSMGGSMVAPTLNSEGKPLYVAVNCSARKINVTSSDGAWKSWIAPQTN
FT                   FEKDLVKDRCNKTA"
FT   gene            complement(542018..543418)
FT                   /locus_tag="sync_0566"
FT   CDS_pept        complement(542018..543418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0566"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47098"
FT                   /db_xref="GOA:Q0ICN6"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICN6"
FT                   /protein_id="ABI47098.1"
FT                   /translation="MVSASTNEAFQAADLKTLRTPVVSGQTRPEAWRRLQLKRLSDLLD
FT                   RHEADILQALRVDLAKPGLEGMFEIVALLQELKVTRRRLKAWMRPRRIPVPIPQRPGRA
FT                   QLIREPLGCVLVIGPWNYPFMLTLQPLISALAAGNTVVLKPSEHAPATAALITRLITEE
FT                   FPSDVVRVVNGDGSIAAALVDLGFDHIFFTGSGAIGAKVLAGAARHLTPVTLELGGKNP
FT                   AVVLDSADLAVTARRLIWGKSVNAGQTCIAPDHLLVQTSIREQLVNALKEERRNLYGED
FT                   PLASADLSCLIHDRHFQHLEGLLTAAREEGRILFGGECDRQRRKIAPTLIEVHSDQDPL
FT                   MAAEIFGPLLPMLTVESLDGAITRIQQQDKPLAIYLFGGDHNDQSEVLQRTSSGGVCFN
FT                   DVLMQKGVPELPFGGVGPSGMGSYHAETGFRTFSHERSVLSRPFFLDLRLRYPPYTLNP
FT                   ALFRRFVS"
FT   gene            543480..545234
FT                   /locus_tag="sync_0567"
FT   CDS_pept        543480..545234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0567"
FT                   /product="trehalose synthase"
FT                   /EC_number="5.4.99.16"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45419"
FT                   /db_xref="GOA:Q0ICN5"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICN5"
FT                   /protein_id="ABI45419.1"
FT                   /translation="MTSRPIGVSTSWNGAGVMTKQQPWWNGAVIYQLIVRSYADGNGDG
FT                   IGDLQGLANRLPYLRWLGVEAIWLTPIYPSPLQDGGYDITDFKSIHPELGDLAAFHRVL
FT                   IAAHSHGIKVVMDLVLNHTSTLHPWFQRARWAPEGSPERDVYVWSDDPKRYADAPVLFR
FT                   HFESSNWEWDEVAQQYYLHRFLRHQPDLNYDSPVVQEEMLDVVDFWIERGVDGFRLDAV
FT                   PFLCEAEGSRCEGLPETHEFLKRLRARVDRHGKDVLLLAEAIQPVEEAAPYLADDELHG
FT                   AFNFALTAHLFASIASGTVEALRECLQAAQNAVGGCRWALPLRNHDELWLGDGHLVPEE
FT                   VIQTIRAGLHQGQGHWLNWGINRRLAPLLNGDPGSNRVMHALLYSLPGLPCLYYGDELG
FT                   MGDWPGLRDRDPNRTPMAWTPGRNGGFSTAPDPLLVLPPITAPGYDYRVVNVEVQKQLP
FT                   GSLLNWHRRMLTCRKLLPALRNGDFELLDCAHPGVIVYVRTNATMTVLVAANLSAAGAS
FT                   FRLDLSRWAGERTREVLWGCDFPPADADWFVYLAAHGFSWWLIGEVEETDNTSEDIDAQ
FT                   QDKLSSGV"
FT   gene            complement(545204..546778)
FT                   /gene="glpA"
FT                   /locus_tag="sync_0568"
FT   CDS_pept        complement(545204..546778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpA"
FT                   /locus_tag="sync_0568"
FT                   /product="glycerol dehydrogenase homolog"
FT                   /EC_number="1.1.5.3"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45212"
FT                   /db_xref="GOA:Q0ICN4"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICN4"
FT                   /protein_id="ABI45212.1"
FT                   /translation="MADQRFDLVVIGGGASGCSVAYEAVRRGLRVALLEGHDLGSGTSC
FT                   RSTKLLHGGVRYLELAFKTADLAQLHLVREALLERGHWLNQAPFLAQRLELALPSDCRL
FT                   GQAYYRIGLGLYDALSGRAGIGSSRLLSSKQLQQALPLLRPDVRRGVAYSDGQFDDARL
FT                   NLLLALTAERAGAVLRTRTKVRELERNSQGQICAAISENHKGEQERWEARAVVNATGIH
FT                   ADAIRRMAAPNCSMRMLTSRGVHLVLRANLCPDGLGLLLPSTDDGRVLFMLPFFGRTLV
FT                   GTTDTPCTQASAAAPSEDEQNYLLDYVRRWFPDLSQPDVGSCWAGGRPLLKPAGAEVNS
FT                   SRVVREHEVERLNCGLISVMGGKWTTCRPMAIDTLKAVEAQFGSPLPDPASLPLIGADQ
FT                   DPKRTPTLLQEQVCALERLLPETPLRDQQRAHLQATFGLEAAALVASWNESDREPLSDV
FT                   IPVCRGEFRHAIRAEHACTATDVLARRCRLAMVDQDEAERLLPQVQALLEEAGVDAPYT
FT                   PELNLSC"
FT   gene            complement(546771..548282)
FT                   /gene="glpK"
FT                   /locus_tag="sync_0569"
FT   CDS_pept        complement(546771..548282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="sync_0569"
FT                   /product="Glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="identified by match to protein family HMM PF00370;
FT                   match to protein family HMM PF02782"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45333"
FT                   /db_xref="GOA:Q0ICN3"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICN3"
FT                   /protein_id="ABI45333.1"
FT                   /translation="MAMAAPPLLLALDQGTSSSRAALFDTDGRPVASASAPLEIHYPAD
FT                   GWVEQSPSAIWESQRLAMSRLEQAITPEQRQAVISCGITNQRETTTLWKRSDGSPCGPA
FT                   LVWQDGRTADLCKQWKASGLETSWRARTGLMLDPYFSASKIRWLLDHESAASSAAAQGD
FT                   LCFGTVDSWLLWQLSGGTVHATDMSNASRTLLMDLKQRQWIDDACAEIGLPKQALPELR
FT                   PCRGDFGVIQAGLPFAGVPIQALLGDQQAATLGQLCLQPGEGKCTYGTGAFLVVNTGAT
FT                   IRHSDAGLLSTLGWTDQHGTPTYCLEGSLFNAGTVVQWLRDGLGIIRSAEEVNPLAQEV
FT                   ENSAGVMLVPAFTGWGTPHWDPSARGLLIGITRDTRRGHIARAALEGIAFSVASLVELA
FT                   EQSMEQSLGELAVDGGAAASDLLLQAQADSTGLNVRRPVHLESTARGVALLAGLQAGAI
FT                   ADLKDLVPNRTQDSRVFEPLQTLEQRQHWRQRWNDAVSRSLHWNG"
FT   gene            548304..549761
FT                   /locus_tag="sync_0570"
FT   CDS_pept        548304..549761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0570"
FT                   /product="Glycoside hydrolase family protein"
FT                   /EC_number="3.2.1.135"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45950"
FT                   /db_xref="GOA:Q0ICN2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICN2"
FT                   /protein_id="ABI45950.1"
FT                   /translation="MGSEACKGMAETPRIGRFPAWVAEAVVYQVFPDRFRRSGRVEAQQ
FT                   GLSMQPWGTEPVEHGFQGGDLYGVIDALDHLQGLGVTCLYLTPVFSSAANHRYHTYNYL
FT                   EVDPLLGGNQALDALIAAVHQRGMRLILDGVFNHCGRGFWAFHHLLENGDSSPYRQWFH
FT                   VHQWPLRPYPGRGQACGYSCWWNDPALPKFNHDHAPVKDHLLAVGKYWLERGIDGWRLD
FT                   VPDEVPSEFWMDFRRMVKAVNPEAWIVGEIWGDARPWLQGEHFDGVMNYRLGWSSLCWV
FT                   AGSRLRRRYHNPMYPLRPLQTEALLEIWSETQGWYAPEVNRCQLNLLDSHDVPRALHSL
FT                   KGDVAALSLALLMLMLQPGAPCLYYGTEAGLEGGAEPDCREAMPWEEPWPHDLCTMIKA
FT                   LTKIRQQVEALRECGLFWQACASDGLIGRAPGVVVVVNRSRRKALLLESHDVPQVGWKT
FT                   NDALIGTYQVARHALGPQSAVLFKALR"
FT   gene            complement(549790..550320)
FT                   /locus_tag="sync_0571"
FT   CDS_pept        complement(549790..550320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0571"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICN1"
FT                   /protein_id="ABI47390.1"
FT                   /translation="MVSLDLLSSFDGMIWLQSGKKVGALFGQHQTTISRNQKKCAQAFD
FT                   IKLQKISSNWQPQGDSSPLLHLERMVHQVARFQGKSSLRLDANRWLDSDLFNPPPAGWL
FT                   VSSAKNVTNPHSLECLQKRIVDACLCPLTDLPTENQSLKNIELKSKKIGVIVLQEHADQ
FT                   ERILGLINMLQQA"
FT   gene            complement(550535..550969)
FT                   /locus_tag="sync_0572"
FT   CDS_pept        complement(550535..550969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0572"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46786"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICN0"
FT                   /protein_id="ABI46786.1"
FT                   /translation="MSRNQKKCAQVFGIKLFKHKRRWSTIGDQTLLQHERKVHQVARLQ
FT                   GKSRLRIEVNGCLDSPYFNPPPSGWVVGTGNNLSDPHGIQYLRQHIVDVCLCPLTDLPA
FT                   ESEDLTIIPLNINSEVGFVMLQQHANQERIIGLVNTLKQM"
FT   gene            complement(551143..553218)
FT                   /locus_tag="sync_0573"
FT   CDS_pept        complement(551143..553218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0573"
FT                   /product="two-component hybrid sensor and regulator
FT                   alr4878, putative"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45424"
FT                   /db_xref="GOA:Q0ICM9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICM9"
FT                   /protein_id="ABI45424.1"
FT                   /translation="MKTQFKSLAEKLTRTTGLQLILVAGSLSILGFSVGRNNVIEQKES
FT                   HRAHLPVIRVSERLSSKISFPTIINQLNEEAISADPELLKDFDKLSLRFWRQLRSFPVD
FT                   YINYGSEDGSFLGIEKSEDGSLFHNEDSARLGRGKMFVYSMTTTGERLKQEDVIPEMSP
FT                   THQEAWYVDTVKAGKPTWSKIYSWEDQPETFSISYNAPIFNQEEKLIGVVGVDMIIDKL
FT                   SNWLQDAWKDQSGLALIVEKNGNVVASSKPKIVLVRSGKTIQRANIQELDSPLAKSLSR
FT                   RYFSQQGENLLVNEKNFKQELVQISSLGSQHFVLRATPWGQEFGLDWFLVTGTSADQEV
FT                   SMAERNLMLMIFISIAALLLALAINRRLINALLTPLGALTSASQSTEQQITDTTKQPEV
FT                   LSFKCEIQKSGAKEFSDLHQAITAMVKAFNNLTQSLKSKEKQIIELFKEKQDKDEQELS
FT                   VMSKKLKTSLEAGSIAHEINQPLSILKLTSQTLINALDNNSKSPNISELKQQLSTINSQ
FT                   SERIILITDKVRALLRNAQTELSDLDLKQVVQSSLRYIHSNNPGSHGWINSKQIDSIAD
FT                   SSAVITGDAVQLQIALINIFKNSIESLREPQHHAPLILVSLKENENFWIIEIEDNGGGL
FT                   LPEMSEESLMKSNKPDGTGLGLFIVRMTMESHNGHLSLLNGSQGGLLAQLSLPKNS"
FT   gene            complement(553215..553784)
FT                   /locus_tag="sync_0574"
FT   CDS_pept        complement(553215..553784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0574"
FT                   /product="Two-component response regulator, CheY-like
FT                   receiver and wHTH DNA-binding domains"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47723"
FT                   /db_xref="GOA:Q0ICM8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICM8"
FT                   /protein_id="ABI47723.1"
FT                   /translation="MNCLVLEDQQIFLDLLGSMVKSFTEISAVFKANSIESAREISSQQ
FT                   TIDLAILDIYLPDGLCNDLAQHLALQNPDIKIIILSGAAQEFVCPEGLKEAIYGIVDKT
FT                   DAFDALRHCINVIVKPAHQDLTERQQTIYNLIGEGKTTKEIAKKLGSAHSTIETHRKAI
FT                   ALKLNVSGAELIRRAALTRTIQSIDQ"
FT   gene            complement(553922..554149)
FT                   /locus_tag="sync_0575"
FT   CDS_pept        complement(553922..554149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0575"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46876"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICM7"
FT                   /protein_id="ABI46876.1"
FT                   /translation="MADLSNIVLVQKNDRVAGQTEHDVSSGEGIFLKRWLQKQVQLGVA
FT                   VTSQKARWRWPSDKTKQSRPFQNSELELVD"
FT   gene            complement(554168..554242)
FT                   /locus_tag="sync_0576"
FT   tRNA            complement(554168..554242)
FT                   /locus_tag="sync_0576"
FT                   /product="tRNA-Thr"
FT   gene            complement(554253..554334)
FT                   /locus_tag="sync_0577"
FT   tRNA            complement(554253..554334)
FT                   /locus_tag="sync_0577"
FT                   /product="tRNA-Tyr"
FT   gene            554384..554857
FT                   /gene="aroQ"
FT                   /locus_tag="sync_0578"
FT   CDS_pept        554384..554857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="sync_0578"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="identified by similarity to SP:P43877; match to
FT                   protein family HMM PF01220; match to protein family HMM
FT                   TIGR01088"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47268"
FT                   /db_xref="GOA:Q0ICM6"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICM6"
FT                   /protein_id="ABI47268.1"
FT                   /translation="MFKSRAMHLLLLNGPNLNLLGQREPGLYGRQTLDQIETALSERAS
FT                   ADGLTLECFQSNFEGALVERIHQAMGKVDGILINAGAYTHTSIAIRDALLGTAIPFVEL
FT                   HLSNTHAREPFRHRSFLADRAVGVICGFGPVSYDLALDGLVRYLRNSASGGVG"
FT   gene            554857..555483
FT                   /gene="miaE"
FT                   /locus_tag="sync_0579"
FT   CDS_pept        554857..555483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaE"
FT                   /locus_tag="sync_0579"
FT                   /product="tRNA-(ms[2]io[6]A)-hydroxylase"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF06175"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47573"
FT                   /db_xref="GOA:Q0ICM5"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010386"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICM5"
FT                   /protein_id="ABI47573.1"
FT                   /translation="MAPTSVASIRWLAASTSASWVQQAILRPMEVLIDHAHCERKAAGS
FT                   AVQLMFRYLCEPGLGEVLSPLAREELEHFEQVLALLQARGRYLEPLPSPGYGGFLAKHI
FT                   RKEEPLRMLDSFLVAGLIEARSHERMALLAEHSPEDDLKDLYGSLLLSEARHFGLYWVL
FT                   CEQRWDRSVIVPRLEELAQVEVAALTGKLENPEDVRMHSVGVDVR"
FT   gene            complement(555490..555750)
FT                   /locus_tag="sync_0580"
FT   CDS_pept        complement(555490..555750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0580"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47085"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICM4"
FT                   /protein_id="ABI47085.1"
FT                   /translation="MIAPRVTSSPLSLSCFTHYCGVLIRFQRQDYLCFSYGECFVRCFQ
FT                   RLAYSTPSVLNEVVELPRSTFFPLVDARATQDLHDVKKCPV"
FT   gene            complement(555796..556059)
FT                   /locus_tag="sync_0581"
FT   CDS_pept        complement(555796..556059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0581"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46310"
FT                   /db_xref="GOA:Q0ICM3"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICM3"
FT                   /protein_id="ABI46310.1"
FT                   /translation="MLQMPDWFWKGVVTGVCGGITLKLLQWLAMPPKEEIKKFFAKRDP
FT                   GKNFQNLKLKHLGRYGHVIPTRWELIKGSLIKKTQRNKMPKR"
FT   gene            complement(556281..556469)
FT                   /locus_tag="sync_0582"
FT   CDS_pept        complement(556281..556469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0582"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45635"
FT                   /db_xref="GOA:Q0ICM2"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICM2"
FT                   /protein_id="ABI45635.1"
FT                   /translation="MIRTICAFTAGFTVAAWIGLEASPRFIDQKGVMSESLVLEALAYT
FT                   SSAVAAASATYLLISRR"
FT   gene            complement(556567..556746)
FT                   /locus_tag="sync_0583"
FT   CDS_pept        complement(556567..556746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0583"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47693"
FT                   /db_xref="GOA:Q0ICM1"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICM1"
FT                   /protein_id="ABI47693.1"
FT                   /translation="MRNRAKLGEKTDAQKLEQTKNVIGDFAIFMGLIGLGMMREGILWS
FT                   WGVLALSVIIYRSQ"
FT   gene            complement(557079..557297)
FT                   /locus_tag="sync_0584"
FT   CDS_pept        complement(557079..557297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0584"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45965"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICM0"
FT                   /protein_id="ABI45965.1"
FT                   /translation="MESKGLIQMKSHGLYGQPISKDEAKNQFKEICLLRQDFLAQNPYA
FT                   RKGEAMDWAIESYFSGIKSRSEKSIAV"
FT   gene            557431..557682
FT                   /locus_tag="sync_0585"
FT   CDS_pept        557431..557682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0585"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45777"
FT                   /db_xref="GOA:Q0ICL9"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICL9"
FT                   /protein_id="ABI45777.1"
FT                   /translation="MGLALISVVRVAILRGSSELWVGDELGTKSLIGEIGVEVGGSLHG
FT                   LNQEEQRFGFRFVQGLMSGIVLVTLSAALNMCFNQAMR"
FT   gene            complement(557650..558438)
FT                   /locus_tag="sync_0586"
FT   CDS_pept        complement(557650..558438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0586"
FT                   /product="possible DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47284"
FT                   /db_xref="GOA:Q0ICL8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICL8"
FT                   /protein_id="ABI47284.1"
FT                   /translation="MVHKYQIVTIGKRTIRRYHHSSIHRQKQLRLNPSEGALKKAVDAC
FT                   KQMLANKRVLVCSKNRLTLTAVSLAEPILQSLIGGTTTEDEALEIQLESNPDLLITSED
FT                   LERGYGIRLVEKAKRQSPDIKALIFLSRETPEVVQEAMEAGADGVMFVSSMGTGDGDFI
FT                   NALRTTNNGGIYYPRAVLEAATANVKPAPILVDPLSERELEVIQCIICGMKNTEIADSL
FT                   LVSAETVKSHVSTVIHKLGVRDRTQAAVFALTHGLVEAHI"
FT   gene            558559..558690
FT                   /locus_tag="sync_0587"
FT   CDS_pept        558559..558690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0587"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45475"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICL7"
FT                   /protein_id="ABI45475.1"
FT                   /translation="MNQIAEGCSLHSFEIDVLFSEPFVQYWKTAVLIGRRVVLGIRV"
FT   gene            complement(558871..559014)
FT                   /locus_tag="sync_0588"
FT   CDS_pept        complement(558871..559014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0588"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47408"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICL6"
FT                   /protein_id="ABI47408.1"
FT                   /translation="MIFSFEIKRSVHSLPLQMEWDKVTSRHIRPIIGDAINQQVNFERV
FT                   LI"
FT   gene            complement(559196..559804)
FT                   /locus_tag="sync_0589"
FT   CDS_pept        complement(559196..559804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0589"
FT                   /product="ARD/ARD' family protein"
FT                   /note="identified by match to protein family HMM PF03079"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47203"
FT                   /db_xref="GOA:Q0ICL5"
FT                   /db_xref="InterPro:IPR004313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR023956"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICL5"
FT                   /protein_id="ABI47203.1"
FT                   /translation="MTELRIYATRGAGVEADRDSAVAAAPEALLSTSNAEQISAQLKTR
FT                   GIKFQRWPSKPKLEQGAMQEQILEAYASLIASVQKNEGYQTVDVMRVERDQISGSTLRQ
FT                   TFRQEHQHAEDEVRFFVEGCGLFALHIKDEVLQVICEANDWIAIPAGTRHWFDMGVDPN
FT                   YCVIRFFKNSGGWAASFTHDPIADHYPGLDQARKQTTQG"
FT   gene            559910..560656
FT                   /gene="cobI"
FT                   /locus_tag="sync_0590"
FT   CDS_pept        559910..560656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobI"
FT                   /locus_tag="sync_0590"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /EC_number="2.1.1.130"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR01467"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46180"
FT                   /db_xref="GOA:Q0ICL4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICL4"
FT                   /protein_id="ABI46180.1"
FT                   /translation="MPHALQLIGVGPGDPELLTIAAVRAIETADVVAYPVARADAEGMA
FT                   WTIASRWTRSGQRRLPLVFPMVAEAEPRLKAWRHAADSLASELRRGLSVVLLCEGDTSL
FT                   FASSSYVQLALRKQHPDLTLKLIPGIPAVCAAAAASAEMAMDWPLALQQDGVLIRPCPD
FT                   RESDLERLLESAESNSMVLALIKLGQRWPWVRACLERRQLLEGSLFAQRVGWPDQVLAR
FT                   ANEIPAESRPYFSLLLIRQTWPGVLP"
FT   gene            560635..561279
FT                   /locus_tag="sync_0591"
FT   CDS_pept        560635..561279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0591"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45265"
FT                   /db_xref="GOA:Q0ICL3"
FT                   /db_xref="InterPro:IPR025067"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICL3"
FT                   /protein_id="ABI45265.1"
FT                   /translation="MAWGIAVTESASFLTSLNWLGLIHPVLMILFVYPVVGATIRLGIL
FT                   ARERRLDLNPIAPTVPVEHADHGRWVTGGMVLAVLVALFHNAMAGGMQGDQMLGFLLAV
FT                   VGAAAAYVALLGAKGVIAKMLWAAACWFTLILIASQPALLQWRQSFPTAVWQSHLWGGS
FT                   ALIALMLAAVVIQKQIAGRLWMRRLHVSMNVVVALLLATQAITGTRDLFMR"
FT   gene            complement(561265..563280)
FT                   /locus_tag="sync_0592"
FT   CDS_pept        complement(561265..563280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0592"
FT                   /product="Putative glycosyltransferase"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45170"
FT                   /db_xref="GOA:Q0ICL2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR003919"
FT                   /db_xref="InterPro:IPR005150"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICL2"
FT                   /protein_id="ABI45170.1"
FT                   /translation="MNALLLLLLIWPLWLIRRPEQDTPIWGRRSLILLISLFTLRYLIW
FT                   RVTSSLNFDSRLSITLSVLLLVAEAWLLLVGLVPLWLAWRRFPDRRFEINDQQKRWSES
FT                   GWKPHVDILVPTYGEPIKVLERALIGCTNLSYPHTKVWVLDDSGRHEVKALASELGCRY
FT                   LHRPERVNAKAGNLNHGLRHCRGELVAVFDADFIPQRTFLDRSIGFLLEPEVALIQTPQ
FT                   TFINADPVMRNLGMENWLLSDEESFYRWIQPVRDGWGAVVCAGTSFVVKRKALNQIGGF
FT                   VEQAISEDFVTGISLTRQHWRLLYLQEKLSAGLAAETMADFVHQRQRWASGTLQSLRLS
FT                   SGPLRRKGLSLGQRIAYLEGVMHWFNNVPRLVLMLMPLSYGILGVIPILLNSQAALTLL
FT                   LPLWSLQVLSLSWLNRGSRTAFLSELTGWVLTVPLTMTVLANLIGRIGGFRVTPKHQRR
FT                   DRGSYSVELLLPLLALVLFNLVNLYGLLSNASALPAEVLAGRPVGLVWGMINLLSLIVA
FT                   IRACWDPAAKDLSPWQKLKIEAWIEDDGGHRYPCCITALSESGARITYSRSPLPWVASS
FT                   RLRWCQELPALPVILTNTTKTEALLHWGNMPRQERYALIRWLFCRPGCWVDRQAPQEGR
FT                   ALLALIRRLIAPPKRSPFNPSLIPQHSPTLQTSAHE"
FT   gene            complement(563277..564272)
FT                   /locus_tag="sync_0593"
FT   CDS_pept        complement(563277..564272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0593"
FT                   /product="dihydrouridine synthase family protein"
FT                   /note="identified by match to protein family HMM PF01207;
FT                   match to protein family HMM TIGR00737"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46998"
FT                   /db_xref="GOA:Q0ICL1"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICL1"
FT                   /protein_id="ABI46998.1"
FT                   /translation="MLLKIQGRLLERQLRCRALQSPLAGVSDRIFRQLVRRWAPDALLF
FT                   TEMVNATSLELGHGRLKMDGLQEETGPIGVQLFDHHPDAMADAARRAADAGAFLIDINM
FT                   GCPVRKIARKGGGSGLIRDPDLACRIVDTVVAAVGLPVTVKTRLGWCGEHNAVKAQAAV
FT                   NWCRRLEEAGARMLTLHGRTREQRFSGTADWNAIAAVKAALSIPVIANGDVNSPEEALR
FT                   CLRITGADGVMVGRGSMGAPWLVGQIDAALSDRPIPATPKPLARLALAKEQLLALIEAR
FT                   GDHGLLIARKHMSWTCTGFHGASQFRQQLMRAPTPAAALDLLDQQMLRME"
FT   gene            564350..564856
FT                   /locus_tag="sync_0594"
FT   CDS_pept        564350..564856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0594"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46771"
FT                   /db_xref="InterPro:IPR014952"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICL0"
FT                   /protein_id="ABI46771.1"
FT                   /translation="MQADGAKDGGLRFARMPPTHWPLSRLLLNRILDDRISDRFVAERV
FT                   WERLGYQPDGEGLIWLAGAETPSAWREAFPQAPEVISIRPASVQLTRSIPREHKQLLKE
FT                   QLKFAGYRIGELYPRRTRRATAVNWLLAWLASHEQVLEEEGPLPLLLDPPLNPVSGHPG
FT                   DLPVR"
FT   gene            complement(565317..565700)
FT                   /locus_tag="sync_0595"
FT   CDS_pept        complement(565317..565700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0595"
FT                   /product="ErfK/YbiS/YcfS/YnhG superfamily protein"
FT                   /note="identified by match to protein family HMM PF03734"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45407"
FT                   /db_xref="GOA:Q0ICK9"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICK9"
FT                   /protein_id="ABI45407.1"
FT                   /translation="MLELIATLVVDLSDQTLTVLNEQAQTVRVIPVSTGKASSPTPTGH
FT                   ASVLTKYRSVTMRGRTYVSPGVPYAMCITANEAICMHAAPWQEDAGQAFGVPRSHGCVR
FT                   MPTQQARWLFENTPKGTKVIIQA"
FT   gene            565834..567201
FT                   /gene="engA"
FT                   /locus_tag="sync_0596"
FT   CDS_pept        565834..567201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engA"
FT                   /locus_tag="sync_0596"
FT                   /product="GTP-binding protein EngA"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00650"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46603"
FT                   /db_xref="GOA:Q0ICK8"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICK8"
FT                   /protein_id="ABI46603.1"
FT                   /translation="MARPVVAIIGRPNVGKSTLVNRLCRSREAIVHDQPGVTRDRTYQD
FT                   GYWGDREFKVVDTGGLVFDDDSEFLPEIREQASLALAEASVALVIVDGQQGLTAADESI
FT                   AEWLRTQNCKTLLAVNKCESPEQGLGMAAEFWRLGLGEPHPISAIHGAGTAELLDQVLT
FT                   FLPPKDEESDEEEPIQLSIIGRPNVGKSSLLNSICGETRAIVSPIRGTTRDTIDTRIER
FT                   ENRRWRLIDTAGIRRRRSVNYGPEFFGINRSFKAIERSDVCVLVIDALDGVTEQDQRLA
FT                   GRIEEDGRACVVVVNKWDAVEKDSHTMTAMEKELRAKLYFLDWAPMLFTSALTGQRVDS
FT                   IFALAALAVEQHRRRVSTSVVNEVLKEALSWRSPPTTRGGRQGRLYYGTQVASRPPSFT
FT                   LFVNEPKLFGDTYRRYVERQIREGLGFDGTPVKLFWRGKQQRDAEKELVRQQNRQG"
FT   gene            567208..568122
FT                   /locus_tag="sync_0597"
FT   CDS_pept        567208..568122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0597"
FT                   /product="possible cobalt transport protein"
FT                   /note="identified by match to protein family HMM PF02361"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47052"
FT                   /db_xref="GOA:Q0ICK7"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICK7"
FT                   /protein_id="ABI47052.1"
FT                   /translation="MDWLRQIPIGQYVDGSAGWLRLLDPRLKLGWVVMFLLTPVLAGPL
FT                   WRLGLVLALLVITALSGLPARLWWRSLLLVLCLGVGFGLLAMFLPTGDPAATLAVRPVQ
FT                   ELQGLSLQTSSWELFRLGPVQLGPLNLGPLSVDRRSAELGLNSATLIVTVVHSVNLMLL
FT                   STPSEDLMWALNWFLFPLTKLGLPVDRLCFQLLLALRFLPLVQEELQNLVRSVASRAVN
FT                   LRQLGLKASFGLILSVGERLLANILLRAEQGADALIAKGGRWLPADCFRPVQSTSALAR
FT                   GLNLLSFVVLLAVVGLRGKYGAF"
FT   gene            568141..568407
FT                   /locus_tag="sync_0598"
FT   CDS_pept        568141..568407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0598"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46107"
FT                   /db_xref="InterPro:IPR021926"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICK6"
FT                   /protein_id="ABI46107.1"
FT                   /translation="MGAERYLNHPTFGMLYQVSTAGEGRDLYATLYAQRMFFLVTLQPR
FT                   GAQFEVIPYQDARHHAELHLARCRRDRAADFADWKQLFDQTFI"
FT   gene            568407..569081
FT                   /locus_tag="sync_0599"
FT   CDS_pept        568407..569081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0599"
FT                   /product="conserved hypothetical protein TIGR00044"
FT                   /note="identified by match to protein family HMM PF01168;
FT                   match to protein family HMM TIGR00044"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45157"
FT                   /db_xref="GOA:Q0ICK5"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICK5"
FT                   /protein_id="ABI45157.1"
FT                   /translation="MASSSSESETIQSRWQAIHAECPDSVNLLAVSKGHPAMAVRELAA
FT                   LGQVDFGESRVQEALPKQQDLEDLSSLRWHFIGRLQANKVRAVVRAFPVIHSIDSQGLA
FT                   ERTSRIAVEENRIPEVFFQVKLREDPAKGGWEPDALREVWPQLQSLPGLKPIGLMTMAP
FT                   LGLGLEDRQSLFHDCRTLADELALSECSMGMSGDWKQAAKAGATWVRVGSGLFGPRPER
FT                   LV"
FT   gene            569189..569764
FT                   /locus_tag="sync_0600"
FT   CDS_pept        569189..569764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0600"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="identified by match to protein family HMM PF04472"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47382"
FT                   /db_xref="GOA:Q0ICK4"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICK4"
FT                   /protein_id="ABI47382.1"
FT                   /translation="MSLISRLRAVVAGDDYLDGDYDDLDYDTGEQDEVEEGPSHSMSSA
FT                   LATLESGNPFDSEPSFTGSNVIGMPGISTGTAEVSLMEPRSFDEMPGAIQALRERKTVI
FT                   LNLTMMEPDQAQRAVDFVAGGTFAIDGHQERVGESIFLFAPSCVTVTNATQDEASVPTH
FT                   VSKDVEQASSEASIAPTPAWSATSATAL"
FT   gene            569718..570602
FT                   /gene="proC"
FT                   /locus_tag="sync_0601"
FT   CDS_pept        569718..570602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="sync_0601"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="identified by match to protein family HMM PF03807;
FT                   match to protein family HMM TIGR00112"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46829"
FT                   /db_xref="GOA:Q0ICK3"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICK3"
FT                   /protein_id="ABI46829.1"
FT                   /translation="MLQLPPGVQQAPPRFDPSVPIALGVIGLGRMAQALVIPLIEQELI
FT                   SADEVIAVVGREHSVATVSARVPSGVKVIAASDSAAEHAWAASVQLLAVKPQMLDGVAA
FT                   SAPPPIETPASGSSLLLSVLAGVPLARLQALFPGRICVRAVPNTPCLVGQGLTGLAWGD
FT                   GISDPQKQQVRSFFEPVSEVLELPEERLDAFLALTSSGPAYVALIAEAMADGAVAMGMP
FT                   RSQAHHLAHRTLAGTAALLQEQELHPGELKDMVASPGGTTMAALRHLEKSGLRSALIEA
FT                   IVAATQHGRGMAN"
FT   gene            complement(570599..571798)
FT                   /gene="rfaG"
FT                   /locus_tag="sync_0602"
FT   CDS_pept        complement(570599..571798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaG"
FT                   /locus_tag="sync_0602"
FT                   /product="Glycosyl transferases group 1"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45922"
FT                   /db_xref="GOA:Q0ICK2"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICK2"
FT                   /protein_id="ABI45922.1"
FT                   /translation="MPVAHIAWLGKKTPFCGNVTYGLSTTEALKKRGHQTSFIHFDNPG
FT                   APSSSNTSLLANDPDVSLPYLLKSQVYTIPSPRAQRELRECLERLQPDVVHASLTLSPL
FT                   DFRLPELCQPLGIPLVATFHPPFDAGLRNLTAGTQQLSYQLYAPALSRYDCVIVFSDLQ
FT                   AEVLNRLGVHESRLAVIPNGVDPDRWSPAPSHPDSISKELHDVRSRLGDQRIFLYMGRI
FT                   ATEKNVEALLRAWRLVKPAGCRLVIVGDGPLRSSLQNVYGNGIGDLLWWGYEANLKSRI
FT                   ALLQCAEVFVLPSLVEGLSIALLEAMACQCACVATDAGADGEVLAGGAGIVLSTQGVTT
FT                   QLRTLLPVLRDQPLLTQELGRRARERVIERYRMVSNIDALEALYDTLIQQKPLAAEARA
FT                   "
FT   gene            complement(571821..573239)
FT                   /locus_tag="sync_0603"
FT   CDS_pept        complement(571821..573239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0603"
FT                   /product="transporter, major facilitator family protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45143"
FT                   /db_xref="GOA:Q0ICK1"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICK1"
FT                   /protein_id="ABI45143.1"
FT                   /translation="MVGDHDSANEHILSGPSLNSPDPALPTSANPEGRRGLQAVIHLDG
FT                   FRRLWVGQIFSQLADKFYIVLMVYLIAQYWVTNTPDSNGALAEIASAIRMDFETRAQRI
FT                   TLLATGIYVANTIPAMVLGSVAGVWVDRWPKRRVMVASNGLRAVLVLCTPLFLIPGPHW
FT                   FGLSWGYWALLLMTFLESVLTQFFAPAEQATIPLLVPREHLLAANSLYQATSMGATIVG
FT                   FALGDPILRGLNHLLQTVGINGGEFLLLPFCYGMAAISLSTIQMREPPRKDSSDSVWKE
FT                   IVAGIQVLREQSSVRGAMVHLVVLYSLLAALYVLAISLASAIQGLGPTGFGSLLAMSGL
FT                   GMAIGAVLVAQMGHRFSRRRLAAAGLGTITWCLVMLGQLRGNLSITLTLCGVLGIGAAL
FT                   VAIPAQTTIQEDTPESQRGRVFGLQNNLINIALSLPLVLAGALVSSIGLIPVLWVLAAL
FT                   SLAAALWERPWERC"
FT   gene            complement(573276..574091)
FT                   /gene="recO"
FT                   /locus_tag="sync_0604"
FT   CDS_pept        complement(573276..574091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="sync_0604"
FT                   /product="DNA repair protein RecO"
FT                   /note="identified by match to protein family HMM PF02565"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47376"
FT                   /db_xref="GOA:Q0ICK0"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICK0"
FT                   /protein_id="ABI47376.1"
FT                   /translation="MSPERRIEGLALKVGPLGEHDRLLTLLSDDVGLIRLAVPGARKPR
FT                   SSLAAAVPLTTMELQVGGRSGLLRVRQLRVQHNFGNVGQRLETLAAAQALSELSISLVA
FT                   GDDPVPGMLSAVLMHLERLELLAQKQRSSEMKSAEGERVDRTLATLVQACVHLLALGGY
FT                   GLPLQTCCRSGAALSPPIGNWEWRCSLLADEGLAIGSQAGAAIQINPSELALLQRLTRL
FT                   ELPERQDGGLMGPRPVWLRLFTLLESWCRVHLPRPVRSFAMVREAVANA"
FT   gene            complement(574088..574768)
FT                   /gene="deoC"
FT                   /locus_tag="sync_0605"
FT   CDS_pept        complement(574088..574768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="sync_0605"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="identified by match to protein family HMM TIGR00126"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46012"
FT                   /db_xref="GOA:Q0ICJ9"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICJ9"
FT                   /protein_id="ABI46012.1"
FT                   /translation="MTASPRQRELPELPPFIHQAVLDPLLEEEALHNLCDAGRLLGFGG
FT                   LCTSLCHLEAVRNRIGPSGRLRLFAVVDFPFGTIPAELKRAQAEWAAARGADALDVVPN
FT                   LAAITAGRAETYAEELAQICDLGLPVTVILDVNRLQPEQLSLAVEAAIDAGASCLQAGN
FT                   GFGAATTPLQVRKLKELARGNCAIKAAGGIQRLDSALDLMEEGATALGTSHGPALIQAL
FT                   RHPQ"
FT   gene            complement(574791..575366)
FT                   /gene="yfiA"
FT                   /locus_tag="sync_0606"
FT   CDS_pept        complement(574791..575366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiA"
FT                   /locus_tag="sync_0606"
FT                   /product="ribosomal subunit interface protein"
FT                   /note="identified by match to protein family HMM PF02482;
FT                   match to protein family HMM TIGR00741"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46833"
FT                   /db_xref="GOA:Q0ICJ8"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICJ8"
FT                   /protein_id="ABI46833.1"
FT                   /translation="MKLLIHGRNLDVTPALREYTETKLERAIHHFDDLVKEADVHLSVA
FT                   RNPRVPQQTAEVTVFANGTVIRAQERSENLYASIDLVASKLARQLRRFKERHSDHGHRT
FT                   TPTAANDVLLTERPTEDSLLEGKEAQLPSPGVRRKYFAMPAMSLEEARHQLELIDHDFY
FT                   LFRDKESGELQVIYHRNHGGFGVIQARN"
FT   gene            575321..576100
FT                   /gene="lipB"
FT                   /locus_tag="sync_0607"
FT   CDS_pept        575321..576100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="sync_0607"
FT                   /product="lipoate-protein ligase B"
FT                   /note="identified by match to protein family HMM PF03099;
FT                   match to protein family HMM TIGR00214"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47024"
FT                   /db_xref="GOA:Q0ICJ7"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICJ7"
FT                   /protein_id="ABI47024.1"
FT                   /translation="MRASHPNCDHGSEASWRSPLPGSTGNLLTASDPGKRSAAFLFEPV
FT                   APVPFSQAWEWQRGWQKCLLAEDGSDREAVWLLQHPSCFTLGRGATEDHLRFDPKNAPA
FT                   PLYRIDRGGEVTHHAPGQLVAYPVLDLRRREPDLHWYMRQLEQVVIDVLAALDLKGQRI
FT                   PGLTGVWLEGRKVAAIGVGCRRWITQHGLALNVSCAMEGFAHVVPCGISDRPVDRLQRW
FT                   IPGITPAAVQPLLRDALAQRLSISWCDLAGLDSGWYS"
FT   gene            576167..578065
FT                   /gene="fadD-1"
FT                   /locus_tag="sync_0608"
FT   CDS_pept        576167..578065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD-1"
FT                   /locus_tag="sync_0608"
FT                   /product="Long-chain acyl-CoA synthetase"
FT                   /EC_number="6.2.1.3"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47818"
FT                   /db_xref="GOA:Q0ICJ6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICJ6"
FT                   /protein_id="ABI47818.1"
FT                   /translation="MKSLARQQHVQGLGRVDQLWPWLEQRHGALMAVDAPHAAHPEHFT
FT                   YQELSQRITTAAAGFRALGIREGDVVGLFAENSPRWLMADQGLMRTGAADAVRGSSAPV
FT                   EELRYILEDAKAVALVVQNADLWQRLQLPAQLRRQLRFVLQLEGDAVDSDVISWDDLLA
FT                   AGAEQQAPDPDLGRDAASAASTTATILYTSGTTGQPKGVPLSHANLLHQMRSLSCVARP
FT                   EPGAPVLSVLPIWHAYERSAEYYFFSCACSQSYTTIKQLKRDLPRVKPVVMVTVPRLWE
FT                   AVQAGFEDVLKTFPASRQRLLRAALSNSSAYCLARRQRCNLMLMPLGRRQRLMACLKSA
FT                   GRWPAHALASKLIWPKLRLQLSGGQLRFPINGGAAIAPHVDSFFEAVGIELLVGYGLTE
FT                   TSPVVSCRRPWRNIRGSSGQPMPQTEFMIVDPESRAPLSFRERGLVLVRGPQVMQGYLG
FT                   KPEATAKVLDVDGWFDTGDLGMLLPDGSVVLTGRAKDTIVLSSGENIEPGPLEAHLLMN
FT                   PVVEQVLLVGQDKKQLAALIVPNQDGLRQFAENKEIENIDLFLPLKDQLKLLDLLKRDF
FT                   NSDLQLRSGSRPEERLCGVAFVEPFTIENGLLTQTLKQKRNEICVRDANTVESIYS"
FT   gene            complement(578128..578658)
FT                   /locus_tag="sync_0609"
FT   CDS_pept        complement(578128..578658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0609"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45730"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICJ5"
FT                   /protein_id="ABI45730.1"
FT                   /translation="MNPFSLAFLSLVIILASPLSAPAQMRMLSRSNMSGQNRVSNGREH
FT                   ITNKNDRIMEMDGQMDSQVVTFTMSDEGIEAPVTELMIQNLEQVRPGDTTSEEKLKLGI
FT                   TKEGELAGMTNSEIITEDGFAMTATMTINEQNVNMHQKTVEETFIETIEDFSTTSNSAA
FT                   FSSGSGFSGNFDF"
FT   gene            complement(579762..580298)
FT                   /locus_tag="sync_0610"
FT   CDS_pept        complement(579762..580298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0610"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45818"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICJ4"
FT                   /protein_id="ABI45818.1"
FT                   /translation="MYSSKLLPFGILLVLATPLSSFAQMKTTSISSGSDSEIMRTSKGT
FT                   EIVKQSSSRSSQMEGVMGNQTMSMTMSGQGMEGTTSELMLQSMEQMRSEDMAVMEQLSM
FT                   GVSEENILDGLLNSELVADENFSITATMTMSESMADMWTDENEVTNIERVEDYETTTKT
FT                   EAWVTETGFVSSFDM"
FT   gene            complement(581377..581568)
FT                   /locus_tag="sync_0611"
FT   CDS_pept        complement(581377..581568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0611"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47350"
FT                   /db_xref="GOA:Q0ICJ3"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICJ3"
FT                   /protein_id="ABI47350.1"
FT                   /translation="MKQMNSQLNATEQKKLSVLLSNTTHKSLKLKALSEDKSITEIVTV
FT                   LIEKYILHPDLLNHQGQS"
FT   gene            582979..583203
FT                   /locus_tag="sync_0612"
FT   CDS_pept        582979..583203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0612"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45259"
FT                   /db_xref="GOA:Q0ICJ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICJ2"
FT                   /protein_id="ABI45259.1"
FT                   /translation="MIYYTQSLQIACYLLFLLLFCIICVFFALYWSLSFLFLLAKLCSV
FT                   LIALSFARLWGSNVYENYVFTAGFMEKLD"
FT   gene            complement(583672..584475)
FT                   /locus_tag="sync_0613"
FT   CDS_pept        complement(583672..584475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0613"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46115"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICJ1"
FT                   /protein_id="ABI46115.1"
FT                   /translation="MKKLIGLLGAAGLLIPSAAMAGNIGNQTGSSAMRATGTSSSLTQV
FT                   SVDSSIHRTADMHVGGYNHGVSVDFSAENATFGHRGGGYGYDQTTGNAAANIDAEVEGG
FT                   YGRVSRHAAEGYIDGEAEGDVTVTTEYTPGQEAKDGFLCGRRGCIVPPQEATPEITAVN
FT                   TEGDVAFAGEAGGERSSLHGHGGYAEAEGYLNGGYDDSNIVFEGGGSEHFLNGAASGSI
FT                   DNYGNGYLGSLTETGDTHTSVDAWTSATSTSRGFESSSFTNTDWN"
FT   gene            complement(584836..585639)
FT                   /locus_tag="sync_0614"
FT   CDS_pept        complement(584836..585639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0614"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45365"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICJ0"
FT                   /protein_id="ABI45365.1"
FT                   /translation="MKKLIGLLGAAGLLIPSAAMAGNIGNQTGSSAMRATGTSSSYTEV
FT                   SVDSNIHRNNHIYVAGYNHGVSVDFSAENATFGHRGGGYGYDQTTGNAAANIDAEVEGG
FT                   YGRVSRHAAEGYIDGEAEGDVTVTTEYTPGQEAKDGFLCGRRGCIVPPQEATPEITAVN
FT                   TEGDVAFAGEAGGERSSLHGHGGYAEAEGYLNGGYDDSNIVFEGGGSEHFLNGAASGSI
FT                   DNYGNGYLGSLTETGDTHTSVDAWTSATSTSRGFESSSFTNTDWN"
FT   gene            586718..586825
FT                   /locus_tag="sync_0615"
FT   CDS_pept        586718..586825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0615"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45932"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICI9"
FT                   /protein_id="ABI45932.1"
FT                   /translation="MVSAVCQVPFDGEFILLDSGIRNHRLQRLSQHLLL"
FT   gene            587368..587811
FT                   /locus_tag="sync_0616"
FT   CDS_pept        587368..587811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0616"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46486"
FT                   /db_xref="InterPro:IPR021297"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICI8"
FT                   /protein_id="ABI46486.1"
FT                   /translation="MSEHSSLTIKRSITIRAVVTPAWKEEAERELSNGIATTDQQLSQL
FT                   EQEGQEVVDQVRRQSANPLDPRVQDQVAQVQQQVAAKRSELEEQKRNLLQQQAQVRELE
FT                   MDQIVEQGQLDSFCDIQVGDNLVSKMQVSVVVRDGVIESIEQG"
FT   gene            588039..589172
FT                   /locus_tag="sync_0617"
FT   CDS_pept        588039..589172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0617"
FT                   /product="2-oxo acid dehydrogenases acyltransferase
FT                   (catalytic domain) protein"
FT                   /note="identified by match to protein family HMM PF00198;
FT                   match to protein family HMM PF02817"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45271"
FT                   /db_xref="GOA:Q0ICI7"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICI7"
FT                   /protein_id="ABI45271.1"
FT                   /translation="MPAGSTAPVGETIGLIVETEAEIADVKAKAPSSAPAAPAAAAPPA
FT                   APAPPTPVSAPAAVSAPAPVTAPVAASVSNGRLIVSPRARKLASQMGVDLAGLRGTGPN
FT                   GRIQAEDVEKAAGRPVTPPRVGEGTSAAAVVGDTVSASPSAPSGNSFGAPGDTVAFNTL
FT                   QAAVNRNMEASLAVPCFRVGYTITTDKLDAFYKQVKLKGVTMTALLAKAVAVTLARHPQ
FT                   VNAATTASGMSYPAEVNVAVAVAMEDGGLITPVLRNADRTDLYELSRQWGDLVKRSRSK
FT                   QLQPEEYSTGTFTLSNLGMFGVDRFDAILPPGTGAILAVAASRPTVVAGKDGSIAVKRQ
FT                   MQVNLTADHRVIYGADGAAFLKDLAELIDTRPESLAL"
FT   gene            589182..591104
FT                   /locus_tag="sync_0618"
FT   CDS_pept        589182..591104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0618"
FT                   /product="Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45859"
FT                   /db_xref="GOA:Q0ICI6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICI6"
FT                   /protein_id="ABI45859.1"
FT                   /translation="MFAASLFSRLIGRALPRAQAARERLPNLQALPILSSDALSSVAYA
FT                   TEASLGVLILAGSSALKQSLPITLAIIALIVIVVLSYRQAISAYPNGGGSYVVARENLG
FT                   RNISLVAAAALLIDYTLTAAVSLMAGTQALSSLLPSLLPHELSLSLLLLALVGWANLRG
FT                   IREAGRIFAIPTYVFVVMILLLTLVGLTDLSFQHGWTPEPPPLEAALQPLGLFLILRAF
FT                   SSGCSAMTGIEAISTGVQVFREPAARNARVTLLVMGGLLASMLLAVTGLGFMYGIAPDS
FT                   QVTVLAQIGIRVFGSGSILFWLLQLSTLLILVLAANTAFAGFPLLAAMLAEDRCLPPQM
FT                   RWLGDRLVYQNGIGVLLAVSALIIWICHGDTTVAVNLYALGVFTAFTLSQLGLVLHWFR
FT                   MRGPGWQGRMALNALGALSTFVVLLVIIVSKFTEGAWSVVIALPLVVWGLALIRRRSRE
FT                   VLALLAPDPRMEPLFLEPKASLPRHHAIVWLGGFNQPSFEAVRYACSIADKVTAVMVLS
FT                   DQQDADQIGAEWDRCAGTQTGALDFQCLESPFSSLLQPFCDFVVEQERNHPELCTTVVM
FT                   PVVVPRDRLDQTLLNQRALNLFTALSAGKSRVFSIVRFYISPAGKKDNAALAACPDVVV
FT                   KPDDA"
FT   gene            591097..592206
FT                   /gene="queA"
FT                   /locus_tag="sync_0619"
FT   CDS_pept        591097..592206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="sync_0619"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase(Queuosine biosynthesis protein
FT                   queA)"
FT                   /EC_number="5.-.-.-"
FT                   /note="identified by match to protein family HMM PF02547"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46506"
FT                   /db_xref="GOA:Q0ICI5"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICI5"
FT                   /protein_id="ABI46506.1"
FT                   /translation="MPDSRDLQLSSYDYVLPEDRIAQAPVEPRHDARLLVVPPAERSLS
FT                   ELRHQRVWDWQQELQPGDLLVVNDTRVLKARLRVRRSGGGLGELLVLEPRGEGRWLCLA
FT                   RPAKRMRPGDQLWLEALEQEPLSLAVLANDAASGGRIVQFPPDCVDALSLEGLLERYGE
FT                   VPLPPYITRHDSSDQERYQTRYATRPGAVAAPTAGLHLSDALLAAIAERGVALAHVTLH
FT                   VGLGTFRPVETEDLSDLTLHSEWVEVRAEVVEAVLACRARGGRVIAVGTTSVRALEAAA
FT                   AGGGGLQPLKGPVDLVIQPGYRFQVVQGLLTNFHLPKSSLLLLVSALIGRDQLLQIYNA
FT                   AIEEMYRFYSYGDAMWIAPEAVLFDARPE"
FT   gene            complement(592297..593328)
FT                   /gene="cysK-1"
FT                   /locus_tag="sync_0620"
FT   CDS_pept        complement(592297..593328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK-1"
FT                   /locus_tag="sync_0620"
FT                   /product="cysteine synthase A"
FT                   /EC_number="2.5.1.47"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR01136; match to protein
FT                   family HMM TIGR01139"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45685"
FT                   /db_xref="GOA:Q0ICI4"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICI4"
FT                   /protein_id="ABI45685.1"
FT                   /translation="MPMLAIKFLENNSSLMSRVYADNSQAIGNTPLVRLNHVTKGCKAT
FT                   VLAKIEGRNPAYSVKCRIGANMIWDAEKRGVLSEGKTIVEPTSGNTGIALAFTAAARGY
FT                   KLILTMPESMSIERRRVMAVLGAELILTEAAKGMPGAIAKAKEIADSDPSKYFMPGQFD
FT                   NPANPEIHEKTTGPEIWDDCDGAIDVLVAGVGTGGTITGVSRYIKQEKGKAITSVAVEP
FT                   SHSPVITQTMNGEALKPGPHKIQGIGAGFIPNNLDLSVVDRVEQVTNEESIEMALRLAQ
FT                   EEGLLVGISCGAATAAAIRLAQQDEFAGKTIVVVLPDLAERYLSSVMFADVPTGIIEQP
FT                   VPV"
FT   gene            593415..594212
FT                   /locus_tag="sync_0621"
FT   CDS_pept        593415..594212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0621"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46305"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICI3"
FT                   /protein_id="ABI46305.1"
FT                   /translation="MNTFYASFLAFASVAFSSVAVSPAAVLAESEEQARGPYLRLGAGV
FT                   QWPETSALKDQRCSSTSPPALFGCGPGDDGRSLGAYGGFDQAPVVDAAIGYRWTSWLRT
FT                   EALLNWSPQLNVSAQSNFLGAGPNQPVRSSGNGLAGFGVLYVDGPSIATVRPFIGAGLG
FT                   AARTSLADVTYRFPAISSDAVTVTSGGRSTSFAYLLTAGVSIPVSEKLDLDLAYRWTDL
FT                   GTVKTNAGSAKIVRPAGRSNLEIAGTEIDLQSQAVLASLRFRF"
FT   gene            complement(594209..595702)
FT                   /locus_tag="sync_0622"
FT   CDS_pept        complement(594209..595702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0622"
FT                   /product="possible cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="identified by match to protein family HMM PF01053"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46961"
FT                   /db_xref="GOA:Q0ICI2"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICI2"
FT                   /protein_id="ABI46961.1"
FT                   /translation="MSSRDLLRNPCWQGKDLGHPLPDGIHAVSVALPRWSDVIAYEDND
FT                   PQCRSQLRALYPRFGLHPLAAEVAQKALAMRPTGMDSPGSSAWPYPNGAAAQLAQHHCL
FT                   RQAPRASTQIVDQLGLAVLIADAEASPHAKAFWQHAGLGASSRRAAISLSKEAAPAAGA
FT                   AIQAKALVIERLAAIYGCDTQRLSLHPSGMAALHTALQWITTMRPGRPTLQIGFPYVDV
FT                   LKLPQVVFAGSELLLDSSNAAMEAALDRIDPAAVIVELPSNPLLQCVDLPTLARLAHVR
FT                   GIPVIADDTIGSCLNIDPLPYADLIFSSLTKSFAGRGDVLAGALVVSPNSRWEQTFQNQ
FT                   HSAAGFTGLGDADAMALEQGSRDVQARVPQLNRHAQALAAKLSNHSEVARVYYPDQCAN
FT                   FRSLLRPGAGHGCLLSFEVKGGIDQAQAVYDGLSVCKGPSLGTPFTLVCPYVLLAHYNE
FT                   LPWAKACGVSAHLLRVSVGLEQPEELWQRFERALSNSML"
FT   gene            complement(595699..596856)
FT                   /gene="metB"
FT                   /locus_tag="sync_0623"
FT   CDS_pept        complement(595699..596856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metB"
FT                   /locus_tag="sync_0623"
FT                   /product="Cystathionine beta-lyase/cystathionine
FT                   gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="identified by match to protein family HMM PF01053"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46088"
FT                   /db_xref="GOA:Q0ICI1"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICI1"
FT                   /protein_id="ABI46088.1"
FT                   /translation="MQRPVPEPATATRAIHHGESFASETGTVMPPIYATSTFEHGNPGG
FT                   FDYTRSGNPNFRILEGVLASVEACSHATVFGSGVSAITAIVSTLSQGDLVLCEENLYGC
FT                   TVRLFEQVFAKFGVRTEWVDFTTPNAVARIEKQRPAMVWLESPTNPLLKVIDLDAVCSA
FT                   ASAAGVPVVVDNTFATALVQRPLALGATLSLTSTTKYINGHSDALGGVVCTDNPSWHQK
FT                   MVFAQKALGLMPSPFDCWLITRGIKTLPLRLNQQMANAAAVADHLASHPAVSWVRYPGR
FT                   DDHPQRAVALRQMNGGGAIVTIGLNANREQVYAICKALRWFTMAESLGGVESLICHPAT
FT                   MTHAAVSSEIKAALGISDGLIRLSLGCEDISDLLIDLDHALTLLP"
FT   gene            597173..597430
FT                   /locus_tag="sync_0624"
FT   CDS_pept        597173..597430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0624"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE21875.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47712"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICI0"
FT                   /protein_id="ABI47712.1"
FT                   /translation="MKESQLQQSDKDEWRDHVLQEIVEFLSKNKEEIHGRYLEQRCGQL
FT                   PRDFIEEKGLMDFELAITFLEDKPKGMGLGLGFFKATLIR"
FT   gene            597596..597733
FT                   /locus_tag="sync_0625"
FT   CDS_pept        597596..597733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0625"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46911"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICH9"
FT                   /protein_id="ABI46911.1"
FT                   /translation="MSKGTGLEKSLLPHKYVFAPSKSLLILLMTSLQLFRSSNKICALN
FT                   "
FT   gene            598109..598393
FT                   /locus_tag="sync_0626"
FT   CDS_pept        598109..598393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0626"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE20369.1; match to
FT                   protein family HMM PF07864"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47038"
FT                   /db_xref="InterPro:IPR012447"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICH8"
FT                   /protein_id="ABI47038.1"
FT                   /translation="MLSMSMGCFADVGVEGWLTDRCGYWAMRFHRDEQSDENDPRIFVD
FT                   YGRGMPNGQSAFLKSRKHLPRKDAETQWNRLIEIGWTQVPPVWGQGIEP"
FT   gene            complement(598416..598817)
FT                   /locus_tag="sync_0627"
FT   CDS_pept        complement(598416..598817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0627"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAQ00268.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47219"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICH7"
FT                   /protein_id="ABI47219.1"
FT                   /translation="MIQSRPVLTAALFDQALSNASLTTEEEDFIEFVRYTGVIDELILR
FT                   KGLSLPAKPPALCRLSDICEKIGAVIPDHFNAAMRWSAEQSQDKIAWKGNLICNIAFNS
FT                   DGIELSPNAGTTLYYTYVVHQELFIGLGS"
FT   gene            599326..599589
FT                   /locus_tag="sync_0628"
FT   CDS_pept        599326..599589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0628"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46266"
FT                   /db_xref="GOA:Q0ICH6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICH6"
FT                   /protein_id="ABI46266.1"
FT                   /translation="MNQASIRRFIFTLITGYLAIFGIQQIPYEFPNQWAVLIPVLIVVY
FT                   IITVWLDGVFFKDDEPLEKHPADLKKAKTKKSSKKANGFGDS"
FT   gene            complement(599776..600384)
FT                   /gene="rpsD"
FT                   /locus_tag="sync_0629"
FT   CDS_pept        complement(599776..600384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="sync_0629"
FT                   /product="ribosomal protein S4"
FT                   /note="identified by match to protein family HMM PF00163;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR01017"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45098"
FT                   /db_xref="GOA:Q0ICH5"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICH5"
FT                   /protein_id="ABI45098.1"
FT                   /translation="MSRYRGPRLRITRRLGDLPGLTRKAAKRSYPPGQHGQARRKRSEY
FT                   AIRLEEKQKLRFNYGVSERQLVRYVKKARAQEGSTGTNLLKLLENRLDNVCFRIGFGPT
FT                   VPGARQLVNHGHVTVNGRVTDIASYQCKAGDVIAIRERKCSKLLAEANLQFPGLANVPP
FT                   HLELDKPKLSAKVIGRAEREWVALEINELLVVEYYSRKV"
FT   gene            600464..600730
FT                   /locus_tag="sync_0630"
FT   CDS_pept        600464..600730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0630"
FT                   /product="conserved hypothetical protein TIGR00278"
FT                   /note="identified by match to protein family HMM PF01809;
FT                   match to protein family HMM TIGR00278"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47900"
FT                   /db_xref="GOA:Q0ICH4"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICH4"
FT                   /protein_id="ABI47900.1"
FT                   /translation="MHESTILSAGSTNPFNRIVSAVMLALIELYRRWISPLIGPRCRFI
FT                   PTCSAYGIEAIQRHGPWRGGWLTLRRLLRCHPFTPCGCDPVPD"
FT   gene            600711..601019
FT                   /locus_tag="sync_0631"
FT   CDS_pept        600711..601019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0631"
FT                   /product="ribonucleotide reductase (Class II)"
FT                   /note="identified by match to protein family HMM PF05768"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45551"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICH3"
FT                   /protein_id="ABI45551.1"
FT                   /translation="MTPSPIDSRRLILYSRAGCCLCEGLEQRLRDLNLEHDIDPLTLVV
FT                   VDIDAPDCAASLRARFDLEVPVLVLGDTELPRVSPRLSGDGLRNWLQRVCATAAGSD"
FT   gene            601045..602556
FT                   /locus_tag="sync_0632"
FT   CDS_pept        601045..602556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0632"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="identified by similarity to SP:Q59650; match to
FT                   protein family HMM PF01225; match to protein family HMM
FT                   PF02875; match to protein family HMM TIGR01085"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47620"
FT                   /db_xref="GOA:Q0ICH2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICH2"
FT                   /protein_id="ABI47620.1"
FT                   /translation="MTQRLHALLHSVGLPVPQGLSDAVIESITCDSRCVGPGSVFIGLP
FT                   GGRVDGGSFWPKALVDGASAVLIGSAAAATLPPEQSDAVLVVPDPVARWAGELAAAFWN
FT                   HPSERIGLIGVTGTNGKTTTTHLIEHLSSACGRPSALFGTLLNRWPGHSVTATHTTAVA
FT                   DRLQAQLAEAYAAGAQLTAMEVSSHALDQHRVAGCRFSGAVFTNLTQDHLDYHETMASY
FT                   FEAKARLFAPPLVADQGAQFVVNIDDPWGKHLAERLGDRCWRSSLSEGSAHAELTMSDL
FT                   VMGSSGVEGRLLSPLGEGSFQSPLLGRFNVMNLLQAVGVLLQQGLPLEALLEAISTFRG
FT                   VPGRMERVVVDGKGGELPTVLVDYAHTPDGLSSALNACRPFADGKLICVFGCGGDRDRG
FT                   KRSQMAAIAAELADAVVVTSDNPRTEDPQQILNDVVEGIPSGTALTVMLDRAEAIAGAI
FT                   KDAGSHDLVLIAGKGHEDYQILGTQKVHFDDREQALKALQDKLIF"
FT   gene            complement(602561..603706)
FT                   /gene="cax"
FT                   /locus_tag="sync_0633"
FT   CDS_pept        complement(602561..603706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cax"
FT                   /locus_tag="sync_0633"
FT                   /product="calcium/proton exchanger"
FT                   /note="identified by match to protein family HMM PF01699;
FT                   match to protein family HMM TIGR00378"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46549"
FT                   /db_xref="GOA:Q0ICH1"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICH1"
FT                   /protein_id="ABI46549.1"
FT                   /translation="MHSNVNQTDDPIPKSLTSSFVDSGRWKFIPALTMLGLTQLASMQE
FT                   WPTLICFIVSATGIIPIALLLSDATEEIAEHSGPTIGAICTAVFGNFAEFIIALSALRL
FT                   GLIDVVKASITGAILSDLLLVTGVAMLVGGLKYSEQSFQETMVRTNGAAMTLAVMAMAL
FT                   PASLISTSGIDDPVAIHGLSMTVAVILIAIYVLTLIFSLATHSHLFDPQHIKNDATELP
FT                   QEAAKSINLLPWIVQLILCTSLLAYQSESFVHFLEPATEQLGFSALFTGIIIIPIIGGF
FT                   SEYVPAVKGAWKDQMDLPISLAMGSSLLVALLIAPALIIIGSLIGQPMNLDFTAFEVIA
FT                   LIFSVLIVNLVNMDAKSNWLEGVLLLGMFAIFGAAFYYYPS"
FT   gene            complement(603752..605035)
FT                   /locus_tag="sync_0634"
FT   CDS_pept        complement(603752..605035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0634"
FT                   /product="hydrophobic amino acid ABC transporter (HAAT)
FT                   family, periplasmic amino acid-binding protein"
FT                   /note="identified by match to protein family HMM PF01094"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46361"
FT                   /db_xref="GOA:Q0ICH0"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICH0"
FT                   /protein_id="ABI46361.1"
FT                   /translation="MESKAARTTDAIAKMFHFLRLRTFVMKKRAANHKSVLPVKLIATI
FT                   LRRSTLITFGLSLSIAATSAQQKDTQITSDSKNTILLGQSLPLSGPSAQIGKKYQAGAQ
FT                   AWFNEVNRQGGINGKKIRLISLDDQYEPELTISNTKTLLEKPNLLALFGYVGTPTTKEI
FT                   LPFIEERKVPLIAPLTGASILRDEKLKMVVNLRASYQMEIDKIVDSLVRNARQKIAIIY
FT                   QDDAFGKDGLKSAESALKKHGLKPIATATVQRNSAKIQSALQVLISSQPNAIIIISTYV
FT                   SSAALSRELLKRDVNAQIMNVSFVGTRALEQSLPVGLANGIGVSQVVPFPWDRWIPVVA
FT                   DYQRLMRVNNSSARFGFTSLEGFMAARLITEGIKKVQGPLTKESLIKSLKSIKKVDLGG
FT                   FQLDLSSNNKQASDYVELTFFGAQQWEP"
FT   gene            604959..606197
FT                   /locus_tag="sync_0635"
FT   CDS_pept        604959..606197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0635"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46675"
FT                   /db_xref="GOA:Q0ICG9"
FT                   /db_xref="InterPro:IPR036719"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICG9"
FT                   /protein_id="ABI46675.1"
FT                   /translation="MTKVRRRRKWNILAIASVVLAALLSIIGVTSLNVDQVPGRDSLRL
FT                   SSASRALTTSADRLPRDGWSSQRGESLSGSEIQADIEALDDAKYHVKIGVYSNSTYDLD
FT                   LSIPSFSSNGYVWMRWKQPLQDYLEANNTDLQEHISLLNALLSDADPVLHPVQDKPAVL
FT                   SDGTYYQLYTYVGRFYIDSATFKRFPFLTISLPIAIEADDVAGGLGYTKLRFEPDIRNS
FT                   GMGLYAGTGIIGWLNRGWSIAEYRHNYATNFGLGGLDRDYSLIVYDITFGTSSWSSFWR
FT                   LMLPLLVVMVMVLLVFKIRPDEQDARAGIPVTVLLTLVFLQQVYRGELPDLPFLTFLDL
FT                   VYVIAYVITLFAFVLLVWIGRRYADMERMPLGEARDNLSKRLELLDEVWPLSMVLFCSV
FT                   AVVTAWVLIPPGS"
FT   gene            complement(606194..607426)
FT                   /gene="csdB"
FT                   /locus_tag="sync_0636"
FT   CDS_pept        complement(606194..607426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csdB"
FT                   /locus_tag="sync_0636"
FT                   /product="L-cysteine/cystine lyase homolog"
FT                   /EC_number="4.4.1.-"
FT                   /note="identified by match to protein family HMM PF00266"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47640"
FT                   /db_xref="GOA:Q0ICG8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICG8"
FT                   /protein_id="ABI47640.1"
FT                   /translation="MTNGLPPANSSTLRDLCPALGNKVYFNYGGQGPLPTPSLEAMTTS
FT                   WQRIQELGPFTTDVWPYISAETNKTRALLGRMCGVAPHRLALTENVTSGCVLPLWGLPL
FT                   KAGDRLLISDCEHPGVVAACHELARREHLEVDNLPVQQFRQGREAQHETDAGVLQALED
FT                   SLMPRTKVVVLSHLLWNTGQLMPIPAVADHLRQHAQQPFLLVDAAQSMGQIPVEAAAQA
FT                   ADIYAFTGHKWACGPEGLGGVALSERILNQANPTLIGWRSLRDETRAVIDDPEPFHHDS
FT                   RRFEIATSCVPLMAGLRQSLRLLANEGNEQERLQTIQSVSSELWRQLKELPGTTPLLKG
FT                   EPPAGLVSFQINDPSGQSPAEVVQILGRSGIWIRNLEEPICLRACTHITTKPNEISRFV
FT                   DALEQLLSPNH"
FT   gene            607419..607826
FT                   /locus_tag="sync_0637"
FT   CDS_pept        607419..607826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0637"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45056"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICG7"
FT                   /protein_id="ABI45056.1"
FT                   /translation="MVKVVFRKVPDYIVKARASYQLQRGVPCDCQSHVGKKQWKEPGGT
FT                   TLKEAHARGLRKRVRDEKGLCSNSVAVLAWLWITLQPLIRCRMADIAGRKSDHIHDDSL
FT                   LIEDHSASSATSRDGGVDWTRFVKKIAFLAQ"
FT   gene            607807..607932
FT                   /locus_tag="sync_0638"
FT   CDS_pept        607807..607932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0638"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46100"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICG6"
FT                   /protein_id="ABI46100.1"
FT                   /translation="MLFLHNKLNFICSFSDRKVVASMIDQVVKILFLIPVFCVAK"
FT   gene            608045..608587
FT                   /locus_tag="sync_0639"
FT   CDS_pept        608045..608587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0639"
FT                   /product="possible Early Protein (E6)"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46347"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICG5"
FT                   /protein_id="ABI46347.1"
FT                   /translation="MTWQVISLPFLMPSKPRNRVGEVYGKLTVIRASERRTKSGNAYWW
FT                   CRCSCGQDREVPGDKLSHNAARKKPIVTACFDCSREFQVEGVCAKNDREERQRRIDAQE
FT                   RRSLLKGVVPDGWLTLPLTDAHARELGQVLFFRGTVCLRGHLAPYRINGGCLTCSGQKP
FT                   SALNHAPTASAEVAHDA"
FT   gene            608633..608725
FT                   /locus_tag="sync_0640"
FT   CDS_pept        608633..608725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0640"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47364"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICG4"
FT                   /protein_id="ABI47364.1"
FT                   /translation="MAANQALPLIGMIAVLPKKRCFLNRSLVQA"
FT   gene            609128..609394
FT                   /locus_tag="sync_0641"
FT   CDS_pept        609128..609394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45817"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICG3"
FT                   /protein_id="ABI45817.1"
FT                   /translation="MQALMILALVLVNLALIVHLTEKVFGFWKKWKNHKLLVNNHPEMN
FT                   AVDPDQGLMAFESDDLTRAFVLDNDEPGASEPFLVSGDQESED"
FT   gene            609730..610446
FT                   /locus_tag="sync_0642"
FT   CDS_pept        609730..610446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0642"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47124"
FT                   /db_xref="GOA:Q0ICG2"
FT                   /db_xref="InterPro:IPR025067"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICG2"
FT                   /protein_id="ABI47124.1"
FT                   /translation="MGMAAVDWLWILHPFLAVVLVYPLIGVVVRLAVQTRARRLQNQKL
FT                   PATVGRDHSDLGRWLAAAVVVVVLIALSVVIGTKAPLAQFEGGLTRAIQLLLVLCGTIV
FT                   SLLALWRCKRPGLRLAFSLITWAGVLGLGAQPEVWRLSDNPLTPGFWQSHYWAGVGVTG
FT                   LMLFSLGARIEILRDIRIRRLHVTANVLAALLFLTQGLTGARDLLEIPLSWQKSTIYAC
FT                   DFNAKTCPSLDPNAQS"
FT   gene            610558..611430
FT                   /locus_tag="sync_0643"
FT   CDS_pept        610558..611430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0643"
FT                   /product="lipase/esterase family protein"
FT                   /EC_number="3.1.1.-"
FT                   /note="identified by match to protein family HMM PF07859"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45304"
FT                   /db_xref="GOA:Q0ICG1"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICG1"
FT                   /protein_id="ABI45304.1"
FT                   /translation="MSQAFSALYRSFQTDVVTRVRCSPVEDTLYTWIDPPSGRSNFVSL
FT                   FFHGGGYTMGSTDDHLQLIASLVEDSGVSVLGVDYRLCPNNCFPAPLDDAEEAYRWLLA
FT                   QGYRSEAIAVAGISAGATLVTQLLHRCQSKSLPMPSLALVMAGVMDFSYGRESVVFNAS
FT                   DDLVSLQRLQAISSHYLPDDGSFDARDVFCMQQDYNSFPRTLFQVGDREVLLSDAIACF
FT                   STLKTAGHDVALHVVPGMIHCGQLFSRDFLPGQRATAEAALFLREGFAAIHASSVSGMG
FT                   ESKKQKTGH"
FT   gene            complement(611383..611994)
FT                   /locus_tag="sync_0644"
FT   CDS_pept        complement(611383..611994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0644"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47497"
FT                   /db_xref="GOA:Q0ICG0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICG0"
FT                   /protein_id="ABI47497.1"
FT                   /translation="MAYVFVHLLPELASHGQAISEAPGMKTFAPTPITEALLFLIALVG
FT                   IMLTYSLDVLATHERQAGRVASSLHTLNFAAISYLYAYSLPSLISTGLAYGVLFTIAIC
FT                   AHVLLADRTMAARHPATFRTRTRWFGTAALVLGLLHAALFHPVADLHLAIATAFIGGGL
FT                   LIAVFREELPAVNRTRLGWFVAGTVSMTSLLLLALTHATH"
FT   gene            complement(612038..612175)
FT                   /locus_tag="sync_0645"
FT   CDS_pept        complement(612038..612175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0645"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45935"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICF9"
FT                   /protein_id="ABI45935.1"
FT                   /translation="MFGFRKEATLKQSLGVGSSALDLFNYLRDGDRQCSLARKQDGNST
FT                   "
FT   gene            complement(612376..613230)
FT                   /locus_tag="sync_0646"
FT   CDS_pept        complement(612376..613230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0646"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46653"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICF8"
FT                   /protein_id="ABI46653.1"
FT                   /translation="MVTEEQLTALDLTLWLGSTDLAGDFDFTSQSTISRRNQKVLKRFG
FT                   IDLKRSNSELLVSGELLLLDLERQVHQMARLKLERGLRLQAPFWLQQGPGIVLPKGWKM
FT                   NSPRADFSCTDPITLVREHVLDACLATPTQIPDDRDDLFILELQKRPINLTLLHRTKES
FT                   QGDLEDGFQWSLENGNLELKLMPFLPASCCDRSKQWFDQLLMTSNLSREDSTDLRPSRH
FT                   SGESFLIAYLTPEMRIAQPIANKVHEHFEPYTYTEHLIVLAQHTNEPAIQALIENLQQQ
FT                   IGH"
FT   gene            complement(613335..613580)
FT                   /locus_tag="sync_0647"
FT   CDS_pept        complement(613335..613580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0647"
FT                   /product="NifU domain protein"
FT                   /note="identified by match to protein family HMM PF01106"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46656"
FT                   /db_xref="GOA:Q0ICF7"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICF7"
FT                   /protein_id="ABI46656.1"
FT                   /translation="MSTETMALTNENVEKVLDELRPFLMADGGNVEVVEIDGPVVKVRL
FT                   QGACGSCPSSTMTLKMGIERKMRESIPEVSEVVQVL"
FT   gene            613665..615134
FT                   /gene="mqo"
FT                   /locus_tag="sync_0648"
FT   CDS_pept        613665..615134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mqo"
FT                   /locus_tag="sync_0648"
FT                   /product="malate:quinone-oxidoreductase"
FT                   /EC_number="1.1.5.4"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF06039; match to protein
FT                   family HMM TIGR01320"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46045"
FT                   /db_xref="GOA:Q0ICF6"
FT                   /db_xref="InterPro:IPR006231"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICF6"
FT                   /protein_id="ABI46045.1"
FT                   /translation="MDRYDVVLVGAGIMSATLATLLHELDPELQLLVVERLEAPALESS
FT                   AAGNNAGTGHAANCELNYTPLQADGTISTEKPLAINASFESSLEFWATLSERGRLDPSC
FT                   FIHRVPHISFVWGEGDVAYLRQRYEQLKSLPAFAAMDWSRDEAELASWIPLVMAGRDPQ
FT                   IAVAATRIERGTDVDFGALSRSLFVPLQASGALDLVFGTSVSDLNRQAEGWELQLRGPS
FT                   GRRVVMTPFVFLGAGGGALPLLQRSGIPEATAYAGFPVSGQWLVCNDPDLSEHHFAKVY
FT                   GKAKVGAPPMSVPHLDSRWIDGRRSLLFGPYAGFSSKFLKQGSLLDLPRSVRSSNLLPM
FT                   LQVGVNNIPLVRYLVNQLRQSSEERMEALKAFLPTARTEDWTLSVAGQRVQIIKRTSAG
FT                   GRLQLGTEVVSAADGSLAALLGASPGASTSVEIMLEILQRCFPDRLASETWQQRLQALL
FT                   PSYGQDLNANGELLQRSRDRSDALLGLQIAR"
FT   gene            complement(615135..616271)
FT                   /locus_tag="sync_0649"
FT   CDS_pept        complement(615135..616271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0649"
FT                   /product="Glycerol dehydrogenase (GLDH)"
FT                   /EC_number="1.1.1.6"
FT                   /note="identified by match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47569"
FT                   /db_xref="GOA:Q0ICF5"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICF5"
FT                   /protein_id="ABI47569.1"
FT                   /translation="MAYPLEQGCIHQRPLAVLASPGRYVQGPGATHELGRELKRLGLAD
FT                   SVLFIAGGTAQRCLARIWQAELPPLGLTPVIETFGGESSEAEIDRLVELAKTHTFTAVV
FT                   GAGGGKASDTARAVANELELPVVITPTLASTDSPCSALSVLYTEQGEMLSYRFYTRHPA
FT                   LVLVDTTVIAQAPKRQLVAGLGDALATWFEARTVRQSHVNNQLGGKPTTSGTALAKLCH
FT                   EILLTDGPAACAAVDAGVATPALERIVEANNLLSGLGFENGGLAAAHAVANGFSMIAGS
FT                   HRMLHGEKVAMGLHTQLVLEGQPQSEICEIFEYCRSVGLPTTLAQLGVNADSDKDIQTI
FT                   AERAVMPGETIHNEPFEVSAAAVDCALKAADQQGRAYA"
FT   gene            complement(616319..616645)
FT                   /locus_tag="sync_0650"
FT   CDS_pept        complement(616319..616645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0650"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46977"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICF4"
FT                   /protein_id="ABI46977.1"
FT                   /translation="MDLPHIPLGWIKPALSVAASLTMAAPFATSAFSCELHQPQQLKDG
FT                   TPLKEQTTQFVPEDHKGMVCMAIAPQCMTKKQWAAHCLSQNNAIESKSCRDALDRPDPN
FT                   PEAI"
FT   gene            complement(616654..616983)
FT                   /locus_tag="sync_0651"
FT   CDS_pept        complement(616654..616983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0651"
FT                   /product="possible drug resistance protein"
FT                   /note="identified by match to protein family HMM PF00893"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46248"
FT                   /db_xref="GOA:Q0ICF3"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICF3"
FT                   /protein_id="ABI46248.1"
FT                   /translation="MPAPWILLMLAIGSEVIGTSCLKLSEGFSRPIPTLVVLAAYSTSM
FT                   LLLSRVVQTIPLGITYALWSGIGIIAIVLVGLLAYKQVPSPGQLVGIATITAGVIIVNL
FT                   TGKHP"
FT   gene            617073..618887
FT                   /gene="lepA"
FT                   /locus_tag="sync_0652"
FT   CDS_pept        617073..618887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="sync_0652"
FT                   /product="GTP-binding protein LepA"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM PF06421;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR01393"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45640"
FT                   /db_xref="GOA:Q0ICF2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027518"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICF2"
FT                   /protein_id="ABI45640.1"
FT                   /translation="MTDAPVKRIRNFCIIAHIDHGKSTLADRLLQDTGTVANRDMQEQF
FT                   LDNMELERERGITIKLQAARMKYKAADGEEYVLNLIDTPGHVDFSYEVSRSLQACEGAL
FT                   LVVDASQGVEAQTLANVYMALENDLEIIPVLNKIDLPGADPDRIKEEIEAIIGLDCSNA
FT                   IPCSAKTGLGVPEILQSVVDRVPPPADTVKEPTKALIFDSYYDPYRGVIVYFRVMSGSI
FT                   SRKDKVLLMASNKTYELDEVGIMAPDEKKVDELHAGEVGYLAASIKAVADARVGDTITL
FT                   LNEPADAPLPGYAEAKPMVFCGLFPTEADQYPDLREALHKLQLSDAALKFEPETSSAMG
FT                   FGFRCGFLGLLHMEIVQERLEREYNLDLIVTAPSVIYNVNLTNGEQILVDNPATLPDPQ
FT                   QRESIEEPYVRMEIYAPNDFNGALMGLCQERRGEYLDMKYITKERVTLIYELPLAEVVT
FT                   DFFDQMKTRTQGYASMEYHLIGYRKNELVRLDVLINAERADPLTTIVHRDKAYNVGKGL
FT                   VEKLKELIPRQQFKIPLQASIGSRIIASTSISAIRKDVLAKCYGGDISRKKKLLKKQAK
FT                   GKKRMKAMGKVDVPQEAFMAVLKLNQTP"
FT   gene            complement(618893..620404)
FT                   /locus_tag="sync_0653"
FT   CDS_pept        complement(618893..620404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0653"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47889"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICF1"
FT                   /protein_id="ABI47889.1"
FT                   /translation="MAEAVISLGASAVLVSASAAALSTTGSIISHTGEKTSLRQNASGG
FT                   LRLMGSEVQRGLHLLIKTKDTPKAELAHTDLNHQQYSSSIQECEAIAIDRKRAFQPAFG
FT                   IRMAELDRPVIYGLSTSARGNGYALERCGAPLTMDGRYGEVAETYIAPILQDIGVMPCQ
FT                   GNPDTCNSQVNPDGTEKSLNDIVKQLDLDFAVIANHGERTPARVAKEPAFAIETDSARK
FT                   LIKIVSPKTEEEQNPSYLEIKNGLRSVSRHDLHFAMYSRASKIEDASSNEQGALLNGAF
FT                   FRNISSNRVRFLLDGSGSMSACILWGSGRGQRRTYWNGNRYISTRKICALTRMESLQNE
FT                   LVMIINGLPDNTKINIESFSSRGYLNHRRWKPSVDGLISLDDSETRQSAISFVHSLNDG
FT                   SVTRWGGTIPWDGLDTALNDEETDTLYFLSDGEPNTNHQGRQWTNDEFSSTVDHYISKN
FT                   DQRGKKITINTTALGLNSNWMKDLANRSTGDYLMIDKNYITVAQQ"
FT   gene            complement(620827..621405)
FT                   /locus_tag="sync_0654"
FT   CDS_pept        complement(620827..621405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0654"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45896"
FT                   /db_xref="GOA:Q0ICF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICF0"
FT                   /protein_id="ABI45896.1"
FT                   /translation="MSMRGIRSGGFTMLEVLVIATIAALTASWMLPTFRRQRLQGEVDQ
FT                   YSRLVEVGLFNLRTRLREERLSHCICFEANNWAPPSSMGLERQQPDGSQAEPLNHCSEE
FT                   DPSSRLRVMNLEGSRMSKTVQARSLESKFCISPPGTSATPQTLTLLLKSIQSDSDPNLL
FT                   VRCLHMNGNGYLIRGNWNQSTQTCQPKWG"
FT   gene            complement(621396..621785)
FT                   /locus_tag="sync_0655"
FT   CDS_pept        complement(621396..621785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0655"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47090"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICE9"
FT                   /protein_id="ABI47090.1"
FT                   /translation="MIGISRVSISALTRTSIEQQRSRIEAEINSNMQLIQQANSRLTLE
FT                   SIPPLDRERACSAPEAYLISRINQAGATQHVPRPAMAERTFTITSLGEGWDVIEVAYQF
FT                   QAPEQTISTEQRMVELHPTFAPRCR"
FT   gene            complement(621869..623428)
FT                   /locus_tag="sync_0656"
FT   CDS_pept        complement(621869..623428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0656"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46560"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICE8"
FT                   /protein_id="ABI46560.1"
FT                   /translation="MLGLVLSAGASALLINQLYAKRLSSSESYQQISEAAALNGFNRIL
FT                   ALLNNPDKDQYRGFLFTIDNQENTSAANNGLTWLNLQDNPELNLEEICTDTSIGMPDHP
FT                   IASRSWPTNEIPFHTSDRKLFREDSQGKIQAFYRMRGYSSPSKTGVGEGVFEVEGVVKR
FT                   INNSGEEQMLARTLLTRSLYVNGSVSNENDWGVLTAQYLDLGPAQIVGPGSILHLVQTN
FT                   QPYLRTDGCSSDTLLTEARGQTDNDNQLGLRIWPVLNRTLPPSNLYAIRPKIDEHIWSF
FT                   DDTKNQCGPRRNRSSICIRDKTDSRRRAPMDVIREGNSVRIPATAICPGHSGDCHIYVE
FT                   HINLQKNSRLLIENDSRPVVLHMELPQGASPSPSGMSGGIQLGNNAQICGVNTGSDDSC
FT                   NNRPERLVITASSGDSPQNCQPSQQQLKIQGVSLPSAMVSLPRGSVHLTGDTQLRGMIW
FT                   SHAFCANGHQLKLTTTDIGSNQHLSMQAGELWEWKNSGFTGIGRTINRGILGTGIDTFR
FT                   QW"
FT   gene            complement(623497..623949)
FT                   /locus_tag="sync_0657"
FT   CDS_pept        complement(623497..623949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0657"
FT                   /product="possible pilin"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45261"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICE7"
FT                   /protein_id="ABI45261.1"
FT                   /translation="MGIVGILSSIALPNYFRQIQKTHQAEANATMAQMMATVAAFADEF
FT                   GTQPKRWVDLNTMTTLMTNQGPAVIEDGDLTKAITLPGERYQLNRINSMNAEKYYVFEA
FT                   IATNTAASDLNIIACIDLQTGASDQIIGRKDEAANINSLKCQGSSG"
FT   gene            624462..624554
FT                   /locus_tag="sync_0658"
FT   CDS_pept        624462..624554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0658"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46865"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICE6"
FT                   /protein_id="ABI46865.1"
FT                   /translation="MLNKFDGISCLPIGSDTAWLLSAVYEEVFD"
FT   gene            complement(624640..625146)
FT                   /locus_tag="sync_0659"
FT   CDS_pept        complement(624640..625146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0659"
FT                   /product="possible pilin"
FT                   /note="identified by match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47675"
FT                   /db_xref="GOA:Q0ICE5"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICE5"
FT                   /protein_id="ABI47675.1"
FT                   /translation="MSILNSRIQLSILSRKKEPGLVQKGFTLVELMIVIVIVGILSAIA
FT                   LPNFLNNTTKAKTTEAKTKISAILKDAHAEYQLDGEIATAIAAAEEQAEENDSDNFTYT
FT                   ADEGADDDQVTVTAEANPSADGGDATLVTAETDGTPLDGCVNLTTGKIEIRKSFKDDSD
FT                   LDCSA"
FT   gene            625239..625448
FT                   /locus_tag="sync_0660"
FT   CDS_pept        625239..625448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0660"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46535"
FT                   /db_xref="GOA:Q0ICE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICE4"
FT                   /protein_id="ABI46535.1"
FT                   /translation="MPESCLKTTGTCLHPNAANEFWLIQGLITGSGLLLDCLVTVIYIA
FT                   TFASWLPDVRMDSPFSGCYWSYAF"
FT   gene            625396..625563
FT                   /locus_tag="sync_0661"
FT   CDS_pept        625396..625563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0661"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46419"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICE3"
FT                   /protein_id="ABI46419.1"
FT                   /translation="MCVWILLLVAAIGHMLFDRLFLSTASIICNGASLCFLLPLPLPLP
FT                   LPLPLPLQVC"
FT   gene            complement(625928..627517)
FT                   /locus_tag="sync_0662"
FT   CDS_pept        complement(625928..627517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0662"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45594"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICE2"
FT                   /protein_id="ABI45594.1"
FT                   /translation="MARKQFLSTIPRKPQKQNGFAGMSELIIASGVGTLLIMASGAALR
FT                   STGTLIKQSEVKTTLRQNSINGLRLMRSEVERSMHLVLNKTESTSEDQAHINLSDSRYS
FT                   SLLSECAALAGNSLFKPMFGVKMVELTKPVLYGVSIGSGGYSIERCGAPLDPGGKYKET
FT                   ENLFLSRVIDHVGAIPCRQKSELNQGESLSTACEDNAPTLAQILASTNFTFTAGKTPNR
FT                   SERQPGLRIETDTNYKLIKFIDPTQSTEDSITQSFINKLGVGDKQLTEQPLYFTAFARA
FT                   DKRIGNFGDDGQGGPLSGAFFQNITSNKVRFAVDGSGSMSACVMWGEGYGTWRTFYDPK
FT                   EGRYRDTRRICALTRMEALISEMTMILDQLPVNTKVGITSFSSDGYMNNREWSESSNGL
FT                   VRIGNEGKRDSAIAFVNTLDDSKVTKWGGTYPWKAIQKAFDDTETDTLYLMSDGQPNRD
FT                   RNGGGWSNWDHQSTADYYANENHDRNHNGKDRALIVNSTSLGLESRWLEMLSEKTQGYY
FT                   NQIDKENLQENS"
FT   gene            complement(627614..628273)
FT                   /locus_tag="sync_0663"
FT   CDS_pept        complement(627614..628273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0663"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45276"
FT                   /db_xref="GOA:Q0ICE1"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICE1"
FT                   /protein_id="ABI45276.1"
FT                   /translation="MTQEHATEGFSLLELLVGIVIISIGLSTSIPTYIRNMRQGEVDRY
FT                   TQQIEAGFFALRAKLGKQKTSCTLRFDHSGLNNFVPPSDLVEMGEHPERLECCNSDIRA
FT                   AGEPSGCANGPQIGDLLASSITNSLQKSKVQRDRSLRLIDREGTAESQVVEVAVNSATY
FT                   ELTPPGTSTMSDNLIFLIRSTNTSEKRLRTRCLQISGTGTVLSASWNQATSSCKNR"
FT   gene            complement(628270..628809)
FT                   /locus_tag="sync_0664"
FT   CDS_pept        complement(628270..628809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0664"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46545"
FT                   /db_xref="GOA:Q0ICE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICE0"
FT                   /protein_id="ABI46545.1"
FT                   /translation="MNIKGRYRHQSQHKVTANGFTIVEVLIAGILMASALTAVGRLSVA
FT                   ALSVSAHSSARASMEAAINDNIQTMQKEDSYFTQEWIKNNDKYNFETACSSPAETLGEH
FT                   LKTIDQDPRLIVHVDSEPSSTVVSKNKPITRTFDFSTIPGILKISYSFEGPEKQIEDEI
FT                   RVIEMNPNFASQCYQT"
FT   gene            complement(628903..630528)
FT                   /locus_tag="sync_0665"
FT   CDS_pept        complement(628903..630528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0665"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46106"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICD9"
FT                   /protein_id="ABI46106.1"
FT                   /translation="MGRKLGAAESYQQMAETAALNGFNRILSELNENNHREVDSDLNKD
FT                   KQGGGDEEVKSKYKGYLFTLNHNGGNPENPGSEQWGWNPANQTNFLLRELCTDRSQLPA
FT                   AVPADAGNANPPHTDLTAGTTSQRKDGQNNIKLQYRLRGYATTATAENNGLGEGRFQIE
FT                   GIVLRDGDDPKTNYLARTLLLRSLYVNSIVVGEGDWAVLSGPTLSLGDTKILKSNLDIG
FT                   NGKVLLNVSSAEPYQKETGCDPDDLLEDVRASDNNDNLKDRIVPILGGLPTSNIWDLGL
FT                   TQDKHPGSEHVRIWTFDDTQGLQECQSIACSRDTNTATAQSRPDIEEDNAAVIRLSTNE
FT                   LCNGKGSDCHVFVEHINLTNTRLLIETSASRPVVLHLEYPGTSTVAPSETGITGSISLG
FT                   NGSELCGVNNEETTCNAEPEQLVILSAAPKPSGVRSCDSVSPQTDQYVLAFDGDSLPNA
FT                   TVHLIPGFVKTGSSGTKLNGLIWADGICTNSGPFSLMTDTNGSSSVVRDLNDLWGWENK
FT                   NFPGYGQMVTRGIRGSGLDTFRRW"
FT   gene            complement(630670..631281)
FT                   /locus_tag="sync_0666"
FT   CDS_pept        complement(630670..631281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0666"
FT                   /product="prepilin-type N-terminal cleavage/methylation
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46647"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICD8"
FT                   /protein_id="ABI46647.1"
FT                   /translation="MRQQERNQRRRIMAITNRWKTYSTAANTIKEITCDHGFTLSECII
FT                   TVAIVGTLSSIALPNYINQVNRTTQNEVVATVSQLQTTIAAYADEYGILPTSWLDLHNI
FT                   SAIMTVEGPITELKDDETKSLGDEPESVDDNTQSFEDDEIILANGNYKVGISNNINLFT
FT                   ITANREESKLNVVACINLSNGASDINRGSIKAEATTPNCG"
FT   gene            complement(631334..631888)
FT                   /locus_tag="sync_0667"
FT   CDS_pept        complement(631334..631888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0667"
FT                   /product="possible pilin"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47175"
FT                   /db_xref="GOA:Q0ICD7"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICD7"
FT                   /protein_id="ABI47175.1"
FT                   /translation="MNPLNSRMQLALINRKKSRNLLEKGFTLVELMIVIVIVGILSAVA
FT                   LPNFLSQTDKAKATEAKSVSSSYLKQIYAAYQEGGLSAANSAIGTGSIPCPADTRYFTF
FT                   SCPDPENADTNQIIATGNTTSGSLSESTITSSVYLTAQNAVTGSSGSGVEGEAGYQAPT
FT                   PDIPALSSGTIVIGNPEAGKS"
FT   gene            632003..633313
FT                   /locus_tag="sync_0668"
FT   CDS_pept        632003..633313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0668"
FT                   /product="two component sensor histidine kinase, putative"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47792"
FT                   /db_xref="GOA:Q0ICD6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICD6"
FT                   /protein_id="ABI47792.1"
FT                   /translation="MVLASSRKHLFLPSLRIGLQSAALLSVIAGYALFLAINAGLADVQ
FT                   RRDNHQRLAASLILQLRGATPPALPLENETLQIRLHSEGPDLLPQQQSLAEGQQWLVSR
FT                   RRVSTAQGDWQWLELRQNITHSLAQERFSQLSLLALAGGSILLTFVLLRLVHRRELVLP
FT                   LQELDHQFQTLDADNLGDHLLDPDHQPHELRPIALAFNNLQERLAVEWKRERSFVDGVA
FT                   HELRTPITLMSGHAQRLQRHPLPLELQRSISVVASEAKRMGVTITMLRDLSRATAGRLD
FT                   LKLENLDVDEQLLIAYERLSLVADGRLLLPTPLSTTSTTLIGDHCRVQECLDALVKNAL
FT                   LYSEGP