(data stored in ACNUC7421 zone)

EMBL: CP000436

ID   CP000436; SV 1; circular; genomic DNA; STD; PRO; 2007700 BP.
XX
AC   CP000436; AABO02000000-AABO02000064;
XX
PR   Project:PRJNA322;
XX
DT   25-AUG-2006 (Rel. 88, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 9)
XX
DE   Haemophilus somnus 129PT, complete genome.
XX
KW   .
XX
OS   Histophilus somni 129PT
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pasteurellales;
OC   Pasteurellaceae; Histophilus.
XX
RN   [1]
RP   1-2007700
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Hammon N.,
RA   Dalin E., Tice H., Pitluck S., Brettin T.S., Bruce D., Challacombe J.F.,
RA   Chertkov O., Detter J.C., Gilna P., Han S., Misra M., Tapia R.,
RA   Thayer N.N., Xie G., Inzana T.J., Duncan A.J., Siddaramppa S.,
RA   Richardson P.;
RT   "Complete genome sequence of Haemophilus somnus 129PT";
RL   Unpublished.
XX
RN   [2]
RP   1-2007700
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Hammon N.,
RA   Dalin E., Tice H., Pitluck S., Brettin T.S., Bruce D., Challacombe J.F.,
RA   Chertkov O., Detter J.C., Gilna P., Han S., Misra M., Tapia R.,
RA   Thayer N.N., Xie G., Inzana T.J., Duncan A.J., Siddaramppa S.,
RA   Richardson P.;
RT   ;
RL   Submitted (07-AUG-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 4cfcd71174474b51613ed4472df90f33.
DR   BioSample; SAMN02598486.
DR   EnsemblGenomes-Gn; EBG00001062831.
DR   EnsemblGenomes-Gn; EBG00001062834.
DR   EnsemblGenomes-Gn; EBG00001062837.
DR   EnsemblGenomes-Gn; EBG00001062840.
DR   EnsemblGenomes-Gn; EBG00001062842.
DR   EnsemblGenomes-Gn; EBG00001062844.
DR   EnsemblGenomes-Gn; EBG00001062848.
DR   EnsemblGenomes-Gn; EBG00001062850.
DR   EnsemblGenomes-Gn; EBG00001062852.
DR   EnsemblGenomes-Gn; EBG00001062854.
DR   EnsemblGenomes-Gn; EBG00001062857.
DR   EnsemblGenomes-Gn; EBG00001062859.
DR   EnsemblGenomes-Gn; EBG00001062862.
DR   EnsemblGenomes-Gn; EBG00001062866.
DR   EnsemblGenomes-Gn; EBG00001062869.
DR   EnsemblGenomes-Gn; EBG00001062871.
DR   EnsemblGenomes-Gn; EBG00001062875.
DR   EnsemblGenomes-Gn; EBG00001062877.
DR   EnsemblGenomes-Gn; EBG00001062879.
DR   EnsemblGenomes-Gn; EBG00001062881.
DR   EnsemblGenomes-Gn; EBG00001062883.
DR   EnsemblGenomes-Gn; EBG00001062885.
DR   EnsemblGenomes-Gn; EBG00001062887.
DR   EnsemblGenomes-Gn; EBG00001062889.
DR   EnsemblGenomes-Gn; EBG00001062891.
DR   EnsemblGenomes-Gn; EBG00001062893.
DR   EnsemblGenomes-Gn; EBG00001062898.
DR   EnsemblGenomes-Gn; EBG00001062900.
DR   EnsemblGenomes-Gn; EBG00001062903.
DR   EnsemblGenomes-Gn; EBG00001062905.
DR   EnsemblGenomes-Gn; EBG00001062907.
DR   EnsemblGenomes-Gn; EBG00001062909.
DR   EnsemblGenomes-Gn; EBG00001062912.
DR   EnsemblGenomes-Gn; EBG00001062915.
DR   EnsemblGenomes-Gn; EBG00001062919.
DR   EnsemblGenomes-Gn; EBG00001062922.
DR   EnsemblGenomes-Gn; EBG00001062926.
DR   EnsemblGenomes-Gn; EBG00001062928.
DR   EnsemblGenomes-Gn; EBG00001062930.
DR   EnsemblGenomes-Gn; EBG00001062932.
DR   EnsemblGenomes-Gn; EBG00001062934.
DR   EnsemblGenomes-Gn; EBG00001062936.
DR   EnsemblGenomes-Gn; EBG00001062938.
DR   EnsemblGenomes-Gn; EBG00001062940.
DR   EnsemblGenomes-Gn; EBG00001062942.
DR   EnsemblGenomes-Gn; EBG00001062944.
DR   EnsemblGenomes-Gn; EBG00001062946.
DR   EnsemblGenomes-Gn; EBG00001062948.
DR   EnsemblGenomes-Gn; EBG00001062950.
DR   EnsemblGenomes-Gn; EBG00001062952.
DR   EnsemblGenomes-Gn; EBG00001062954.
DR   EnsemblGenomes-Gn; EBG00001062955.
DR   EnsemblGenomes-Gn; EBG00001062956.
DR   EnsemblGenomes-Gn; EBG00001062957.
DR   EnsemblGenomes-Gn; EBG00001062959.
DR   EnsemblGenomes-Gn; EBG00001062960.
DR   EnsemblGenomes-Gn; EBG00001062961.
DR   EnsemblGenomes-Gn; EBG00001062962.
DR   EnsemblGenomes-Gn; EBG00001062963.
DR   EnsemblGenomes-Gn; EBG00001062965.
DR   EnsemblGenomes-Gn; EBG00001062968.
DR   EnsemblGenomes-Gn; EBG00001062969.
DR   EnsemblGenomes-Gn; EBG00001062970.
DR   EnsemblGenomes-Gn; EBG00001062971.
DR   EnsemblGenomes-Gn; EBG00001062972.
DR   EnsemblGenomes-Gn; EBG00001062973.
DR   EnsemblGenomes-Gn; EBG00001062974.
DR   EnsemblGenomes-Gn; EBG00001062975.
DR   EnsemblGenomes-Gn; EBG00001062976.
DR   EnsemblGenomes-Gn; EBG00001062977.
DR   EnsemblGenomes-Gn; EBG00001062978.
DR   EnsemblGenomes-Gn; EBG00001062979.
DR   EnsemblGenomes-Gn; EBG00001062980.
DR   EnsemblGenomes-Gn; EBG00001062981.
DR   EnsemblGenomes-Gn; EBG00001062982.
DR   EnsemblGenomes-Gn; EBG00001062983.
DR   EnsemblGenomes-Gn; EBG00001062984.
DR   EnsemblGenomes-Gn; EBG00001062985.
DR   EnsemblGenomes-Gn; EBG00001062986.
DR   EnsemblGenomes-Gn; EBG00001062987.
DR   EnsemblGenomes-Gn; EBG00001062988.
DR   EnsemblGenomes-Gn; EBG00001062989.
DR   EnsemblGenomes-Gn; EBG00001062991.
DR   EnsemblGenomes-Gn; EBG00001062992.
DR   EnsemblGenomes-Gn; EBG00001062993.
DR   EnsemblGenomes-Gn; EBG00001062994.
DR   EnsemblGenomes-Gn; EBG00001062995.
DR   EnsemblGenomes-Gn; EBG00001062996.
DR   EnsemblGenomes-Gn; EBG00001062997.
DR   EnsemblGenomes-Gn; EBG00001062998.
DR   EnsemblGenomes-Gn; EBG00001062999.
DR   EnsemblGenomes-Gn; HS_r16S01.
DR   EnsemblGenomes-Gn; HS_r16S02.
DR   EnsemblGenomes-Gn; HS_r16S03.
DR   EnsemblGenomes-Gn; HS_r16S04.
DR   EnsemblGenomes-Gn; HS_r16S05.
DR   EnsemblGenomes-Gn; HS_r23S01.
DR   EnsemblGenomes-Gn; HS_r23S02.
DR   EnsemblGenomes-Gn; HS_r23S03.
DR   EnsemblGenomes-Gn; HS_r23S04.
DR   EnsemblGenomes-Gn; HS_r23S05.
DR   EnsemblGenomes-Gn; HS_r5S01.
DR   EnsemblGenomes-Gn; HS_r5S02.
DR   EnsemblGenomes-Gn; HS_r5S03.
DR   EnsemblGenomes-Gn; HS_r5S04.
DR   EnsemblGenomes-Gn; HS_r5S05.
DR   EnsemblGenomes-Gn; HS_tAla01.
DR   EnsemblGenomes-Gn; HS_tAla02.
DR   EnsemblGenomes-Gn; HS_tAla03.
DR   EnsemblGenomes-Gn; HS_tArg01.
DR   EnsemblGenomes-Gn; HS_tArg02.
DR   EnsemblGenomes-Gn; HS_tArg03.
DR   EnsemblGenomes-Gn; HS_tArg04.
DR   EnsemblGenomes-Gn; HS_tAsn01.
DR   EnsemblGenomes-Gn; HS_tAsn02.
DR   EnsemblGenomes-Gn; HS_tAsn03.
DR   EnsemblGenomes-Gn; HS_tAsp01.
DR   EnsemblGenomes-Gn; HS_tAsp02.
DR   EnsemblGenomes-Gn; HS_tAsp03.
DR   EnsemblGenomes-Gn; HS_tCys01.
DR   EnsemblGenomes-Gn; HS_tGln01.
DR   EnsemblGenomes-Gn; HS_tGln02.
DR   EnsemblGenomes-Gn; HS_tGlu01.
DR   EnsemblGenomes-Gn; HS_tGlu02.
DR   EnsemblGenomes-Gn; HS_tGlu03.
DR   EnsemblGenomes-Gn; HS_tGly01.
DR   EnsemblGenomes-Gn; HS_tGly02.
DR   EnsemblGenomes-Gn; HS_tGly03.
DR   EnsemblGenomes-Gn; HS_tHis01.
DR   EnsemblGenomes-Gn; HS_tIle01.
DR   EnsemblGenomes-Gn; HS_tIle02.
DR   EnsemblGenomes-Gn; HS_tLeu01.
DR   EnsemblGenomes-Gn; HS_tLeu02.
DR   EnsemblGenomes-Gn; HS_tLeu03.
DR   EnsemblGenomes-Gn; HS_tLeu04.
DR   EnsemblGenomes-Gn; HS_tLys01.
DR   EnsemblGenomes-Gn; HS_tLys02.
DR   EnsemblGenomes-Gn; HS_tLys03.
DR   EnsemblGenomes-Gn; HS_tMet01.
DR   EnsemblGenomes-Gn; HS_tMet02.
DR   EnsemblGenomes-Gn; HS_tMet03.
DR   EnsemblGenomes-Gn; HS_tPhe01.
DR   EnsemblGenomes-Gn; HS_tPro01.
DR   EnsemblGenomes-Gn; HS_tPro02.
DR   EnsemblGenomes-Gn; HS_tPseudo01.
DR   EnsemblGenomes-Gn; HS_tSer01.
DR   EnsemblGenomes-Gn; HS_tSer02.
DR   EnsemblGenomes-Gn; HS_tSer03.
DR   EnsemblGenomes-Gn; HS_tThr01.
DR   EnsemblGenomes-Gn; HS_tThr02.
DR   EnsemblGenomes-Gn; HS_tTrp01.
DR   EnsemblGenomes-Gn; HS_tTyr01.
DR   EnsemblGenomes-Gn; HS_tVal01.
DR   EnsemblGenomes-Gn; HS_tVal02.
DR   EnsemblGenomes-Gn; HS_tVal03.
DR   EnsemblGenomes-Gn; HS_tVal04.
DR   EnsemblGenomes-Tr; EBT00001666170.
DR   EnsemblGenomes-Tr; EBT00001666171.
DR   EnsemblGenomes-Tr; EBT00001666172.
DR   EnsemblGenomes-Tr; EBT00001666173.
DR   EnsemblGenomes-Tr; EBT00001666174.
DR   EnsemblGenomes-Tr; EBT00001666175.
DR   EnsemblGenomes-Tr; EBT00001666176.
DR   EnsemblGenomes-Tr; EBT00001666177.
DR   EnsemblGenomes-Tr; EBT00001666178.
DR   EnsemblGenomes-Tr; EBT00001666179.
DR   EnsemblGenomes-Tr; EBT00001666180.
DR   EnsemblGenomes-Tr; EBT00001666181.
DR   EnsemblGenomes-Tr; EBT00001666182.
DR   EnsemblGenomes-Tr; EBT00001666183.
DR   EnsemblGenomes-Tr; EBT00001666184.
DR   EnsemblGenomes-Tr; EBT00001666185.
DR   EnsemblGenomes-Tr; EBT00001666186.
DR   EnsemblGenomes-Tr; EBT00001666187.
DR   EnsemblGenomes-Tr; EBT00001666188.
DR   EnsemblGenomes-Tr; EBT00001666189.
DR   EnsemblGenomes-Tr; EBT00001666190.
DR   EnsemblGenomes-Tr; EBT00001666191.
DR   EnsemblGenomes-Tr; EBT00001666192.
DR   EnsemblGenomes-Tr; EBT00001666193.
DR   EnsemblGenomes-Tr; EBT00001666194.
DR   EnsemblGenomes-Tr; EBT00001666195.
DR   EnsemblGenomes-Tr; EBT00001666196.
DR   EnsemblGenomes-Tr; EBT00001666197.
DR   EnsemblGenomes-Tr; EBT00001666198.
DR   EnsemblGenomes-Tr; EBT00001666199.
DR   EnsemblGenomes-Tr; EBT00001666200.
DR   EnsemblGenomes-Tr; EBT00001666201.
DR   EnsemblGenomes-Tr; EBT00001666203.
DR   EnsemblGenomes-Tr; EBT00001666204.
DR   EnsemblGenomes-Tr; EBT00001666205.
DR   EnsemblGenomes-Tr; EBT00001666206.
DR   EnsemblGenomes-Tr; EBT00001666207.
DR   EnsemblGenomes-Tr; EBT00001666208.
DR   EnsemblGenomes-Tr; EBT00001666209.
DR   EnsemblGenomes-Tr; EBT00001666210.
DR   EnsemblGenomes-Tr; EBT00001666211.
DR   EnsemblGenomes-Tr; EBT00001666212.
DR   EnsemblGenomes-Tr; EBT00001666213.
DR   EnsemblGenomes-Tr; EBT00001666214.
DR   EnsemblGenomes-Tr; EBT00001666215.
DR   EnsemblGenomes-Tr; EBT00001666216.
DR   EnsemblGenomes-Tr; EBT00001666217.
DR   EnsemblGenomes-Tr; EBT00001666218.
DR   EnsemblGenomes-Tr; EBT00001666219.
DR   EnsemblGenomes-Tr; EBT00001666220.
DR   EnsemblGenomes-Tr; EBT00001666221.
DR   EnsemblGenomes-Tr; EBT00001666222.
DR   EnsemblGenomes-Tr; EBT00001666223.
DR   EnsemblGenomes-Tr; EBT00001666224.
DR   EnsemblGenomes-Tr; EBT00001666225.
DR   EnsemblGenomes-Tr; EBT00001666226.
DR   EnsemblGenomes-Tr; EBT00001666227.
DR   EnsemblGenomes-Tr; EBT00001666228.
DR   EnsemblGenomes-Tr; EBT00001666229.
DR   EnsemblGenomes-Tr; EBT00001666230.
DR   EnsemblGenomes-Tr; EBT00001666231.
DR   EnsemblGenomes-Tr; EBT00001666232.
DR   EnsemblGenomes-Tr; EBT00001666233.
DR   EnsemblGenomes-Tr; EBT00001666234.
DR   EnsemblGenomes-Tr; EBT00001666236.
DR   EnsemblGenomes-Tr; EBT00001666237.
DR   EnsemblGenomes-Tr; EBT00001666238.
DR   EnsemblGenomes-Tr; EBT00001666239.
DR   EnsemblGenomes-Tr; EBT00001666240.
DR   EnsemblGenomes-Tr; EBT00001666241.
DR   EnsemblGenomes-Tr; EBT00001666242.
DR   EnsemblGenomes-Tr; EBT00001666243.
DR   EnsemblGenomes-Tr; EBT00001666244.
DR   EnsemblGenomes-Tr; EBT00001666245.
DR   EnsemblGenomes-Tr; EBT00001666246.
DR   EnsemblGenomes-Tr; EBT00001666247.
DR   EnsemblGenomes-Tr; EBT00001666248.
DR   EnsemblGenomes-Tr; EBT00001666249.
DR   EnsemblGenomes-Tr; EBT00001666250.
DR   EnsemblGenomes-Tr; EBT00001666251.
DR   EnsemblGenomes-Tr; EBT00001666252.
DR   EnsemblGenomes-Tr; EBT00001666253.
DR   EnsemblGenomes-Tr; EBT00001666254.
DR   EnsemblGenomes-Tr; EBT00001666255.
DR   EnsemblGenomes-Tr; EBT00001666256.
DR   EnsemblGenomes-Tr; EBT00001666258.
DR   EnsemblGenomes-Tr; EBT00001666260.
DR   EnsemblGenomes-Tr; EBT00001666261.
DR   EnsemblGenomes-Tr; EBT00001666262.
DR   EnsemblGenomes-Tr; EBT00001666263.
DR   EnsemblGenomes-Tr; EBT00001666265.
DR   EnsemblGenomes-Tr; HS_r16S01-1.
DR   EnsemblGenomes-Tr; HS_r16S02-1.
DR   EnsemblGenomes-Tr; HS_r16S03-1.
DR   EnsemblGenomes-Tr; HS_r16S04-1.
DR   EnsemblGenomes-Tr; HS_r16S05-1.
DR   EnsemblGenomes-Tr; HS_r23S01-1.
DR   EnsemblGenomes-Tr; HS_r23S02-1.
DR   EnsemblGenomes-Tr; HS_r23S03-1.
DR   EnsemblGenomes-Tr; HS_r23S04-1.
DR   EnsemblGenomes-Tr; HS_r23S05-1.
DR   EnsemblGenomes-Tr; HS_r5S01-1.
DR   EnsemblGenomes-Tr; HS_r5S02-1.
DR   EnsemblGenomes-Tr; HS_r5S03-1.
DR   EnsemblGenomes-Tr; HS_r5S04-1.
DR   EnsemblGenomes-Tr; HS_r5S05-1.
DR   EnsemblGenomes-Tr; HS_tAla01-1.
DR   EnsemblGenomes-Tr; HS_tAla02-1.
DR   EnsemblGenomes-Tr; HS_tAla03-1.
DR   EnsemblGenomes-Tr; HS_tArg01-1.
DR   EnsemblGenomes-Tr; HS_tArg02-1.
DR   EnsemblGenomes-Tr; HS_tArg03-1.
DR   EnsemblGenomes-Tr; HS_tArg04-1.
DR   EnsemblGenomes-Tr; HS_tAsn01-1.
DR   EnsemblGenomes-Tr; HS_tAsn02-1.
DR   EnsemblGenomes-Tr; HS_tAsn03-1.
DR   EnsemblGenomes-Tr; HS_tAsp01-1.
DR   EnsemblGenomes-Tr; HS_tAsp02-1.
DR   EnsemblGenomes-Tr; HS_tAsp03-1.
DR   EnsemblGenomes-Tr; HS_tCys01-1.
DR   EnsemblGenomes-Tr; HS_tGln01-1.
DR   EnsemblGenomes-Tr; HS_tGln02-1.
DR   EnsemblGenomes-Tr; HS_tGlu01-1.
DR   EnsemblGenomes-Tr; HS_tGlu02-1.
DR   EnsemblGenomes-Tr; HS_tGlu03-1.
DR   EnsemblGenomes-Tr; HS_tGly01-1.
DR   EnsemblGenomes-Tr; HS_tGly02-1.
DR   EnsemblGenomes-Tr; HS_tGly03-1.
DR   EnsemblGenomes-Tr; HS_tHis01-1.
DR   EnsemblGenomes-Tr; HS_tIle01-1.
DR   EnsemblGenomes-Tr; HS_tIle02-1.
DR   EnsemblGenomes-Tr; HS_tLeu01-1.
DR   EnsemblGenomes-Tr; HS_tLeu02-1.
DR   EnsemblGenomes-Tr; HS_tLeu03-1.
DR   EnsemblGenomes-Tr; HS_tLeu04-1.
DR   EnsemblGenomes-Tr; HS_tLys01-1.
DR   EnsemblGenomes-Tr; HS_tLys02-1.
DR   EnsemblGenomes-Tr; HS_tLys03-1.
DR   EnsemblGenomes-Tr; HS_tMet01-1.
DR   EnsemblGenomes-Tr; HS_tMet02-1.
DR   EnsemblGenomes-Tr; HS_tMet03-1.
DR   EnsemblGenomes-Tr; HS_tPhe01-1.
DR   EnsemblGenomes-Tr; HS_tPro01-1.
DR   EnsemblGenomes-Tr; HS_tPro02-1.
DR   EnsemblGenomes-Tr; HS_tPseudo01-1.
DR   EnsemblGenomes-Tr; HS_tSer01-1.
DR   EnsemblGenomes-Tr; HS_tSer02-1.
DR   EnsemblGenomes-Tr; HS_tSer03-1.
DR   EnsemblGenomes-Tr; HS_tThr01-1.
DR   EnsemblGenomes-Tr; HS_tThr02-1.
DR   EnsemblGenomes-Tr; HS_tTrp01-1.
DR   EnsemblGenomes-Tr; HS_tTyr01-1.
DR   EnsemblGenomes-Tr; HS_tVal01-1.
DR   EnsemblGenomes-Tr; HS_tVal02-1.
DR   EnsemblGenomes-Tr; HS_tVal03-1.
DR   EnsemblGenomes-Tr; HS_tVal04-1.
DR   EuropePMC; PMC1855741; 17172329.
DR   EuropePMC; PMC2175527; 18197260.
DR   EuropePMC; PMC2717017; 17965355.
DR   EuropePMC; PMC3096633; 21611187.
DR   EuropePMC; PMC3339403; 22111657.
DR   EuropePMC; PMC4625094; 26587237.
DR   EuropePMC; PMC5414144; 28464950.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   SILVA-LSU; CP000436.
DR   SILVA-SSU; CP000436.
XX
CC   URL -- http://www.jgi.doe.gov
CC          JGI Project ID: 2662200
CC          Source DNA and bacteria available from Tom Inzana
CC          Contacts: Tom Inzana (tinzana@vt.edu)
CC                    Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Plasmid and fosmid libraries were prepared at the Joint Genome
CC   Institute (JGI) Production Genomics Facility (JGI-PGF) in Walnut
CC   Creek, CA. Shotgun sequencing was performed at the JGI-PGF. Large
CC   (40 kb), median (8 kb) and small (3 kb) insert random sequencing
CC   libraries were sequenced for this genome project with average
CC   success rate of 96% and average high-quality read lengths of 685
CC   nucleotides. After shotgun stage, reads were assembled with
CC   parallel phrap (High Performance Software, LLC). Possible
CC   mis-assemblies were corrected with Dupfinisher (unpublished, S.
CC   Han) or transposon bomb of bridging clones. Gaps between contigs
CC   were closed by editing, custom primer walks or PCR amplification.
CC   The completed genome sequence of H. somnus 129PT contains 59147
CC   reads, achieving an average of 18-fold sequence coverage per base
CC   with error rate less than 1 in 100,000. Gene predictions were
CC   obtained using Glimmer and tRNAs were identified using tRNAScan-SE.
CC   Basic analysis of the gene predictions was performed by comparing
CC   coding sequences against the PFam, BLOCKS, COGS and Prodom
CC   databases. Gene definitions and functional classes were added
CC   manually by a team of annotators at JGI-LANL, using BLAST results
CC   in addition to information from the basic analysis. A total of 1880
CC   features have been annotated on the sequence record.
CC    The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2007700
FT                   /organism="Histophilus somni 129PT"
FT                   /strain="129PT"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:205914"
FT   gene            join(2006035..2007700,1..257)
FT                   /locus_tag="HS_1792"
FT   CDS_pept        join(2006035..2007700,1..257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_1792"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_1792"
FT                   /db_xref="EnsemblGenomes-Tr:ABI26060"
FT                   /db_xref="InterPro:IPR011093"
FT                   /db_xref="InterPro:IPR011119"
FT                   /db_xref="InterPro:IPR022391"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1C3"
FT                   /protein_id="ABI26060.1"
FT                   /translation="MFKSLIQFFKSKSNTSNIKKENAVQRQERQDIEGWITPYSGQELL
FT                   NTELRQHHLGLLWQQVSMTREMFEHLYQKPIERYAEMVQLLPASESHHHSHLGGMLDHG
FT                   LEVISFAAKLRQNYVLPLNAAPEDQAKQKDAWTAAVIYLALVHDIGKSIVDIEIQLQDG
FT                   KRWLAWHGIPTLPYKFRYIKQRDYELHPVLGGFIANQLIAKETFDWLATYPEVFSALMY
FT                   AMAGHYDKANVLAEIVQKADQNSVALALGGDITKLVQKPVISFAKQLILALRYLISQKF
FT                   KISSKGPGDGWLTEDGLWLMSKTTADQIRAYLMGQGISVPSDNRKLFDEMQAHRVIEST
FT                   SEGNAIWYCQLSADAGWKPKDKFSLLRIKPEVIWDNIDDRPELFAGTICVVEKENEAEE
FT                   KISNTVNEVQDTVPINKKENIELTSNLQEENTALQSLNPSQNPEVVVENCDNNSVDFLL
FT                   NMFSDNNEQQVMNIPSADAEAGTTMILKSEPENLNTHIEVEANAIPKLPTNDDTHLKSE
FT                   GQKFVDWLKDKLFKKQLTFNDRTAKVHIVNDCLFIVSPSSFELYLQEKGESYDEECINN
FT                   LQYEFQALGLHRKRIIKNDTINFWRCKVIGPKKESFLVGYLVPNTRLFFGDKILINNRH
FT                   LLLEE"
FT   gene            384..1181
FT                   /locus_tag="HS_0001"
FT   CDS_pept        384..1181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0001"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24282"
FT                   /db_xref="GOA:Q0I1C2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1C2"
FT                   /protein_id="ABI24282.1"
FT                   /translation="MIYPNEITRTHLLNWRNTVVGEGIKPITWNSYLRHLKCLYKFGIE
FT                   NNLLIYKENPCNNLFLRAGKPKRKILIERQLIKLDFFLSSEENLPKLLKPQWFIQALVN
FT                   TFRFTGIRRAQLLRLKIGDVDLYQKVIHISPEINKNHEYHCIPISDRLFPYIERLVIEL
FT                   RKYKQSSDSQLFNINIFRKTRYKGQITTEYQISHLFRVISNKLGFQVSPHRFRHTVATN
FT                   LMKNPNNLYVAKQLLGHKDVRVTLTYIESDVEMLREKVNSDLL"
FT   gene            1316..1393
FT                   /pseudo
FT                   /locus_tag="HS_tPseudo01"
FT   tRNA            1316..1393
FT                   /pseudo
FT                   /locus_tag="HS_tPseudo01"
FT                   /product="tRNA-OTHER"
FT   gene            1397..1475
FT                   /locus_tag="HS_tAsn03"
FT   tRNA            1397..1475
FT                   /locus_tag="HS_tAsn03"
FT                   /product="tRNA-Asn"
FT   gene            1927..3324
FT                   /gene="pncB"
FT                   /locus_tag="HS_0002"
FT   CDS_pept        1927..3324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="HS_0002"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24283"
FT                   /db_xref="GOA:Q0I1C1"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016471"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041529"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1C1"
FT                   /protein_id="ABI24283.1"
FT                   /translation="MYTSNFTNLILNVDSYKASHWLQYPKGTEYISYYIEARRESFDVV
FT                   MFGLQAFIKEYLLKPICQQDVDEAEIVLKAHGLPFYRDGWQHLIHKHQGYLPLKIEAVP
FT                   EGTVLPVGNVVCQITNTDPDFFWLVGYLETALLRAIWYPSTVASLSYFCKKQIRQALIK
FT                   SANDLSGLDFQLHDFGARGASSLETVALGGLAHLVNFKGTDSVSALIAAKRWYNINEMP
FT                   AFSIPAAEHSTITSWGKDREINAYQNMIECFGGEGKLYSVVSDSYDLWHVLEHIWGEKL
FT                   KDLVIEKGGRLIIRPDSGNPIEIICKTLEILANKFGYILNQKGYKVLPDCLRIIQGDGI
FT                   NAQSLPKILDAVMQKGFSAENVNFGMGGGLLQQVNRDTMSWAMKASAICINGQWQEIYK
FT                   DPITSQSKRSKKGVLALVKQGSDWLTIKQSELNGQTNQLQTVFFNGKLFIEENLTEIRL
FT                   RTTSFLV"
FT   gene            complement(3401..3865)
FT                   /gene="gptA"
FT                   /locus_tag="HS_0003"
FT   CDS_pept        complement(3401..3865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gptA"
FT                   /locus_tag="HS_0003"
FT                   /product="xanthine-guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.22"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24284"
FT                   /db_xref="GOA:Q0I1C0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023747"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1C0"
FT                   /protein_id="ABI24284.1"
FT                   /translation="MSEKYVVTWDMFQMHTRKLSERLLPATQWKGIIAVSRGGLFPAAV
FT                   IARELGIRHIETVCISSYDHNQQGNLNVLHAAQVKNGGEGFIVVDDLVDTGNTARAIRE
FT                   LYPNARFVTVFAKPAGANLVDDYVIDIPQNTWIEQPWDMGITFVPPLARK"
FT   gene            3990..5450
FT                   /gene="pepD"
FT                   /locus_tag="HS_0004"
FT   CDS_pept        3990..5450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="HS_0004"
FT                   /product="Xaa-His dipeptidase, Metallo peptidase, MEROPS
FT                   family M20C"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24285"
FT                   /db_xref="GOA:Q0I1B9"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="PDB:2QYV"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1B9"
FT                   /protein_id="ABI24285.1"
FT                   /translation="MSDLQSLQPKLLWQWFDQICAIPHPSYKEEQLAQFIINWAKTKGF
FT                   FAERDEVGNVLIRKPATVGMENRKPVVLQAHLDMVPQANEGTNHNFDQDPILPYIDGDW
FT                   VKAKGTTLGADNGIGMASALAVLESNDIAHPELEVLLTMTEERGMEGAIGLRPNWLRSE
FT                   ILINTDTEENGEIYIGCAGGENADLELPIEYQVNNFEHCYQVVLKGLRGGHSGVDIHTG
FT                   RANAIKVLLRFLAELQQNQPHFDFTLANIRGGSIRNAIPRESVATLVFNGDITVLQSAV
FT                   QKFADVIKAELALTEPNLIFTLEKVEKPQQVFSSQCTKNIIHCLNVLPNGVVRNSDVIE
FT                   NVVETSLSIGVLKTEDNFVRSTMLVRSLIESGKSYVASLLKSLASLAQGNINLSGDYPG
FT                   WEPQSHSDILDLTKTIYAQVLGTDPEIKVIHAGLECGLLKKIYPTIDMVSIGPTIRNAH
FT                   SPDEKVHIPAVETYWKVLTGILAHIPSR"
FT   gene            complement(5598..8168)
FT                   /gene="mutS"
FT                   /locus_tag="HS_0005"
FT   CDS_pept        complement(5598..8168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="HS_0005"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24286"
FT                   /db_xref="GOA:Q0I1B8"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1B8"
FT                   /protein_id="ABI24286.1"
FT                   /translation="MHTFENHTPMMKQYLKIKAENPDVLLFYRMGDFYELFYDDAKKAA
FT                   ELLDISLTKRGQSAGQPVPMAGVPYHAIEGYLAKLVHLGESVAICEQVGEPVIAKGPVE
FT                   RQVVRIVTPGTVSDEALLPEKQDNLIATIYQEKTQFGLAVLDMTSGCFQISELQDAASL
FT                   QAELQRIQPVELLYSEALEDKHLIEQFKGLRRRPLWEFELSTAIQLLNRQFGTKDLRGF
FT                   GVEKAVLGLCAAGCLLQYAKETQRTALPHIQSISLLQNSDTVQIDASTRRNLELTQNLA
FT                   GGTENTLAAILDKCVTPMGSRLLKRWIHQPIRNIEKLQCRQQHIQMLLQQNLVEELQPL
FT                   LRQVGDMERILARVALRSARPRDLTRLRTALEQIPFIQHQLTKIPHFVAFSQQIADFSV
FT                   QLALLQRAIIDNPPLLIRDGGVIAEGYNEELDEWRSLSEGATRYLKDLEQRERANTGID
FT                   TLKIGFNAVHGYYIQISQGQAHKAPLHYVRRQTLKNAERYIIPELKTYEEKVLKAKGAS
FT                   LALEKQLYDEIFDQLLPHLGDLQLASLTLAELDVLTNLAERAETLNYVQPQFSTQIGLQ
FT                   IMQGRHPVVEQVLKDPFIANPVELNQKRHLLIITGPNMGGKSTYMRQTALITLMAYIGS
FT                   FVPAESAVIGPIDRIFTRIGASDDLASGRSTFMVEMTEMANILHQATEQSLVLIDEIGR
FT                   GTSTYDGLSLAWACAEQLAQKIRSLTLFATHYFELTVLPEKIDGIHNVHLDAIEHNDNI
FT                   AFMHSIQEGAASKSYGLAVAALAGVPQNVIKSAKQKLKQLETLSQQNSCQSQSVLTQVQ
FT                   GELTLMEEEENTSAVIETLKTLDPNELSPKQALECLYQLKKMLN"
FT   gene            complement(8310..9125)
FT                   /gene="aroE"
FT                   /locus_tag="HS_0006"
FT   CDS_pept        complement(8310..9125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="HS_0006"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24287"
FT                   /db_xref="GOA:Q0I1B7"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1B7"
FT                   /protein_id="ABI24287.1"
FT                   /translation="MDKYAVWGNPIAQSRSPQLHRYFAKQTRQNLDYVAILGDEEKFEQ
FT                   QLSDFFAQGAKGCNITAPFKERAFKLAQQHSKRCLSAESCNTLKKLADGTLFADNTDGA
FT                   GLVSDLQRLNWLKPNQRILILGAGGATKGVLLPLLQAQQNILITNRTFSRAEDLAHKFN
FT                   HFGTIEALDLEHIPIQTFDLIINATSTGLQGKTIDIDPQILQLASAVYDMQYSKESDTP
FT                   FIALCKKQGVTKISDGFGMLVGQAAHAFYLWRGVMPEIDPLFSGNEIKI"
FT   gene            complement(9129..9707)
FT                   /locus_tag="HS_0007"
FT   CDS_pept        complement(9129..9707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0007"
FT                   /product="possible translation factor, Sua5 family"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24288"
FT                   /db_xref="GOA:Q0I1B6"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1B6"
FT                   /protein_id="ABI24288.1"
FT                   /translation="MSTYFQNNNMNITQIIEKLKQNEVVAYPTEAVFGLGCNPFSQSAV
FT                   EKLLILKQRPREKGLILVAPKLDYFFSFIDKEQINSQHWQKLQQTYPRPITWIVPAKKD
FT                   IAKFLCGNFNSIAIRVSQHPAIKILCEQTGFALTSTSANLSGIAPCKTSDEVRLQFGAD
FT                   FPVLDMSVGSAAKPSEIRDLFTNQLVRQG"
FT   gene            complement(9677..10225)
FT                   /locus_tag="HS_0008"
FT   CDS_pept        complement(9677..10225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0008"
FT                   /product="DNA topoisomerase I-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24289"
FT                   /db_xref="GOA:Q0I1B5"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1B5"
FT                   /protein_id="ABI24289.1"
FT                   /translation="MSKSLFQHTKHQEHCPQCEAVLQMKQGKKGLFLGCSNYPSCDYIK
FT                   PLHPNNESKILKNLAQNCPKCGRFLQLKQGSYGMFIGCSGYPECRFVVHEEQETTEQQI
FT                   VCPECQHGELVARHGRQGKNFYACNQYPKCKFTLAQKPHLIPCPNCQMQGAILKKEDEN
FT                   HRTWLCINKNCQHIFKTTI"
FT   gene            10359..10922
FT                   /locus_tag="HS_0009"
FT   CDS_pept        10359..10922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24290"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1B4"
FT                   /protein_id="ABI24290.1"
FT                   /translation="MNLQDHFLIAMPHLEDENFQRSVVYICENNEQGSMGLVLTQATDL
FT                   SIAELCAKMNFMMADEREYSDKLVLLGGPVNLEHGFILHKKTAQEFQHSYKVTDQIYLT
FT                   TSADIINTFGTAQSPEKYLVTLGCARWEPNQLENEIANNDWLVVPADEDILFDVDISER
FT                   WFAANQLLGIEHVNFSYQQQMEHS"
FT   gene            10922..11347
FT                   /locus_tag="HS_0010"
FT   CDS_pept        10922..11347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0010"
FT                   /product="possible endonuclease involved in recombination"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24291"
FT                   /db_xref="GOA:Q0I1B3"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1B3"
FT                   /protein_id="ABI24291.1"
FT                   /translation="MSITVLAFDFGTKSIGCAVGQSITGTAQALPAFKAQDGIPDWLKI
FT                   EKCLKDWQPNIVVVGLPLNMDGSEQDLTHLARKFANRLNGRFGVKVELQDERLTTKQAR
FT                   DEIFQRGGYRALKKEKVDSISACLILESWFENGACGE"
FT   gene            complement(11348..12106)
FT                   /locus_tag="HS_0011"
FT   CDS_pept        complement(11348..12106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0011"
FT                   /product="possible transcriptional regulator of sugar
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24292"
FT                   /db_xref="GOA:Q0I1B2"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1B2"
FT                   /protein_id="ABI24292.1"
FT                   /translation="MIPAERQKKLLKLISKQEIISINELVKLLDVSHMTVRRDIQKLEQ
FT                   EGIVVSVSGGVKLLEHLFIEPTHNDKSLLSTLQKEKIGSRAAELIPVNTTIYLDAGTTT
FT                   LEIAHNIAQREDLLVITNDFVIANFLMKHGQCELIHTGGSINKSNFSSVGELATQLLKQ
FT                   LSIDLAFISTSSWNLRGLTTPDEKKLPVKKAILQSSYNKILVSDSSKYGKTATFSICEL
FT                   NVFNSIICDDKLLLNAQESIKEMEIELILV"
FT   gene            12277..13185
FT                   /locus_tag="HS_0012"
FT   CDS_pept        12277..13185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0012"
FT                   /product="3-hydroxyisobutyrate dehydrogenase family
FT                   protein"
FT                   /EC_number="1.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24293"
FT                   /db_xref="GOA:Q0I1B1"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1B1"
FT                   /protein_id="ABI24293.1"
FT                   /translation="MNQKLFSVAVIGLGAMGMGAAKSCIQAGLDTYGVDLNLQALEILK
FT                   TAGAKQVSTSAIGFAKDLDAVLLLVVNANQVNNILFGEQGLAQHLKPKTAVMISSTISA
FT                   QDAKEISQKLTKLNLIMLDAPVSGGAAKAAQGEMTVMASGSSEAFEKLKPVLDAVSGKV
FT                   YNIGEEIGLGATVKIIHQLLAGVHIAAGAEAMALAAKAGIPLDLMYDVVTNAAGNSWMF
FT                   ENRMKHVVDGDYTPLSMVDIFVKDLGLVNDTAKSLHFPLHLASTAYSMFTEASNAGYGK
FT                   EDDSAVIKIFSGLDLPKKGGH"
FT   gene            13187..14428
FT                   /locus_tag="HS_0013"
FT   CDS_pept        13187..14428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible secretion system component"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24294"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1B0"
FT                   /protein_id="ABI24294.1"
FT                   /translation="MLGVIADDFTGASDIASFLVENGLKTVQMNGIPKTALNSKVDAIV
FT                   ISLKSRSNPVEEAIQQSLQALDWLKQNGCTQFYFKYCSTFDSTEKGNIGPVTDALMAAL
FT                   ETDFTVITPALPVNGRTIFNGYLFVGDVLLNESGMRNHPITPMKEANLVRLMDAQSQGK
FT                   TGLLTYADVIQGAERVKVRFTELKQQGYKYAVVDAVDNSQLAVLAEAVADFKLVTGGSG
FT                   LGAYIAAYRSGGQKGTNAFVPNKGKTVVLSGSCSVMTNSQVNAYKAQAPSYFLQAEQAI
FT                   NNPNYVEELYAWVVENLNGNFAPMVYATVPPEKLKEIQHQFGGDKASHAIETTFAKLAK
FT                   KLKVAGVTNFITAGGETSSIVVQELAFSGFHIGKQIAPGVPWLQAVEEPIFLALKSGNF
FT                   GKENFFSFAQGMCV"
FT   gene            14425..15057
FT                   /gene="fucA"
FT                   /locus_tag="HS_0014"
FT   CDS_pept        14425..15057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fucA"
FT                   /locus_tag="HS_0014"
FT                   /product="possible L-fuculose-phosphate aldolase, aldolase
FT                   class II family"
FT                   /EC_number="4.1.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24295"
FT                   /db_xref="GOA:Q0I1A9"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1A9"
FT                   /protein_id="ABI24295.1"
FT                   /translation="MKELEQKQQMVALARSLFERGYTVGGAGNLSVRLDKNRILVTPTG
FT                   SSLGRLEADRLSVLDMQGNVLSGDKPSKESVFHLAMYQKNPSCQAIVHLHSTYLTALSC
FT                   LEDLDTENAIRAFTPYYVMRIGKLPVIPYYRPGNFNIAKELGERALDGKAFLLANHGVV
FT                   VTGESLIDAVDNTEELEETAKLYFILQGQKVRYLTDDEVNDLKHRGK"
FT   gene            15060..15836
FT                   /locus_tag="HS_0015"
FT   CDS_pept        15060..15836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0015"
FT                   /product="possible hydroxypyruvate isomerase"
FT                   /EC_number="5.3.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24296"
FT                   /db_xref="GOA:Q0I1A8"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1A8"
FT                   /protein_id="ABI24296.1"
FT                   /translation="MPKFAANLTMMFNEVPFLDRFEAAATAGFKYVEYLWPYDYPADML
FT                   KEKLDKYGLQQVLFNTSAGNVDAGEWGVSAIPGREADSHRDIDLALEYALALGCPHVHV
FT                   MAAVVPQGEDREAYKQTFIKNVQYAADKFKPHGIKVLLEALSPEVKPNYLLKSQFDTLE
FT                   IVESVNRDNVFVQLDYFHAQNVDGNLSRLTDKLNGKFAHIQIASVPNRHEPDEGEINYQ
FT                   YLFDKLDQIGYQGFIGCEYKPRSDTLAGLDWFKPYK"
FT   gene            15963..16910
FT                   /locus_tag="HS_0016"
FT   CDS_pept        15963..16910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0016"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24297"
FT                   /db_xref="GOA:Q0I1A7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1A7"
FT                   /protein_id="ABI24297.1"
FT                   /translation="MKIVITGGQGFLGQRLAKTLLSNSTLSINELVLIDVIKPIAPNND
FT                   PRVRCLEMDLRNPEGLDEIITEKTTALFHLAAIVSSHAEQDPDLGYEINFLATRNLLEV
FT                   CRKNNPKVRFIFSSSLAVYGGNLPEIIQDHTAVTPQSTYGSQKAMCELLINDYSRKGFV
FT                   DGIVVRLPTICIRPGKPNKAASSFVSSIIREPLQGEEAICPVSSDLRLWLSSPNTVINN
FT                   FIHALTLPSLPQRSWHIINLPGFTVSVKQMLSDLASIKGENILEKVRFEFDENINNIVA
FT                   SWPAEIDNKTALKHGFNVDADFKEVIQQFIKNDM"
FT   gene            16926..18398
FT                   /gene="gntP"
FT                   /locus_tag="HS_0017"
FT   CDS_pept        16926..18398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntP"
FT                   /locus_tag="HS_0017"
FT                   /product="GntP family permease (gluconate uptake protein)"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24298"
FT                   /db_xref="GOA:Q0I1A6"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1A6"
FT                   /protein_id="ABI24298.1"
FT                   /translation="MFDLPIPIIGLLIAVFVLVYLVLKTRVHAFIAMLIASAIAGLIGG
FT                   MSVNETLGAISKGFGGTLGGIGIVIGLGVMMGSVLEVSGAAEKMAYSFIKLLGKKKEEW
FT                   ALAITGYIVSIPIFVDSAFVILYPVAKALAKNGKRSLLTLGVALAGGLVVTHHTVPPTP
FT                   GPLGVAGLFAVDIGAMLLVGMALAILPVIGIVLYAKWLDKKYPEFNQQVFTQEELKQKY
FT                   DDYIESREKKNLPSLGLSLLPIVLPIVLIFIKAMFDLTAKGHAELAQMGVYQFFAFVGH
FT                   PMIALAISVLVAVYTLLPKADRDSTALHLEEGVKTAGIILLVTGAGGALGAVLRDSGAG
FT                   KQLAEQIASLPISPILIPFIVSTLVRFIQGSGTVAMVTAASISAPILAQIPGVNMLLAA
FT                   QAATMGSLFFGYFNDSLFWVVNRMMGINDVKKQMIVWSVPTTIAWGIGGISVILCNLVW
FT                   GNDGSLFDLLFPIAVMAIIAFYIKFQNRTLNK"
FT   gene            complement(18540..18716)
FT                   /locus_tag="HS_0017a"
FT   CDS_pept        complement(18540..18716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0017a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0017a"
FT                   /db_xref="EnsemblGenomes-Tr:ABI26061"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1A5"
FT                   /protein_id="ABI26061.1"
FT                   /translation="MNHLDSAQETLSLYAQQIITLNHRFYEEFNRVMEMMIGNPYSTLV
FT                   RLLLRAKLYSHWN"
FT   gene            19007..20050
FT                   /locus_tag="HS_0018"
FT   CDS_pept        19007..20050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24299"
FT                   /db_xref="GOA:Q0I1A4"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1A4"
FT                   /protein_id="ABI24299.1"
FT                   /translation="MKYITSKHVFFDYLNENEFVIGIGSNQEITNNKDYFNNCLNLCYF
FT                   CINPKSISEILSFIKDNNIDILYFDKMKKMKFITKEIIDFNDRYSRNHLYYNALGYKIY
FT                   DIQNKISKSHILIVGAGGIGNICSYLLGTIGIKKLSIIDDDIVEESNLNRQFLFREKDI
FT                   NKNKVETIKRELLSIRKDIIIDIFPEKLNKSILDKISQIDLVICSADDEYCIDMINEFC
FT                   CFNKIPLINVGYLNDISVIGPFYIPKLEYSCCLCCDKSIYLENDVIDEKVKKIKSVTKA
FT                   PSTIINNFFAGAMLGSELIKFFACDYKSMQSINSVIGIHNKNFKYEEIKLARNYNCKYC
FT                   GVNNETL"
FT   gene            20037..21212
FT                   /locus_tag="HS_0019"
FT   CDS_pept        20037..21212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0019"
FT                   /product="permease, major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24300"
FT                   /db_xref="GOA:Q0I1A3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1A3"
FT                   /protein_id="ABI24300.1"
FT                   /translation="MRHYEKIITSCVSTSATRMLIGAVSTIYMLVSGINLYEVGLIKST
FT                   QAILIFVLGFAVGILSDRIERKWLHITALIFSTFWLYFFYLAGLYKSFNLFLLAEILNA
FT                   ISLCVYQNNTNAYLVDQFYHEQPKGELSLALGKLGKWEFSLMAFSALLGGVLYSTLSEN
FT                   LFLLTTIIMSTVTVASFILLPKVSRRATHKTLPFIQKQDFLILIRKFSRYKQAIFLFVV
FT                   LSLYFQIIIQYWQAVVYAINKSEQNGLILGGMLFSMFMVQSWAGKAIEVKYPFSRLTLA
FT                   LSFLSSMVLSFFAERWQSVFFYTIAICLALFVVRYTVIQTDTELHRHLLSRFRAKYDML
FT                   LNSLVRILTAVVLLIIGYISNLYGIQAIQIIGLIIAIIFTLFALITSQNVK"
FT   gene            complement(21510..22280)
FT                   /gene="uxuR"
FT                   /locus_tag="HS_0020"
FT   CDS_pept        complement(21510..22280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uxuR"
FT                   /locus_tag="HS_0020"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24301"
FT                   /db_xref="GOA:Q0I1A2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1A2"
FT                   /protein_id="ABI24301.1"
FT                   /translation="MPISRGFMQNNSRTYTKIGKILKEEISQGKYKIGDKLPTERNISE
FT                   RFEVSRTIVREAIVMLEVEKIIEVRKGSGIYVIKIPDLLQEEADNKLRDVGPFELLQAR
FT                   QLLESSIAEFAAQQVTKQDILRLRQILDKEKELFAQNIDDCSADKEFHLALAEITGNDV
FT                   LIQTQEQLWKYRFNNAMWTQLHSRIIHNDLHHLWIKDHETILNAIQRKNPALARKAMWQ
FT                   HLENVKTKLLELSDVEDTNFDGYLFNVNPVIVGI"
FT   gene            22388..23446
FT                   /locus_tag="HS_0021"
FT   CDS_pept        22388..23446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0021"
FT                   /product="Zn-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24302"
FT                   /db_xref="GOA:Q0I1A1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1A1"
FT                   /protein_id="ABI24302.1"
FT                   /translation="MSINFVKEGNIMSKYVRSVCLVEPKKVDIKTVLYPKKGECDVLIK
FT                   VESIGICGSDIGAFRGTNPLVTYPRILGHEIVGTVIESGVGMPKNINIGDRVILEPYIY
FT                   CGHCYPCSISRTNCCEALKVLGVHIDGAMQEIVRHPAHMLIKAPDIPIHELALAEPLTI
FT                   SLHAIRRTKVKAGEHVAIIGAGAIGLMAALVAKAYGATPILIDILDKRLDYAKSIGIPN
FT                   IINPAKENDLEAIKSITNGRMAEVVIEASGANIAVQNTLKYTSFAGRIALTGWPKNETP
FT                   LPTNLITFKELNIYGARTSKGEFEEALKLLESRKIEPKNIISKVITFDEIPHYIEELSE
FT                   NPDDYLKIIAVF"
FT   gene            23475..24458
FT                   /locus_tag="HS_0022"
FT   CDS_pept        23475..24458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0022"
FT                   /product="dicarboxylate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24303"
FT                   /db_xref="GOA:Q0I1A0"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1A0"
FT                   /protein_id="ABI24303.1"
FT                   /translation="MKLKKLTKVLVVAGLVFSSSAFAKTVIKIGHFNSDMHPSNIVLNE
FT                   VFKKTVEEKTQGRYEIRIFPNNQLGGEDQIVNGLRNGTIEGGITGLLLQNVDPIFGVWE
FT                   MPYLFKDNVEAKKVLESPIAKEIGDKMEQYGIKLLAYGMNGFRVISSNKKLEKFDDFKG
FT                   LRLRVPLNSLFVDWAKAMNINPQSMPLSEVFTALEQKVIDGQENPYMLLKDSGLYEVQK
FT                   YIIQTNHIFSPGLLQLSLKTWNKMSKEDQEIFLEAAKLYQEKEWELAMKMEQDVKDFFH
FT                   KNGKEVIIPSEQFKADMLKASETLYQNFYQKYDWAKGVIEKIQAAK"
FT   gene            24523..25002
FT                   /locus_tag="HS_0023"
FT   CDS_pept        24523..25002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0023"
FT                   /product="permease (transport protein)"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24304"
FT                   /db_xref="GOA:Q0I199"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I199"
FT                   /protein_id="ABI24304.1"
FT                   /translation="MKFSTALDRTLKMLAVIALVTMILLVFFNAMLRYFFDSGIAWSEE
FT                   FARICFVYMIFLGIILVAKERGHLTVDIVISYLPAYVQMYTLFFADILVLLALSFITYG
FT                   AYQLMLLTYTQKMPATEISTAFLYLAAVISSLSYFLVVFTNLWKHLKLAFRGGKA"
FT   gene            24999..26273
FT                   /locus_tag="HS_0024"
FT   CDS_pept        24999..26273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0024"
FT                   /product="permease (transport protein)"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24305"
FT                   /db_xref="GOA:Q0I198"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I198"
FT                   /protein_id="ABI24305.1"
FT                   /translation="MMLGLFLGSLFLFLFLGVPVALSMLLSASFMLWHMDMFDTQLIAE
FT                   NFVMGTNNFPLMAIPFFMLTGEIMKYGGISERIINFAMSMVGHIKGGLGYVVIISGLIF
FT                   AGLSGSAVADTAALGAILIPMMVAKKYDVARSTGLVCAAGIISVVIPPSIPMIVYGITA
FT                   GASITKLFMGGTVPGLLMVTGLWLMWKFLYRNHEENIKPKQSGAERWQAFKKAFFPLLL
FT                   PVIIIVGLRGGIFTPTEAGVVAAIYAGLVSLGYRSLNKENLIEVFLNTIKTTSMVMFVA
FT                   AAAMISAFAITVAQIPTELVQFIKGLTDNSTVLMLVIMIFLLLVGCVMDLIPAVLIFVP
FT                   VLLPVLRAYNIDIAYFGIMMVINLSIGLITPPVGTVLYVGSGIAKLGISKISKGISPFL
FT                   LVYVAILMLMVFFPDVVIVPMNWLS"
FT   gene            26460..27107
FT                   /locus_tag="HS_0025"
FT   CDS_pept        26460..27107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0025"
FT                   /product="allophanate hydrolase, subunit 1"
FT                   /EC_number="3.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24306"
FT                   /db_xref="GOA:Q0I197"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I197"
FT                   /protein_id="ABI24306.1"
FT                   /translation="MLTIHHTSEQSLLCEIAPPAELAKQQRIWQIAEQARQLANVQEVV
FT                   VGMNNFTVYYDLFADSQPLIESLQSLWENYQPQSVKTPRCIEIPVHYGGEFGEDLFDVA
FT                   QFHQTTPKEIIRRHTEPVYTVFMIGFQAGFPYLNGLPENLYTPRRDIPRTKVPAGSVGI
FT                   GGSQTGIYPFTSPGGWQLLGRTDLALFDIQQSPPTLLSAGDNVRFVAESIQL"
FT   gene            27104..28033
FT                   /locus_tag="HS_0026"
FT   CDS_pept        27104..28033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0026"
FT                   /product="allophanate hydrolase, subunit 2"
FT                   /EC_number="3.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24307"
FT                   /db_xref="GOA:Q0I196"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I196"
FT                   /protein_id="ABI24307.1"
FT                   /translation="MIYIKQVQGFAHIQDLGRYGFRSLGIGHSGAMDSLALQAGNLLLK
FT                   NANNAPAIEITLGGMSLTFDCDTPFCFTGALVEAELDGMPVFSYFRYTAKVRQTLTLKR
FT                   IIKGNYTYLCVAGGFLVPQVQGSASTDLRAQFGGYQGRMLRAGDCIPTVLRDIQLSFLS
FT                   IEPIDFTHKIGTTLSSEYEAFTTESRERFFQQRWVLQNNSSRMGYRFAENSLKLTAPLE
FT                   MLSYAAPAGTVQVPPDGQPIVLMADAQTTGGYPKIACVISADLGRLAQTSIGSAVQFEL
FT                   LTRKQAVARFKQDQNYLEDIRRKVNETD"
FT   gene            28020..28763
FT                   /locus_tag="HS_0027"
FT   CDS_pept        28020..28763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0027"
FT                   /product="lactam utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24308"
FT                   /db_xref="GOA:Q0I195"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I195"
FT                   /protein_id="ABI24308.1"
FT                   /translation="MKQIDLNVDLAEGCANDQQLLQLVSSANVCCGLHAGDYNEIRKAI
FT                   LWAKENDVRIGAHPSFPDRENFGRTNMQLPDDELKACLFYQLGAVKALCDASGVTMEYV
FT                   KPHGALYNMAAKDPHLAALIAETVKSVDPSLKLMGLSGSIMLTVAEQHGLATISEVFAD
FT                   RHYLADGSLVPRTRDDAMVENDEEAISQVLQMVLEGTVPTVDGGNVAIKADSICLHGDG
FT                   EHAVVFAKRIRRELKEKGILVTSSI"
FT   gene            28889..30076
FT                   /locus_tag="HS_0028"
FT   CDS_pept        28889..30076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0028"
FT                   /product="permease (transport protein)"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24309"
FT                   /db_xref="GOA:Q0I194"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I194"
FT                   /protein_id="ABI24309.1"
FT                   /translation="MSNNNRSALIGAAFLMATSAIGPGFLTQTATFTQNLFASFGFVIL
FT                   LSILLDIGAQLNIWRIIAVSEKKAQDVANAVLPGAGYFLALLIVMGGLAFNIGNVGGAG
FT                   LGLNILTGVSPEKGAIISGIIAVGVFLFREAGKVMDRFAQIMGFVMIALTVFVAVKANP
FT                   PIADAVVHTFLPEKLDVIAIVTLVGGTVGGYITFAGAHRLLDAGIKGKENLKEVSRSSV
FT                   SAILIASIMRVVLFLAVLGVVSMGVQLDPKNPASTPFAYVAGNVGLMIFGIVIWAASIT
FT                   SVIGAAYTSVSFITSFSPFIEKHKNCFIVAFIVISTVVLATIGRPAQVLVFVGTLNGLI
FT                   LPISLGLVLLAAYKTNIVGNYKHPIWMTIAGAIVVVSMAILSIITLSKYVFGLFT"
FT   gene            30320..31048
FT                   /gene="araC"
FT                   /locus_tag="HS_0029"
FT   CDS_pept        30320..31048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC"
FT                   /locus_tag="HS_0029"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24310"
FT                   /db_xref="GOA:Q0I193"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I193"
FT                   /protein_id="ABI24310.1"
FT                   /translation="MLQLTTFGTGIIFDGKHSFSTHRGQLLLFTPSAVQHYHRHPESQY
FT                   WHYKWIYFLPNPKWNKWLNWSNIEEKIGRITIGDDRYFQEISQLFSKIEVELKSSKFFK
FT                   EDVATSLLEYLLMKSISAEKIEVIPVIDQRILNVCDLILTNLAKNDSLEALAKKVFLSP
FT                   SRLSHLFKQSLGIGLVQWREVQRISEAKKLLYFSNISISNIAKSLGYEDSLYFSKIFKK
FT                   HTALSPSKFRTLERCKNNEM"
FT   gene            31236..32210
FT                   /locus_tag="HS_0030"
FT   CDS_pept        31236..32210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0030"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24311"
FT                   /db_xref="GOA:Q0I192"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I192"
FT                   /protein_id="ABI24311.1"
FT                   /translation="MKKLTLKHTLFSGILALTCYGSVLANDVVNISKIDGMPWFNRMAE
FT                   GVVQAGKDNNINAYQVGPSNTDAPQQVKLIEDLIAKKVSAISIVPNDANALEPVLKKAK
FT                   QNGIVVLTNESVGQPSADWDIEIIDNAQFAADYVEEVAKAMGGKGGYVIYVGGLTVPQH
FT                   NLWADLFVKYQKEHYPDMFEVTSRMPVAENINDARRTTIDLVKAHSDLKAVVSFGSQGP
FT                   IGAGLAVKEKRLKNKLNVFGMMIPSQAANLIKSGDITMGITYDPASAGYALAAVAAKVL
FT                   KGEKIEDGLELPNVGKAKVDTEKKLLQFHNVLKVTKDNIDNLY"
FT   gene            32278..33753
FT                   /locus_tag="HS_0031"
FT   CDS_pept        32278..33753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0031"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24312"
FT                   /db_xref="GOA:Q0I191"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I191"
FT                   /protein_id="ABI24312.1"
FT                   /translation="MQNINKTFHGVKALNRVNLSLDYGEALCLAGQNGCGKSTLIKILS
FT                   GVYQPDKGAEIQIGASKYTKLTPQASIEQGIQVIYQDLALFPNLTVAENIAINLHRKLG
FT                   WVSQSEIHQVALNAILSINADLDLNAILEDLPIAQQQLVAICRALAQNARLLIMDEPTA
FT                   SLTAKEVQDLLKVVLKLKSKGISIIFVSHKLQEVMSVSDTVLVLKNGNMVGQYPISEMD
FT                   EKRLGFLMTGLEIDYKRLDLPDFSQNRTVLEVQNLTLPNQYESINFSLREGEIIALTGL
FT                   LGSGRTELCLSLFGITQPKSGDILLNGEKVIFQNNRDAIKQGIAYVSEDRMTTGLIMTE
FT                   SIHHNIISTIFHKITDKFNIIKSSKAYNYSQELIESLKIKVTDSDLPVNTLSGGNAQRV
FT                   SIAKWLAIDPRIIILDAPTIGVDIANKEGIFQIIRTLAQKGIAVIFVTDEVEEAYYNSH
FT                   KVIVMKKGKIVGEILPIYTTEKSIAEVVYENHQ"
FT   gene            33722..34696
FT                   /locus_tag="HS_0032"
FT   CDS_pept        33722..34696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0032"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24313"
FT                   /db_xref="GOA:Q0I190"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I190"
FT                   /protein_id="ABI24313.1"
FT                   /translation="MRRLFMKITNNHILSTTILILATLLSLFTNDFATIENIYDVVNNY
FT                   SMLMILACGLFVVLLSGGIDISFPAITIISQYIMVTAIGKYDIGFFGVFAVSSAIGILL
FT                   GFINALFVNRLSVPSIIITISTLNIFYGGLLYFTKGVWLYDYPEWFTQELLFFKQTSQD
FT                   GFEFGLSFQAIMAILSILLTWLITSRLTIGRKIYALGGNQDATSRIGFNILFLHLFAYG
FT                   YMGFMAGIAGIVQSYTVQSVAPDSLLGYELTVLAAVVLGGASLSGGKGTLFGTVMGVML
FT                   LAIIQNGLNLMNVSSYWQTIITGIIIILSISATALGQLKKQGV"
FT   gene            34699..35649
FT                   /locus_tag="HS_0033"
FT   CDS_pept        34699..35649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0033"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24314"
FT                   /db_xref="GOA:Q0I189"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I189"
FT                   /protein_id="ABI24314.1"
FT                   /translation="MRSKFDHTIFYLLALFIITVIAFSILIPDIFWSVSNFQSMASQIP
FT                   VLGILTLAMALPMLTGGINLSIIASMNACSLIIACFITKHAGISWLFLSIVLSFLCALI
FT                   IGVINGALIAIIRVSPILATLGTMTLINGINILVTNGSTVAGFPEIILSINTSTFLWLP
FT                   LPILIFLFLAGLVWFFLEKTSMGKAVYFIGNNEKATYYSGINTKKVLIWIYIISSVLCV
FT                   FAALLMMSKLNSAKASYGDSYLLISILAAVLGGFNPDGGKGKLIGIMLALVLLQVIESG
FT                   LNMLGISSYITMILWGSLLLLFIFLQKNRLFLLKN"
FT   gene            35662..37254
FT                   /locus_tag="HS_0034"
FT   CDS_pept        35662..37254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0034"
FT                   /product="sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24315"
FT                   /db_xref="GOA:Q0I188"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="InterPro:IPR042029"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I188"
FT                   /protein_id="ABI24315.1"
FT                   /translation="MQNEKQLIEQGNIVIGIELGSTRIKAVLITSDGTILATGGADWEN
FT                   RLIEGVWTYHQHEIWEKLQAAYVDLSKTVKAKYHTTIRTAKALGISAMMHGYLPFDKQG
FT                   NQLVPFRTWRNNITLKSSEKLTALFQYPIPQRWSIAHLYQALLNKEPHLSEIDYITTLS
FT                   GYVHWQLTENKVLGIGDASGMFPIDTEMQSYNKTMLTQFEQAIIEYQMPWRLDAILPKV
FT                   LVAGEHAGKLTFKGAKLLDPTGNLQAGIPLCPPEGDAGTGMIATNCIKEKTGNISAGTS
FT                   AFAMIVLEKALSKVYSELDIVTTPAGKLVAMAHANNCTSDINAWINLFGECLATFGVYV
FT                   CMEELYEMLFLHALQGEPDCGGLLSYGFYSGEHNVGLSEGCPVFLHPTKARFNLANFMR
FT                   THFYTAFGAMKLGMDILINQEKVEISRILGHGGIFKTEGVAQKILSSALNIPLATASTA
FT                   SNGGAWGIALLANFLTISKRYNLEEYLDNCIFNTTKLNLIQPDKIMSEGYERFMQRYKQ
FT                   GISIVESALFLNQ"
FT   gene            complement(37376..38092)
FT                   /locus_tag="HS_0035"
FT   CDS_pept        complement(37376..38092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0035"
FT                   /product="peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24316"
FT                   /db_xref="GOA:Q0I187"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011906"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I187"
FT                   /protein_id="ABI24316.1"
FT                   /translation="MEGKKVPQVTFRTRQGDQWVDVTTADLFDNKTVVLFSLPGAFTPT
FT                   CSATHLPRYNELACEFKALGVDDIICVSVNDTFVMNAWKADQESENVTVIPDGNGEFTS
FT                   GMGMLVDKTELGFGKRSWRYSMLVKNGVVEKMFIEPQEPGDPFKVSDADTMIKYLNPNW
FT                   TEKPSVSIITKPGCPFCAKAKTLLKEKGYTFEEIILGRDASTISVRAITGKTSVPQVFI
FT                   GGQYIGGSDDLAQYFA"
FT   gene            38221..39135
FT                   /gene="oxyR"
FT                   /locus_tag="HS_0036"
FT   CDS_pept        38221..39135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxyR"
FT                   /locus_tag="HS_0036"
FT                   /product="hydrogen peroxide-inducible genes activator"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24317"
FT                   /db_xref="GOA:Q0I186"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I186"
FT                   /protein_id="ABI24317.1"
FT                   /translation="MNIRDLEYLVSLAEHKHFRRAADACYVSQPTLSGQIRKLEDELGI
FT                   VLLERTSRKVLFTQSGLLLVKQAKTVLREIKLLKEMASNQGKEMNGPLHMGVIPTIGPY
FT                   LLPYIVPALKNTFPDLELFLYEAQTQKLLEQLETGHLDCVILASVDEAEAFIEVPMFNE
FT                   RMLLAVSDEHPLSKEDSIKMDKLKGYEMLMLDDGHCLRNQALDYCFAAGAKENQNFRAT
FT                   SLETLRNMVSANTGITLIPELALLNEGSRKGIKYLPCFSPEPSRGISLVYRPGSPLRGR
FT                   YERIANKVSEIIKPLLNNRKNGN"
FT   gene            complement(39262..39657)
FT                   /gene="mscL"
FT                   /locus_tag="HS_0037"
FT   CDS_pept        complement(39262..39657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="HS_0037"
FT                   /product="large-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24318"
FT                   /db_xref="GOA:Q0I185"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I185"
FT                   /protein_id="ABI24318.1"
FT                   /translation="MSFIKEFREFAMRGNVIDMAVGVIIGGAFGKIVSSLVADVIMPIL
FT                   SFFTSSVDFKDLHIVLKEATDKTPAMTLKYGMFIQNIFDFIIIAFAIFLMIKALNKLKK
FT                   EEPKVEKVITPSNEEKLLTEIRDLLKK"
FT   gene            complement(39742..41118)
FT                   /gene="trkA"
FT                   /locus_tag="HS_0038"
FT   CDS_pept        complement(39742..41118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="HS_0038"
FT                   /product="Trk system potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24319"
FT                   /db_xref="GOA:Q0I184"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I184"
FT                   /protein_id="ABI24319.1"
FT                   /translation="MRIIILGAGQVGTTLAENLVSEDNDITLIDNDAVRLAHLQDKHDL
FT                   KVINGSASSPRILREAGAPDADLLVAVTSSDETNMISCQIAYTLFNTPTKIARIRDAEY
FT                   WREKDKLFQPHMIPIDHIISPEQLVTEEISRLIDYPGALQVAHLANENISIVVVKAYYG
FT                   GPLVGYSLSALKDHMPHIDCRILSILRQDKVIRPQGSTIIEAGDEVTFICATIYIKAVM
FT                   SELQRLEKPYKRVMIIGGGNIAVGVAKKLENHCTVKLIERNAERATSLAEKLSKTLVLH
FT                   GDPSDKSLLFEEHIENIDAFLCLTSDDETNIMSAFLAKHLGAKKAMVLIQRMAYINLVQ
FT                   GGTIDIAVSPQQATISALLGHVRKGDIANAISLRHGIAEALEIIVHGDEKTSQVIGRKL
FT                   RELKLPNGAIIGAILRQDTVIIARKDAVIESGDHVIVYLSDKKYVTEIEKLFQPNAFFI
FT                   "
FT   gene            complement(41203..42591)
FT                   /gene="rsmB"
FT                   /locus_tag="HS_0039"
FT   CDS_pept        complement(41203..42591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmB"
FT                   /locus_tag="HS_0039"
FT                   /product="16S rRNA m(5)C-967 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24320"
FT                   /db_xref="GOA:Q0I183"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I183"
FT                   /protein_id="ABI24320.1"
FT                   /translation="MSKSQHNKTKRAVKSTALFTPRSVRVLAAEVILQVLVQGKSLSTL
FT                   LPEQQSAVKPQDFPLLQEICFGICRVLPRLERIIQLLLDKPLKGKTRIVHCLLLVGLYQ
FT                   ILYTRIPAHAAVDEVVSATKSLKSDSFRGLLNAVLRRFLREQEQILAIVDKHWQTLHPE
FT                   WLVNKLKQSYANWREIVEANNQKPPMWLRINLQHCSIADYQQLLMERGISTSTTNHPQA
FT                   LRLHQASAVNLLPYFEQGWVSVQDLHAQWSALLLEPENNELILDACAAPGGKTTHILEQ
FT                   APNAKVIALDIEPARLQRVKENLVRMKQQAIIICGDATQPEQWLSEIDFNAIGLTFKSE
FT                   SAVQFDRILLDAPCSATGVIRRHPDIKWLRQESDITPLVQLQGQILEALWKKLKPQGIL
FT                   VYATCSLLPEENSQQIQHFLTKHNDAKLEPLPFTIGEEIGHQFVPTEQGGDGFYYAKLR
FT                   KLPN"
FT   gene            complement(42588..43541)
FT                   /gene="fmt"
FT                   /locus_tag="HS_0040"
FT   CDS_pept        complement(42588..43541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="HS_0040"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24321"
FT                   /db_xref="GOA:Q0I182"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I182"
FT                   /protein_id="ABI24321.1"
FT                   /translation="MKPLNIIFAGTPDFAAQHLQALLQSQHNVLAVYTQPDKPAGRGQT
FT                   LRASAVKILAEKHHIPVYQPKSLRKVEVQENLSKLNADVMVVVAYGLILPLAVLQTFPL
FT                   GCLNVHGSLLPRWRGAAPIQRAIWAGDKKTGVTIMQMNEGLDTGDMLHKVCCDITPTET
FT                   STSLYTKLANIAPKALLEVLDGLEQSLFKAEVQDESLSNYAEKLSKEEAKLDWSLSAEQ
FT                   LERCIRAFNPWPMSYFVTQDSQGTLQTLKVYQASVLPHQDKPCGTILAADKRGIQVATA
FT                   NGVLNLEQLQPAGKKPMSARDLLNSRADWFKIGQVL"
FT   gene            complement(43616..44128)
FT                   /gene="def"
FT                   /locus_tag="HS_0041"
FT   CDS_pept        complement(43616..44128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="HS_0041"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24322"
FT                   /db_xref="GOA:Q0I181"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I181"
FT                   /protein_id="ABI24322.1"
FT                   /translation="MALLNVLIYPDERLKTVAEPVSVFDEELQTFIDNMFETMYHEEGI
FT                   GLAATQVNVHKRIITIDIEGTKENQIVLINPEILESFGETGIEEGCLSLPGLRGFVPRK
FT                   ETVKVKAQNRQGEDFMLDADGLLAICIQHEIDHLNGIVFADHLSPLKRQRMKEKLLKLQ
FT                   KQIAKNR"
FT   gene            complement(44316..44945)
FT                   /gene="narP"
FT                   /locus_tag="HS_0042"
FT   CDS_pept        complement(44316..44945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narP"
FT                   /locus_tag="HS_0042"
FT                   /product="nitrate/nitrite response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24323"
FT                   /db_xref="GOA:Q0I180"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I180"
FT                   /protein_id="ABI24323.1"
FT                   /translation="MSDKTKVLLIDDHPLMRRGIKQLLELDESFEVIGDAGSGSEGVNL
FT                   ALQLEPDLIILDLNMKGLSGLDTLKALRTEGIDARILILTVSDAKNDIFTLIDAGADGY
FT                   LLKDTEPDTLLSQIKRVTQGEVILSESIKNLLLERQHKDDPIYSLTDREMNVLALIATG
FT                   LANKQIAGQLFISEETVKVHIRNLLRKLNVHSRVAATVLYFQHKGV"
FT   gene            complement(44960..47470)
FT                   /gene="cyaA"
FT                   /locus_tag="HS_0043"
FT   CDS_pept        complement(44960..47470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaA"
FT                   /locus_tag="HS_0043"
FT                   /product="adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24324"
FT                   /db_xref="GOA:Q0I179"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="InterPro:IPR024686"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I179"
FT                   /protein_id="ABI24324.1"
FT                   /translation="MKYDLQQAKKQVEFVDQLRLERALSSTSVEFQRVLQLLTLLLHIN
FT                   HPLMGGYLPNAPHGIARFQLSKYQQEFLTTHLPQGDFEQLSTHLAALQHLTDTPILGVY
FT                   VMGSIGSISQTPSSDLDIWVCHREDLSLEDKEQLSKKNYLLQQWARSLGVEINLYLIDQ
FT                   QRFRSFRYADALTSENSGSAQYMLLLEEFYRSVIRLAGKPLLWLHLKVANEQDYSSEVN
FT                   RLIKTKQINIDDWVDFGCLSAFSANEYFGASLWQLYKGIDSPYKSVLKILLLESYSYEY
FT                   PNTHLIAQEFKQRLLNNDLDYHYDPYLAMLERVSSFLTKLNEFKRLDFVRRCFYMKASE
FT                   YIVQQQENNWRSKKLHQLTQQWNWSDNLLQNLNQRTTWKIKKVKESHNDLMQYLMLSYR
FT                   NLINFGRKHNVNASIMPQDVSILTRKLYTAFEELPGKITLLNQAISLDLSEPHLTFIEV
FT                   KQNKFFKAGWYLVTQKPDVQGLCQKRHIEYGENLNKLVSWAYFNGLLTPITSLYIHSDT
FT                   VSLKTLRNFVADLRLSFPITRTKKATNKELTQQCKIKHLSVTINLTNDPTAHLLQSKST
FT                   ILPSDLFSFGPSEESLVGSIDLTYRNIWNEIRTLHFEGANAILLALKVLSNKIYPGSTP
FT                   PKSINVFCYSQHYQKTLCNIVHALIKKYIDIRIGDTDAPKNNMLRIAGKNWQLFFEERG
FT                   LSLQEMQNTSINNSVFDNELRNTIEEKETALLAEQKHYPYEMDAFASEGFLQFFFEDNE
FT                   DKSFNVYILDEQNHIEIYRHCEGSKEQKIREINQIYQSASLDKNNNPYKIVQHNFNYPQ
FT                   FYQLLPDCNGGTKIVPFHSRLALS"
FT   gene            47625..48590
FT                   /gene="hemC"
FT                   /locus_tag="HS_0044"
FT   CDS_pept        47625..48590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="HS_0044"
FT                   /product="hydroxymethylbilane synthase (porphobilinogen
FT                   deaminase, PGB)"
FT                   /EC_number="2.5.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24325"
FT                   /db_xref="GOA:Q0I178"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I178"
FT                   /protein_id="ABI24325.1"
FT                   /translation="MSINKTLKIATRQSPLALWQANYVKNRLQQRYSHLSVELVPIITK
FT                   GDVILDTPLAKIGGKGLFVKELENALLNGEADIAVHSMKDVPMQFPKGLELSVICPRED
FT                   PRDAFVSNKYRTLDELPQGAIVGTSSLRRQCQLKNWRADLDIRSLRGNVGTRLNKLDQG
FT                   DYDAIILASAGLIRLGLTERIRSFIEIDTILPACGQGAVGIECRVDDRDVQSLLMPLAD
FT                   QTTTYCVLAERAMNFHLQGGCQVPIGAYAILENNQLYLRGLVGDVHGSQILSAEGQFEL
FT                   SLDFESSQSAVQKAEELGVSIAEQLLQQGADKILQAVYQS"
FT   gene            48677..49345
FT                   /gene="hemD"
FT                   /locus_tag="HS_0045"
FT   CDS_pept        48677..49345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="HS_0045"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24326"
FT                   /db_xref="GOA:Q0I177"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I177"
FT                   /protein_id="ABI24326.1"
FT                   /translation="MALHLPLISIIAGQELNRLPNKLQQLNCGDYVVAVSKNAVEYAQK
FT                   TLSAVGFCWRSDLYYFTVGQRTAEYFASQIENSVYYPVEQESSEGLLNLPQMQDLQARN
FT                   ILILRANGGREFFTEQAILRGAKVETLECYQRMPIEYNKLEKISLCQRIGVDTIVVTSQ
FT                   EMLNYLVKLVPTNETGWLFSCRLVTVSQRIAALAKSVGWTNIVVADKADNLSLFLALQQ
FT                   "
FT   gene            49546..50745
FT                   /gene="hemX"
FT                   /locus_tag="HS_0046"
FT   CDS_pept        49546..50745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemX"
FT                   /locus_tag="HS_0046"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24327"
FT                   /db_xref="GOA:Q0I176"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I176"
FT                   /protein_id="ABI24327.1"
FT                   /translation="MERENEQVGEKRTAAQVETVVVKKGGTVIALLALLIALGIGGAGY
FT                   YFGQQKVEEIQQKLTALSQPSEAMPSENNDTLLATIEEYKQTFIQKIERLENEMTKQNQ
FT                   LIQSLQAQVNKLDAVGKVEQSTDWLLFETDYLLNNALRKIVLDNDVETAIALLKVADET
FT                   LVKVNDPKVINIRQAINADLKQLLSVNNVDQNAIMQHLSQLANGIDELVVLNVNFDEQE
FT                   NTQLSDSLQDWKENVEKSAVSFLNHFIRVKPRHVNSKELLAPNQDIYLRENIRLRLQIA
FT                   IMAVPRQQNDLYKQSLEIVGSWIRSYFDTSTEVAQNFLKEIDELAEKSIYVDVPNQLKS
FT                   LLLLDKLLNKEQSSVQKIEMTVDKDLVSSTDQVSEEGKTDQAVEKSDEKPIEQPVEQAQ
FT                   "
FT   gene            50760..52037
FT                   /gene="hemY"
FT                   /locus_tag="HS_0047"
FT   CDS_pept        50760..52037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemY"
FT                   /locus_tag="HS_0047"
FT                   /product="porphyrin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24328"
FT                   /db_xref="GOA:Q0I175"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I175"
FT                   /protein_id="ABI24328.1"
FT                   /translation="MFRVLFLMLVLLAGLIGGPYLSGKQGYVLIQTASYNIEMSITMLV
FT                   IFFVILMAIVYLIEWVVTRFFRLSNNTYSWFSRRKRVKAQRQTLEGLVKMNEGDYSKAE
FT                   KLIGKNARHSDKPILNLIKAAEAAQQRGDDFVANRYLIEATELAGTDSLIVEIARTRIL
FT                   LQQNKLPAARSSVDSLLEMTSRNKEVLKLAVKIYLKSAAFHALDKILDQIEKVGLYSSD
FT                   EFTALQRKVEDGLLDEKMNEEGVDGLLRWWDEQPRKRRNDLYVKVGLIRRLLDSDDHES
FT                   AYELAIDALKKVENSVEANVALCTQITRLQPEDNSKLLKLLEKRAKQSNSKDCCCVERA
FT                   LGYLYVRNDDFAKAAEAFKKVIENKASLQANDITMAAYVFEQVGELELAQKVREEGLRN
FT                   AMSIKESENKTKKTAENPTALLEQKS"
FT   gene            complement(52092..53078)
FT                   /gene="dusA"
FT                   /locus_tag="HS_0048"
FT   CDS_pept        complement(52092..53078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dusA"
FT                   /locus_tag="HS_0048"
FT                   /product="tRNA-U16,U17-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24329"
FT                   /db_xref="GOA:Q0I174"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I174"
FT                   /protein_id="ABI24329.1"
FT                   /translation="MKQNQPHFYRGRFSVAPMLDWTTRHCRFFHRQFSQYTLLYTEMVT
FT                   TGAIIHAKYDHLAYDVSENPVALQLGGSDPEKLQYCAKKAEERGYQEINLNVGCPSDRV
FT                   QNGMFGACLMARADLVAECVNAMQSAVNIPVTVKTRLGIDEFDSYEFLCDFIEKVHNIG
FT                   CQEFIIHARKAWLSGLSPKENREIPPLNYERVYQLKKDFPDLLISINGGIKTLEEIQRH
FT                   LNYVDGVMVGREAYQNPSLLGYIDQALFDPSCAIITPRQAIENMFPYIEQQLSQGVYLN
FT                   HIARHLLGAFQQCKGARQWRRYMSENIHKSHAGVEVIEKALTFIEEK"
FT   gene            complement(53491..55044)
FT                   /locus_tag="HS_0049"
FT   CDS_pept        complement(53491..55044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0049"
FT                   /product="sugar kinase, FGGY family"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24330"
FT                   /db_xref="GOA:Q0I173"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I173"
FT                   /protein_id="ABI24330.1"
FT                   /translation="MALDAGTGSIRAVIFDLEGNQIATSQKEWTHISDPNIPGSMGFDL
FT                   QNNWHLACLCIQEVLATSQIDAKQIIAISTCSMREGIVLYDANKNPIWACGNVDARSVE
FT                   EVIQLKSLNQYQFEQQVYQSSGQTLALSALPRLLWLAHHQPNLYAQVHFLSMISDWLGF
FT                   MLSGELAVEPSNAGTTGILNLKTRKWEHTLLEMAGLNPAILPKVKETGEILGQVTAHSA
FT                   QQTGLIVGTPVVVGGGDVQLGCIGLGITEPGQAAIIGGTFWQQVVNLPQAMTDPKMNIR
FT                   INPHVIAPMVQAESISFFTGLTMRWFRDAFCEEEKAVAHRLGVDAYTLLEQMAEKIPVG
FT                   SNDVIPVFSDAMHFKSWYHAAPSFINLSIDPEKCNKSVLFRALQENAAIVSSCNLDQVQ
FT                   QFSHVNLTSIVFAGGGAKGKLWSQILADVTGLVVNVPVVKEATALGCAIAAGVGAGIYT
FT                   SLHEAGKTLVKFERQHQPNARNHNLYQIHKEKWQEIYQQQLKLVDRGLTISLWKAPGIK
FT                   "
FT   gene            complement(55098..56057)
FT                   /locus_tag="HS_0050"
FT   CDS_pept        complement(55098..56057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0050"
FT                   /product="transcriptional regulator, possible sorbitol
FT                   operon regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24331"
FT                   /db_xref="GOA:Q0I172"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I172"
FT                   /protein_id="ABI24331.1"
FT                   /translation="MINLDNHYEAGFNEEELLARIAWFYYHDNLTQNEIGEKLGLPRLK
FT                   VSRLLEKGRQIGLIKVQINSRYKGCLELEEALKQRFHLQHIRVLPELQNYEVNARLGVG
FT                   ASQMLMGLLKAKQVLSFGFGDTVMHTVKHCNDFIKQNQIKLITLTGGVGPYMQSIGQLD
FT                   SSCAISIIPAPLRASSPEAAQLFQKEGYVRDIMLAASMADVAVVGIGSTVQKTRSTLLQ
FT                   TGYIINEKQLDEFRQKGAVGDILGYFLQENGNIQPDMPIHEELISVSLDSIKRIPTIIG
FT                   VAGGEDKVEAIIAALLGQHINSLVTEEKTARTILAKVV"
FT   gene            56274..57782
FT                   /gene="ego"
FT                   /locus_tag="HS_0051"
FT   CDS_pept        56274..57782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ego"
FT                   /locus_tag="HS_0051"
FT                   /product="autoinducer 2 ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24332"
FT                   /db_xref="GOA:Q0I171"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030281"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I171"
FT                   /protein_id="ABI24332.1"
FT                   /translation="MKETESNPTPLLEACDVSKAFSGVEVLKSINFSLYSGQVHTLLGG
FT                   NGAGKSTLMKIIAGIQLQDTGTLKIHGKVRTNLTPSKAHQLGIYLVPQEPLLFSNLSVK
FT                   ENILFGLPRTMDLQSKLTALLTELNSHLNLDMQAGLLDVADQQLVEIMRGLMRDAQILI
FT                   LDEPTASLTPVETENLFGQINSLLVKGVGIVFISHKLSEVWQIADWVSVMRDGYIALSE
FT                   PIDKINHDDVIQAITPRAKNASLTESQQLWLDLPGHKRVKSTEFPLLTVENFTGEGFRD
FT                   INFEIYPGEILGLAGVVGSGRTELAETLYGLRKAKSGKVIFCDELINSLSVKQRLKRGL
FT                   VYLPEDRQASGLHLDSPLSWNTCGLTYHDMGFWIDESKEKAILERYYHAIGIKFNHVEQ
FT                   SVRTLSGGNQQKILIAKCLEADPRLLIVDEPTRGVDIGARADIYQLIKSIAKQNVAVLF
FT                   ISSDLEEIEQMSSRVLVMHDGKLSQSLKGEDINTDNIMRLAFSS"
FT   gene            57791..58789
FT                   /locus_tag="HS_0052"
FT   CDS_pept        57791..58789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0052"
FT                   /product="autoinducer 2 ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24333"
FT                   /db_xref="GOA:Q0I170"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I170"
FT                   /protein_id="ABI24333.1"
FT                   /translation="MWKFIQNNRELTILAAILLLFGLLGVVDDFSLQTLMMIFNSTQIL
FT                   ALLAIGATFVILTRNIDVSVGSIMGLSAVVVGLVLNSGYSLLIACTITLLCGIIAGGVN
FT                   GVLVSVLRIPAIVATLGTLGLYKGLMLVLTGGKWIEGLPHSLKTLSEEIVLGFSPIGLA
FT                   VIFLILVTYYFFTHTYIGRCFYAVGDNLQGALQLGVKVNVIRISAFAVNGLMAALAGII
FT                   FASQIGFVPNSTGNGLEMKAIAACVLGGISLLGGAGNILGAVLGAYFLIQIDTILVLMK
FT                   VPAYWNNFVAGVVLLAVLVFDGRIRVMIVNNIKQQRYARFLKDNSLQENQK"
FT   gene            58786..59769
FT                   /locus_tag="HS_0053"
FT   CDS_pept        58786..59769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0053"
FT                   /product="autoinducer 2 ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24334"
FT                   /db_xref="GOA:Q0I169"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I169"
FT                   /protein_id="ABI24334.1"
FT                   /translation="MIKKYSWEIALFCLLILEIIGFGLVNPRLLDLKVLFNSTSDFIYI
FT                   GMLALPLTLIIVSGGMDISFGSVVGLCAITLGVLFRLGIPLSVAIAVTFAVGSLCGAIN
FT                   AVLIIYTQVNPLVITLGTMYLFGGGALLLSGFAGATGYEGIGGFPDVLLDFANLSFGII
FT                   PTPIIYFLIMTSLFWLLMHRTRIGRSTFLIGQNLRVSKYSAVPVNQTLFIIYPLIGLIA
FT                   AFVGVLLVSYFGSARSDLGSSLLMPALTAVVLGGANIYGGSGSVIGTAIAALLIGYLQQ
FT                   GLQMVGISNETSSALSGALLIIVLIGKSLNTHRAVVIQWWNRIRAV"
FT   gene            59882..60901
FT                   /locus_tag="HS_0054"
FT   CDS_pept        59882..60901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0054"
FT                   /product="autoinducer 2-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24335"
FT                   /db_xref="GOA:Q0I168"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I168"
FT                   /protein_id="ABI24335.1"
FT                   /translation="MKYSLLKTTALAVALGFTGFNIAQAMDKVAFIPKLVGVGFFTSGG
FT                   QGAVEMGKKLGLDVTYDGPAEPSVSNQVQMINNFVNQGYNAIIVSAVSPDGLCSTLKRA
FT                   MKKGVKVLTWDSDTQPECRSYYINQGTPTQLGSMLVEMVSSQISKPKAKVAFFYSSPTV
FT                   TDQNQWVKEAKAKIEKEHPKWEIVTTQFGYNDAIKSLQTAEGILKAYPDLDAIIAPDAN
FT                   ALPAAAQAVENLKRQGTIVVGFSTPNVMRPYVKRGTVNQFGLWDVVKQGQLSVAVANEL
FT                   LKGNSLKVGDKLNVDGIGEVEVSANKVQGYEFEAKGNGIVLLPERVVFTKDNIDNYDF"
FT   gene            60920..61798
FT                   /locus_tag="HS_0055"
FT   CDS_pept        60920..61798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0055"
FT                   /product="conserved aldolase"
FT                   /note="possible fructose-1,6-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24336"
FT                   /db_xref="GOA:Q0I167"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I167"
FT                   /protein_id="ABI24336.1"
FT                   /translation="MADLDDIKDGKDFGIGIPQTNKLFFVKGSSALDWGMQSRLANIFN
FT                   PKTGKTIMLAFDHGYFQGPTTGLERIDLNIAPLFDYTDVLMCTRGILRSVVPPDTRKSI
FT                   ALRASGANSILTELSNEAVAVSIEDALRLNVSAMAAQVYIGSEYEHQSIKNIIQLVDQG
FT                   NRYGMPVMAVTGVGKDMARDQRYFSLSTRIAAEMGAHIIKTYYVDRGFERVTAGCPVPI
FT                   VIAGGKKLPELDALEMCYQAIDQGAAGVDMGRNIFQSEAPIAMIKAVQAVVHGGENAKD
FT                   AYQLYLSEKNN"
FT   gene            61864..62166
FT                   /locus_tag="HS_0056"
FT   CDS_pept        61864..62166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24337"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I166"
FT                   /protein_id="ABI24337.1"
FT                   /translation="MFAMLVEINIKEGKEKEFLEVFERNHIGTRQELGNLRFDILRDPE
FT                   IRTRFYAYEVYENETALNFHRQTEHYRRCVRELESLMTGSRSKKIFEWILPNPYV"
FT   gene            62159..62869
FT                   /gene="rpe"
FT                   /locus_tag="HS_0057"
FT   CDS_pept        62159..62869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="HS_0057"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24338"
FT                   /db_xref="GOA:Q0I165"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="PDB:3CU2"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I165"
FT                   /protein_id="ABI24338.1"
FT                   /translation="MSKLSLIQQLKQQKLSVGILSANWLQLNEEVTTLLENQINVLHFD
FT                   IADGQFSSLFTVGAIGIKYFPTHCFKDVHLMVRNQLEVAKAVVANGANLVTLQLEQYHD
FT                   FALTIEWLAKQKTTYANQVYPVLIGACLCPETPISELEPYLDQIDVIQLLTLDPRNGTK
FT                   YPSELILDRVIQVEKRLGNRRVEKLINIDGSMTLELAKYFKQGTHQIDWLVSGSALFSG
FT                   ELKTNLKVWKSSIM"
FT   gene            63132..63443
FT                   /gene="rpsJ"
FT                   /locus_tag="HS_0058"
FT   CDS_pept        63132..63443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="HS_0058"
FT                   /product="SSU ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24339"
FT                   /db_xref="GOA:Q0I164"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I164"
FT                   /protein_id="ABI24339.1"
FT                   /translation="MQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTR
FT                   KERFTVLISPHVNKDARDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG"
FT   gene            63460..64086
FT                   /gene="rplC"
FT                   /locus_tag="HS_0059"
FT   CDS_pept        63460..64086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="HS_0059"
FT                   /product="LSU ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24340"
FT                   /db_xref="GOA:Q0I163"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I163"
FT                   /protein_id="ABI24340.1"
FT                   /translation="MIGLVGRKVGMTRIFNEDGVSIPVTVIEIEANRVTQVKTLENDGY
FT                   TAVQVTTGFKKASRVTKPEAGHFVKAGVEAGRGLWEFRTEGEEFTLGQEINVDIFTDVK
FT                   KVDVTGTSKGKGFQGGVKRWNFRTQDATHGNSLSHRVLGSIGQNQTPGRVFKGKKMAGH
FT                   LGAERVTVQSLEIVRVDVERKLLLVKGSVPGATNSDVIVKPAVKA"
FT   gene            64102..64704
FT                   /gene="rplD"
FT                   /locus_tag="HS_0060"
FT   CDS_pept        64102..64704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="HS_0060"
FT                   /product="LSU ribosomal protein L4P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24341"
FT                   /db_xref="GOA:Q0I162"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I162"
FT                   /protein_id="ABI24341.1"
FT                   /translation="MELQVVGANALTVSETTFGREFNEALIHQVVVAYAAGARQGSRAQ
FT                   KTRAEVSGSGKKPWRQKGTGRARSGDIKSPIWRSGGVTFAAKPQDHSQKVNKKMYRGAI
FT                   KSILSELVRQDRLVVVEKFEIDAPKTKVLVQKLKDMALTDALIITASLDENLFLAARNL
FT                   YKVDVRDVQAIDPVSLIAFDKVVVTVDAVKQIEEMFA"
FT   gene            64701..65006
FT                   /gene="rplW"
FT                   /locus_tag="HS_0061"
FT   CDS_pept        64701..65006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="HS_0061"
FT                   /product="LSU ribosomal protein L23P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24342"
FT                   /db_xref="GOA:Q0I161"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I161"
FT                   /protein_id="ABI24342.1"
FT                   /translation="MIQQERLLKVLRAPHVSEKATNNTEKSNTIVFKVALDANKVEIAN
FT                   AVEQLFEVKVDSVRTVVVKGKTKRRGAKMGQRSDWKKAYVTLQEGQSLDFVEGAAE"
FT   gene            65027..65848
FT                   /gene="rplB"
FT                   /locus_tag="HS_0062"
FT   CDS_pept        65027..65848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="HS_0062"
FT                   /product="LSU ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24343"
FT                   /db_xref="GOA:Q0I160"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I160"
FT                   /protein_id="ABI24343.1"
FT                   /translation="MAIVKCKPTSAGRRHVVKIVNPELHKGKPYAPLLGIKSKTGGRNN
FT                   LGRITTRHIGGGHKQHYRVIDFKRNKLDIPAVVERLEYDPNRSANIALVLYKDGERRYI
FT                   LAPKGLSAGDQIQSGINAPIKIGNSLPMRNIPVGSTVHNVELKPGKGGQIARSAGAYVQ
FT                   IIAREGNYVTLRLRSGEMRKVLSECVATIGEVGNSEHMLRVLGKAGANRWRGVRPTVRG
FT                   TAMNPVDHPHGGGEGRNFGKHPVTPWGVQTKGKKTRHNKRTDKYIVRRRGK"
FT   gene            65875..66150
FT                   /gene="rpsS"
FT                   /locus_tag="HS_0063"
FT   CDS_pept        65875..66150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="HS_0063"
FT                   /product="SSU ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24344"
FT                   /db_xref="GOA:Q0I159"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I159"
FT                   /protein_id="ABI24344.1"
FT                   /translation="MPRSLKKGPFLDLHLLKKVEKAVESGDKKPIKTWSRRSMIIPSMI
FT                   GLTIAVHNGRQHVPVYVSDEMIGHKLGEFAPTRTYRGHAADKKAKK"
FT   gene            66161..66493
FT                   /gene="rplV"
FT                   /locus_tag="HS_0064"
FT   CDS_pept        66161..66493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="HS_0064"
FT                   /product="LSU ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24345"
FT                   /db_xref="GOA:Q0I158"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I158"
FT                   /protein_id="ABI24345.1"
FT                   /translation="METIAKHRYARTSAQKARLVADLVRGKKVAQALEILTFTNKKAAA
FT                   LVKKVLESAIANAEHNDGADIDDLKVAKIFVDEGPSMKRVMPRAKGRADRILKRTSHIT
FT                   VVVSDR"
FT   gene            66510..67217
FT                   /gene="rpsC"
FT                   /locus_tag="HS_0065"
FT   CDS_pept        66510..67217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="HS_0065"
FT                   /product="SSU ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24346"
FT                   /db_xref="GOA:Q0I157"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I157"
FT                   /protein_id="ABI24346.1"
FT                   /translation="MGQKVHPHGIRLGIVKPWNSTWFANTQDFADNLDGDFKVRQFLNK
FT                   ELANASVSRITIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRNAVAAIAGVPAQINIA
FT                   EVKKPELDAKLVAGSIASQLERRVMFRRAMKKAVQNAMRLGAKGIKVEVSGRLGGAEIA
FT                   RSEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAIAQQPEQQP
FT                   ATPKKAPRGKGRK"
FT   gene            67231..67641
FT                   /gene="rplP"
FT                   /locus_tag="HS_0066"
FT   CDS_pept        67231..67641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="HS_0066"
FT                   /product="LSU ribosomal protein L16P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24347"
FT                   /db_xref="GOA:Q0I156"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I156"
FT                   /protein_id="ABI24347.1"
FT                   /translation="MLQPKRTKFRKVHKGRNRGIAAGTEVSFGTFGLKAVGRGRLTARQ
FT                   IEAARRAMTRAVKRQGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVMYE
FT                   MDGVSEEVARHAFALAAAKLPIKTTFVTKTVM"
FT   gene            67641..67832
FT                   /gene="rpmC"
FT                   /locus_tag="HS_0067"
FT   CDS_pept        67641..67832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="HS_0067"
FT                   /product="LSU ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24348"
FT                   /db_xref="GOA:Q0I155"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I155"
FT                   /protein_id="ABI24348.1"
FT                   /translation="MKAQELRTKTVEELNAELVNLLGEQFKLRMQAATGQLQQTHQLKQ
FT                   VRRSIAQVKTVLTEKAGA"
FT   gene            67832..68086
FT                   /gene="rpsQ"
FT                   /locus_tag="HS_0068"
FT   CDS_pept        67832..68086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="HS_0068"
FT                   /product="SSU ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24349"
FT                   /db_xref="GOA:Q0I154"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I154"
FT                   /protein_id="ABI24349.1"
FT                   /translation="MTDKIRTVQGKVISDKMDKSFVVAIERTVKHPIYGKFIRRTTKLH
FT                   VHDEHNEAKLGDVVEVRGCRPLSKTKSHTLVRVVEKAQA"
FT   gene            68283..70889
FT                   /gene="irp"
FT                   /locus_tag="HS_0069"
FT   CDS_pept        68283..70889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="irp"
FT                   /locus_tag="HS_0069"
FT                   /product="iron-regulated outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24350"
FT                   /db_xref="GOA:Q0I153"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I153"
FT                   /protein_id="ABI24350.1"
FT                   /translation="MKLYKFRKELFVLTFLVSGSSISAEIIAELDEVVVSDSSSVADFQ
FT                   SLAFQGGRKASDVFIEGKEFKTRSATLGNALAGELGVHSNPFGGGASAPVIRGQEGVRI
FT                   KLLQNGSDIVDMSNISPDHAVVADTLLAQQVELVRGTSTLMYGMASPAGVVNIVDNRIP
FT                   TSRPEKGYEGEIVSRFDTASKEKVLTAGVTLAAGDNFLIRAEGLTRKSENYHVPEVFIG
FT                   QKLNYLPDSHHKSKVGTLGTTWIGDKGYLGASVSYRKDRYGIPGHNHAFDYCSGHLFDT
FT                   DNLKAITGGDGEAPYLNAYPHLMTDADMISSLHFHCGADIQGHKHSHESIYGHDHDISE
FT                   AGPVVDMRSKRYDVRGEWKAPLPWISKVKLSLAYADYYHDEKHDGKAHIDKNDSQGIKD
FT                   RKKYTAAIMSGKPEAFYANRGFNSRLEIYHQPTEHFNGVVGMQYQTQKTKVQRLAPSLN
FT                   NNGQDLSGERKESERNPLVPHTNKQFSVFALEQFTWRNFIVEVGARWETQRIPIKYDPN
FT                   KLRLDKAAGSKVRLPDLSPYTENALSYSGTLMWDFHPAYRLSITGSHNERIPSPMELYY
FT                   HGKHLATNSFQYGNKDLKKERSNNVEIGLMRISDKWDFKVSAYYQRFKNYIHNENLYRE
FT                   GNLFMRRYNQSQARFYGFEGEIGYQITPNHKITFFGDYVNGKLFGFKKFYGNPKFKKIC
FT                   EIPKAQLIDIERCIEDEEWGEEWDYRKIGEQIIERPNRNAARVPPMRLGFRLKSQFNDN
FT                   WSSSLEYTRMFAQKRISINTVIKEIDREEAEKRRENANGLGYDGHYTELVPEDVTQGYH
FT                   LLNLSLNYSRKIDGVEYSATLSANNLLNQKIYIHNSYLPYVPQMGRNFILNVGVTF"
FT   gene            71086..71457
FT                   /gene="rplN"
FT                   /locus_tag="HS_0070"
FT   CDS_pept        71086..71457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="HS_0070"
FT                   /product="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24351"
FT                   /db_xref="GOA:Q0I152"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I152"
FT                   /protein_id="ABI24351.1"
FT                   /translation="MIQEQTMLDVADNSGARSVMCIKVLGGSHRRYAAIGDIIKVTVKE
FT                   AIPRGKVKKGDVLKAVVVRTKKGVRRPDGAVIRFDGNACVILNNNTEQPIGTRIFGPVT
FT                   RELRSEKFMKIISLAPEVL"
FT   gene            71470..71781
FT                   /gene="rplX"
FT                   /locus_tag="HS_0071"
FT   CDS_pept        71470..71781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="HS_0071"
FT                   /product="LSU ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24352"
FT                   /db_xref="GOA:Q0I151"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I151"
FT                   /protein_id="ABI24352.1"
FT                   /translation="MAAKIRQNDEVIVLAGKDKGKRGKVTKVLPNGKVFVEGVNIITKH
FT                   EKPVPALGKAGGLVKKEAAIDVSNVAIFNPTTNKADRVGFRIEDGKKVRFFKSNNEII"
FT   gene            71799..72338
FT                   /gene="rplE"
FT                   /locus_tag="HS_0072"
FT   CDS_pept        71799..72338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="HS_0072"
FT                   /product="LSU ribosomal protein L5P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24353"
FT                   /db_xref="GOA:Q0I150"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I150"
FT                   /protein_id="ABI24353.1"
FT                   /translation="MAKLHDYYRDTVVNELKAKFNYSSVMQVPRIEKITLNMGVGEALT
FT                   DKKLLDNAVADLAAISGQKPLVTKARKSVAGFKIRQGYPIGCKVTLRGERMWEFFERLI
FT                   TIAVPRIRDFRGLNTKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTAKSD
FT                   EEGQALLAAFNFPFRK"
FT   gene            72350..72655
FT                   /gene="rpsN"
FT                   /locus_tag="HS_0073"
FT   CDS_pept        72350..72655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="HS_0073"
FT                   /product="SSU ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24354"
FT                   /db_xref="GOA:Q0I149"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I149"
FT                   /protein_id="ABI24354.1"
FT                   /translation="MAKQSMIARDVKRAKLADKFYEKREELKKVISDVNTSDEERWAAV
FT                   LKLQTLPRDSSPVRQRNRCRQTGRPHGVLRKFGLSRIKVREAAMRGEIPGLKKASW"
FT   gene            72692..73084
FT                   /gene="rpsH"
FT                   /locus_tag="HS_0074"
FT   CDS_pept        72692..73084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="HS_0074"
FT                   /product="SSU ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24355"
FT                   /db_xref="GOA:Q0I148"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I148"
FT                   /protein_id="ABI24355.1"
FT                   /translation="MSMQDPIADMLTRIRNGQAANKVAISMPSSKLKVAIANVLAEEGY
FT                   IANVKVSEGVKPELEITLKYFQGKPVVESIQRVSRPGLRIYKRKNELPKVMGGLGVAVV
FT                   STSKGIMTDRKARQAGLGGEIICYVA"
FT   gene            73101..73634
FT                   /gene="rplF"
FT                   /locus_tag="HS_0075"
FT   CDS_pept        73101..73634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="HS_0075"
FT                   /product="LSU ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24356"
FT                   /db_xref="GOA:Q0I147"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I147"
FT                   /protein_id="ABI24356.1"
FT                   /translation="MSRVAKAPVSIPASVEVKLDGQLLTVKGKNGELSRTIHNSVEVKQ
FT                   DNNQLTFSPRVGIANADAQSGTARALVNAMVIGVNEGFTKKLQLVGVGYRAQMKGNVLV
FT                   LSLGFSHPIDHVLPAGVTAECPSQTEIVLKSADKQLIGQVAADIRAYRRPEPYKGKGVR
FT                   YADEVVRMKEAKKK"
FT   gene            73648..74001
FT                   /gene="rplR"
FT                   /locus_tag="HS_0076"
FT   CDS_pept        73648..74001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="HS_0076"
FT                   /product="LSU ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24357"
FT                   /db_xref="GOA:Q0I146"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I146"
FT                   /protein_id="ABI24357.1"
FT                   /translation="MDKKSARIRRAARARHMMREQGVIRLVIHRTSRHIYAQVIAPNGS
FT                   EVLATASTVEKAISEQVKYTGNKDAAAVVGKIVAERALEKGIKSVAFDRSGFKYHGRVQ
FT                   SLADAAREAGLQF"
FT   gene            74017..74517
FT                   /gene="rpsE"
FT                   /locus_tag="HS_0077"
FT   CDS_pept        74017..74517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="HS_0077"
FT                   /product="SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24358"
FT                   /db_xref="GOA:Q0I145"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I145"
FT                   /protein_id="ABI24358.1"
FT                   /translation="MASIEKQTGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGR
FT                   VGFGYGKAREVPAAIQKAMEKARRNMITVALNEGTLQHPIKGSHTGSRVFMQPASEGTG
FT                   IIAGGAMRAVLEVAGVRNVLSKAYGSTNPINVVRATIDALANMKSPEMVAAKRGKTVDE
FT                   ILG"
FT   gene            74521..74703
FT                   /gene="rpl"
FT                   /locus_tag="HS_0078"
FT   CDS_pept        74521..74703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl"
FT                   /locus_tag="HS_0078"
FT                   /product="LSU ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24359"
FT                   /db_xref="GOA:Q0I144"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I144"
FT                   /protein_id="ABI24359.1"
FT                   /translation="MMAKTIKVTQVRSSIARLPKHKATLRGLGLRRINHTVELIDTPAI
FT                   RGMINQVSYMVKVEE"
FT   gene            74708..75142
FT                   /gene="rplO"
FT                   /locus_tag="HS_0079"
FT   CDS_pept        74708..75142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="HS_0079"
FT                   /product="LSU ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24360"
FT                   /db_xref="GOA:Q0I143"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I143"
FT                   /protein_id="ABI24360.1"
FT                   /translation="MRLNTLSPAEGAKHNAKRLGRGIGSGLGKTSGRGHKGQKARTGGG
FT                   VRRGFEGGQMPLYRRLPKFGFTSMKSAVTAEVRLNDLAKVEGNIITLDTLKAANVLTKD
FT                   IRFAKVILAGEVKTAVTIRGLGVTKGAKVAIEAAGGSIEE"
FT   gene            75150..76475
FT                   /gene="secY"
FT                   /locus_tag="HS_0080"
FT   CDS_pept        75150..76475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="HS_0080"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24361"
FT                   /db_xref="GOA:Q0I142"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I142"
FT                   /protein_id="ABI24361.1"
FT                   /translation="MAKQPGYQNRSTQSGTSELKSRLLFVLGALIVFRIGSFIPVPGID
FT                   AAVLAQLLEQQKGTIIDMFNMFSGGALSRASIFALGIMPYISASIIIQLLTTVHPALAE
FT                   LKKEGEAGRRKISKYTRYSTLALATIQAIGISTGLPNMLPGLVPNLGFSFYFTAVISLV
FT                   TGTMFLMWLGEQITERGIGNGISLIIFAGIVAGLPSAIGQTIEQARQGQMHLLVLLLIA
FT                   VIVFAVTYFVVFFERGQRRIKVEYAKRQQGRQIVGGHSTHLPLKVNMAGVIPAIFASSI
FT                   ILFPATLTSWFGQGSNLEWLTELSLLLHPGQPLYLIVYAVAIIFFSFFYTAMQYNPRDT
FT                   ADNLKKSGAFIPGIRPGEQTSRYIDKIMTRLTLIGGLYITFVCLVPYIMTSAWNVQFYF
FT                   GGTSLLIVVVVIMDFIVQIQSHLMSTKYESALKKANLKGFGQ"
FT   gene            76503..76616
FT                   /gene="rpmJ"
FT                   /locus_tag="HS_0080a"
FT   CDS_pept        76503..76616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="HS_0080a"
FT                   /product="LSU ribosomal protein L36P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0080a"
FT                   /db_xref="EnsemblGenomes-Tr:ABI26062"
FT                   /db_xref="GOA:Q0I141"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I141"
FT                   /protein_id="ABI26062.1"
FT                   /translation="MKVRASVKKMCRNCKIVKREGVVRVLCSDPKHKQRQG"
FT   gene            76760..77116
FT                   /gene="rpsM"
FT                   /locus_tag="HS_0081"
FT   CDS_pept        76760..77116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="HS_0081"
FT                   /product="SSU ribosomal protein S13P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24362"
FT                   /db_xref="GOA:Q0I140"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I140"
FT                   /protein_id="ABI24362.1"
FT                   /translation="MARIAGINIPDQKHAVIALTAIYGIGKTRAKAICAAAGIAEDVKI
FT                   RELSEEQIDKLRDEVGKFTVEGDLRREVTLNIKRLLDLGCYRGLRHRRGLPVRGQRTKT
FT                   NARTRKGPRKPIKK"
FT   gene            77132..77521
FT                   /gene="rpsK"
FT                   /locus_tag="HS_0082"
FT   CDS_pept        77132..77521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="HS_0082"
FT                   /product="SSU ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24363"
FT                   /db_xref="GOA:Q0I139"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I139"
FT                   /protein_id="ABI24363.1"
FT                   /translation="MAKTPVRTRKRVKKQVVDGVAHIHASFNNTIVTITDRQGNALAWA
FT                   TAGGSGFRGSRKSTPFAAQVAAERCAEVVKEFGLKNLEVMVKGPGPGRESTIRALNAAG
FT                   FRITNITDVTPIPHNGCRPPKKRRV"
FT   gene            77551..78171
FT                   /gene="rpsD"
FT                   /locus_tag="HS_0083"
FT   CDS_pept        77551..78171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="HS_0083"
FT                   /product="SSU ribosomal protein S4P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24364"
FT                   /db_xref="GOA:Q0I138"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I138"
FT                   /protein_id="ABI24364.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIDTAPGQHGARK
FT                   PRLSDYGSQLREKQKVRRIYGILERQFRNYYKEANRLKGNTGENLLVLLEGRLDNVVYR
FT                   MGFAATRAEARQLVSHKAIVVNGRVVNIPSFQVSVNDVVAVREKSKKQARIKASLELAE
FT                   QRERPTWLEVEAAKMEGVFKRVPERSDLSADINEHLIVELYSK"
FT   gene            78204..79193
FT                   /gene="rpoA"
FT                   /locus_tag="HS_0084"
FT   CDS_pept        78204..79193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="HS_0084"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24365"
FT                   /db_xref="GOA:Q0I137"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I137"
FT                   /protein_id="ABI24365.1"
FT                   /translation="MQGSVTEFLKPRLVDIEQISSTHAKVILEPLERGFGHTLGNALRR
FT                   ILLSSMPGYAVTEVEIDGVLHEYSSKEGVQEDIIEVLLNLKGLAVKVQNKDNVFLTLSK
FT                   SGIGPVVAADITHDGDVEIVNPDHVICHLTDENASINMRIRVQRGRGYVPASSRVHSLD
FT                   EERPIGRLLVDACYSPVDRIAYNVQAARVEQRTDLDKLVIELETNGTIEPEEAIRRAAT
FT                   ILAEQLDAFVDLRDVRQPEVKEEKPEFDPILLRPVDDLELTVRSANCLKAETIHYIGDL
FT                   VQRTEVELLKTPNLGKKSLTEIKDVLVSRGLSLGMRLENWPPASIAED"
FT   gene            79235..79621
FT                   /gene="rplQ"
FT                   /locus_tag="HS_0085"
FT   CDS_pept        79235..79621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="HS_0085"
FT                   /product="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24366"
FT                   /db_xref="GOA:Q0I136"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I136"
FT                   /protein_id="ABI24366.1"
FT                   /translation="MRHRKSGRQLNRNSSHRQALFRNLASALVSHEIIKTTLPKAKELR
FT                   RVVEPLITLAKVDSVANRRLAFARTRNIETVAKLFNELGPRFAQRAGGYTRILKCGFRA
FT                   GDNAPMAYIELVDRPALAEEAKTE"
FT   gene            complement(79692..80378)
FT                   /locus_tag="HS_0086"
FT   CDS_pept        complement(79692..80378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0086"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24367"
FT                   /db_xref="GOA:Q0I135"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR017056"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I135"
FT                   /protein_id="ABI24367.1"
FT                   /translation="MILFAGDPHGSYSHLYPFIQEHANVSLIILGDLQLTTSDELDKLA
FT                   QFCDLWFIHGNHDSKTVSAYEALWGTKWKSRNLHGKVVDIQGIKIAGLGGVFRGQIWMP
FT                   PNKPLFFDHIHYCQYAPPEKIWRGGIPLRHRTSIFPSDIEALEKQKADILICHEAPKPH
FT                   PLGFSVINNLATSMQVKHIFHGHHHESFDYTKRPNKNPFKITNVGFRSLCNINGNFLLI
FT                   GIDDRE"
FT   gene            complement(80383..81660)
FT                   /gene="nadR"
FT                   /locus_tag="HS_0087"
FT   CDS_pept        complement(80383..81660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadR"
FT                   /locus_tag="HS_0087"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24368"
FT                   /db_xref="GOA:Q0I134"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006417"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016429"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="InterPro:IPR041749"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I134"
FT                   /protein_id="ABI24368.1"
FT                   /translation="MSNFSYLQQKRKQLNLKVNDLCTQANITRAYFNQLVSGKIKNPSA
FT                   TKLSALHKVLQITEQDNKKVGVIFGKFYPVHTGHINMIYEAFSKVDELHVVVCSDTERD
FT                   LKLFYDSKMKRMPTVQDRLRWMQQIFKYQKNQIVIHHLIEDGLPSYPNGWAAWAEQVKY
FT                   LFKEKNVNPSVVFSSEIQDKVPYEKYLNLQVELVDPKRRFLNISATKIRNNPFHYWKFI
FT                   PKEVRPFFAKTIAILGGESSGKTTLVNKLATVFNTTSAWEYGREFVFEKLGGNEQAMQY
FT                   SDYPQIALGHQRYIDYAVRHAHKVAIVDTDFITTQAFCIQYEGKAHPFLDSMIKEYPFD
FT                   VTILLNNNTQWVDDGLRSLGNAKQRQRFQQLLKKLLDKHSVPYIEIDSPSYLERYNQVK
FT                   NIVEKVLNEELLDLAVETITPSIFKE"
FT   gene            complement(81736..82026)
FT                   /locus_tag="HS_0088"
FT   CDS_pept        complement(81736..82026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0088"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24369"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I133"
FT                   /protein_id="ABI24369.1"
FT                   /translation="MNKIAYNGAIYIKMELIMLNPKKIEQIIQQIQDALPQGVKELGQD
FT                   AEMKLKQILQSQLSKLDIVTREEFDVQTQVLMRTREKLVELEKRLEQLQEK"
FT   gene            82323..82961
FT                   /gene="ribB"
FT                   /locus_tag="HS_0089"
FT   CDS_pept        82323..82961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribB"
FT                   /locus_tag="HS_0089"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /EC_number="4.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24370"
FT                   /db_xref="GOA:Q0I132"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I132"
FT                   /protein_id="ABI24370.1"
FT                   /translation="MNQSLLSQFGTSEERVKRAIEAFKRGNGVLVLDDEDRENEGDLIF
FT                   PAETITVEQMAKLIRYGSGIVCLCITDELCQQLDLSPMVQNNTSINQTAFTVSIEAAQG
FT                   VSTGVSAQDRVTTIQAAIADNAKPQDLSRPGHVFPLRAKKGGVLARRGHTEAAVDLASW
FT                   AGHKPAGVICEITNDDGSMARTPEIVEFGKKFNYPVVTIEDLVRYASNK"
FT   gene            complement(83118..83783)
FT                   /gene="thiE"
FT                   /locus_tag="HS_0090"
FT   CDS_pept        complement(83118..83783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="HS_0090"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24371"
FT                   /db_xref="GOA:Q0I131"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I131"
FT                   /protein_id="ABI24371.1"
FT                   /translation="MQHKYDIATAMRLYFIAGSQDVTHFASDPADNLLSVLEQALQAGI
FT                   TCYQFREKGKRALQNPIAYKALAIACRNLCRKYKVPFVVNDDVALAVEIGADGIHVGQT
FT                   DMPPHQVKRLCTGKCFVGTSVNTIEQGLIAQNDPNVDYFGVGPIFPTQSKEDAEPVLSP
FT                   AFITQIRANHIDKPMVAIGGIKVKDVAMLMAKGANGVAVISAITQSNHIEKTVKELLR"
FT   gene            complement(83783..84595)
FT                   /gene="thiD"
FT                   /locus_tag="HS_0091"
FT   CDS_pept        complement(83783..84595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="HS_0091"
FT                   /product="phosphomethylpyrimidine kinase
FT                   (hydroxymethylpyrimidine phosphokinase)"
FT                   /EC_number="2.7.4.7"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24372"
FT                   /db_xref="GOA:Q0I130"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I130"
FT                   /protein_id="ABI24372.1"
FT                   /translation="MSKVAIALTIAGSDNSGGAGIQADLKTFQMQKVFGMTAITAVTAQ
FT                   NSLGVYDIHPVPPATIRSQLKAIAEDYQVSALKIGMLGNVDIIQCVAEELEKYDFGKIV
FT                   LDPVMYAKGGAALLEPAAVSTLRSLLLPKTDVITPNLPEVAALTDIHVVDDHTARLAAE
FT                   KLLVMGVKNVVIKGGHSQNSQSEICRDWLFTQHSSLKLDSPRFDTPHTHGTGCTFSACI
FT                   VAELAKGESVQSAVRTAKDFISASISHPLNIGHGHGPTNHWAYSQGTK"
FT   gene            complement(84588..85388)
FT                   /gene="thiM"
FT                   /locus_tag="HS_0092"
FT   CDS_pept        complement(84588..85388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="HS_0092"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24373"
FT                   /db_xref="GOA:Q0I129"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I129"
FT                   /protein_id="ABI24373.1"
FT                   /translation="MNSQFLTKLRQRNPLIHNITNIVAANFSANGLLAIGASPIMSACI
FT                   EEMEEMAKLSQSLVINIGTLTGKDVEAMLLAGKTANQVGIPVVLDPVGVGATTFRQKTT
FT                   ALLLEQVQFSAIRGNAGELAYIAGVQWSTKGVDAGKGMADIAEIAHLVARKYQCIAVIS
FT                   GETDYISDGKRLAKLNNGTPLFPKITASGCLLSAVCSAFLAVAEQKDYFDALVEGCSAY
FT                   AIAGEIAAQSLSSTQFGQFTLGLLDQLASLTPEQINQYARISYE"
FT   gene            85961..86569
FT                   /gene="recO"
FT                   /locus_tag="HS_0093"
FT   CDS_pept        85961..86569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="HS_0093"
FT                   /product="DNA replication and repair protein RecO"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24374"
FT                   /db_xref="GOA:Q0I128"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I128"
FT                   /protein_id="ABI24374.1"
FT                   /translation="MAKGARAKRSAWKSLLQPFTPLLLNWSGRGELKILIKAEAISLTL
FT                   PLQTTALYSGFYVNELIARLLAPETAYPDLFQYYLQCLTALASSPQEIEKSLRTFEFQL
FT                   LEVLGYAVDFCHCAGSGKPVDEKMTYRYREEKGFIASLIKDNLTFYGRELLAFERREFV
FT                   DKTVLQAAKRFSRIALKYYLGNKPLKSRELFTQNILHTK"
FT   gene            86590..87909
FT                   /gene="rumA"
FT                   /locus_tag="HS_0094"
FT   CDS_pept        86590..87909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rumA"
FT                   /locus_tag="HS_0094"
FT                   /product="23S rRNA m(5)U-1939 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24375"
FT                   /db_xref="GOA:Q0I127"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I127"
FT                   /protein_id="ABI24375.1"
FT                   /translation="MVLLYQPKKQKKLRAAFTTIVQDLDYQGLGVAKIQGKTWFIENAL
FT                   PQEQVQVQVIEEKRQYGLGRVQKILQASPLRQTPRCAYYQICGGCQSQHIPIHLQRETK
FT                   QKALFQRLTKLQKEAIEFMPMISGEAWHYRRRVRLSLYWDAKSKNLKIGFRQKNSQQIV
FT                   NIRQCDVLDPLLNELLPKLHELLSTWSKPKTLGHIELVAADNGVAMLLRVTEKLAEHDR
FT                   TLLLDFAFNHQVMLFVQDEKEICHLQGDLPYYQLDDGSILHFDIRDFIQVNRQLNQNMV
FT                   NTALDWLDLKKKDNVLDLFCGMGNFTLPISRYVKSAVGIEGVLPMVEKARRNGERNHCH
FT                   NVQFYQCDLSQSFTEQEWAKVPFDKILLDPPRSGAAFALNALCYLMAEKIVYVSCNPAT
FT                   LVRDVELLLKFGYQLKKVAMIDMFPHTSHLESISLFERNR"
FT   gene            87921..90158
FT                   /gene="relA"
FT                   /locus_tag="HS_0095"
FT   CDS_pept        87921..90158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relA"
FT                   /locus_tag="HS_0095"
FT                   /product="GTP diphosphokinase (GTP pyrophosphokinase)"
FT                   /EC_number="2.7.6.5"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24376"
FT                   /db_xref="GOA:Q0I126"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I126"
FT                   /protein_id="ABI24376.1"
FT                   /translation="MVAVRGSHLLNLQDFVVEQWSKSLSLPENVEQKLIQAWRYAQQKC
FT                   LIVQSESEKKIVCSLQAGVEMVEILHSLNMDAESLITAMLYPLVNHKMTSLMQIKEDFG
FT                   SNISKLVKGVVEMDNIRQLNASHSANSLQVDNVRRMLLAMVDDFRCVIIKLAERISYLR
FT                   DVDRLYSEEEKVLAAKECSNIYAPLANRLGIGQLKWELEDYCFRTLHPDTYHAIANLLK
FT                   ERRLDREQYIADFVQELRGYLNENLDQVEVYGRPKHIYSIWRKMQKKHLEFSDLYDVRA
FT                   VRIIVQKLQDCYSALGIVHTHFKHLPKEFDDYVANPKPNGYQSIHTVVLGKGGKPIEVQ
FT                   IRTQQMHDDAELGVAAHWKYKEGVSGGRSGYEEKIAWLRKLLAWQDDITDSGEVMAEMR
FT                   SQVFDDRVYVFTPKGEVVDLPTGSTPLDFAYAIHSEIGHRCIGAKVGGRIVPFTYQLQM
FT                   GDQIEIITQKTPNPSRDWVNPNLGFTHTAKARAKIQNWFKKQDRDKNIPAGKELLEVEI
FT                   ARLGISLKQVEQHGLPRYNLKNLEDLYAGIGGGDIRLNQLINFLQNKLIKVSAQQTDEE
FT                   ILRYVANKGAHYVSQKQKTEKKGYVIVEGVGNLMYHIARCCQPIPGDDIMGYITMGRGI
FT                   SIHRGDCEQFIELQNTHPERVVESVWGENYATGFRISIRIIASDRNGLLRDITTVLANE
FT                   KISVLGVSSRADTKKQLATINMEIELNNVQILSKILARLAKLDDIIEAKRL"
FT   gene            90183..90539
FT                   /gene="dgkA"
FT                   /locus_tag="HS_0096"
FT   CDS_pept        90183..90539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgkA"
FT                   /locus_tag="HS_0096"
FT                   /product="diacylglycerol kinase"
FT                   /EC_number="2.7.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24377"
FT                   /db_xref="GOA:Q0I125"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I125"
FT                   /protein_id="ABI24377.1"
FT                   /translation="MKKTTGLEHFIKSIVYSLKGLKSTIQHESAFRHELVVCCILFPLA
FT                   FHFAQSKIEFVLMIGSLLLVLVTELLNSAIEVVVDRIGTEYHELSGRAKDQGSAAVFVA
FT                   IILALFTWGVILFC"
FT   gene            complement(90586..92524)
FT                   /gene="tbpA"
FT                   /locus_tag="HS_0097"
FT                   /note="transferrin-binding protein A; C-terminal and
FT                   central fragments"
FT   gene            92709..92966
FT                   /locus_tag="HS_0099"
FT   CDS_pept        92709..92966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24378"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I124"
FT                   /protein_id="ABI24378.1"
FT                   /translation="MEDSRIEYKIDIPDKQNKLKAEIVSFLNSEGGEIHLGVNDDGTVD
FT                   KLLIENKKQEWEQILSNWVVNAFSPNVMNLISIYPNEVLL"
FT   gene            93052..93987
FT                   /locus_tag="HS_0100"
FT   CDS_pept        93052..93987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24379"
FT                   /db_xref="GOA:Q0I123"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I123"
FT                   /protein_id="ABI24379.1"
FT                   /translation="MIRSHSSNDFELISIDRDDLTFEYIESRFKEKGIKFDVYALSLIG
FT                   KDNKYNNAALLLSDQNPTISKFAVFQGTDVSVFLDKKEFTGSILKQLDEILYFASLSNR
FT                   KRITISGKPGREEYLDIPKRALREAIVNCYCHRDYTLSGDVKIEFYDDRVQIFSPGSLP
FT                   DGLTLENIKMGMVAKRNKIIVNTLDKIDVIENYASGVRRIFEDYADFTKQPEYYISNNG
FT                   VIVTLFNRNYEAQNEAQNEAQILKLDNQKRIEKILELIKENKNITRSNLKDILGVSKST
FT                   IERDISKLKEEDKLEYIGSSRNGYWKVKNN"
FT   gene            94032..94934
FT                   /locus_tag="HS_0101"
FT   CDS_pept        94032..94934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24380"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I122"
FT                   /protein_id="ABI24380.1"
FT                   /translation="MGAWNATIFGNDTSLDIKEEFFRRYNLGEEVEDIKNSLLLEEDDE
FT                   DRFNVIFALAHCMWEVGQLDNKFLNEVKNTIDNEEDLKVNKELGADAKFIKQRIKNLEK
FT                   FLEKISNKKEKPKKRVAPPVEVESKYRNGAVMLFNYVDGMWGVVIAVDSKFYDKETFYN
FT                   YIQTDIKMKDKPTMSDVLKAHIIDPSFHSKEYNSFRDPIYYHYFVNLVSGYLKSSGTKR
FT                   FEKYNDCAFEIIGYLADWGRCSSGVFHCFDYHRQKTAEEFKECVMRVLTKNYEENPDVR
FT                   TKMTVAEIEKEFLTRVLTR"
FT   gene            complement(95049..95423)
FT                   /gene="tbpA"
FT                   /locus_tag="HS_0102"
FT                   /note="transferrin binding protein A; N-terminal region"
FT   gene            95537..95761
FT                   /locus_tag="HS_0103"
FT   CDS_pept        95537..95761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0103"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24381"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I121"
FT                   /protein_id="ABI24381.1"
FT                   /translation="MNYIVAKQNVACEMYFSLAFLPRVFVLYEQNKYALIHIDIKELLN
FT                   INAIGYVKKIHFTCHPDVANGLCIFVKSA"
FT   gene            95721..96155
FT                   /locus_tag="HS_0104"
FT   CDS_pept        95721..96155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24382"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I120"
FT                   /protein_id="ABI24382.1"
FT                   /translation="MLLTACASSLKVLELPQVKTDSRLFVITQQFPQSEKSLLAIEVQP
FT                   HQWRWVQTDPLGAPIARLVLSKAGWQNDGFVMPNKQAKQLFSAIATYFMSTMIFDVQQI
FT                   SENEYAQNHRLIWRFSPQKHGVNIELGDKSVWFVEPLRLN"
FT   gene            96182..97399
FT                   /gene="fabF"
FT                   /locus_tag="HS_0105"
FT   CDS_pept        96182..97399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="HS_0105"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase
FT                   (beta-ketoacyl-ACP synthase)"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24383"
FT                   /db_xref="GOA:Q0I119"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I119"
FT                   /protein_id="ABI24383.1"
FT                   /translation="MTETLYLSKPAIISAMGEGLKTHIEMLLNAEHSPLVHSDKVFSRH
FT                   HIAGKIGVFGEINLSLRPFPDKLSVQHRSRNNQVLWHALADIEPQIEQAVQQFGKQRIA
FT                   VVIGSSTTGVDENIPVFKGGASQQDWSLAPFNFQQVSFSAPADFVAEVYGLSGLVYGIS
FT                   TACTSGARALISAARLLKNNLCDAVICGGVDTLSPLTVSGFNSLSVLSAQRTNPFSRYR
FT                   NGINIGEGAAVFLMTKKRLNDESLQLFGYGASSDAYHMSSPHPEGEGAISAFENALKNA
FT                   NVKAEQVGWINLHGTGTVQNDHMESLAVERIFGDKTTCTTTKGYTGHTLGAAGAIEAAI
FT                   LWGMISRDYNPTGKLPAQLWDQEKDENLPALAITDRDSYWKMDRRIGVSSSFAFGGNNS
FT                   VLVLGE"
FT   gene            97401..97853
FT                   /locus_tag="HS_0106"
FT   CDS_pept        97401..97853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24384"
FT                   /db_xref="InterPro:IPR016776"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I118"
FT                   /protein_id="ABI24384.1"
FT                   /translation="MVNLHCPMTQVAPFLPHSNDMVLLDLITDFGEDFLIAEARIKSDN
FT                   ILIREGKLSAFSGIEIMAQGVAAWAGCMAVQANEPVRLGYLLGTRKLHIYQDEIAIGSR
FT                   LQIKINMSIQDVTGFGVFDCQLIDLADNHVILEGALNVFSPKEEQQ"
FT   gene            97853..98581
FT                   /gene="fabG"
FT                   /locus_tag="HS_0107"
FT   CDS_pept        97853..98581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="HS_0107"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24385"
FT                   /db_xref="GOA:Q0I117"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011285"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I117"
FT                   /protein_id="ABI24385.1"
FT                   /translation="MAKTVLITGSSRGIGKAIALNLAAQGYDIVVHCRSRIAEAENVAQ
FT                   EVRALGQNARVLQFDVADREKVRSILEADVEENGAYYGIVLNAGLTRDNAFPALTDDDW
FT                   DSVLRTNLDGFYNVLHPIMMPMIRRRQAGRIVCITSVSGLIGNRGQVNYSASKAGLIGA
FT                   VKALAIELAKRKITVNCVAPGLIDTDILDENVPIDEILKMIPAGRMGDPEEVAHAVQFL
FT                   MDEKAAYITRQVIAVNGGLC"
FT   gene            98654..99892
FT                   /gene="fab"
FT                   /locus_tag="HS_0108"
FT   CDS_pept        98654..99892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fab"
FT                   /locus_tag="HS_0108"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24386"
FT                   /db_xref="GOA:Q0I116"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I116"
FT                   /protein_id="ABI24386.1"
FT                   /translation="MVVTGIGGITAFGNDWQKIKTAFQRKQNAVKSMNDWVERFPELDA
FT                   RLGAVIEDYYPPKHWNRKQLRSLGRVSQLVVDASERALANASLLDEDGIILEYLKDGRM
FT                   GVACGSSTGSTNDIKDAAELLMTGKSDGFNANTYVRMMPHTTAANIGIFFGLTGRIIPT
FT                   SSACSSGSQAIGYSYEAIKYGLIPMMLAGGGEEFCPSEVYVFDSLYAASRNNDNPSHTP
FT                   RPYDKARDGLVIGEGGCMFVLEELEHALARGANIIAEVVGYGANSDGSHVTRPQKETMQ
FT                   RCMELALKDAGIEPSKIGYVSGHGTATEQGDIAETLATEAVFGYVPMSSQKSYLGHTLG
FT                   ACGALESWFSIEMMRDGWFAPTINLDNVDERCGKVDYIQHDGREIHTDYVMNNNFAFGG
FT                   VNTSLIFKRWTDE"
FT   gene            100060..100812
FT                   /locus_tag="HS_0109"
FT   CDS_pept        100060..100812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24387"
FT                   /db_xref="GOA:Q0I115"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I115"
FT                   /protein_id="ABI24387.1"
FT                   /translation="MTQQICNFSFNLHAWNIVCNKELSGEDWQQGEQYWMESVAKRETV
FT                   APKLAFLPPLKRRRLSESARLFFEAAWPLTEQENNLPVVYASLNGEINRSFALWHSLLT
FT                   EGDVSPTSFSLSVHNALVGQWSEMRQVKNETTAITALKDSLEIALLEAFLLLNDGQEKV
FT                   LVVLSETPLSVKYNAQPVERLPLSYALAMVVEKGSTYQLSLQSQAVESAVFFDNALAWV
FT                   QQQYLGASQWQTQSSRGGTWLWKKNLIG"
FT   gene            100788..101549
FT                   /gene="plsC"
FT                   /locus_tag="HS_0110"
FT   CDS_pept        100788..101549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /locus_tag="HS_0110"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24388"
FT                   /db_xref="GOA:Q0I114"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I114"
FT                   /protein_id="ABI24388.1"
FT                   /translation="MEEKLDWLRRFLGTLFGFILFGFVGVLFKIILYPYAKQYLKADLA
FT                   TQLKGRKIVSRTWAFFVRYLIWAGILEVRYHGFERLGRKGQLVLANHPSLLDVVLIFSQ
FT                   VPEFNCIVKQDLLKNPAMSSPIKACGFVPNTESEELLEMSHRILQEQSLLLFPEGTRTG
FT                   WDGVVKLHRGAVSIGLRSAKVITPVVIKMTPLNFKKGQPWYKIPKTKIVYELTVGEDID
FT                   PQKWSAEKPLPIASRRLNQYLEDYFNSQTKD"
FT   gene            101553..101810
FT                   /gene="acp"
FT                   /locus_tag="HS_0111"
FT   CDS_pept        101553..101810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acp"
FT                   /locus_tag="HS_0111"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24389"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I113"
FT                   /protein_id="ABI24389.1"
FT                   /translation="MELELQLKQLIIDSLALEDIGVEDIDTDAPLFGDEGLGLDSVDAL
FT                   ELGLAVQKTFGLQLDSEQQNLRNHFESVATLASFIQSQKQ"
FT   gene            101826..102074
FT                   /gene="acp"
FT                   /locus_tag="HS_0112"
FT   CDS_pept        101826..102074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acp"
FT                   /locus_tag="HS_0112"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24390"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I112"
FT                   /protein_id="ABI24390.1"
FT                   /translation="MTEQEIQKVLTEALVSLFEIDADKIKPETNLYQDLEIDSIDAIDL
FT                   IDYIKRQTGYKLKAEDFRNVRTVSDVIAAVQKISENA"
FT   gene            102135..102515
FT                   /locus_tag="HS_0113"
FT   CDS_pept        102135..102515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0113"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible
FT                   3-hydroxymyristoyl/3-hydroxydecanoyl-[acyl-carrier-
FT                   protein] dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24391"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR016962"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I111"
FT                   /protein_id="ABI24391.1"
FT                   /translation="MSIEQRLMQSELVQNPIWLSETQEENLQIFRAKVPLDLCYFKGHF
FT                   ANFPLVPGVVELQWVKEKIDAYFGKEMQMNRIDNLKFQKFLRPNDEFELTLKWEENKNR
FT                   IGFQLKTEGEMCASGFVIFKNG"
FT   gene            102625..103059
FT                   /locus_tag="HS_0114"
FT   CDS_pept        102625..103059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0114"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24392"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I110"
FT                   /protein_id="ABI24392.1"
FT                   /translation="MALLWAIKAIKAVSFHRFLAILMAILLGIVWLTRSLETMYWYPVI
FT                   ISTAMLILFGGSLFSSQSLIERFARLQDSNLSPQAVSYTRKVTLVWSGFFVLNITICTA
FT                   LILAGQYHWWALYSGGISYVLMGLLMCIERLVRQKVIKNG"
FT   gene            103052..104335
FT                   /locus_tag="HS_0115"
FT   CDS_pept        103052..104335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0115"
FT                   /product="conserved acyl-coenzyme A synthetase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24393"
FT                   /db_xref="GOA:Q0I109"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I109"
FT                   /protein_id="ABI24393.1"
FT                   /translation="MDNQHNQGDDTDFALRCQQIRQQLEEERVKAVGLWLDNADQFACV
FT                   LLACLNAKVNVLLPPNLLNENLEWLEQHSALLFDKKMIEQFGRLQKIQKIQPLLDKQNE
FT                   SEIWLKTSGSSGQAKIIKKTAKQMWRESQALVSVLPFNANEQISVIGSVSLQHLYGLTF
FT                   RIFLPLQMGWKLGGEQLHYPEYLLAESRHYRTLWISSPALLSHLNLASLDQHVQIAGII
FT                   SSGGALPEQTALALREELPCPVIEIYGSTETGAIAFRQQTGGLWQAMPNTRLGLNDEEA
FT                   LWVENAWIVGREQTADAVQFSEHGFELLGRIDRIIKLGDKRLSLVKIEQDLLKHCFVQD
FT                   CYIALHCLHQRPLAWVALNKEGIAYFKQQGRQAVISQFRQHLRLTQEKFALPRYWRFTD
FT                   KLPRNNQSKISRLDFEKICTALEYEVFV"
FT   gene            104332..105060
FT                   /locus_tag="HS_0116"
FT   CDS_pept        104332..105060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0116"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24394"
FT                   /db_xref="GOA:Q0I108"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I108"
FT                   /protein_id="ABI24394.1"
FT                   /translation="MTAFNPIAIIPHYNHSATVGSVAEQLNQLGLPVLIVDDGSSLEHK
FT                   AVIEQFPQNEQLSILFCEINGGKGAAFKAGLKQTQKLGFSHAIQVDADGQHNIIDVKKM
FT                   LEQAEKSPNAIVCGKPIYGKDAPKSRLYGRKITDFWNAINTLSFDIKDGMCGFRIYPIA
FT                   QIMPILAQEQIGGGMDFDTEILIHSYWQKIPLIWVDTPVKYEKDGISHFRGWADNWLIS
FT                   KMHARLFFRMLKRLFTGKIR"
FT   gene            105057..105977
FT                   /locus_tag="HS_0117"
FT   CDS_pept        105057..105977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24395"
FT                   /db_xref="GOA:Q0I107"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR014548"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I107"
FT                   /protein_id="ABI24395.1"
FT                   /translation="MNKHWAKQQERGTAFFLTLTRLIVKYLPLPIIRVVNFWVVLYFYL
FT                   TSRQKRCYIAEYQQKLTALFPETKLPKYAVFRQFLAFGEAITDRFAVWQKKIRYEHLIV
FT                   DDADNLYADISGNGRGQILVCSHFGNIEICRALFGSGQHENFKLNVLVHNRHAVAFNKA
FT                   LGDAGADELPLIQVEDLNVQKMLELAEKIDRGEWIAIAADRIPVRGDKTEPVNFLGSPA
FT                   EFPQGAWLLASLLKVPLNTIFCIKEQGRYRLQLRRFSESIQGRGKVREQNIRNVMQKYA
FT                   DLLAKECAKSPFLWFNFYDFWHRKD"
FT   gene            105959..106426
FT                   /locus_tag="HS_0118"
FT   CDS_pept        105959..106426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0118"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24396"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I106"
FT                   /protein_id="ABI24396.1"
FT                   /translation="MASQRLTYFSQGDFMKLIKILALTFSAVVIVACAPRDTTHYLSIQ
FT                   EALSSPEAKKILNPKIKLYFGKPAPGQVIQKGAVTNPKTNAVNKTDKEACQWVFLSAVK
FT                   RFQDQAVAKGVTKVGNLVSYYKKKEYSSTTKYECHAGRSIAGVALKGDFVK"
FT   gene            106506..106949
FT                   /locus_tag="HS_0119"
FT   CDS_pept        106506..106949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0119"
FT                   /product="conserved thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24397"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I105"
FT                   /protein_id="ABI24397.1"
FT                   /translation="MRLKKHIYAEHFSDYEIPFFDVDSIFIMWHGHYVKYLEMARCAFL
FT                   EEIHYTYDVMREKGYGWPIVQLHLKYVKPAVFRQKIRVHLAVVEYESCIRIDYTITDLA
FT                   TKQKLTKGSTTQVAVDISTGEMQLQTPQSWRDAIESYHGFIAE"
FT   gene            106960..107547
FT                   /locus_tag="HS_0120"
FT   CDS_pept        106960..107547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24398"
FT                   /db_xref="GOA:Q0I104"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I104"
FT                   /protein_id="ABI24398.1"
FT                   /translation="MKKYLFVLLILLCCKNLWAFSQDDLVHLLQKPQNTQGEFSQQRYL
FT                   KALTKPIITSGKFILIKNKGLVWETEKPFTHQLKVTAKGISQWNGTAWENHSRLGQGEQ
FT                   IKLFLGLLSGDIQALATQFDVVLSGDEKNWQLQLMPSSLLMKQIFNQIIIQGNVAVQRI
FT                   ELHEKQGDRTLILFNNQQINLPLSPFIQSLFQ"
FT   gene            107556..109847
FT                   /locus_tag="HS_0121"
FT   CDS_pept        107556..109847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0121"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24399"
FT                   /db_xref="GOA:Q0I103"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I103"
FT                   /protein_id="ABI24399.1"
FT                   /translation="MRKLLTVYRLIFAGVLCLVVAIFMYHLQTGKWLQTDLHTLLPDSQ
FT                   HYTKIQLEADKHQEQQFNQQVIALVGHSQSEAAFKLAEKVAEQWQKSGLFQTLSVKNQP
FT                   NLAELQQQIELLKLATLPISTRNQIIQQPERYFQQYAEQIINPFGYQNLLPLEQDWLGF
FT                   GRFVLSQSQQQSQIQWHAETGMLYAVQQGKTWVLLTGKIVDSDLIKPQQNLTALLKQNA
FT                   QFIQEQQGQWLSTGAVIFADYSQQQAKYESTIMGGLGISLTLLLLLLVFRSLRILWLFL
FT                   PISVGMVAGITATISCFGQIHILTLVIGTSLVGVLIDFPLHWLTSSLFLSRWRANKAMA
FT                   KLRLTFFVSLLVTLLGYALLGFTALPILKQTALFSGMALIFAVLTTFLYLPLFFRHYQS
FT                   GKSLFLRRILQINFHVKINSLLNKILFVVSTGFIVVGLQKSYWQDDIRQWVAMPMELIE
FT                   QAQKIRQITGIDLSNQYLLITAENNEQLLQKDRILTEKLQRFAQENNLIKFQSLSQWIM
FT                   SKKQQAEFIQQLKNIPAESYSVFDEIGIPKDMIRHSLKKLEKQPLVSLEQALNTELGKV
FT                   WKNLYLGELDRGKVASIIKVSGLNNPKILEQIVNNRDIYWQDKPAHLNQLFEQTRNQAA
FT                   WLKLLSFGLAALLLWRMFGISQTLKMLSIPLISVVCTVAILGWLNITISLFAMFGLLLV
FT                   SVIGIDYIAYMQTAKEPLSIKRFTISLAALTTLISFALLGLSSTPAVASFGLSVSLGGL
FT                   ISLGMILRIK"
FT   gene            complement(109988..111220)
FT                   /gene="serA"
FT                   /locus_tag="HS_0122"
FT   CDS_pept        complement(109988..111220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="HS_0122"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24400"
FT                   /db_xref="GOA:Q0I102"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I102"
FT                   /protein_id="ABI24400.1"
FT                   /translation="MTTKVSLDKSKIKFLLLEGIHQNALEVLKAAGYTNIEYHRKALEP
FT                   DELKIAIKDAHFIGIRSRTSLTEDILAEATKLIAIGCFCIGTNQVDLEAAKARGIPVFN
FT                   APFANTRSVAELVLGEILLLMRNIPQANADVHRGLWNKSMVGSYEVRGKRLGIIGYGHI
FT                   GSQLSIIAEALGMNVYFYDIETKLPLGNAQQMNSLEELLSTCDVVSLHLPENSSTKNLM
FT                   NAERIAQLKANCIFINAARGTVVDIDALAQALESKKIRGAAIDVFPKEPASIEEEFISP
FT                   LRAFDNVILTPHIGGSTVEAQENIGVEVANKFVKYSDNGSTLSAVNFPEVSLPEHSNAK
FT                   RLLHIHHNRPGILNKINQIFVEQNINIAAEYLQTEAKIGYVVIDVETEDTAQLLAKLKQ
FT                   IEGTIRARVLF"
FT   gene            complement(111246..111905)
FT                   /gene="rpiA"
FT                   /locus_tag="HS_0123"
FT   CDS_pept        complement(111246..111905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="HS_0123"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24401"
FT                   /db_xref="GOA:Q0I101"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I101"
FT                   /protein_id="ABI24401.1"
FT                   /translation="MDQLSMKKMAAQAALQYVKPDSIIGVGSGSTVNCFIEVLGTIKET
FT                   IKGAVAASKASEELLLRQGIEVFSANDVSGLDIYVDGADEINPQKMMIKGGGAALTREK
FT                   IVAALAKKFICIVDSSKQVDVLGSTFALPIEVIPMARSQVARKLVALGGSPEYRENVVT
FT                   DNGNVILDVYNFKIMNPIEMEKELNNVAGVVTNGIFALRSADIVIVGTPEGTKIIE"
FT   gene            complement(112001..113179)
FT                   /locus_tag="HS_0124"
FT   CDS_pept        complement(112001..113179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0124"
FT                   /product="coproporphyrinogen III oxidase, anaerobic"
FT                   /EC_number="1.3.99.22"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24402"
FT                   /db_xref="GOA:Q0I100"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I100"
FT                   /protein_id="ABI24402.1"
FT                   /translation="MTQFSLVKLFPIQLPPLSLYIHIPWCVQKCPYCDFNSHAQKGSIP
FT                   ETEYVTHLLTDLKQDLVRYHASIANRKLHSIFIGGGTPSLFSVQSIDYLLNQIKQLIPF
FT                   EDNIEITLESNPVTAESDRFVGYAQAGVNRISIGIQSFNNEKLQRLGRAHNAVEAKSAV
FT                   RFAQHSGLNSFNLDLMHGLPNQSLVQALDDLQQAIALKPPHLSWYQLTIEPNTMFAYRP
FT                   PKLPDEDELWDIFEQGHQLLSKAGYQQYETSAYAKVDFQCQHNLNYWRFGDYLAIGCGA
FT                   HGKLSFADGQILRFSKTKHPKGYMRGEYLYEEKNIPFSERPFEFFMNRFRLLEPMEKQQ
FT                   FELLTGLAQSAVEKQIDWALEKNYLSETNRTWQITEQGKLFLNELLTEFLPD"
FT   gene            complement(113179..113775)
FT                   /locus_tag="HS_0125"
FT   CDS_pept        complement(113179..113775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0125"
FT                   /product="Ham1 family protein"
FT                   /note="possible xanthosine triphosphate pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24403"
FT                   /db_xref="GOA:Q0I0Z9"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0Z9"
FT                   /protein_id="ABI24403.1"
FT                   /translation="MKQKIVLATANPGKVKEMADVLSEFGFDVVAQKDLGIDSPEETGL
FT                   TFVENALLKARYAAKMSGLPAIADDSGLVVPVLNGAPGLYSARYAGVEGKEAEQKNREK
FT                   LLAELANVPVNERHAKFVSCIVMLQHDTDPSPIIAEGECHGIIAFSESGSNGFAYDSLF
FT                   FYPETGCTFAELETSEKKKISHRAKALAVLKERLK"
FT   gene            complement(113965..114300)
FT                   /gene="comEA"
FT                   /locus_tag="HS_0126"
FT   CDS_pept        complement(113965..114300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comEA"
FT                   /locus_tag="HS_0126"
FT                   /product="ComE operon protein (competence protein)"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24404"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0Z8"
FT                   /protein_id="ABI24404.1"
FT                   /translation="MKKITSFFKSLLMLSVALGAFNAFAETPTQPPSSAQATQQVEPVI
FT                   INDKLNINTATAEEIKHALIGIGSKKAEAIVQYREKFGKFTAAEQLLEVKGIGKATLEK
FT                   NRDRIIF"
FT   gene            complement(114522..114911)
FT                   /locus_tag="HS_0127"
FT   CDS_pept        complement(114522..114911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0127"
FT                   /product="possible translation initiation inhibitor
FT                   (endoribonuclease L-PSP)"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24405"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0Z7"
FT                   /protein_id="ABI24405.1"
FT                   /translation="MTKIIHTEKAPAAIGPYVQAVDLGNLVLTSGQIPVNPATGEIPAD
FT                   ITAQARQSLENIKAILAQAGLAVADIVKTTVFVKDLNQFATVNAEYERFFVENNHPNFP
FT                   ARSCVEVARLPKDVGIEIEAIAVRQ"
FT   gene            complement(114972..115553)
FT                   /locus_tag="HS_0128"
FT   CDS_pept        complement(114972..115553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0128"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24406"
FT                   /db_xref="GOA:Q0I0Z6"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="PDB:3CEB"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0Z6"
FT                   /protein_id="ABI24406.1"
FT                   /translation="MWQFPLFETILIEQGQAKNISYHQQRYEKSLLKFYPKMKLQPFDL
FT                   AKIIAKHTALFTHREGLIRCRIDYNHHDYVLQCFPYQQKVYRTFKPVFCDHIDYSLKFS
FT                   DRTLLNNLLKQKEECDEIMIIRQGKVTDCSIGNLIFRQNNQWITPDKPLLEGTQRAKLL
FT                   EQKKIIAREIFFEDLAQYEEIRLINAMNGL"
FT   gene            complement(115702..116709)
FT                   /gene="pabB"
FT                   /locus_tag="HS_0129"
FT   CDS_pept        complement(115702..116709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="HS_0129"
FT                   /product="aminodeoxychorismate synthase, subunit I"
FT                   /EC_number="2.6.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24407"
FT                   /db_xref="GOA:Q0I0Z5"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0Z5"
FT                   /protein_id="ABI24407.1"
FT                   /translation="MSLNNSSQFRDFVQQANYFGQNKLPFFFLIDFEQQKPIILPIEQA
FT                   AKENIFFTILQPQGIKSNVDWHFEFSAKDCHFSFNPMKFKDYQQGFELVKSELQKGNSY
FT                   LLNLTYPSKIETNYSLMQLFQQTKSSYKLLFKNEFICFSPEPFIQIYENKIYTYPMKGT
FT                   INATLENAEQQLLNSQKELREHYTIVDLMRNDLAIVAKNIEVKRFRYVEKIHTERGAIL
FT                   QTSSEICGELEENWRHNIGHILAALLPAGSISGAPKEKTVEIIQQAEQQKRGYYTGVFG
FT                   IFDGETLQSAVAIRFIEKRCDGYYFRSGGGITIQSDIEDEYNELCAKVYLPLIK"
FT   gene            116766..117335
FT                   /gene="trpG"
FT                   /locus_tag="HS_0130"
FT   CDS_pept        116766..117335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpG"
FT                   /locus_tag="HS_0130"
FT                   /product="anthranilate synthase, component II"
FT                   /EC_number="4.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24408"
FT                   /db_xref="GOA:Q0I0Z4"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0Z4"
FT                   /protein_id="ABI24408.1"
FT                   /translation="MNTNLLVINNHDSFTYNLVDLIRRLGTPFKVVNVEDLSLVEIENF
FT                   SHLLISPGPDVPHAYPQLFDLLEKYHQSKSILGVCLGHQTLCEFFGGKLYNLQNVRHGQ
FT                   AKQLKVRSNSRLFRNLPLTFQIGLYHSWAVSPENFPEDLEITAICDDEVIMAMQHKTLP
FT                   IYGVQFHPESYISEFGKQIIQNWLSN"
FT   gene            117488..117967
FT                   /locus_tag="HS_0131"
FT   CDS_pept        117488..117967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0131"
FT                   /product="DNA-binding stress protein"
FT                   /note="Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24409"
FT                   /db_xref="GOA:Q0I0Z3"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0Z3"
FT                   /protein_id="ABI24409.1"
FT                   /translation="MTTTIGLDRNSSKQLATELNNLLASYQIFYMNVRGYHWNIKGVNF
FT                   FELHAKFEEIYDDLVVKVDEIAERILTLGYTPSNAFSEYLTQSQIQEHINVTNAQDCLN
FT                   GTLQGFKTLLKQQRSILAIASDANDEGTASQMSDYIKEHEKLIWMFSAACESCHA"
FT   gene            complement(118067..119425)
FT                   /gene="trmE"
FT                   /locus_tag="HS_0132"
FT   CDS_pept        complement(118067..119425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmE"
FT                   /locus_tag="HS_0132"
FT                   /product="tRNA modification GTPase trmE"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24410"
FT                   /db_xref="GOA:Q0I0Z2"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0Z2"
FT                   /protein_id="ABI24410.1"
FT                   /translation="MSRDTIVAQATPIGRGGVGILRVSGPLAQQVAEQVLGKTLTPRMA
FT                   NYLPFKDSDGTVLDQGIALYFKAPNSFTGEDVLELQGHGGQIVMDLLLKRILQIDGIRL
FT                   ARPGEFSEQAFLNDKLDLAQAEAIADLIEASSEQAARSALKSLQGEFSNKINELVDSVI
FT                   YLRTYVEAAIDFPDEEIDFLADGKIETHLREIIAKLAKVKNEAKQGAILREGMKVVIAG
FT                   RPNAGKSSLLNTLAGREAAIVTDIAGTTRDVLREHIHIDGMPLHIIDTAGLRDATDEVE
FT                   KIGIRRAWDEIEQADRILLILDSTENQVELDLVQSEFMAKLPPHIPLTIVRNKADLSGE
FT                   AEVLDEQNGLAVISLSAKTQKGVDLLRQHLKQSMGYQVCTEGGFLARRRHLEALEQADI
FT                   HLQAGLIQLTEFYAGELVAEELRIAQHHLSEITGQFTSDDLLGNIFSSFCIGK"
FT   gene            complement(119511..121136)
FT                   /gene="oxaA"
FT                   /locus_tag="HS_0133"
FT   CDS_pept        complement(119511..121136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxaA"
FT                   /locus_tag="HS_0133"
FT                   /product="protein translocase subunit yidC"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24411"
FT                   /db_xref="GOA:Q0I0Z1"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0Z1"
FT                   /protein_id="ABI24411.1"
FT                   /translation="MDSKRSLLFMALLFISFLIYQQWQVDYNTPKPEMTEQAQVSEVNS
FT                   TALTATSDIANDTQAKGRVITLENDVFRLKVNTLGGDVIGSELLNYDAELHSSAPFVLL
FT                   QNNADKVYIAQSGLVGKNGIDSRAGRANYQVEGDVFKLAEGQQELKVPLVFEKDGVIYR
FT                   KVFVLKPGSYALEVNFEITNQSPKPIEVVPYAQLTHTLVESSGSMAMPTYTGGAYSSSE
FT                   TNYKKYSFEDMEKADLDIHTKAGWVALLQHYFVSAWIPNQDANNTLYTLTNTKKHLGSI
FT                   GYRSAPIVIENGATETIHTQLWTGPKLQDQMADVANHLDLTVDYGWAWFIAKPLFKLLT
FT                   LIQSLVQNWGLAIIGVTLVVKAILYPLTKAQYTSMAKMRMLQPKLQEMRERFGEDRQRM
FT                   SQEMMKLYKEEKVNPLGGCLPILLQMPIFIALYWTFMEAVELRHAPFFGWVQDLSAQDP
FT                   YFILPILMGASMFLLQKMSPTPVADPMQQKVMTFMPLIFMVFFLFFPAGLVLYWLASNL
FT                   ITIAQQWLIYRGLEKKGLHTRVKK"
FT   gene            complement(121136..121396)
FT                   /locus_tag="HS_0134"
FT   CDS_pept        complement(121136..121396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24412"
FT                   /db_xref="GOA:Q0I0Z0"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0Z0"
FT                   /protein_id="ABI24412.1"
FT                   /translation="METSHSFGAKVLIGAIRIYQLMISPLIGPRCRFVPTCSCYGIQAV
FT                   KTHGVVKGSWLTVKRILKCHPFNVGGYDPVPPKINNNKENE"
FT   gene            complement(121360..121719)
FT                   /gene="rnpA"
FT                   /locus_tag="HS_0135"
FT   CDS_pept        complement(121360..121719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="HS_0135"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24413"
FT                   /db_xref="GOA:Q0I0Y9"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0Y9"
FT                   /protein_id="ABI24413.1"
FT                   /translation="MVKLGFSRELRLLTPSHFKCVFQKPLRVSTPEITILARKNNLEHS
FT                   RLGLTVAKKHLKRAHDRNRVKRISRESFRLLQGQLANYDFVIITKKGIGNLDNQQLFQT
FT                   LDKLWKRHIRLVQKS"
FT   gene            complement(121734..121868)
FT                   /gene="rpmH"
FT                   /locus_tag="HS_0135a"
FT   CDS_pept        complement(121734..121868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="HS_0135a"
FT                   /product="LSU ribosomal protein L34P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0135a"
FT                   /db_xref="EnsemblGenomes-Tr:ABI26063"
FT                   /db_xref="GOA:Q0I0Y8"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0Y8"
FT                   /protein_id="ABI26063.1"
FT                   /translation="MKRTFQPSVLKRNRTHGFRARMATKNGRQVLARRRAKGRKSLSA"
FT   gene            122211..123569
FT                   /gene="dnaA"
FT                   /locus_tag="HS_0136"
FT   CDS_pept        122211..123569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="HS_0136"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24414"
FT                   /db_xref="GOA:Q0I0Y7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0Y7"
FT                   /protein_id="ABI24414.1"
FT                   /translation="MSSTVSTLWRDCLLQLQDQVSSNDFTTWLRPLQDDVSESNMILYA
FT                   PNCFIKGWVENHYLTQITKLAQQLLNNDQFMVKIQDGIKPTEKTTTNVEQKTQNENCHN
FT                   EITSQQNYRSYLNKNHVFDNFVEGKSNQLARAVAQKVAKNPGEQSANPLFLYGGTGLGK
FT                   THLLHAVGNGILANNPHAQVVYMHAERFMQSYVKALKSDRMDSFKRFYRTVDALLIDDI
FT                   QFFAGKDGTQEEFFHIFNSLFERGRQIILTSDRYPKEIEKIEDRLKSRFGWGISVAIEP
FT                   PELETRVAILLKKAEEKNMVLPEEVAMFIGGKLRTNVRELEGALNRVHAHAEFTGKAIT
FT                   IDFVRETLKDMLALQDKLVTIENIQKIVADYYRIKISDLKSKRRSRNITRPRQLAMALA
FT                   KELTNRSLPEIGRNFGDRDHTTVLHACKAIAKLREEDNGIQEDWSNLIRTLSV"
FT   gene            123581..124681
FT                   /gene="dnaN"
FT                   /locus_tag="HS_0137"
FT   CDS_pept        123581..124681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="HS_0137"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24415"
FT                   /db_xref="GOA:Q0I0Y6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0Y6"
FT                   /protein_id="ABI24415.1"
FT                   /translation="MQFIVSREHLLKPLQQVCGVLSSRPNFPILNNVLLQIEGNVLRIT
FT                   GTDLEVELSTQAQLIQASQDGSYTIPAKKFLDICRSFPDEAEITVIFEEERALVRSGRS
FT                   KFNLTALPADEYPNLADWQSEVDFYLPQSTLRRLIEATQFSMANQDARYFLNGMKFETE
FT                   GNLLRTVATDGHRLAVCTIPLEQDLHTHAVILPRKGILELMRLLENSEHAAHVQIGTNN
FT                   LRIDLGSIIFTSKLIDGRFPDYRRVLPRNATHIMEGNWELLKQAFARMAILSSDKVKTV
FT                   RLQLTSNQLKITATNPEQEVAEEILDVIYNGADMEVGFNVSYILDVLNALKCQQVRLCF
FT                   TDASSSCLLEDADDESAEYVVMPMRL"
FT   gene            124685..125761
FT                   /gene="recF"
FT                   /locus_tag="HS_0138"
FT   CDS_pept        124685..125761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="HS_0138"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24416"
FT                   /db_xref="GOA:Q0I0Y5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0Y5"
FT                   /protein_id="ABI24416.1"
FT                   /translation="MAISRLIINHFRNLTAIDLEFERGFNFIIGNNGSGKTSLLEAIFY
FT                   LGHGRSFKSAVANRIISYQQPHFILHGKIQEQQHQWSVGLQKQRQGNTLMKINGEDAKK
FT                   ISDLAHLLPMQLITPEGLTLLNGGPSYRRAYLDWGLFHHNASFYNAWSSLNRLLKQRNS
FT                   ALQQVCSYEKLKIWDRELTKLAYQVSYWREAYAEALRSEIEKTCQLFLPELEISVSFHQ
FT                   GWDKNMDYADLLQQNFERDRALGYTFSGPQKADFRFKANGLPVEDILSRGQLKLLMCAL
FT                   RLAQGEHLMQQKKRHCIFLLDDFASELDQYKRTLLAERLQKNGSQVFVTAITQEQLQQI
FT                   QPEKHRTFYLENGRIKDL"
FT   gene            complement(125818..126462)
FT                   /gene="crp"
FT                   /locus_tag="HS_0139"
FT   CDS_pept        complement(125818..126462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crp"
FT                   /locus_tag="HS_0139"
FT                   /product="catabolite gene activator (cAMP receptor
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24417"
FT                   /db_xref="GOA:Q0I0Y4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0Y4"
FT                   /protein_id="ABI24417.1"
FT                   /translation="MLEQQGQSAPSMDPTLEWFLSHCHIHKYSAKSSLIHAGEKAETLY
FT                   YLIRGSVAVMVKDEEGKEMILTYLSQGDFFGEAGLFDETQPRSAWVKAKSSCEIAEISY
FT                   KKFRQLIQVNPEILMYLAGQLAHRLQNTSKQVSNLAFLDVTGRIAQTLLNLAKMPDAMT
FT                   HPDGMQIKITRQEIGQMVGCSRETVGRILKMLEDQHLISAHGKTIVVYGTR"
FT   gene            complement(126475..126714)
FT                   /locus_tag="HS_0140"
FT   CDS_pept        complement(126475..126714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24418"
FT                   /db_xref="InterPro:IPR010648"
FT                   /db_xref="InterPro:IPR036685"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0Y3"
FT                   /protein_id="ABI24418.1"
FT                   /translation="MEQFAMLIPWEKLEEQTLLNIVDSFILREGTDYGSTELSLAEKRE
FT                   NLFKNIRQGKAILVWSELHQSIDIKNKMDFLNRK"
FT   gene            complement(126734..127393)
FT                   /gene="ttk"
FT                   /locus_tag="HS_0141"
FT   CDS_pept        complement(126734..127393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttk"
FT                   /locus_tag="HS_0141"
FT                   /product="cell division inhibitor SlmA"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24419"
FT                   /db_xref="GOA:Q0I0Y2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0Y2"
FT                   /protein_id="ABI24419.1"
FT                   /translation="MEQQQLDIGDAEIVVASKQKTQKIEKRTVKERRQQVLTVLTHMLH
FT                   SERGMERMTTARLAQEVGVSEAALYRYFPSKTKMFEALLDNIENTLFSRINHSIKNETN
FT                   TMNRVRDILQTILDFARKNPGLTRILTGHALMFEDSQLQARVARFFDRLELQFVNILQM
FT                   RKLREGKSFHLDEKIIASHLVTLCEGQFMRYVRNNFRHLPNQGFEQQWKLLESLFA"
FT   gene            complement(127393..127848)
FT                   /gene="dut"
FT                   /locus_tag="HS_0142"
FT   CDS_pept        complement(127393..127848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="HS_0142"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="dUTPase or desoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24420"
FT                   /db_xref="GOA:Q0I0Y1"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0Y1"
FT                   /protein_id="ABI24420.1"
FT                   /translation="MKKIDVKILDPRIGTEFPLPTYATIGSAGLDLRALVDEGFEVQPG
FT                   ETKLISTGLSIYIADPNLAAVILPRSGLGHKNGIVLGNLVGLIDSDYQGPLMVSLWNRS
FT                   DKPFKIEIGDRIAQLVFVPVVQAEFNIVEEFQQTDRGNGGFGHSGKK"
FT   gene            complement(127845..129071)
FT                   /gene="coaBC"
FT                   /locus_tag="HS_0143"
FT   CDS_pept        complement(127845..129071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="HS_0143"
FT                   /product="Phosphopantothenate-cysteine ligase"
FT                   /EC_number="6.3.2.5"
FT                   /note="bifunctional"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24421"
FT                   /db_xref="GOA:Q0I0Y0"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0Y0"
FT                   /protein_id="ABI24421.1"
FT                   /translation="MQNLIRGKRIVIGITGGIAAYKTIELIRLLRKAQAEVRVVLTNAA
FT                   TEFVTPLTLQAISGNAVSQSLLDHEAELAMGHIELAKWADLIVIAPASADFIARMAVGM
FT                   ANDLLSTICLATNSPIFLAPAMNQQMYAQTVTQQNLAQLMTRGVQFIGPNSGEQACGDV
FT                   GIGRMSEPFEIFTALCQSFLHTQDLLDVSVVITAGPTREAIDPVRYISNHSSGKMGFAI
FT                   AEAFAQRGAKVTLISGPVNLATPHNVQRINVVSAQEMYQHAIQSAEQNQIFIGCAAVAD
FT                   YRVEQIAEQKIKKIPGNDEMVLKLVKNPDILATVANLMENRPFVVGFAAETQNVEQYAK
FT                   DKLQRKNLDMICANDVSGGQVFNSEQNALQLFWQNGQEGLALKHKSDLAKQLVDKIIVR
FT                   YKWKLEESK"
FT   gene            129244..129912
FT                   /gene="radC"
FT                   /locus_tag="HS_0144"
FT   CDS_pept        129244..129912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="HS_0144"
FT                   /product="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24422"
FT                   /db_xref="GOA:Q0I0X9"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0X9"
FT                   /protein_id="ABI24422.1"
FT                   /translation="MTQQNTTLMPREKLLKYGASSLDDKELLAIFLRTGIKNCPVMQLS
FT                   ELVLAHFSSLRGLINADQKHFCQMKGLGITQFVQLQACTEMTKRYLLQELQFAQEFTSP
FT                   DTVRMYLQTELENKDREIFMVLFLDNQHRLIKKEEMFLGTINQANVYPREIIKTALFCN
FT                   AAALILAHNHPSGVSTPSMADRKMTENIKQLSELMEIRVLDHFIIGKGNYFSFAEQGWI
FT                   "
FT   gene            130133..130369
FT                   /gene="rpmB"
FT                   /locus_tag="HS_0145"
FT   CDS_pept        130133..130369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="HS_0145"
FT                   /product="LSU ribosomal protein L28P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24423"
FT                   /db_xref="GOA:Q0I0X8"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0X8"
FT                   /protein_id="ABI24423.1"
FT                   /translation="MSRVCQVTGKRPAVGNNRSHAMNATRRRFLPNLHTHRFWVESEKR
FT                   FVTLRLTAKGMRIIDKKGIDAVLAEIRARGEKI"
FT   gene            130381..130551
FT                   /gene="rpmG"
FT                   /locus_tag="HS_0145a"
FT   CDS_pept        130381..130551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="HS_0145a"
FT                   /product="LSU ribosomal protein L33P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0145a"
FT                   /db_xref="EnsemblGenomes-Tr:ABI26064"
FT                   /db_xref="GOA:Q0I0X7"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0X7"
FT                   /protein_id="ABI26064.1"
FT                   /translation="MAAKGAREKIRLVSTAETGHFYTTTKNKRNMPEKMEIKKFDPVVR
FT                   KHVIYKEAKIK"
FT   gene            130656..131468
FT                   /gene="mutM"
FT                   /locus_tag="HS_0146"
FT   CDS_pept        130656..131468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="HS_0146"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24424"
FT                   /db_xref="GOA:Q0I0X6"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0X6"
FT                   /protein_id="ABI24424.1"
FT                   /translation="MPELPEVETTLKGVSPYLKGFIIEKIVVRNPKLRWEVSKELSTFK
FT                   HVKILNLTRRAKYLIIHTEQGYIIGHLGMSGSVRIVPHDNPVNKHDHFDIVMNNGKLLR
FT                   YNDARRFGAWLWTNNLSEFHLFFKLGPEPLSETFNSTYLFKKSRQKSTALKTFLMDNSV
FT                   VVGVGNIYANEILFLCGLHPQKIAKTLTKKQAEQLVFTIKQVLNEAIEQGGTTLKDFLQ
FT                   PDGRPGYFAQKLLVYGNKDKPCPRCGTKIKSIIIGQRNSFFCPQCQKK"
FT   gene            131560..133236
FT                   /gene="ilvG"
FT                   /locus_tag="HS_0147"
FT   CDS_pept        131560..133236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvG"
FT                   /locus_tag="HS_0147"
FT                   /product="acetolactate synthase, large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24425"
FT                   /db_xref="GOA:Q0I0X5"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0X5"
FT                   /protein_id="ABI24425.1"
FT                   /translation="MNGANLVVECLKAHGVTSLFGYPGGAIMPVYDAIYDSGLDHLLCR
FT                   NEQGAAMAAIGYARSTNKVGVCVATSGPGATNLITGLGDALMDSIPIIAITGQVASNFI
FT                   GTDAFQEADILGLSLACTKHSFIVQHIDELPEIIAKAFQIAQSGRPGPVLIDLPKDVQF
FT                   APTSLKPIVYPKIADSLQNLVALEQAKNLLSQAKRPVLYVGGGVGMAKSSDGMSGVKAI
FT                   RTFLDITNIPSVSTLKGLGTIPPKHPLYMGMIGMHGTKAANYAVQECDLLIACGARFDD
FT                   RVTGKLDTFAPHAKVIHIDIDVAEINKLRKADVGLQGDLVEAITNLAQLLDIEPWRKDI
FT                   EQLKASFDFNYIENTEDKEIEPCALLHTLSERKAKNAVITTDVGQHQMWSAQHMKHYEP
FT                   ENYITSAGFGSMGFGLPAAIGAAKARPQDPVILITGDGSLMMNIQELGSIKRGNLPIKI
FT                   LLLDNQRLGMVRQWQSLFFHGRHSHTVLDDNPDFVTLASAFGIAGERIEKVSEVSDALD
FT                   RLLNAKEAYLLHVCIPDEENVWPLVPPNTCNSNMIEEDIGV"
FT   gene            133240..133458
FT                   /gene="ilvM"
FT                   /locus_tag="HS_0148"
FT   CDS_pept        133240..133458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvM"
FT                   /locus_tag="HS_0148"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24426"
FT                   /db_xref="GOA:Q0I0X4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0X4"
FT                   /protein_id="ABI24426.1"
FT                   /translation="MKTYDLTIQANKRPETLERLLRVVRHRGFEVIILHSESKGNVIDL
FT                   RLTVQSERAIELLIHQLVKLPDVITLS"
FT   gene            133524..134186
FT                   /locus_tag="HS_0149"
FT   CDS_pept        133524..134186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0149"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24427"
FT                   /db_xref="GOA:Q0I0X3"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0X3"
FT                   /protein_id="ABI24427.1"
FT                   /translation="MEGAVLAIKLGLVEEIVFENGSKMSTAIRKKPMEQAIVHELGAEG
FT                   NDVGLKAHHGGIDKALFFMAERSFAKLTALLGKHDSYQGKAIYGENFIVSFFDEENVCV
FT                   GDQYQIGDVQIEISQPRIPCETLSKNANNKNTRAIVVETGLTGWYVRVIKNGVIKKGDK
FT                   IRRLANPYPKLTIKYLNYLLATEATVELKTQLEQAIECPVLAEAFKRYLKMKWRKIS"
FT   gene            134303..134806
FT                   /gene="ubiC"
FT                   /locus_tag="HS_0150"
FT   CDS_pept        134303..134806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiC"
FT                   /locus_tag="HS_0150"
FT                   /product="chorismate lyase"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24428"
FT                   /db_xref="GOA:Q0I0X2"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0X2"
FT                   /protein_id="ABI24428.1"
FT                   /translation="MNISLFRQILSSTKWQNDIFTLSPQKQDWLLHQGSLTRKLQQYCQ
FT                   QLKVEIVAEKWVSDMSFGFTGHHEPIWLREVILKGDEQAWIFAQTRLPQSTIENVAPDI
FT                   INVGSTPIGLWLFPQQPKRKTLEWIYDTATGLYARRSVLLLNQYPIEIKELFLQDFKFF
FT                   QSKV"
FT   gene            134810..137224
FT                   /gene="rnr"
FT                   /locus_tag="HS_0151"
FT   CDS_pept        134810..137224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnr"
FT                   /locus_tag="HS_0151"
FT                   /product="RNAse R"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24429"
FT                   /db_xref="GOA:Q0I0X1"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0X1"
FT                   /protein_id="ABI24429.1"
FT                   /translation="MITPKKTNKKAKKITALTEEPYFFQEQQKYSNPIPSREFILQIIR
FT                   DFNAPMSKEDLFKTLAIVDPEQKEGMRRRLRAMENEGQLVFTKRKCYALPEKLDLLKGS
FT                   VIGHREGYGFLQIEGSKSDWFIPNIQMQKVIHGDFVLAQPNGYDRKGRSEVRIVRVLES
FT                   RNKHIVGRFFMEEGIGYVVPDDSRINRDILIPNEFRNGARMGQVVVVELKPRTATFTQL
FT                   VGKIVEILGENMAKGMETEIAIRNHDIPHIFPSAVEKQVRKYTDSVPEEAKQGRRDLRT
FT                   LPLVTIDGEDARDFDDAVFCQRSGDGGWTLWVAIADVSYYVRLRTALDNEAYQRGNSVY
FT                   FPNRVVPMLPEILSNGLCSLNPQVDRLCMVCEIRISPQGKMTDYSFYEAVMNSYARLTY
FT                   TKVAQILAGDELLQQRYHVLVPHLQELHQMYQALLQARYQRGAIDFETIETKFVFNEMG
FT                   RIECIEPMVRNDAHKIIEECMILANIAAANFMERHQEPALFRIHAGPSQEKLSAFRAFL
FT                   RECGLTLKGGINPTTADYAQLLAQVRERPDHELIQTMLLRSLSQAVYHPDNIGHFGLAL
FT                   TEYAHFTSPIRRYPDLTLHRSIKYLLAKQQGSKRKTTDTGGYHYSLEEMDLLGDHCSLT
FT                   ERRADDATREVVDWLKCEYMQDHVGDEFDGIISSVTGFGLFVRLDDLFIDGLVHISTLD
FT                   NDYYQFDSIKQRLIGENSGTTYRLGDKVKIRVEAVSLAQRQVDFVLLSSQRKPGRSGKT
FT                   ANKRAKQKSFQEKNRTSKIERHKSAVKKTKNLSKKQQSPASKTRKQKKQKG"
FT   gene            137231..137968
FT                   /locus_tag="HS_0152"
FT   CDS_pept        137231..137968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0152"
FT                   /product="23S rRNA Gm-2251 2'-O-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24430"
FT                   /db_xref="GOA:Q0I0X0"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0X0"
FT                   /protein_id="ABI24430.1"
FT                   /translation="MAENIYGIHAVQAFLINAPERLIEVYVLKGREDKRLQSVLNELYK
FT                   LGISVQFLNRDTLDKKANGEVHQGIIARVQPAKELNENDLVEILQKKANPLLLVLDGIT
FT                   DPHNLGACLRSADAAGVCAVIVPKDKSAQLTAIARKVACGAAEVVPLVRVTNLARTLRD
FT                   LQQQHNIWVVGTAGEAIETLYEAKLTGGLALVMGAEGDGMRRLTRETCDQLISIPMAGS
FT                   VSSLNVSVATGICLFEIVRQRLG"
FT   gene            complement(138109..138654)
FT                   /locus_tag="HS_0153"
FT   CDS_pept        complement(138109..138654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0153"
FT                   /product="conserved hypothetical protein, with TPR repeat
FT                   (tetratrico peptide repeat)"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24431"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0W9"
FT                   /protein_id="ABI24431.1"
FT                   /translation="MNLKKSILIALLSFGIVQSTLAETDTERFNRALQFIKQQNYSDAF
FT                   PLFKQLAEQGDANAQHNLGLMYEYGDGITQNDQQAVYWYTKAAEQGYANAQNNLGLMYT
FT                   DGGKGITQNYKQAVYWYTKAAEQGYANAQYNLGVMYANGQGVQRNVSKAKQYYRLACDN
FT                   GLNIGCQTYAKLDKKGIK"
FT   gene            complement(138698..139495)
FT                   /gene="cysE"
FT                   /locus_tag="HS_0154"
FT   CDS_pept        complement(138698..139495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="HS_0154"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24432"
FT                   /db_xref="GOA:Q0I0W8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0W8"
FT                   /protein_id="ABI24432.1"
FT                   /translation="MSIEVWSLIRAEAAKLAENEPMLASFFHATILKHNNLGSALSYIL
FT                   ANKLANPIMPAIALREIIEEAHQNQPQIIESAACDIRAVRQRDPAVEQYSTPLLYLKGF
FT                   HALQSYRITHYLWQQGRKALAIYLQNQISVAFDVDIHPAARIGCGIMFDHATGIVIGET
FT                   SVIENDVSILQGVTLGGTGKESGDRHPKIREGVMIGSGAKVLGNIEIGRYAKIGANSVV
FT                   LQSVSEYTTVAGVPSQIVGKNKGAKPAFDMDQYFIDDAINLNI"
FT   gene            complement(139497..140513)
FT                   /gene="gpsA"
FT                   /locus_tag="HS_0155"
FT   CDS_pept        complement(139497..140513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="HS_0155"
FT                   /product="glycerol 3-phosphate dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24433"
FT                   /db_xref="GOA:Q0I0W7"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0W7"
FT                   /protein_id="ABI24433.1"
FT                   /translation="MNDNSPSPTPITVIGAGAYGTALAIAFSRNGYPTYLWGHHPQHCQ
FT                   RLRNERKNQAFLPNIHFPDSLYVEDNLAQAIQHSRELLIVVPSHVFGDVIMQIKPHLRS
FT                   DQRIAWATKGLERNTGRLLQEVVEEHVGYGYPLAVLSGPTFAKELAAGMPTAITLASNN
FT                   EQFALEFQERIHCSKHFRVYINQDMIGVQLGGAVKNVIAIAAGISDGMGFGANARTALI
FT                   TRGIAEISRLGISLGANPNTFMGTSGLGDLVLTCTDNQSRNRRFGLMLGQGFDCTTAIN
FT                   ELGPVIEGFYNTKETFLLAQQQGVEMPITEQVYQILFCGKKPEDAAITLLGRKRKRE"
FT   gene            complement(140580..141095)
FT                   /gene="secB"
FT                   /locus_tag="HS_0156"
FT   CDS_pept        complement(140580..141095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="HS_0156"
FT                   /product="protein translocase subunit secB"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24434"
FT                   /db_xref="GOA:Q0I0W6"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0W6"
FT                   /protein_id="ABI24434.1"
FT                   /translation="MTEKNQDAVTEEQGTEVVLQIQRIYVKDVSFEAPNLPHIFQQEWK
FT                   PKLDFNLSTETTHLAEDLYEVCLNISVETTMEGSEDVAFICEVKQAGIFAISGLEDVQL
FT                   AHCLTSQCPNMLFPYARELISSLVNRGTFPALNLAPVNFDALFVEYMQRQQAQEESKAE
FT                   EKEKKEVH"
FT   gene            complement(141106..141552)
FT                   /locus_tag="HS_0157"
FT   CDS_pept        complement(141106..141552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0157"
FT                   /product="conserved hypothetical protein, with
FT                   rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24435"
FT                   /db_xref="GOA:Q0I0W5"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0W5"
FT                   /protein_id="ABI24435.1"
FT                   /translation="MQEYLPLATEFAKNHSLMVIAWIAVFVMLIYTSVKSFTSKVTAVE
FT                   NAEATRLINNEEAIVIDLRTIDEFQRGHIINSINVLPTEIKNQNLGKIEQHKDTPVILV
FT                   CATGMNAGASAELLVKQGFSRVYSLKDGISGWIAANLPLVKKHK"
FT   gene            141796..143106
FT                   /gene="dcuB"
FT                   /locus_tag="HS_0158"
FT   CDS_pept        141796..143106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcuB"
FT                   /locus_tag="HS_0158"
FT                   /product="anaerobic C4-dicarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24436"
FT                   /db_xref="GOA:Q0I0W4"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0W4"
FT                   /protein_id="ABI24436.1"
FT                   /translation="MFYIQFAIVLVCILIGARIGGIGLGVMGGLGLCILAFGFGLQPAG
FT                   LPIDVMFMIMAVVSAAAAMQAAGGLDYMIKIATNILRRNPKYITFVAPAVTWLFTFLAG
FT                   TGHVAYSVLPVIAEVSRHSGIRPERPLSMAVIASQFAIVASPIAAAVVAVVNYLEPQGI
FT                   NLGSVLMVTIPSTILGIALACVFVNKMGKELKDDPNYQRLLQNPEYVKENSVSNIAEIE
FT                   IKPTAKLSVGLFLFGALLVVVMGAYPELRPSFNDKPMGMAHTIEIVMLTVGALIILTCK
FT                   PNGNAITQGSVFHAGMRAVIAIFGIAWLGDTLMQGHIAGIKESVKLLVETAPWAFAFAL
FT                   FLLSVLVNSQGATVATLFPLGIALGIEPAILIGVFVAVNGYFFIPNYGPIIASIDFDTT
FT                   GTTRIGKFIFNHSFMLPGLLSMAFSLGFGLLFASILL"
FT   gene            complement(143179..144039)
FT                   /gene="ubiA"
FT                   /locus_tag="HS_0159"
FT   CDS_pept        complement(143179..144039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="HS_0159"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24437"
FT                   /db_xref="GOA:Q0I0W3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0W3"
FT                   /protein_id="ABI24437.1"
FT                   /translation="MTIFAKDKLIAYGQLMRLDKPIGTLLLLWPTLWALYLAEKAMPTL
FT                   SVLAIFICGVFLMRSAGCVINDYADRHIDGKVKRTSLRPLSTGRATPREAKWLFIVLVF
FT                   CSFLLVLCLNLYTIGLSVIAVILAFIYPFMKRYTHLPQFFLGAAFGWSIPMAYGATIEA
FT                   LPLECWLLFIANLSWTVAYDTQYAMVDRDDDLRIGVKSTAILFAQYDNKIIALLQIITL
FT                   IFLFSVGYLSQLNNRYFIVLAIAGLFFVYQCRLTKNRDRASCFNAFLNNNYFGLTVFIA
FT                   VLFGI"
FT   gene            144024..144500
FT                   /gene="glpE"
FT                   /locus_tag="HS_0160"
FT   CDS_pept        144024..144500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpE"
FT                   /locus_tag="HS_0160"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24438"
FT                   /db_xref="GOA:Q0I0W2"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0W2"
FT                   /protein_id="ABI24438.1"
FT                   /translation="MQILSFDWLNLVILNKSAVYFTVKSFLEKVSLPYKETVLYCEILL
FT                   LLNYHKMTTFKEINSEQAWEILNNKNAVLVDIRDLSHFIYSRPKSAFHLTHQRFSEFQQ
FT                   KYEYDQPIIVSCYHGVSSRNVAQFLVEQGYDEVYSLIGGFAGWVQANLPVESGY"
FT   gene            complement(144524..144862)
FT                   /locus_tag="HS_0161"
FT   CDS_pept        complement(144524..144862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24439"
FT                   /db_xref="GOA:Q0I0W1"
FT                   /db_xref="InterPro:IPR035333"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0W1"
FT                   /protein_id="ABI24439.1"
FT                   /translation="MYILSRIKMKKQNMPTGFSRFSWALVGFCLPVLLWPLALLISPNF
FT                   IKNPNLDDFQMRWMSIFFWAYPFILGIIARYSFKLNQRNSKLAKYVLLLSAVIFYSVLI
FT                   YVCAVGLN"
FT   gene            144882..145751
FT                   /gene="glpG"
FT                   /locus_tag="HS_0162"
FT   CDS_pept        144882..145751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpG"
FT                   /locus_tag="HS_0162"
FT                   /product="GlpG protein, Rhomboid family"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24440"
FT                   /db_xref="GOA:Q0I0W0"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0W0"
FT                   /protein_id="ABI24440.1"
FT                   /translation="MKLLFGSERENFIIWFRDYIRAKYLLELTIQNYIDEKYNRSVRGV
FT                   FIEENHPLLTQLEQEKILFLQDPFNPCYQQAAWEAGDTHSIQYKKTSWVAIWKISSKWF
FT                   QQGKITLFITALCTLIYVLQNLGFEQGIFHFTHYPANPAQQTEIWRYISHSLVHLSPLH
FT                   FLFNLSWFWLFGGAIERQLNAKKLLLLFFVSSILTGVVQNYFSDYRFFGLSGVVYAVLG
FT                   YVFILDKFHYAKFALPSGFFLMLIMGIALGFISPLVGIYMGNSAHISGLLCGILLGLWQ
FT                   VKKGRFEN"
FT   gene            145978..146502
FT                   /locus_tag="HS_0163"
FT   CDS_pept        145978..146502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0163"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24441"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="InterPro:IPR039255"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0V9"
FT                   /protein_id="ABI24441.1"
FT                   /translation="MQKVKLPLTVDPIKDAQRRLDYQGCYVSNQVTRLAESVVKVLSDV
FT                   QVTLSFFVDPQKLTVMKGRASVDVELECQRCGYPFSQSLECEFSYSPVSDLGKINELPE
FT                   IYEPIELNEFGEIDLIGTIEDELIVALPIVPMHSSEHCEVSVAEQVFGELPEELAKKPN
FT                   PFAVLASLKKK"
FT   gene            146520..146690
FT                   /gene="rpmF"
FT                   /locus_tag="HS_0163a"
FT   CDS_pept        146520..146690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="HS_0163a"
FT                   /product="LSU ribosomal protein L32P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0163a"
FT                   /db_xref="EnsemblGenomes-Tr:ABI26065"
FT                   /db_xref="GOA:Q0I0V8"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0V8"
FT                   /protein_id="ABI26065.1"
FT                   /translation="MAVQQNKKSRSRRDMRRSHDALTTAAVSVDKTSGETHLRHHVTAD
FT                   GYYRGRKVINK"
FT   gene            146757..147089
FT                   /gene="plsX"
FT                   /locus_tag="HS_0164"
FT   CDS_pept        146757..147089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="HS_0164"
FT                   /product="possible fatty acid/phospholipid synthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24442"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0V7"
FT                   /protein_id="ABI24442.1"
FT                   /translation="MSPRITICELVKALGKHPMLSLLFANNQQIFPLRQRFPIDSQNYL
FT                   AVCHCSHVIENNQGLVHTLVHIFVEYQLGLFYLYAALLNIGIEETKEYKEYKAIRDMAL
FT                   QSSKKG"
FT   gene            147142..148092
FT                   /gene="fabH"
FT                   /locus_tag="HS_0165"
FT   CDS_pept        147142..148092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="HS_0165"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24443"
FT                   /db_xref="GOA:Q0I0V6"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0V6"
FT                   /protein_id="ABI24443.1"
FT                   /translation="MYSRILATGSYIPANIRTNADLEKMVETSDEWITTRSGIKERRIA
FT                   GENETVATMGFKAAKNALQLANICPNDIDLVLVATTSHSYAYPSAACQIQGMLDIDDAI
FT                   SFDLAAACTGFIYALSVADQFIKTGKVKKALVIGADINSRKLDETDRSTVILFGDGAGA
FT                   VILESSDIEGIISTHLHASLDKSNALILPQTQHGEAQSGYIQMQGNATFKLAVRELSNV
FT                   VEETLRDNHLDKADLDWLVPHQANLRIITATAEKLNMSLDQVVITLDKYGNTSAATVPV
FT                   ALDEAVRDGRIKRGQLLLLEAFGGGWTWGSALVRF"
FT   gene            148136..149074
FT                   /gene="fabD"
FT                   /locus_tag="HS_0166"
FT   CDS_pept        148136..149074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="HS_0166"
FT                   /product="[Acyl-carrier-protein] S-malonyltransferase"
FT                   /EC_number="2.3.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24444"
FT                   /db_xref="GOA:Q0I0V5"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0V5"
FT                   /protein_id="ABI24444.1"
FT                   /translation="MKKFAMVFPGQGSQAVGMLAELAAEYPIVEETFQQASSVLGYDLW
FT                   QLVQQGPAEELNKTWQTQPALLAASVAIYRVWQQKYPHLKPEVMAGHSLGEYSALVCAG
FT                   VIDFQDGIKLVQLRGKLMQQAVPEGTGAMYAIIGLDNESIVQACKASEQGEIVSAVNFN
FT                   SPGQVVIAGAKVAVERAAVACKEAGAKRALPLAVSVPSHCALMKPAAEELAVALEKMTF
FT                   SIPQIPVINNVDVKAENETTKIRTALVRQLYSPVRWTEIVENMAREGIELLFEMGPNKV
FT                   LTGLTSRIVKELNAKAVNDLSSLNTVEESLD"
FT   gene            149128..149853
FT                   /gene="fabG"
FT                   /locus_tag="HS_0167"
FT   CDS_pept        149128..149853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="HS_0167"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24445"
FT                   /db_xref="GOA:Q0I0V4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I0V4"
FT                   /protein_id="ABI24445.1"
FT                   /translation="MQGKIALVTGATRGIGRAIAEELASKGAFVIGTATSEKGAESISA
FT                   YLGKQGKGLVLNVADQDSIDAVLSAIKAEVGDVEILVNNAGITRDGLLMRMKDDDWFDI
FT                   MQTNLTSIYRLSKAVLRPMMKKGGRIINIGSVVGSMGNPGQTNYCAAKAGVIGFTKSLA
FT                   KEVAARGVTVNVVAPGFIATDMTDVLTDEQKANILTNVPAGRLGQPKDIAKAVAFLASE
FT                   DASYITGTTLHVNGGMYLP"
FT   gene            150107..150337
FT                   /gene="acpP"
FT                   /locus_tag="HS_0168"
FT   CDS_pept        150107..150337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="HS_0168"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24446"
FT                   /db_xref="GOA:Q0I0V3"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0V3"
FT                   /protein_id="ABI24446.1"
FT                   /translation="MSIEERVKKIIVEQLGVKEDDVKPEASFIEDLGADSLDTVELVMA
FT                   LEEEFDIEIPDEEAEKITTVQSAIDYVQNNQ"
FT   gene            150486..150914
FT                   /gene="rplK"
FT                   /locus_tag="HS_0169"
FT   CDS_pept        150486..150914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="HS_0169"
FT                   /product="LSU ribosomal protein L11P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24447"
FT                   /db_xref="GOA:Q0I0V2"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0V2"
FT                   /protein_id="ABI24447.1"
FT                   /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAR
FT                   TESLEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSSKPNKDKVGKVTLD
FT                   QIRQIAETKAADMTGATIETKMKSIEGTARSMGLVVEG"
FT   gene            150919..151608
FT                   /gene="rplA"
FT                   /locus_tag="HS_0170"
FT   CDS_pept        150919..151608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="HS_0170"
FT                   /product="LSU ribosomal protein L1P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24448"
FT                   /db_xref="GOA:Q0I0V1"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0V1"
FT                   /protein_id="ABI24448.1"
FT                   /translation="MAKLTKRMKAIKAGVDSTKQYEINEAITVLKQFTSTKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFTQGANVDAAKAAGADLVGMEDLAEQI
FT                   KKGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKSGQIRY
FT                   RNDKNGIIHTTIGKANFSAEQLKENLQALLAALTKAKPATAKGIFIRKVSVSTTQGAGV
FT                   AVDQSSL"
FT   gene            151892..152383
FT                   /gene="rplJ"
FT                   /locus_tag="HS_0171"
FT   CDS_pept        151892..152383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="HS_0171"
FT                   /product="LSU ribosomal protein L10P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24449"
FT                   /db_xref="GOA:Q0I0V0"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0V0"
FT                   /protein_id="ABI24449.1"
FT                   /translation="MALNLQDKQAIVAEVNEAAKGALSAVIADSRGVTVDKMTELRKAA
FT                   REAGVSMRVVRNTLLRRAVEGTAFECLTDTFVGPTLIAFSNEHPGAAARLFKDFAKAND
FT                   KFEIKGAAFEGKIQNVEFLATLPTYEEAIARLMGTMKEAAAGKLARTLAAYRDKLQEAA
FT                   "
FT   gene            152435..152803
FT                   /gene="rplL"
FT                   /locus_tag="HS_0172"
FT   CDS_pept        152435..152803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="HS_0172"
FT                   /product="LSU ribosomal protein L12P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24450"
FT                   /db_xref="GOA:Q0I0U9"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I0U9"
FT                   /protein_id="ABI24450.1"
FT                   /translation="MSLTNEQIIEAIASKTVTEIVELISAMEEKFGVSAAAAAVAVAAG
FT                   PAEVAEEKTEFDVVLAEAGANKVAVIKAVRGATGLGLKEAKDLVESAPANLKEGISKAE
FT                   AEALKKELEEAGAKVEIK"
FT   gene            complement(153043..154242)
FT                   /gene="rho"
FT                   /locus_tag="HS_0173"
FT   CDS_pept        complement(153043..154242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="HS_0173"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24451"
FT                   /db_xref="GOA:Q0I1X1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1X1"
FT                   /protein_id="ABI24451.1"
FT                   /translation="MGLENLARLRKQDIIFAILKQHAKSGEDIFGGGILEILPDGFGFL
FT                   RSADSSYLAGPDDIYVSPSQIRRFNLQTGDKIEGKIRPPKEGERYFALLKVDRVNDDKP
FT                   EVSRSKILFENLTPLHANSRLRMERGNGSTEDLTARILDLASPIGKGQRGLIVAPPKAG
FT                   KTMLLQNIAQSIIHNYPECELIVLLIDERPEEVTEMQRSVKGEVIASTFDEPAARHVQV
FT                   AEMVIEKAKRSVEHKKDVVILLDSITRLARAYNTVTPASGKILSGGVDANALHRPKRFF
FT                   GAARNVEEGGSLTIIATALVDTGSKMDEVIFEEFKGTGNMELHLSRKIAEKRVFPAIDF
FT                   NRSGTRKEDLLTTPDELQKMWILRKILNPMGEIEAMEFLIDKLMMAKTNEEFFEVMKRS
FT                   "
FT   gene            154500..155759
FT                   /gene="rhlB"
FT                   /locus_tag="HS_0174"
FT   CDS_pept        154500..155759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlB"
FT                   /locus_tag="HS_0174"
FT                   /product="ATP-dependent RNA helicase, DEAD box family"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24452"
FT                   /db_xref="GOA:Q0I1X0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1X0"
FT                   /protein_id="ABI24452.1"
FT                   /translation="MQNSHLSQQRFSDLALHRSVQQAIKEKGFEFCTPIQALSLPITLK
FT                   GQDIAGQAQTGTGKTIAFLTATFHHLLQKNNINSSEQPRALILAPTRELVVQIANDANF
FT                   LVQATGLKTGLAYGGEGYDKQLKVIDQGIDILIGTTGRVIDYVKQGIIRLDYIQVVVLD
FT                   EADRMFDLGFIRDIRYLLRKCPVPQQRLTMLFSATLSYKVRELAFEHMNDPQYVEIEPL
FT                   QKTGHRIREELFYPSNQDKMALLMTLLEEEWPERCIIFSNTKHRCEEIWGYLSADGHRV
FT                   GLLTGDVMQKKRLSLLKQFTDGTLDILVATDVAARGLHIPDVTHVFNYDLPDDCEDYVH
FT                   RIGRTGRAGESGISISFACEEYAINLPAIEEYIGHSIPVSQYDAKALIEDLPTPHRIKR
FT                   GAFDSRSNLQRTIKRLKKTY"
FT   gene            155873..156559
FT                   /gene="rpe"
FT                   /locus_tag="HS_0175"
FT   CDS_pept        155873..156559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="HS_0175"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24453"
FT                   /db_xref="GOA:Q0I1W9"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1W9"
FT                   /protein_id="ABI24453.1"
FT                   /translation="MTPYLIAPSILSANLARLGEDVENVLKSGADVIHFDVMDNHYVPN
FT                   LTFGPAICKALRDYGIKAPIDVHLMVKPVDRIIPDFAKAGADYITFHPEASEHIDRSLQ
FT                   LIRDCGCKAGLVFNPATPLSYLDYVLDKIDVILLMSVNPGFGGQAFIPSTLEKLKQARK
FT                   IIDESGLDIRLEVDGGVKVNNIAEIAQAGADMFVAGSAIFDQPDYKKVIDEMRQQLSTI
FT                   REKETK"
FT   gene            156556..157230
FT                   /gene="gph"
FT                   /locus_tag="HS_0176"
FT   CDS_pept        156556..157230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gph"
FT                   /locus_tag="HS_0176"
FT                   /product="phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24454"
FT                   /db_xref="GOA:Q0I1W8"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="PDB:2HSZ"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1W8"
FT                   /protein_id="ABI24454.1"
FT                   /translation="MTQFKLIGFDLDGTLVNSLPDLALSINSALKDVNLPQASENLVMT
FT                   WIGNGADVLSQRAVDWACKQAEKELTEDEFKYFKRQFGFYYGENLCNISRLYPNVKETL
FT                   EALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGK
FT                   FGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNIPIAQSKPDWIFDDFADILKI
FT                   TQ"
FT   gene            157240..158241
FT                   /gene="trpS"
FT                   /locus_tag="HS_0177"
FT   CDS_pept        157240..158241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="HS_0177"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24455"
FT                   /db_xref="GOA:Q0I1W7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1W7"
FT                   /protein_id="ABI24455.1"
FT                   /translation="MTKPVVLSGVQPSGELTIGNYLGALRQWVNMQDEYECLYCIVDLH
FT                   AITVRQDPDTLRKATLDVLALYLACGIDPEKSTIFIQSHIPEHTQLAWILNCYTYFGEM
FT                   SRMTQFKDKSARHADNINVGLFTYPVLMAADILLYQANQVPVGEDQRQHLEITRDIAQR
FT                   FNALYGEHFIVPEAFIPKAGARVMSLLEPEKKMSKSDENRNNVIGLLEDPKAVVKKIKR
FT                   AVTDSDEPPVVRYDVKNKAGVSNLLDILSGVTGKSIVQLEAEFEGKMYGHLKSAVADEV
FT                   ATMLTTLQERFYHFRNNEELLNKIAAEGAEKARKRAKETLDKVYRAVGFVTP"
FT   gene            complement(158460..158900)
FT                   /locus_tag="HS_0178"
FT   CDS_pept        complement(158460..158900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0178"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24456"
FT                   /db_xref="GOA:Q0I1W6"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1W6"
FT                   /protein_id="ABI24456.1"
FT                   /translation="MHYLIVFISGKVNYPFHNGMKFMLIQQRLIFLVQRHLIDEDIMTI
FT                   TLNIRNRLGKKWRVNLKTKQVDMLLIHLAMALGRIKRGYVAKALNPDFFSEIERAVCFT
FT                   KILKLHQELLTFIPFPIPKEEQSHFIANIYSLSLAQPWILTP"
FT   gene            158953..159555
FT                   /locus_tag="HS_0179"
FT   CDS_pept        158953..159555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0179"
FT                   /product="possible phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24457"
FT                   /db_xref="GOA:Q0I1W5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1W5"
FT                   /protein_id="ABI24457.1"
FT                   /translation="MLNKEIIARYEGLIFDMDGTVIDTMPCHKQAWELVGAEMGYALDG
FT                   DVMYQLGGAPVRTIAKAIMEKAQMPLYLMEDVISLKRKYGIELIMKNATLLPAADIVKQ
FT                   YVGQKPLALGTGSHRYVTEMLLEKFQLQSYFGAIVTAEDVINHKPEPDTFLRCAELLNL
FT                   DPLKCLVFEDADLGVQAGLAAEMDVFDVRVNQIITSK"
FT   gene            complement(159556..159843)
FT                   /locus_tag="HS_0180"
FT   CDS_pept        complement(159556..159843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24458"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1W4"
FT                   /protein_id="ABI24458.1"
FT                   /translation="MPIKVAYTSLKQYHNYLFTFEKYSELDIERTINRTKGLFKELKQT
FT                   LNNHNGLKKHNFMFIKYFLNKSYKHNQKIRLATISLLCLNVQITQNTDKI"
FT   gene            complement(159934..162681)
FT                   /locus_tag="HS_0181"
FT   CDS_pept        complement(159934..162681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0181"
FT                   /product="TonB-dependent outer membrane receptor"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24459"
FT                   /db_xref="GOA:Q0I1W3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1W3"
FT                   /protein_id="ABI24459.1"
FT                   /translation="MSNKFKLTAVAFSVLSTCVYAEEMLDQINVEYKLPPKQEVFKKAG
FT                   ATSVRENISTSTQSIDDIIRTVPGAFTNLDKSSGIVSVNVRGQTGFGRVNTMVDGISQT
FT                   FFATSGDNSEKAGGTSQFGATIDPAFITSVDIQRGSFDGKAGANALVGSANFRTIGVDD
FT                   VISEGRNVGALLNAGGGTNATGPNYMGAVAFRYPFSDTRTLGFMYAYSWRKSSQDFKVG
FT                   GGRSIKDVDAEEVGRIVKEACKGEFLCKEDEKRKLYGLQPYDPSKLLHYPQSHLAKIEY
FT                   NDKYNKAILSYRSLSTALSGRNLENKNYQLNYQLKPKENLQFELILADNTSTQTYHKGS
FT                   VFNGKMLKDVLESKNSAKTTDINMHFSIPFTEKFSYEATLGANILKNKYSKNRHPRELG
FT                   YYFDGGEPNSRDFCDYVGKYKNACIYHGIRSNTFQPDGEQRFKTLYFDQTFKYDIYTLK
FT                   VNANRQIYKYSGATFPRDPRDRVTRYFPADPEQKTKDGYTVYVNGNSSAIVHKYGYDGA
FT                   IKFGCYHYENDEEQWVDVYNCPTFYSVQKGNSRAHDNYSMSFSADFHPLFSPFVSYAKT
FT                   HRVPNIKEMYFSEFGTLAIRPDLKSEKAKTIQFGINGYKNGIFSDFDALGFKVLAYQTK
FT                   IRDYIINIKQECSSNSWRGADKAPTIYDCVGHLTHINYEGGKTILKTEMVDSGSGFKVP
FT                   LNQLIPADSSPIVKIQGLELELNYDIGWFYANLSYARQKTNQPSSYSDSSNSVGDDSET
FT                   GQYLQGFGLSKISSLPKDYGSLDLGTRLFDGKLTLGGTAKYYGKSKRARLDKADGDVIL
FT                   PGTFTSRKTGETFLTYVRISGTEEIKAQPIIFDFYAIYQPTENLTIKGEIQNAFDKKYI
FT                   NPLDANNDSANQMTYAMGVGDGYQKALNNYSKGRTFVLNVNYKF"
FT   gene            complement(162913..163530)
FT                   /locus_tag="HS_0182"
FT   CDS_pept        complement(162913..163530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0182"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24460"
FT                   /db_xref="GOA:Q0I1W2"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1W2"
FT                   /protein_id="ABI24460.1"
FT                   /translation="MLSVFNFIDLLGTFIFALSGAVAGMKKQFDLFGIFVVSAVTAIGG
FT                   GIIRDLCLSATPPAGLENIAYLLIILLAVCCVSFFQEKITSFSKVSNLLDAVGLGFFAA
FT                   FGANKTWYMTENIQLSIILGCISAVGGGCIRDVLTNKSPLIFQSEIYAGAAIVGATIEL
FT                   LGSTGLISPLLSPWLAIITCTLIRMLAIRYRIQFPFIKDKSL"
FT   gene            163772..165307
FT                   /gene="ilvA"
FT                   /locus_tag="HS_0183"
FT   CDS_pept        163772..165307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="HS_0183"
FT                   /product="L-threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /note="threonine dehydratase; threonine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24461"
FT                   /db_xref="GOA:Q0I1W1"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1W1"
FT                   /protein_id="ABI24461.1"
FT                   /translation="MISNLTEQPSGAEYLKAILSSKIYELAQVTPLQPMLKLSERLSNT
FT                   VLVKREDRQLVHSFKLRGAYAMIAGLSQPQKNAGVITASAGNHAQGVALSAKNLGLNAL
FT                   IVMPQNTPRIKVDAVRGYGGEVLLYGANFDEAKAKAIELSESKSMTFIPPFDHPAVIAG
FT                   QGSLAMELLQQNSHIDRIFVPVGGGGLAAGVAVLIKQLMPDIKVIAVESKDSACLHAAL
FT                   KVGQPVDLERVGLFADGVAVKRIGNETFRVCQQYIDDVVLVDSDEVCAAMKDMFENVRA
FT                   IAEPSGAVSLAGLKKYVKEHNIQGETLVNILSGANLNFHTLRYVSERCEIGEKHEAIFA
FT                   VTIPEEKGSFLRFCHLLGDRPVTEFNYRYADKEQACIFVGVRISSEKEKLEIIQQLEQN
FT                   DYKVMDLSDDEIAKTHIRYMIGGRTTSNSKERLYNFEFPEQKGALLKFLMMLGTHWNIS
FT                   LFHYRAYGADYGNVLAGFQLDEHDEIRFNGHLEELAYTYQDVTDSPAYKYFLA"
FT   gene            complement(165383..166315)
FT                   /gene="ispH"
FT                   /locus_tag="HS_0184"
FT   CDS_pept        complement(165383..166315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="HS_0184"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24462"
FT                   /db_xref="GOA:Q0I1W0"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1W0"
FT                   /protein_id="ABI24462.1"
FT                   /translation="MANPRGFCAGVDRAISIVELALEIHGAPIYVRHEVVHNRFVVDGL
FT                   RDRGAIFVEELDEVPNGAIVIFSAHGVSQAVRQEAKERNLKVFDATCPLVTKVHMQVAR
FT                   ASRKGTKAILIGHEGHPEVIGTMGQYDNDKGGIYLVEDVEDIAKLTLRNDEDITFMTQT
FT                   TLSIDDTADVIEVLKQKYPAIQGPRKNDICYATTNRQQAVRELAELSDLVIVVGSKNSS
FT                   NSNRLAELASRMGVTAKLIDDANDIEVSWLNNVKVIGLTAGASAPEILVQSVISRLKEL
FT                   GVDEVEELEGCEENTVFEVPKELRINKVE"
FT   gene            complement(166327..166824)
FT                   /gene="lspA"
FT                   /locus_tag="HS_0185"
FT   CDS_pept        complement(166327..166824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="HS_0185"
FT                   /product="signal peptidase II, Aspartic peptidase, MEROPS
FT                   family A08"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24463"
FT                   /db_xref="GOA:Q0I1V9"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1V9"
FT                   /protein_id="ABI24463.1"
FT                   /translation="MNLSKTGLPFLWISAVAFFTDLITKLAVVKNFSLYESINILPFFN
FT                   LTYVRNHGAAFSFLADHAGWQKYFFILLALVVSFMILFFLYKNQATQKLQNTGYALMVG
FT                   GALANAADRAYHGFVVDFFDFYWQQWHYPVFNIADVAICIGAGLLAIDAFKQNDKKESK
FT                   QN"
FT   gene            complement(166899..169712)
FT                   /gene="ileS"
FT                   /locus_tag="HS_0186"
FT   CDS_pept        complement(166899..169712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="HS_0186"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24464"
FT                   /db_xref="GOA:Q0I1V8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1V8"
FT                   /protein_id="ABI24464.1"
FT                   /translation="MTDYKNTLNLPETGFPMRGDLAKREPDMLKNWYDKNLYQKVREAS
FT                   KGKKTFILHDGPPYANGTLHLGHAVNKILKDIIMKSKTALGFDTPYVPGWDCHGLPIEL
FT                   KVEGLVGKPNEKISAAEFRQACRDYAKEQVEGQKADFIRMGVLGDWDNPYLTMNFETEA
FT                   EIIRTLGKVIQNGHLYKGSKPVHWCLDCASSLAEAEVEYEDKVSPSIYVRFAAVSAAEV
FT                   EEKFNALGKGQGALSAVIWTTTPWTLPSNRAIAVNAELEYQLVQLGNERVILATELVQT
FT                   VQNALGIEQIQILGSAKGGDLELIRFNHPFYDFSVPMILGDHVTVDGGTGLVHTAPDHG
FT                   QDDFVVSKKYGLEMAGLVANDGKFISSTPFFAGKGVFEANDLVLEKLKETGALLKLERI
FT                   KHSYPHCWRHKTPIIFRATPQWFIGMETQDLRIKALSEIKSVRWIPSWGEARIDKMVAN
FT                   RPDWCISRQRTWGVPMTMFVHNETEELHPRTLELLEDIAKRVEKAGIQAWWDLDPAELL
FT                   GEEAKTYHKVPDTLDVWFDSGSTYASVVEQRPEFNGKSTDMYLEGSDQHRGWFMSSLML
FT                   STATNNKAPYKQVLTHGFTVDEKGRKMSKSLGNVIVPSEVWNKNGADILRLWVASTDYT
FT                   GEIAVSHKILNSAGDTYRRIRNTARFLLANLNGFDPKNDLVNPEEMISLDRWAVSCALE
FT                   AQNEIKEAYDNYQFHTVVQRLMRFCSIEMGSFYLDIIKDRQYTTKADSLARRSCQTALW
FT                   HISEALVRWIAPILSFTADEIWGYLPKLDNRAEFVFTEEFYDGLFGLDESDKLDDTYWQ
FT                   QLLKVRAEVNRVLEQARNDKLIGAGLEAKVTVYASEEIRPLLEQLGNELRFVLITSQVV
FT                   VKPLSKADVAESELTGLAVKVERADGEKCPRCWHFATDIGSNKEHSHICGRCIENVEGN
FT                   GEQRQFA"
FT   gene            complement(169731..170279)
FT                   /locus_tag="HS_0187"
FT   CDS_pept        complement(169731..170279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0187"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24465"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1V7"
FT                   /protein_id="ABI24465.1"
FT                   /translation="MKKLKNLLLILGTFIPCLSFAQNIILDGYKDLKFGMTYQQVADSK
FT                   LCTGWEYYQPLNSYKCQHFLFNGNNREATAYFNGQVLNSIAIDILNYSQNRPPFPREVQ
FT                   EVKDILNGLPQKYGPPTKVVCGADYARSNEECNINTTDINFDDYWMVEFLNGQIRLVNS
FT                   VNQWVILVYSSAKTILDSL"
FT   gene            complement(170377..171321)
FT                   /gene="ribF"
FT                   /locus_tag="HS_0188"
FT   CDS_pept        complement(170377..171321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="HS_0188"
FT                   /product="FMN adenylyltransferase"
FT                   /EC_number="2.7.7.2"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24466"
FT                   /db_xref="GOA:Q0I1V6"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1V6"
FT                   /protein_id="ABI24466.1"
FT                   /translation="MQLIRGFHNLPEPLKQQGCAVTIGNFDGVHLGHQSILQHLKAKAK
FT                   QLNLPVVVMLFEPQPYEYFQGDQAPARLMRLRDKLAYLAQLGVDYVFCVKFNRTFAQLS
FT                   AEQFISDCLVKHLKMKFLSIGDDFRFGLNREGDFRLLQKKGQQQSFIVEDNRSLQLNDQ
FT                   RISSTAIRQALSEDNLALAEKLLGKPYRIYGRVAHGNKLGRTIGFPTANIYLHRQVNPI
FT                   KGVYVVKVRLKNGDIFQGVANIGKRPTINGVKQLLEVHLFNFDRDLYGQSLQIEFCHKI
FT                   RHEKKFPSLNALKNQIENDVVVAKKYFQQVLNL"
FT   gene            complement(171407..171892)
FT                   /gene="folA"
FT                   /locus_tag="HS_0189"
FT   CDS_pept        complement(171407..171892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="HS_0189"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24467"
FT                   /db_xref="GOA:Q0I1V5"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1V5"
FT                   /protein_id="ABI24467.1"
FT                   /translation="MKLSIIVAMTKNHVIGKNNQMPWHLPADLAWFRQNTGGKPIIMGR
FT                   KTFESIGRPLPNRTNIVLSRSPYEHDGIIWKDNLQSAVDFVRENHHEIMLIGGGELFKQ
FT                   YLPQANKLYLTEIQTELEGDTFFPEFNWQEWQIEFEQQRPADEKNPYACRFLILNRK"
FT   gene            complement(171945..172424)
FT                   /locus_tag="HS_0190"
FT   CDS_pept        complement(171945..172424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24468"
FT                   /db_xref="GOA:Q0I1V4"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1V4"
FT                   /protein_id="ABI24468.1"
FT                   /translation="MGALIMDLILKLLDDMFFAAIPAVGFALVFNVPKNVLKYCAFLGA
FT                   LGHGTRTFLVHFNIPLVFATFIAASVVGFIGVYLSHRYLAHPKVFTVAAVIPMIPGVFA
FT                   YKAMIAIVHLHHYGFNEQRVAQMTEYFLKTGFLIGALVFGLALPGLLFYRHKPVV"
FT   gene            complement(172412..173200)
FT                   /locus_tag="HS_0191"
FT   CDS_pept        complement(172412..173200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0191"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24469"
FT                   /db_xref="GOA:Q0I1V3"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1V3"
FT                   /protein_id="ABI24469.1"
FT                   /translation="MNTTEDNSSFQQREITRTCAQVAQMLLQHGAESTLIVQMAQRLGF
FT                   ALGIDSVECALTPNAVIITTLYDHNCITTVRKNLDKGINMQVVTEVQRLVIMAEKGLYD
FT                   LQQIRKKLDGIKPLKYNRFVVVTMIGLSCACFAHLSGGDIIVFLITFIASSIAMFIRQT
FT                   LTLRHYNPLIVFAITAFVASMVAGLAVKYELGNDPQIALASSVLLLVPGFPLINSLADI
FT                   LKGHINMGIARWTLATVLTFGTCLGIVFALSFLHIANWGR"
FT   gene            173358..174470
FT                   /gene="proB"
FT                   /locus_tag="HS_0192"
FT   CDS_pept        173358..174470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="HS_0192"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24470"
FT                   /db_xref="GOA:Q0I1V2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1V2"
FT                   /protein_id="ABI24470.1"
FT                   /translation="METQKTNKTIVVKFGTSTLTQGSSKLNRPHMMEIVRQITQLHRAG
FT                   FRIIIVTSGAMAAGRHYLNHPQLPPTIASKQLLAAVGQSQLIQTWEQLFAIYDIHIGQI
FT                   LLTRADIEDRERFMNARDTLHALLDNRIIPVINENDAVATAEIKVGDNDNLSALVAILA
FT                   QAEQLYLLTDQRGLFDSDPRKNPQAKLISIVDKITDHIRSIAGGSGTTLGTGGMTTKIS
FT                   AADIATRSGVETIIAPGNLENVIVNLAYGKEIGTKFVVQTDCLESRKQWLFAAPVAGIV
FT                   TIDEGAESAVLIQHKSLLPAGIISVEGCFSRGEVVKICGTNGKKIALGVPRYNSDSLIQ
FT                   IKGKKSQDIEQILGYEYGSVAIHRDDMVVY"
FT   gene            complement(174631..175185)
FT                   /gene="nusG"
FT                   /locus_tag="HS_0193"
FT   CDS_pept        complement(174631..175185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="HS_0193"
FT                   /product="transcription antitermination protein nusG"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24471"
FT                   /db_xref="GOA:Q0I1V1"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1V1"
FT                   /protein_id="ABI24471.1"
FT                   /translation="MTENTAKKRWYVLQAFSGFEGRVAATLREYIKLHQMEEQFGEVLV
FT                   PTEEVVENVGGKRRKSERKYFPGYVLVQMEMNDYTWQLVRSVPRVMGFIGGTPDKPAPI
FT                   SQKEAERILNRVQETADKPRHRKEFQPGEEIRVTEGPFADFNGTVEEVDYDKGRLKVSV
FT                   LIFGRATPVELEFSQVEKANS"
FT   gene            complement(175187..175594)
FT                   /gene="secE"
FT                   /locus_tag="HS_0194"
FT   CDS_pept        complement(175187..175594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="HS_0194"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24472"
FT                   /db_xref="GOA:Q0I1V0"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1V0"
FT                   /protein_id="ABI24472.1"
FT                   /translation="MALEITKNKVAPEIEQKSKGLNGFLWLLVVAIVIVAAVSNIYLVE
FT                   KFSTALRVVGIVVALLIALGIAAITNQGMKARRFFSDSRIELRRITWPTRPEAMQTTLI
FT                   VFAVTVIASLILWGLDSVIVSLITFLTDLRF"
FT   gene            complement(175770..176954)
FT                   /gene="tufA"
FT                   /locus_tag="HS_0195"
FT   CDS_pept        complement(175770..176954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="HS_0195"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24473"
FT                   /db_xref="GOA:Q0I1U9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1U9"
FT                   /protein_id="ABI24473.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLSKHFGGAAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTATRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDF
FT                   PGDDTPIVRGSALQALNGVAEWEEKILELASHLDNYIPEPERAIDQPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIIRTGEEVEIVGIKETTKTTVTGVEMFRKLLDEGRAGENIGALLRG
FT                   TKREEIERGQVLAKPGSITPHTDFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMTVSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK"
FT   gene            complement(177054..177132)
FT                   /locus_tag="HS_tThr01"
FT   tRNA            complement(177054..177132)
FT                   /locus_tag="HS_tThr01"
FT                   /product="tRNA-Thr"
FT   gene            complement(177133..177210)
FT                   /locus_tag="HS_tGly01"
FT   tRNA            complement(177133..177210)
FT                   /locus_tag="HS_tGly01"
FT                   /product="tRNA-Gly"
FT   gene            complement(177250..177337)
FT                   /locus_tag="HS_tTyr01"
FT   tRNA            complement(177250..177337)
FT                   /locus_tag="HS_tTyr01"
FT                   /product="tRNA-Tyr"
FT   gene            complement(177366..177444)
FT                   /locus_tag="HS_tThr02"
FT   tRNA            complement(177366..177444)
FT                   /locus_tag="HS_tThr02"
FT                   /product="tRNA-Thr"
FT   gene            177659..178612
FT                   /gene="coaA"
FT                   /locus_tag="HS_0196"
FT   CDS_pept        177659..178612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaA"
FT                   /locus_tag="HS_0196"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24474"
FT                   /db_xref="GOA:Q0I1U8"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1U8"
FT                   /protein_id="ABI24474.1"
FT                   /translation="MEELNTIKLSDHLTPFLTFNRQQWAELRKSVPLKLTEQDLKPLLG
FT                   FNEELSLEEVSTIYLPLARLINYYIEENLRRQTVLKRFLSGHNPKVPYIISIAGSVSVG
FT                   KSTSARILQSLLANWPVARKVDLITTDGFLYPLEILQKKNLLQKKGFPISYDTQRLIRF
FT                   LADIKSGKKNVKAPIYSHLTYDIIPNQFDIVDRPDILILEGLNVLQIGTNKSNQMFVSD
FT                   FVDFSIFVDAEEDQLKEWYIKRFLKFCRSAFTDPNSYFKHYANLSEQEAIETASQIWDN
FT                   INGLNLKQNILPTRERANLILKKGENHKVELVKLRK"
FT   gene            complement(178666..179874)
FT                   /gene="gltS"
FT                   /locus_tag="HS_0197"
FT   CDS_pept        complement(178666..179874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltS"
FT                   /locus_tag="HS_0197"
FT                   /product="sodium/glutamate symporter (glutamate permease)"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24475"
FT                   /db_xref="GOA:Q0I1U7"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1U7"
FT                   /protein_id="ABI24475.1"
FT                   /translation="MTFGTYETVALACLVLLLGYFLVKRVHFLSEYNIPEPVVGGFIVA
FT                   IILSIVHHFWDMSFSFDTKLQTTMMLVFFSSIGLSANFARLAKGGKPLVIFLFAALGLI
FT                   ILQNTVGIGTSMLVGLDPAYGLIAGSVTLTGGHGTGAAWAETLSNRFGIQGALELAMAC
FT                   ATFGLVFGGIIGGPVARFLLKRLHKAEVPEDENVDDIEEVFEKPVYRRKINTRSIIETI
FT                   TMMSVCLIVGQYLDVLTKGTALQLPTFVWCLFTGTVIRNALAHVVKFKVADEAIDVLGT
FT                   VGLSLFLAIALMSLKLWELAGLALPILVVLLAQVVVMATYSIFVTYRMMGRDYDAVVLS
FT                   AGHCGFGLGATPTAVANMQAVTSHFGPSHKAFLIVPMVGAFFIDLLNSVALNIFLNIVD
FT                   VLH"
FT   gene            complement(180055..183531)
FT                   /gene="dnaE"
FT                   /locus_tag="HS_0198"
FT   CDS_pept        complement(180055..183531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="HS_0198"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24476"
FT                   /db_xref="GOA:Q0I1U6"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1U6"
FT                   /protein_id="ABI24476.1"
FT                   /translation="MSQPRFVHLRVHSDFSMINGITKVKPLIKACVQHEMVAMALTDFT
FT                   NFCGLVRFYGEAQSSGVKPIIGADVLVKSDLLGDELFELTLLAKNNEGYHNITLLLSKA
FT                   YERGYYNLPYIDQSWLAEHHEGIIILSGGRNGDVGKKLLKNNSADVETAVAFYQEYFPD
FT                   HFYLSLSRTGRSDEDRYIQSALILAQQKQLPLVATNDVCFLSPEDFEAHEIRVAIHDGY
FT                   TLDDPKRPKLYSSQQYFRSEQEMCELFADIPTALENTVLIAQRCNVTIRLGTYFLPKFP
FT                   TGDLSPEDFLIQKSKEGLEERLQTLFPDPQVRSEKRKEYDDRLQTELDVINKMGFPGYF
FT                   LIVMEFIQWSKDNDIPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPDRVSMP
FT                   DFDVDFCMDKRDRVIEHVAETYGRGAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDRI
FT                   AKLIPADPGMTLTKAFEVEPRLSEIYNNDEEVKALIDMARKLEGVTRNAGKHAGGVVIS
FT                   PSLITDFSPLYCDSEGKHPVTHFDKNDVEYAGLVKFDFLGLRTLTIIKWALDMINARLV
FT                   KEGKSAVDISTIPLNDPDSFNLLKKAETTAVFQLESRGMKDLIKKLQPDCFEDIIALVA
FT                   LFRPGPLESGMVQNFIDRKHGVEPVSYPDVKYQHESLKPILEPTYGVIVYQEQVMQIAQ
FT                   VLAGYSLGGADLLRRAMGKKKPEEMAAQRDIFEKGAIAKGIDGDLAMKIFDLVEKFAGY
FT                   GFNKSHSAAYALVSYQTLWLKTHYPAEFMAAVMTSEMDNTDKIVSFYDECLRMGLTIVP
FT                   PDINTGKHHFSVNDNGEIVYGIGAIKGVGEVPINAIVSAREQGGIFKDLFDLCARVDLK
FT                   KVNRRTFENLIKSGAFDKLGPHRAALAQNLEDALKASDQHAKDEAIGQVDMFGVLTSSH
FT                   EDVETAYAHTPRWSEKQILDGERETLGLYLSSHPITRYLKELSHYSSTRLNELSPNTRG
FT                   KISTVCGLIVALRFAVTKKGNRLGIATLDDRSGLLDITLFADALERFGDKLQKDTVVIV
FT                   SGTVSFDDFSQGLKMSVRELMTLDEARSRYAKNLAISLSQEQITPHFIRQLKGIIEPFS
FT                   GGSLPIHLYYQSKDGRALIRFGVQWSVYPTDELLSALVTMLGENAVELEFD"
FT   gene            complement(183692..186262)
FT                   /gene="clpB"
FT                   /locus_tag="HS_0199"
FT   CDS_pept        complement(183692..186262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="HS_0199"
FT                   /product="ATP-dependent Clp protease, subunit B"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24477"
FT                   /db_xref="GOA:Q0I1U5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1U5"
FT                   /protein_id="ABI24477.1"
FT                   /translation="MNIDKFTTKFQQAIAEAQSLAIGKDHQFIEPVHLMTALLNQQDGS
FT                   IPPLLTASGGNLALLHNELAAELSRLPQVSGNNGDIQVSRSLVKLLNLCDKLAQQRQDK
FT                   FISSELFLLAIFEDKGALSESLKKCGIKQENLLQAIDKLRGGEKVNEQGAEENRQALEK
FT                   YTIDLTARAESGKLDPVIGRDEEIRRAIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IVNGEVPEGLKGKRVLSLDMGALIAGAKYRGEFEERLKAVLKELAQEEGRVILFIDEIH
FT                   TMVGAGKTDGAMDAGNLLKPSLARGELHCVGATTLDEYRQYIEKDAALERRFQKVFVGE
FT                   PTVEDTIAILRGLKERYEIHHHVQITDPAIVAAATLSHRYISDRQLPDKAIDLIDEAAS
FT                   SIRMEIDSKPQPLDRLERRIIQLKLEQQALQKEDDEASRKRLDLLEEELGEKEREYAEL
FT                   EDVWKAEKAALSGAQHIKAELDNAKIQMEQARRISDFAKMSELQYGRIPELEKQLAQAE
FT                   SAEGKEMTLLRNRVTDEEIAEVLSRATGIPVAKMMEGEKDKLLRMEQELHKRVVGQSEA
FT                   VVAVANAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELCKTLANFMFDDENAMVRIDMS
FT                   EFMEKHSVSRLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHSDVFNILLQVL
FT                   DDGRLTDGQGRTVDFRNTVVIMTSNLGSDLIQGNKELDYNAMKEIVMSVVGQHFRPEFI
FT                   NRIDETVVFHPLAKENIRAIATIQLQRLVKRMETHGYQLEFTDATLDFIGEVGYDVIYG
FT                   ARPLKRAIQQEIENPLAQQILSGQLLPGKKVIVDYVDGKVVAQQ"
FT   gene            complement(186446..186907)
FT                   /locus_tag="HS_0200"
FT   CDS_pept        complement(186446..186907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24478"
FT                   /db_xref="GOA:Q0I1U4"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1U4"
FT                   /protein_id="ABI24478.1"
FT                   /translation="MLLPFILIALCAGIALAAQAAINTQLAQSLSGQPVFAAFVSFAMG
FT                   TIALFFICWWKMDLFSALQQVPKQPLWKLIGGLLGALAVFTTIFLAPKIGVTNMLFFII
FT                   VGQLLTALIIDHFGLIGMSQRSINVWQLIGFIVIGLGLLLFFFGKKLFH"
FT   gene            187091..187348
FT                   /gene="oadG"
FT                   /locus_tag="HS_0201"
FT   CDS_pept        187091..187348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadG"
FT                   /locus_tag="HS_0201"
FT                   /product="oxaloacetate decarboxylase, gamma subunit"
FT                   /EC_number="4.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24479"
FT                   /db_xref="GOA:Q0I1U3"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="InterPro:IPR023424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1U3"
FT                   /protein_id="ABI24479.1"
FT                   /translation="MTNTNVQLIQEGVNLMLSGMGFVLVFLLILIFAIKLMSKLIGYFS
FT                   SEPTLPQQVFIPTTELNDLERLRPVIVAAIAHHRRQQNLQ"
FT   gene            187361..189160
FT                   /gene="oadA"
FT                   /locus_tag="HS_0202"
FT   CDS_pept        187361..189160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadA"
FT                   /locus_tag="HS_0202"
FT                   /product="oxaloacetate decarboxylase, alpha subunit"
FT                   /EC_number="4.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24480"
FT                   /db_xref="GOA:Q0I1U2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1U2"
FT                   /protein_id="ABI24480.1"
FT                   /translation="MATHEKKISITDVVLRDAHQSLFATRLRLDDMLPIAAELDKIGYW
FT                   SLEAWGGATFDACIRFLGEDPWVRLRELKKAIPNTPLQMLLRGQNLLGYRHYADDVVNK
FT                   FVERAVANGMSVFRVFDAMNDPRNMQQALRAVRKNGGHAQGTLSYTTSPVHTLETWLDT
FT                   TEQLLEIGIDSLVIKDMSGILSPVEAYKLVSEIKKRYDVRLHMHCHSTTGMAEMALLKA
FT                   IEAGADGIDTAISSMSGTYGHPATEALVATLDNTQYDTGLSIPQLERIADYFRNVRKKY
FT                   AKFEGQLRGVDSRILVAQVPGGMLTNLENQLKQQNASDKLDKVLQEIPKVRADLGYIPL
FT                   VTPTSQIVGTQAVINVLMGERYKTIAKETAGILKGEYGRTPAPVNAELQAKVLAGEQPI
FT                   TDRPADHLAPEMDKLSTEIKRMVKEKGIQLAENEIDDVLIVALFPQVGLKFLENRGNPN
FT                   AFEPVPTNEVKTSEKPTALSSRNDSAVYTVEVEGKSFVVKVTEGGDISHITPVSTAPST
FT                   QSTESATSATTKNIPVNAPMAGNIWKVLVKEGQQVAEGEVLLILEAMKMETEIRAATSG
FT                   TVQGIKVKAGDTVAVGDILLTLA"
FT   gene            189212..190477
FT                   /gene="oadB"
FT                   /locus_tag="HS_0203"
FT   CDS_pept        189212..190477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadB"
FT                   /locus_tag="HS_0203"
FT                   /product="oxaloacetate decarboxylase beta subunit"
FT                   /EC_number="4.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24481"
FT                   /db_xref="GOA:Q0I1U1"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1U1"
FT                   /protein_id="ABI24481.1"
FT                   /translation="MHLSWGQAIMLVISLLLLYLAVVKKFEPLLLLPIGFGGLLSNIPE
FT                   ANMAFSALENLLHSNNNQHLSTLANLLHSDTDVQAIKQVLEKAPELLHVQAELLAKDLG
FT                   YTDGVLSTFYDVAINSGAAPLIIFMGVGAMTDFGPLLANPKTLLLGAAAQFGIFATVLG
FT                   ALALNGLGIIEFTLPQAAAIGIIGGADGPTAIYLASKLAPELLGAIAVAAYSYMALVPL
FT                   IQPPIMRLLTTKQERKIKMVQLRNVSNREKILFPIVLLVLVALLLPDAAPLLGMFCFGN
FT                   LMRVSGVVERLSDTAQNALINIVTIFLGLSVGAKLVADKFLQPQTLGILLLGIIAFAIG
FT                   TASGVLMAKLMNCFSKDKINPLIGSAGVSAVPMAARVSNKLGLEADHQNFLLMHAMGPN
FT                   VAGVIGSAIAAGVMLKYIAATM"
FT   gene            complement(190550..191503)
FT                   /gene="tal"
FT                   /locus_tag="HS_0204"
FT   CDS_pept        complement(190550..191503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tal"
FT                   /locus_tag="HS_0204"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24482"
FT                   /db_xref="GOA:Q0I1U0"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1U0"
FT                   /protein_id="ABI24482.1"
FT                   /translation="MTTQLDALRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASSL
FT                   PQYAPLIDEAIAYAKAKSADKTQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYD
FT                   TQATVEKARKLIALYNEAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLFSEAQ
FT                   ARACAEAGVYLISPFVGRILDWYKANSDKKEYAPAEDPGVISVTKIYNYYKQYGYNTVV
FT                   MGASFRNVGEITELAGCDRLTIAPALLKELQENSTALVRKLEFKGEVQAKPQPLTESQF
FT                   YWQHNSDPMAVEKLADGIRKFAIDQEKLEKMLLEKF"
FT   gene            191691..194036
FT                   /gene="imp"
FT                   /locus_tag="HS_0205"
FT   CDS_pept        191691..194036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="HS_0205"
FT                   /product="organic solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24483"
FT                   /db_xref="GOA:Q0I1T9"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1T9"
FT                   /protein_id="ABI24483.1"
FT                   /translation="MKKNYYTVLSLSILTALYSTSSQANLQQQCLIGVPHFQGEIVQGD
FT                   PNELPVYIEADHAKMNQSTHAQYEGNVNVKQGNRHLTAGMIEIEQHGKDNAKRYAYAKN
FT                   GFDYKDNLIQLNGDNAKIHLDSKDANIQDADYQLVGRQGRGTADEVELREHYRVMKNAT
FT                   FTSCLPNSDAWSIEAKEMRQHIQEEYAEMWHARFKVSGIPIFYTPYLQLPIGDRRRSGL
FT                   LIPKAGISTRHGYWYAQPFYWNIAPNFDATFTPKYMSHRGWQLNAETRYLTRIGEGKFV
FT                   VEYLKTDRHSDSLNTARSRHLFYWGHNSHFLKDWRLNVNYTKVSDKHYFNDFESEYGNS
FT                   TDGYVDQQASISYYQPNYNLSISAKQFQIFDKVDIGPYRALPQIDFNYYRNEIANGLVD
FT                   FSLFSQVVRFDNDSALMPTAWRFHIEPSLTFPLSNRYGSLNIETKLYATRYLQKRGKGE
FT                   NAEEIKKTVNRVLPQIKLDFQTVLANRQSFIEGYTQTLEPKFQYLYRPYKDQSDIGLKQ
FT                   QNNDYLGFGYDSTLLQQDYFSLFRDRRYSGLDRIVSANQITLGGTTRFYDKNANERFNL
FT                   SIGQIYYLKDSRTDNNPQNMAQGRSSSWSLESNWRINSKWNWRGSYQYDTHLNQTSLAN
FT                   TVLEYNSEKNNLIQLSYRYVNQSYIDQNLIGKNTYGQSIKQLGMTTAWELTDHWTLVGR
FT                   YYQDLALKKPVEQYLGIQYNSCCWSIGVGARRYVTNRANQRNDEVLYDNSLSLTFELRG
FT                   LSPSDHKNNIDEMLKKGKLPYIKAFSLY"
FT   gene            complement(194113..195192)
FT                   /gene="fba"
FT                   /locus_tag="HS_0206"
FT   CDS_pept        complement(194113..195192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="HS_0206"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24484"
FT                   /db_xref="GOA:Q0I1T8"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1T8"
FT                   /protein_id="ABI24484.1"
FT                   /translation="MAKLLDIVKPGVLTGDDVQKVFAYAKANNFAIPAVNCVGTDSVNA
FT                   VLETAARVKAPVIIQFSNGGAAFYAGKGIKPASGIRPDVLGAIAAAKHVHTLAAEYGVP
FT                   VILHTDHAAKKLLPWIDGLLEAGEKHFAETGKPLFSSHMIDLSEEPMAENMAICREYLA
FT                   RMDKMGMTLEIEIGITGGEEDGVDNSDVDESKLYTQPEDVLFVYDQLSPISPRFTIAAA
FT                   FGNVHGVYKPGNVKLKPSILGASQEFVSKERNLPAKSLDFVFHGGSGSSTEEIREAISY
FT                   GAIKMNIDTDTQWATWEGVLNFYKANEAYLQGQLGNPEGPDAPNKKYYDPRVWLRKAEE
FT                   SMSKRLEKSFEDLNCVDVL"
FT   gene            complement(195284..196438)
FT                   /gene="pgk"
FT                   /locus_tag="HS_0207"
FT   CDS_pept        complement(195284..196438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="HS_0207"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24485"
FT                   /db_xref="GOA:Q0I1T7"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1T7"
FT                   /protein_id="ABI24485.1"
FT                   /translation="MTDLDLAGKRVFIRADLNVPVKEGKVTSDARIKATIPTLKLALEK
FT                   GAKVMVTSHLGRPTEGEFKPEDSLQPVVDYLKGAGFNVRLAQDYLNGVEVNEGEIVVLE
FT                   NVRVNKGEKKNDPELSKKYAALCDVFIMDAFGTAHRAQASTYGVAEFAPVACAGPLLAA
FT                   ELEALGKALKEPQRPMLAIVGGSKVSTKLTVLDSLSKIADQLIVGGGIANTFIAAEGHN
FT                   VGKSLYEADLIPEAQRLSKVTNIPVPVDVRVGTEFSETALSTEKSVADVSGEESIFDIG
FT                   DKSAEQLADIIRNAKTILWNGPVGVFEFPNFRKGTEIVSNAIAEATANGAFSIAGGGDT
FT                   LAAIDLFGIKDKISYISTGGGAFLEFVEGKVLPAVEILEKRANG"
FT   gene            196692..196952
FT                   /gene="fdx"
FT                   /locus_tag="HS_0208"
FT   CDS_pept        196692..196952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdx"
FT                   /locus_tag="HS_0208"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24486"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1T6"
FT                   /protein_id="ABI24486.1"
FT                   /translation="MALLITDKCTNCDMCLPECPNDAISIGDEIYIIDPHLCTECVGHY
FT                   DTPTCQNVCPITNCIKTDPEHIETEEQLWERFVLIHHADKI"
FT   gene            complement(197001..212432)
FT                   /gene="hsf"
FT                   /locus_tag="HS_0209"
FT   CDS_pept        complement(197001..212432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsf"
FT                   /locus_tag="HS_0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible large adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24487"
FT                   /db_xref="GOA:Q0I1T5"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1T5"
FT                   /protein_id="ABI24487.1"
FT                   /translation="MNKIFKTKYDVTTGQTKVVSELANNRQVASRVEGASVGVGQPKCG
FT                   VFLGMFKVLPLALLMSGLLSSAAYGANVWIDVNPNGITGGDNKPSSVWYNGGLSDNKNE
FT                   VVLLADGESTTGAKAQYKNKDFKRTVIIGSRAVGGGNDATAIGYRAIVGKNLAETNTDD
FT                   SHQGTAVGYRAFSYGNESVSLGNDTVAYGESSISIGSDNVGRNIGKYSRTGLSYDIWKL
FT                   YRQNGSKFNYTGEYAAIDGADPDTSRSKYEAYLSETNPTKPFYRTHNWAFGDSSIAIGS
FT                   RNVAYGHGSLAMGTLSVAKGDYSTALGTATLAFGNSSVALGNESYVYAGNSIGVGNEVQ
FT                   AISDGSMVYGYQSYAGGPGSIAIGKRALSNVEPSAHFKQTVEDFGNLWYEGKSTVHALG
FT                   MLDNPQNHGKSKDLDGYFLPATEKQSGTEEEKAKGKNGGAVALGYYVYALGENSVALGR
FT                   QAYSKGDRSIAIGPYAYGGYEKTIAMGYGAKAMSSQSLALGSLSRVEGKNSVALGVEAK
FT                   VLNDESNSELNGQNSMALGNNSEVTMKNSVAIGNMSNTRYYYTGDKSNPTPSSNNNNNN
FT                   NNNAITLPAYIPKGTSYSYTSTSDDGVISVGGWDRRDGKLGRRRIINVAPGALDSDAAT
FT                   VGQLKALEYAYKEGVVAYYTVEGGKNYKVVKDADGKFYKANTENGTPLDSTAIAADKVF
FT                   VGPKGANERSQSIQVNGRRRNVVDMGDKIKFAHISDGEITSGSDQAITGNQLNQLGSTI
FT                   LGLGVQSNDKTKFDTPSFTKVQYEGSTGTQNHTTFKNAIDESIKAINKGLVIQGDDKQG
FT                   KISLGSTLNIKAGNTSVTDQGTKTEYKSDNIRTAYQPKNKTLLIGIKENPTFKSVTVSD
FT                   PITASSPEGTLTTKKYVDDQLKNVSTNLHFLSVQGTDKTAGNYNNDGAKASYSVAIGVN
FT                   AQVVDPTIVVTGNKPKPTATAGIAIGYNAKSEAENAVAIGRDVSIDVPNSFVMGSNNTV
FT                   TQSFKETNGAVVVIGSGTKLVESKSSIAIGAVYKVHQGKADGTLIENAAWTASIGNKNK
FT                   IKNGTDIVALGNNIEVKDETNEENPKNKTRIANNDLILIGNGATAETAKNSVLVGAKSN
FT                   AGKGAKNAVIIGHSAEAKAEAEGAVVIGQGANVQTKATGAIAFGQSATVNAEASNAIAF
FT                   GKSASVQPNATSGIAFGQSASVSVADGIALGSHSVASTAGDKVGFNTVTGATKADPVSH
FT                   GAWKSKYGALSIGGNNNGTRQITGVAAGTNDTDAVNVAQLKEATLHFVSVNGGSKTDEN
FT                   YTNNGATKTGAIALGIGAKAASENSIAMGKDSKIEAEISNAVAIGANNHLRGLRGKDNK
FT                   DQYKHTVAIGSDNIITGRKIVNLGSGNKIGNAEDSYQTDKKAGAVSIRVIGDDNKVHGV
FT                   WNTVIGEENKLESSNWTQVIGDYNAVTKSDYAIVISSNQAQKGDQQKTTNTVTNSNYAI
FT                   VIGNQAKATDAKNSVVIGASANSTAESAVVLGKGATVQANATGAVAIGEGASVSTNAGE
FT                   SIALGKGSKATQKENTVSTYTATQTSNIKFNGFSGSGNDKSVLSIGDGGKERVIKHVAP
FT                   GKISNDSTDAINGSQLYSVIDVFGHLGATVLGAEVDATKGFKQSTFENVKYKDGGRDQK
FT                   NTFKAAIDETIKAINKGIVISDGSETGTRQLGETLTVKAGNIDKPQTDSDGFSSNNIKT
FT                   KYLKDNGEILIGIKDKPEFKEVTVSQELTDTSKDNVLTTKKYVDNKLANVASKFTVSGN
FT                   EGSQFEINKDNNKLSIKGETTNNNIKTKATSSKEIEISLSDTLTGITSIGKNSDNGITF
FT                   NTNATTIKLGGVSLSLNKDNTAVKISGVADGKDTNDAVNKGQLDKKQDKLTGTITANNG
FT                   IKLTGTAANSIASDITLSLEDGLKEKIDNALSKADAGNTYAKVDASNIENGNKASWRTT
FT                   LDVYSKTEANAEIAKAKETVTNGDGITVSATPDGTDGPKTFTVALADEYKTKINSIGTG
FT                   SVADNDKNTVTGGKVHTAIEDAKTTLTSTINGKADKNLSNIDETGKAKIKTLATEAIDV
FT                   QGKEGELKVTPSTSGNKKSFTVSLNDDIKTKIDGIGTGTVVADNNKTVTGGAVHTAIEA
FT                   AKTDLKGKLYANTATFGLKGNDSQEVTKKLDNTIEIKGTDTAKSGQTNIYVSKADENGL
FT                   KIELGENLKGIKKISQGEKAVISLEDKALTLTSNNNKVAVKSDHVLSDKDIYIGTKTDD
FT                   NKLVKKSELGGGYITFEDENTSKGTKNVNFGKKVIYGKSAEITPTVEASIDDAKVTFAI
FT                   NDASIEGTKLKDATIAEAKLDQGIKTKLNKTFKVKAGDESSDNLIGEELEFATKDANLT
FT                   VGLDATKKKITYGLSSALTGIESIGKDNNTKITFKNNGQNEIDFTVGTNTTYKFTDSGL
FT                   DLASKPITNLGSGLEQKTGNGGRQDLDEFLKLTATNGQPSDGKLNKAINAGDLLHVAQG
FT                   LVGKGLKFKADSASADGSTKTEMTIALGQAVTFKGDGKYLTTKLNDTNGEISFNLSVAE
FT                   SISDASTDGDSTQNTSNSKLVTENAVKNFVTNKINNLSSTLQLEGDNTENDKDPADPIG
FT                   KVELKTEKLKLTGENDFIETEVKANDPTVTIKLAQKVKDKLAIIKVGENTNGDNSFALG
FT                   KDSKLETKKTAPTGITQNVGGNDVTITWSNAGAGQNKEVVSVGDTGKERIITHVAAGDV
FT                   RDGSTDAVNGGQLHRVIDVFGKLGLDVLGAEKADSGDGFKKSKFDVVKTSDNTTDSNPE
FT                   KSEKTFKTAIEDNIAAINKGLKFAGDNDGEKQLYLGSTLNIKGAKGEASSAGSNSASSD
FT                   TTNNHQNIFTKASDTGLEIALNEALQGISSISGKKGTDGSAVAKIDFTSSGTSTSPTVK
FT                   ITADGGEFTFGKDGLNLNSKQITGIASGLGLKDSVDGNNGGSAGTSNSDTDIINKVLSG
FT                   NPDKDNNNAVNVKDLSKVANALVEKGLSFEGNGGNTDKVTRKLGDTLKIVGKGSDANSI
FT                   TATENNIKVSKNTTNDGLEIGLSETLAGIKSIANGDKAKIALDNDKKTITFTAGETNNN
FT                   VTLSEGEFSGVSEINKADGKGALKLADSTATLESASGNSNVALKANEATVTAGTDKGSL
FT                   KLEAAKATLESAKNGSNVALDGTSATLSAGNGKGSIKVATGSGDDANKIELSPENGSAV
FT                   TLAKDGTNGVKATGLSTVGLDGDNALVFTNGAGNKAELKVGGSALTFTKATTGNTVKIS
FT                   NVAVGKIESSSSEAITGGQLHDLATHLGVAVDNSGKTTFTAPSFAKINGSEAPKTFKGA
FT                   IDNLITAVNGGLTFRGNDNSSSPSSTTLQLGRTLTIDSSESKTKLENSKATKEKDITTK
FT                   LEPSNGSDSQAGTLTLTLNKATSVDENDERVVTSSAVANKLKNYTTTETLEDDFLRVTG
FT                   ENINGHQKEFGKNVGLEEVKLEEDETEGTSELVQAKALVDYLKGTGEKSVKLSDSAKTQ
FT                   AIGEGSISIGHNAVSRNEGSIAMGYNSEASNSGAISIGQGSTVLGTSSVAVGKENDVKG
FT                   NFSFVLGESNTLDKEQTYVIGSDNTISGAKNIAIGLGNTVGGNENIVLGSHVDLKDDVE
FT                   GAIVLGDKSIGVSNAVSVGNALTKRRIVFVDTPQGEYDAVNKKYVDGLTLSYKENSTGP
FT                   AKSINLKTGALDFVKSENISVAVEADGKITHTLNNNLTSIVSISGGKNGSEDAAKITLS
FT                   SKPETEEEAKDYVKTVTINDAKLKGLLDGEIAESSKEAVTGKQLADLTKQLGVDVSTSD
FT                   KTKFTAPIFEYLSKVDGSFNKNPTTLKGAIDEARAKLNEGLKFGGDIPSAGTNTNNTHY
FT                   LGSTINIVRLGTPTGTGAVAPTSTDGYSGSNLITQYTNDKGNAKIEIGFKDAPTFSKVT
FT                   LSQEQKYGEADKVGSNDLITKSYLEGALSNFKFNVEYGDKKVQIGRGDTLKFADGLNIQ
FT                   GSLKQEGATQPSVVTSTTAPTTVNTPSGSENGGAGTTVVSNGADSSNSGSSDSTSNMAS
FT                   SGGTNGASSDSADTAVASSSPTAGTSSTPTTTPTTTTSTTTAVVTIGTKNDLTNITSIS
FT                   SKAGSADGNDADNGTTGDVTKLSLTPENATFQVGTTGSKVKIDKEGISLTPQATDPKDP
FT                   SANAPSITINVGSVPATPNTSSPAQPADPSLPAVDNGPSIAFAAKGGSNGSKEGTGTIK
FT                   YLKDRTVKNTQSMNDKDKYGEGDNKGNAATEGAVKELYDSGLKFAGNDNVEVAKKIGDK
FT                   LAIVGQGLTKDKVATFKGTDGNIAVTAKPNSGSDANSKLEISLSESLKDMNSFETKAKK
FT                   VTGGKDDLYAKSKLDGEGLHLTPFAGISEQDVIGPLTDKAAHYGLLGSTVKDGDKTNTQ
FT                   TAGESKLTQDGNTNVSTATETKLTSKDGETASLTAKGLTVGDSTKDGDKTHAVYGKTGF
FT                   SVKGKDGSSEIVSLKVANGQDGNAQSATLAFAKGTDSKSGTGTIKGLADIKPDETDGSL
FT                   AANKNYVDEKVSDLDSNRPFDFYVKEGEKEIKVVKGRDGKFYKPEDLKGAKYVAGTADG
FT                   DKGKYTKNGQDVKSSIADKQAAVVIKAEPTTSPMTITNVKDGDLTNTSTDAINGGQLVK
FT                   ATGAKFIDDPNSSETAPKPKIMVFADGRDGKSGLEAEAMATKGLTGKDGLNGKNANDKA
FT                   NALRDGEAGTVVFTDRQGNRLVKANDGKYYEAGDVEADGKLKQGASAVEKLQLSLVNHE
FT                   GEATKPVALGNVASGLELPAPETDPAKAKEAKEKTAQLANAVKDKKAEVSDKAKTLSDK
FT                   AKTFTRLTLAVNGLEQAANALPDGKAKAQIEAQLKETQEELAKAQKALETAKTDLQTAQ
FT                   ENLKTANADYEANYEGYAKVADLVSADSKANVANVATVGDLQAVAKSGMKFKGNDGVEV
FT                   RKQLSETLSIIGEGTFNSNRTAAGNIKVEMAQDGKGLEVKLSDQLKNMTSFETREVNGK
FT                   KARLDSNGLRVVNKGKDGTDDKAKSATYGAEAVVLEDKNKSDKAVMTAGGIRFADSSTQ
FT                   ATALSTELNKNGLTVNGAGGQIHIDGTKGVITVPNIKPNADGHVVVNKNYVDTKNNELR
FT                   TQMNNNDRNMRAGVAQAVAQANLPINILPGKSTLSLATGNYMGTQAFAVGYSRVSDNGK
FT                   LSVKFSLGHGDKKTSVGAGVGYSW"
FT   gene            complement(212868..213617)
FT                   /locus_tag="HS_0210"
FT   CDS_pept        complement(212868..213617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0210"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24488"
FT                   /db_xref="GOA:Q0I1T4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1T4"
FT                   /protein_id="ABI24488.1"
FT                   /translation="MIKIRNIHKTFDNNPVLRGIDLDIEKGQVVVILGPSGSGKTTFLR
FT                   CLNALELPEQGTIEFHKENPLYIDFTDKHIRKNILPLRKKSGMVFQQYNLFPHKTALEN
FT                   IMEGPVQVQQRKPDEVRQEAETLLCKVGLIDKANLYPHQLSGGQQQRVGIARALAIRPE
FT                   LMLFDEPTSALDPELVQDVLNTMKELANEGWTMVVVTHEIKFALDVADVVVVMDKGIIV
FT                   EQGSPKTLFENPQHERTKAFLHQIRFN"
FT   gene            complement(213631..214347)
FT                   /locus_tag="HS_0211"
FT   CDS_pept        complement(213631..214347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0211"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24489"
FT                   /db_xref="GOA:Q0I1T3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1T3"
FT                   /protein_id="ABI24489.1"
FT                   /translation="MLNNFLASLPFMTEARAELVINGFFPMVKAAVLVSIPLAIVSFIL
FT                   GMVIAIAVALIRVSPSHSIIHRLFLFITKIYISIIRGTPMLVQISIVFYGLPALGIFID
FT                   PIPAAIIGFSLNVGAYASETVRAAIQSVPKGQWEAGYTIGMTYMQTFRRIIVPQAFRVA
FT                   VPPLSNTFISLFKDTSLASVVTVTEMFRVAQQVANMSYDFLPVYIEAALIYWCFCFILF
FT                   LWQARIEKKLARYVTR"
FT   gene            complement(214337..215119)
FT                   /locus_tag="HS_0212"
FT   CDS_pept        complement(214337..215119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0212"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24490"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1T2"
FT                   /protein_id="ABI24490.1"
FT                   /translation="MLKKITFLFTAVLTIAANTQALAQASLLDRINNKGTITVGTEGTY
FT                   APFTYHDSTGKLTGYDVEVTRAVAKKLGVTVEFKETQWDAMLAGLKAGRFDLVANQVAL
FT                   TTPERQATFDKSEPYSWSGAMLVARDNETRIKQVEDVKGLKAAQTLSSNYGELAQKYQA
FT                   KIVPIDGMAQGLLLIQQKRADMTFNDALALLDYLKKYPNSGLKPVWESKDKVGAGLIVN
FT                   KNNDEALAKISAAIEELRNDGTLKQLGEQFFGRDISVK"
FT   gene            complement(215433..215996)
FT                   /locus_tag="HS_0213"
FT   CDS_pept        complement(215433..215996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0213"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24491"
FT                   /db_xref="InterPro:IPR032359"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1T1"
FT                   /protein_id="ABI24491.1"
FT                   /translation="MAPVNIFSSKHFFIKKHKSRLEKIKDDFLRITPGFQMIKVNGRLL
FT                   VINLQTLERNFGFHDIIKKEAVSGCSAIKSINILSNPEVLIELIEDVKYARKLTKIAKG
FT                   SPVLSAKIPNKQIIEFCKIYPSLRNKFRFNEDKEQIILDTKVSKDLFIKVLMDDFLTSE
FT                   LTKYNYVSLAKDNLSDSMDEQTTE"
FT   gene            complement(216015..216398)
FT                   /locus_tag="HS_0214"
FT   CDS_pept        complement(216015..216398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0214"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24492"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1T0"
FT                   /protein_id="ABI24492.1"
FT                   /translation="MTLDSLKDELKLYKENEIGICVYAILKENLYNPMRLDIESESLNN
FT                   LTSLFLTEIRDTIINRDDLSLMKLSSSDERKNAIYEYDLDIPKELSTLDFVLGNDNIGL
FT                   FNLKNHDFGEIKSLIIEIGNNER"
FT   gene            complement(216401..216868)
FT                   /locus_tag="HS_0215"
FT   CDS_pept        complement(216401..216868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0215"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24493"
FT                   /db_xref="GOA:Q0I1S9"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1S9"
FT                   /protein_id="ABI24493.1"
FT                   /translation="MSSVWHIINASMVSIISTIALLYSIIVYIKFQIDLGSSTDLPFTI
FT                   KKIENSSYENLTFLATYIIPLISFDFDNNRQLIILAILLIVMGIIYIKTDLFYANPSLA
FT                   LLGFKLYKADGNFKNGERNDIILITRERLSLNDKATYIKLDERIYYVKKVG"
FT   gene            complement(217020..218141)
FT                   /gene="mloA"
FT                   /locus_tag="HS_0216"
FT   CDS_pept        complement(217020..218141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mloA"
FT                   /locus_tag="HS_0216"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24494"
FT                   /db_xref="GOA:Q0I1S8"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025758"
FT                   /db_xref="InterPro:IPR026287"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1S8"
FT                   /protein_id="ABI24494.1"
FT                   /translation="MHVSHYMHNKYHICVKKMRNYQIPNLFNLGDLETKKVLKAANQAH
FT                   QALGELKGVVQTVPNQNILLGTLPLQEAKESSEIENIITTQDDLYQSNVATQQFTTIAA
FT                   KEVHHYAQAVSFGFSEVRKTELITLNLIKQIQAKLEGNNAGFRKQIGTGLVNQRTGQVV
FT                   YMPPQQPEMIEHYMSVLERFINDSEQIDYDPLVKMAIVHHQFESIHPFYDGNGRTGRII
FT                   NILYLIQQNLLDTPILYLSRYINRNKDQYYYLLQFVRDHNDWEEWLIFMLNGIAETAKQ
FT                   TVDLINQIKKLMQEHKLLIRNQLPNIYSHELINNLYKYPYTKIDFIAEDCQVHRNTAGK
FT                   RLEQLVDLGILKKVKIGKENFYINMELYYLLTK"
FT   gene            complement(218189..218512)
FT                   /locus_tag="HS_0217"
FT   CDS_pept        complement(218189..218512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24495"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1S7"
FT                   /protein_id="ABI24495.1"
FT                   /translation="MPLQPYFLQIKTTQPDYSPRPIPTAQAQTTHSETAHSTNPPKVAN
FT                   GCGCRHPHAGRECRCGGFKPKWRGREIEGREVGVSFLGSWVNQYGYSNGLRVKIQHEYA
FT                   QKK"
FT   gene            219081..219368
FT                   /locus_tag="HS_0218"
FT   CDS_pept        219081..219368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0218"
FT                   /product="hemophilus-specific protein, uncharacterized"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24496"
FT                   /db_xref="GOA:Q0I1S6"
FT                   /db_xref="InterPro:IPR025911"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1S6"
FT                   /protein_id="ABI24496.1"
FT                   /translation="MKSGGEQKATIRFVYMFPIVDSALIEIDYTEEFKIDFKYTALLIK
FT                   EDLYINQHKARIHEIATKTYTNAITKRFGFENFCCDFAKLEEKHRAYEAQ"
FT   gene            complement(219532..220920)
FT                   /locus_tag="HS_0219"
FT   CDS_pept        complement(219532..220920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0219"
FT                   /product="conserved transporter, NadC family"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24497"
FT                   /db_xref="GOA:Q0I1S5"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1S5"
FT                   /protein_id="ABI24497.1"
FT                   /translation="MSKTVSKSIFNQNALIFILDVIVFFVLLYVLPFDEKANKGLALLV
FT                   FIAVLWLTEALHVTVTALLVPFIAIALGLVTTKTALASYSAPTIFLFFGGFALATALHI
FT                   QKLDRMIANKIMMLAKGNLFIGVIYLFSITAFLSMWMSNTATASMMLPLAMGILSQLDR
FT                   TKEHNTYVFVLLGIAYSASIGGMGTVIGSPPNAIVASQLKLSFSDWLYFGLPIMLILMP
FT                   IMIGTLYIIFKPNLKASFKQNFEKVEMNNQRIITLLIFVTIAFCWIFSAKLNPMLSSLL
FT                   GLEKNIASFDSVIALLAAIAVCVSGVISWKQLQDNTDWGVLMLFGGGLTLSAVLQDSGA
FT                   SKVLADGIVFMIEGGNFYLIGLLVAAFIIFLTEFTSNSASAALLVPIFISIARSLGMPE
FT                   LGLALIIGLGASCAFMLPVATPPNAIVFGTGEIKQKEMVRAGVVLNIICVLFIGTFAYL
FT                   FWLH"
FT   gene            complement(221104..221604)
FT                   /gene="rraA"
FT                   /locus_tag="HS_0220"
FT   CDS_pept        complement(221104..221604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rraA"
FT                   /locus_tag="HS_0220"
FT                   /product="regulator of ribonuclease activity A"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24498"
FT                   /db_xref="GOA:Q0I1S4"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR014339"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1S4"
FT                   /protein_id="ABI24498.1"
FT                   /translation="MYIDTAELCDIYLDQIDVVEPIFSSFGGKSTFFGKITTIKCFENN
FT                   GLISEILEENGEGRVLLIDGGGAVRRALIDANLAQLAADNGWEGIIVYGAIRQLQQLEN
FT                   INIGIQALAPIPVGSDEQSIGETDVPVNFGGVTFFPDDYVYADLTGIILSQEPLDLEEF
FT                   DSL"
FT   gene            complement(221651..222565)
FT                   /gene="menA"
FT                   /locus_tag="HS_0221"
FT   CDS_pept        complement(221651..222565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="HS_0221"
FT                   /product="1,4-dihydroxy-2-naphtoate prenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24499"
FT                   /db_xref="GOA:Q0I1S3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1S3"
FT                   /protein_id="ABI24499.1"
FT                   /translation="MDIMANNSVKMWFETARPKTLPLAAASIMTGSALAYWSQQFSWTT
FT                   TLLCLLTTLLLQILSNFANDYGDHQKGSDTQERIGPLRAIQQGAINAKQLKQGLILVVF
FT                   LSLISGSLLIVNAYQTIVDLVAFALLGLLAILAAITYTVGTKPYGYLGLGDVSVLIFFG
FT                   LLGVGGTYYLQTHQLNWLIFLPATATGLLATAVLNINNLRDIEQDRKAGKNTLVVRLGA
FT                   ENARIYHCIILLLSALSYIIFALYTFTHWSNFIFILSFPLLIKHAHFVYRNKNPLHLRP
FT                   MLAQMSLLALFTNLLFSLSLLVN"
FT   gene            222663..223385
FT                   /locus_tag="HS_0222"
FT   CDS_pept        222663..223385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24500"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1S2"
FT                   /protein_id="ABI24500.1"
FT                   /translation="MSKFLLHLTPIAIIHTPYKEKFSVPRQANLVQDGTGIVELLPPFN
FT                   CPEAVRGLEQFSHLWLIFQFDNVPTGKWQPTVRPPRLGGNERIGVFASRATHRPNPLGL
FT                   SKVELREVEYKNGKILLHLGSVDLIDGTPILDIKPYIAYADNEPCARSGFAQEKPEQEL
FT                   RVEFSPEVQIVLAKLEKKRPHLSRFIREVIQQDPRPAYQKGKNLHKIYGMALYEFNVRW
FT                   RIKHDDVTVAEVIEIQHV"
FT   gene            223545..223964
FT                   /gene="rbsD"
FT                   /locus_tag="HS_0223"
FT   CDS_pept        223545..223964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsD"
FT                   /locus_tag="HS_0223"
FT                   /product="ribose transport protein RbsD"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24501"
FT                   /db_xref="GOA:Q0I1S1"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1S1"
FT                   /protein_id="ABI24501.1"
FT                   /translation="MKKTKLLNASLSHHIATLGHTESLVICDAGLPISNQVERIDLALE
FT                   AGVPGFLQTVDVVISEMFVEHAVVAKEIREKNPQIHDALLDSLRKLSEQQGNCIAVEYV
FT                   EHEEFKVLSSESKVAVCTGEFSPYANIILYSGVPF"
FT   gene            224095..224280
FT                   /locus_tag="HS_0224"
FT   CDS_pept        224095..224280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0224"
FT                   /product="hemophilus-specific protein, possible
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24502"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1S0"
FT                   /protein_id="ABI24502.1"
FT                   /translation="MNTILVFYACSCFVFNRVLAWQNEQYGQDSHYKFSCTKITNLLSQ
FT                   WKKELINVILKYFNNH"
FT   gene            224451..224690
FT                   /locus_tag="HS_0224a"
FT   CDS_pept        224451..224690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0224a"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible transposase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0224a"
FT                   /db_xref="EnsemblGenomes-Tr:ABI26066"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1R9"
FT                   /protein_id="ABI26066.1"
FT                   /translation="MWSYYKRKSPNTVDFECVECGYIEHADVVGALNVLERGEQSSMPK
FT                   NVKVGYFRRVYKVNYVISSLRQEPTEYPIACDGS"
FT   gene            224788..225741
FT                   /gene="rbsK"
FT                   /locus_tag="HS_0225"
FT   CDS_pept        224788..225741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="HS_0225"
FT                   /product="ribokinase"
FT                   /EC_number="2.7.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24503"
FT                   /db_xref="GOA:Q0I1R8"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1R8"
FT                   /protein_id="ABI24503.1"
FT                   /translation="MSKTLTVLGSINADHVISVPHFAKPGETLSGKQYHIAYGGKGANQ
FT                   AVAAARLADFSQGATVNFVGCIGSDDIGQAMKKAFAQDGINVATITEIPNEMTGIAMIQ
FT                   VADSGENSIVISAGANAYLTPEIVDKFATEIERADYLLMQLETPLNAILEAAKLAKKHG
FT                   ATVVLNPAPASQLPDELLSLLDMITPNETETEILTGVKVTDEQSAAKAASVLHQKGVAT
FT                   VLITLGSKGVYVSRKSSTQELGQNKVIAGFRVNAVDTTAAGDTFNGAFLTALLENKSLD
FT                   EAIRFAHAAAAISVTRQGAQPSIPTRRETLDFLAQH"
FT   gene            225762..226772
FT                   /gene="rbsR"
FT                   /locus_tag="HS_0226"
FT   CDS_pept        225762..226772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsR"
FT                   /locus_tag="HS_0226"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24504"
FT                   /db_xref="GOA:Q0I1R7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1R7"
FT                   /protein_id="ABI24504.1"
FT                   /translation="MATMKDIARIAQVSTSTVSHVINNSRFVSEEIRQKVMAVVEQLNY
FT                   TPSALARSLKVKETKTIGMLVTTSDNPFFAEVVASVERYCRQHHYHLILCNTNDDSICL
FT                   QENLQNLIRKQVDGLLLMCTDSAFETSPLNLTVPTVIMDWWPTELSADKIFEDSEQGGY
FT                   LATRTLIKHQHHDIAIITGNLKKPLARNRLEGYKQALQEYNIPIRDKWIIESHFNFEGG
FT                   VKGMEQLLQLKQRPSAVFACSDTIAVGAYQAVWRHGLSVPEDISIIGYDNIHLAQYLSP
FT                   PLSTVHQPKDEFAHLAVDTLLQRIKNPTESYRTLTLKPEIVLRQSICSCFLPKSA"
FT   gene            complement(226801..227187)
FT                   /gene="smpA"
FT                   /locus_tag="HS_0227"
FT   CDS_pept        complement(226801..227187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpA"
FT                   /locus_tag="HS_0227"
FT                   /product="conserved small protein A"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24505"
FT                   /db_xref="GOA:Q0I1R6"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR026592"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1R6"
FT                   /protein_id="ABI24505.1"
FT                   /translation="MILGLSVTACSSVQKIVYRIDVPQGNYLESAAVEQVKVGMNAQQV
FT                   QYLLGTPMLIDPFSNQTWYYVFLQQKSYNAPEQHTFIVNFDRRGIVTDVNLDKPLPDVE
FT                   KEYINNTIIQGPEAKRTSWWKFWR"
FT   gene            complement(227282..228295)
FT                   /gene="ndpA"
FT                   /locus_tag="HS_0228"
FT   CDS_pept        complement(227282..228295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndpA"
FT                   /locus_tag="HS_0228"
FT                   /product="possible nucleoid-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24506"
FT                   /db_xref="GOA:Q0I1R5"
FT                   /db_xref="InterPro:IPR007358"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1R5"
FT                   /protein_id="ABI24506.1"
FT                   /translation="MSIIVNQIVLHQLVKTSQDENTVQLKTHLRDELLPITAETEQMML
FT                   QLHQEYHNKTKAYGVFQETSNFAQILNRTLENDIDFLAFSHQSAELLRQELGKYSFAND
FT                   GTLILCQYNFLATDYLFIALLDSRYSMLVDENLEIKQTHYLDITQFDIACRINLTELHL
FT                   DAKSTRYLTFIKGRVGRKIADFFMDFLGAEEGLNPQVQNQCLLQAVSDYCQQADLTKEQ
FT                   TQAVKKQVFDYCKGQINVGEEIVVRELSANIPTLNEQSFVDFAVSQNYGLEENIPPVRT
FT                   ALKSLTKFSGSGKGITLSFDAELLNSRIFWDEATDSLTITGLPPNLRDQLQRQTKE"
FT   gene            228413..228634
FT                   /locus_tag="HS_0229"
FT   CDS_pept        228413..228634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0229"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24507"
FT                   /db_xref="InterPro:IPR009857"
FT                   /db_xref="InterPro:IPR023202"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1R4"
FT                   /protein_id="ABI24507.1"
FT                   /translation="MAKISKFQDKQVEAILNDMIAVLEKHQAPVDLSLVVLGNMVTHLL
FT                   NSSVGSQQRIVLAKVFSDALMNSVKNSK"
FT   gene            228636..230378
FT                   /locus_tag="HS_0230"
FT   CDS_pept        228636..230378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24508"
FT                   /db_xref="GOA:Q0I1R3"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012159"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024588"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1R3"
FT                   /protein_id="ABI24508.1"
FT                   /translation="MFGIKTSKQYRDELSRKITWGHWVAFFNILWAIVIGSRYAFIIDW
FT                   PHTLFGKIYFFISLLGHFSFIVFALYLLALFPLSFIIKNERTFRGISVILTTIGATLLL
FT                   VDTEVFSRFNLHLSTLVWNLLVNPDDGKLSYKWQIFFAPMPLILFVQMLFSRWAWYKLR
FT                   SLERQKWIKGVALVFVVSFIATHILYAWADAYIYRPITMQKSNFPLSYPMTARSFLEKH
FT                   GFLNKSEYEKTLNEQGRLDALKVNYPKQKLTFSDELPKTNIVLITISGLRHDAVRQDIM
FT                   PNLFAFSENSTKFTHHYSSGNSLNQGLTGLFYGLNANYADSLLSNKTTPVLIEQLKQGK
FT                   VRYEIGLFGQNLSRSILLKKSIFANEKIRNDNNASTQRFIEFVNTRQQQQKLFFAYLNY
FT                   SLNSNLTIEQYYQKLSEIDDEIGSAFKSIDFTHTIVIVTSEYGYSFDFSDKKRPTNYFA
FT                   REVIQVPMIIRWENLPIGKVNKLSSHTDLVPALMKHIFKVKNPISDFSQGQDLFDLDDN
FT                   RSWVLAGNYRWNVIITPDDSQYHIDRNGHYQKYNQHYQKISSTQPPLGLFLEVFSQNTA
FT                   FIEK"
FT   gene            complement(230592..231308)
FT                   /gene="sfsA"
FT                   /locus_tag="HS_0231"
FT   CDS_pept        complement(230592..231308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="HS_0231"
FT                   /product="sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24509"
FT                   /db_xref="GOA:Q0I1R2"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1R2"
FT                   /protein_id="ABI24509.1"
FT                   /translation="MQLPNLQSATLLRRYKRFLADVELNNGEILTLHCANTGAMTGCGE
FT                   KGDTVWFSTSDSKTRKYPHSWELTQLKNGQTVCINTHRSNQLTLEALQNKIITELAEYD
FT                   EILPEVKYGVENSRIDFLLKGKNLPDCYVEVKSVTFVKNHLGLFPDAVTTRGQKHLREL
FT                   IAMKKRGHRAVVFFAGLHDGFNRFTVAKSIDPDYAELLQQAVKEGVEVYSYAVKFDFSH
FT                   QKPTALYLTNLVNYLE"
FT   gene            231517..233049
FT                   /gene="pntA"
FT                   /locus_tag="HS_0232"
FT   CDS_pept        231517..233049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntA"
FT                   /locus_tag="HS_0232"
FT                   /product="NAD(P)(+) transhydrogenase, alpha subunit
FT                   (pyridine nucleotide transhydrogenase)"
FT                   /EC_number="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24510"
FT                   /db_xref="GOA:Q0I1R1"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008142"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1R1"
FT                   /protein_id="ABI24510.1"
FT                   /translation="MLIGVPRELLDNESRVAATPKTVQQILKLGFEVIVENNAGFNASF
FT                   EDQAFVNAGAKIGSAQDIWNADIIFKVNAPTDAEIAQIKEGATLISFIWPAQNSELMAK
FT                   LSAKKINVLAMDAVPRISRAQALDALSSMANISGYRAVIEAAHEFGSFFTGQITAAGKV
FT                   PPAKVLVIGAGVAGLAAIGAANSLGAIVRAFDSRPEVKEQVKSMGADFLEIDFQEEGGS
FT                   GDGYAKVMSEEFNRRAMALYAEQAKEVDIIITTAAIPGKPAPRLITKEMVDSMKPGSVI
FT                   VDLAALTGGNCDYTQAGEIVVTENQVKVIGYTDFPSRLPTQSSQLYGTNLVNLLKLLCK
FT                   EKDGNIHIDFEDVVLRGVTVIRDGEVTWPAPPIQVSAQTQQKTTAPVVDKKEKTPINPK
FT                   VKYGVMALAGAAFLWLGSVMPAAFLSHFTVFVLACVVGYYVVWNVSHALHTPLMAVTNA
FT                   ISGIIIVGALLQIAQGNFFISLLAFIAILVAAINIFGGFKVTQRMLAMFRKG"
FT   gene            233062..234522
FT                   /gene="pntB"
FT                   /locus_tag="HS_0233"
FT   CDS_pept        233062..234522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="HS_0233"
FT                   /product="NAD(P)(+) transhydrogenase, beta subunit
FT                   (pyridine nucleotide transhydrogenase)"
FT                   /EC_number="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24511"
FT                   /db_xref="GOA:Q0I1R0"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1R0"
FT                   /protein_id="ABI24511.1"
FT                   /translation="MSEGLVQAAYIVAALLFIMSLAGLSKHETAKAGCWYGIVGMAIAL
FT                   VATIFGPYSQGLFWIIIAMAVGAVIGIQRAMKVEMTEMPELVAILHSFVGLAAVLVGFN
FT                   SFGLHETAQFLVPEGVEYVTDAAQALLAQQKADFVAEQSVLATIHNVEVFLGIFIGAVT
FT                   FTGSIVAFGKLRGIINSKALMLPHRHKLNLAALIISALLMVAFLNSPDNIFPVLLMTAI
FT                   ALAFGWHLVASIGGADMPVVVSMLNSYSGWAAAAAGFMLNNDLLIVTGALVGSSGAILS
FT                   YIMCKAMNRSFISVIAGGFGNDVVASSEAEQGEHRETTAEEVAEMLKNASSVIITPGYG
FT                   MAVAQAQYPVAEITAKLRERGVNVRFGIHPVAGRLPGHMNVLLAEAKVPYDVVLEMDEI
FT                   NEDFADTDVVLVIGANDTVNPAAMDDPNSPIAGMPVLEVWKAANVVVFKRSMAVGYAGV
FT                   QNPLFFKENTQMLFGDAKERVEDILKAL"
FT   gene            234603..236252
FT                   /locus_tag="HS_0234"
FT   CDS_pept        234603..236252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0234"
FT                   /product="phosphoglycerol transferase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24512"
FT                   /db_xref="GOA:Q0I1Q9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1Q9"
FT                   /protein_id="ABI24512.1"
FT                   /translation="MVQYALLILFSLASIIFIINSHYRWTYFFAISQFLLFIGIMFTIT
FT                   GQWQRAVNFSSTLFIVFVLFHRIKIHFYKQPLLISDFFLVIDWRNWETLLHYRQAFFAI
FT                   MGLLVLLAYGIFGWQNTPALPFYWQIISGLISIILIVSICHCTKNKQAIKQWLDSLPDD
FT                   GRDVFLNLPMSCRGIFYKSPVFSGGSQYFLEKAESIESHKQSNSEQKADIVVWLQESTL
FT                   NPHSFLFKQHNIPPITMYENQDDTKCNSHLRVHTLGGATWKSEFAFLSGLPSTDFGAMA
FT                   NAVFYSVVPHLKYSFVKNLKAQGYYCVALSPFTKGNYNAKSAYDHFGFDLMLQPQDLGY
FT                   PAPLSKNLWTIGSDEMSQYVQKILDKKDVPQLKDLQKPLFVYVLTMREHGPYYNCGNIF
FT                   QIQMDCATERGIGELNDYIQRIVNLNQVMEDFNLYMQRRNKPYILGYFGDHQISIKEAV
FT                   PSYSFNYPYPEYITQFAIRSNLETDFEKHDFLDLAFIAGTILEIAGLPVDEFMQTNIKM
FT                   RKLSGGKLQDCTDQQLLESYRHYIYSELKVAE"
FT   gene            236311..236580
FT                   /gene="galK"
FT                   /locus_tag="HS_0235"
FT   CDS_pept        236311..236580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galK"
FT                   /locus_tag="HS_0235"
FT                   /product="galactokinase"
FT                   /EC_number="2.7.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24513"
FT                   /db_xref="GOA:Q0I1Q8"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1Q8"
FT                   /protein_id="ABI24513.1"
FT                   /translation="MYQSHDSMRDDFEITVPEIDYLVELLQIVIGKNGGARMTGGGFGG
FT                   CIVAIAPQDKVEEVRQIIADNYEKQTGLKEDFYVCTASKGVTIC"
FT   gene            236574..237617
FT                   /gene="galM"
FT                   /locus_tag="HS_0236"
FT   CDS_pept        236574..237617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galM"
FT                   /locus_tag="HS_0236"
FT                   /product="aldose 1-epimerase"
FT                   /EC_number="5.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24514"
FT                   /db_xref="GOA:Q0I1Q7"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013458"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="InterPro:IPR018052"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1Q7"
FT                   /protein_id="ABI24514.1"
FT                   /translation="MLIDCFEKEHKQGMAPDGQPFRIFTLTNTKGMKVQVMDWGATWIS
FT                   CQVPVGKEVREVLLGCQINDYPIQQVYLGASIGRYANRIANSRFELNGKRYLLNANQHQ
FT                   HQLHGGKGFHNERWYLEKCGVNSITFSHFSPDGDQGFPGNLHAFVTYSLSETNNVRIEY
FT                   EAICDQDCPINLTNHAYFNLNDATFGCDIRGHSLQLNSDYFLPVDSVGIPNAKLKAVEG
FT                   TSFDFREEKPIGLDFLQEEQKLVKGYDHSFLLNPDIEKPCAILTALDRSLRMQVLTSQP
FT                   ALQIYTGNFLSATPTRQNGQYADYAGIALETQCLPDTPNHPEWWKYGGITKVGEKYSHK
FT                   TEYQFIR"
FT   gene            237772..238665
FT                   /gene="corC"
FT                   /locus_tag="HS_0237"
FT   CDS_pept        237772..238665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corC"
FT                   /locus_tag="HS_0237"
FT                   /product="magnesium and cobalt efflux protein"
FT                   /note="possible hemolysin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24515"
FT                   /db_xref="GOA:Q0I1Q6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1Q6"
FT                   /protein_id="ABI24515.1"
FT                   /translation="MSNDEQINTITENESKKNFFHSLFGRFFQGELKNRQELVDVIRDS
FT                   EQNELIDQNTREMIEGVIEISELRVRDIMIPRSQIIFIENDQDLEACLDVIIASAHSRF
FT                   PVISDERDNIAGILHAKDLLKFFRSNAEQFELQSLLRPAVIVPESKRVDRMLKDFRAER
FT                   FHMALVVDEFGAISGLVTIEDILEQIVGDIEDEFDEEDVADIRQLSRHTYVVRALTDID
FT                   DFNEQFKTNFADEEVDTIGGLIMQAFGYLPKRGEEIVLDNLSFKVTSADSRRIIQVRVT
FT                   VPDEQLTDSKKQNTEE"
FT   gene            238662..240194
FT                   /gene="cutE"
FT                   /locus_tag="HS_0238"
FT   CDS_pept        238662..240194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutE"
FT                   /locus_tag="HS_0238"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24516"
FT                   /db_xref="GOA:Q0I1Q5"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1Q5"
FT                   /protein_id="ABI24516.1"
FT                   /translation="MRNYLVYFIAILTGGVGVLAFSPFDLWAIAYLSLAGLIWVAKKSQ
FT                   KKTALLASFLWGLSFFGIGVNWLNVSIYQFGGTPLIVSYLLVILLAGYLALYPVLFTYL
FT                   VQRFRVQSLAIFPAIWTLTESLRSWVFTGFPWLQFGYTQLDSPFANLAALFGVEGLTFF
FT                   VMWISAVIFSLISQLIQSKKQWAIIITHSVLLVVMLGLSASTALLKFTQENPQKSLNVT
FT                   LVQGNIEQQLKWDPDYFYQTLTIYQRLINQSLDDSDLIILPEAALPALENHIQPYLQTL
FT                   QQLAQEKGVEVVIGTIYQEESEDKLLNSIVNLGNADEPYHLNTKNRYAKHHLVPFGEYV
FT                   PLDKILRPLGSVFNLPMSSFASGDFVQKPFLAKNRHFTPAICYEIIFGSQLQQNLTKQS
FT                   DFILTISNDAWFGDSIGPWQHLQMARMRAIELGRPVIRATNTGITAFIDAQGKIVAQAP
FT                   QFTETTLRHKIVATEGMTPYAILGTKPLYLLISLLVLFRSLGALIRKKLTQG"
FT   gene            complement(240202..240933)
FT                   /locus_tag="HS_0239"
FT   CDS_pept        complement(240202..240933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0239"
FT                   /product="deoxyribonuclease, TatD family"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24517"
FT                   /db_xref="GOA:Q0I1Q4"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1Q4"
FT                   /protein_id="ABI24517.1"
FT                   /translation="MAQLVHNARQVDVEKILIVAVLQRDFENIVNMTALYPTQLYYGLG
FT                   LHPLYIEQHSKNDLDILSQALEQGSAACRAIAEIGLERGKSDLISERLWKKQCEFLEVQ
FT                   LSFAQRFNLPVSLHSRQSHDHLFTFLKRIKVNKCGVIHGFAGSYDQAKRFVDLGYKIGV
FT                   GGTITYERANKTRNTIAKLPLDSLLLETDSPDMPICGFQGQPNRSERIIHVFHELCQLR
FT                   KEPAELIASTIWKNSCNLFAK"
FT   gene            241113..241613
FT                   /locus_tag="HS_0240"
FT   CDS_pept        241113..241613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24518"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1Q3"
FT                   /protein_id="ABI24518.1"
FT                   /translation="MLECNTALFDENVPTIFVGPLSKMLFNGNRSNNYIFNRHILMETF
FT                   VSCFDTFNFIDNIHSFNDFTKYSIAPFLHNGFTKHFFCSIIKECVVCYIDEKLSCRRMR
FT                   IRCSCHGNCATFIAKSITCFVFNWCFSIFFTQATFHTTTLDHKSINNTVENCVIIETLF
FT                   AIC"
FT   gene            complement(241185..241694)
FT                   /gene="ppiB"
FT                   /locus_tag="HS_0241"
FT   CDS_pept        complement(241185..241694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiB"
FT                   /locus_tag="HS_0241"
FT                   /product="peptidylprolyl isomerase (peptidyl-prolyl
FT                   cis-trans isomerase)"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24519"
FT                   /db_xref="GOA:Q0I1Q2"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1Q2"
FT                   /protein_id="ABI24519.1"
FT                   /translation="MITLHTNFGDIKLALNFEKAPITAENFLTYCKEGFYNNTIFHRVI
FT                   DGFMIQGGGMESGLREKNTKAPIKNEASNGLSNKRGTIAMARTSDPHSATAQFFINVAD
FT                   NTFLDYRAKEMFGKTVVQEWGYAVFGEVVEGMDIVDKIKGVKTGNKSFHQDVPVEDVII
FT                   TSVTIE"
FT   gene            241833..243212
FT                   /gene="cysS"
FT                   /locus_tag="HS_0242"
FT   CDS_pept        241833..243212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="HS_0242"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24520"
FT                   /db_xref="GOA:Q0I1Q1"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1Q1"
FT                   /protein_id="ABI24520.1"
FT                   /translation="MLKIFNTLTREKEVFKPISENKVGMYVCGVTVYDLCHIGHGRTFV
FT                   CFDVIARYLRYLGYELTYVRNITDVDDKIIRRSLENRETCEQLVDRMVVEMYKDFDALN
FT                   VLRPDFEPRATHHIAEIIALVEKLIARGHAYVADNGDVMFDVESFKEYGKLSRQDLTQL
FT                   QAGARVEISEIKKNPMDFVLWKMSKENEPSWNSPWGAGRPGWHIECSAMNCKHLGEHFD
FT                   IHGGGSDLMFPHHENEIAQSCCAHGNRYVNYWIHSGMIMVDKEKMSKSLGNFFTIRDVL
FT                   NHYDAESVRYFLLTAHYRSQLNYSEENLDLAHGALERLYTALRGTDKSAVAFGGENFIA
FT                   QFTEAMNDDFNTPNAISVLFEMAREINRLKNEDKLLADGLAARLRELAGILGLLEQDPE
FT                   DFLQAGSDDAEIAKIEALIKQRNDARQAKDWARADAARNELTTMGVILEDGSNGTMWRK
FT                   M"
FT   gene            complement(243264..243995)
FT                   /locus_tag="HS_0243"
FT   CDS_pept        complement(243264..243995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0243"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24521"
FT                   /db_xref="GOA:Q0I1Q0"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1Q0"
FT                   /protein_id="ABI24521.1"
FT                   /translation="MHRTKLEQKQPHFDAQKRRKKECKNSNTPFVRPKLELPHGHNKLL
FT                   LHSCCAPCSGEVMEAIHASGIDFTIYFYNPNIHPLKEYLIRKEENIRFAEKWGIPFIDA
FT                   DYDRQNWFDRAKGMEDEPERGIRCTMCFDMRFEKAAQYAHENGFPVFTSCLGISRWKDM
FT                   NQINGCGHRAAEKYDDVVYWDYNWRKGGGSQRMIEISKRERFYQQEYCGCVYSLRDTNK
FT                   WREANGRQKIEIGKLYYSADK"
FT   gene            complement(244128..245108)
FT                   /gene="ispB"
FT                   /locus_tag="HS_0244"
FT   CDS_pept        complement(244128..245108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispB"
FT                   /locus_tag="HS_0244"
FT                   /product="octaprenyl-diphosphate synthase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24522"
FT                   /db_xref="GOA:Q0I1P9"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1P9"
FT                   /protein_id="ABI24522.1"
FT                   /translation="MNPMNINAIQSLIKTDMDKVNATILAQLNSDVALINQLGYYIVQS
FT                   GGKRIRPMIALLAARALNYQGDEPITCAAFVEFIHTATLLHDDVVDESDMRRGNPTANA
FT                   EFGNAASVLVGDFIYTRAFQLMTKLNSLRILQIMSDATNIIAEGEVQQLMNVNDPETSE
FT                   DNYMKVIYSKTARLFEVATQCAAITAQSNAEQEIALQHYGRYLGTAFQLVDDVLDYSAN
FT                   AATLGKNIGDDLAEGKPTLPLLHAMRNGTPQQSALIREAIEQGGKRDFLDDVLAIMTEQ
FT                   KSLDYAMSKAKEEAQKAVDSISCLPENQYKQALISLAYLSVERHY"
FT   gene            245340..245651
FT                   /gene="rplU"
FT                   /locus_tag="HS_0245"
FT   CDS_pept        245340..245651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="HS_0245"
FT                   /product="LSU ribosomal protein L21P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24523"
FT                   /db_xref="GOA:Q0I1P8"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1P8"
FT                   /protein_id="ABI24523.1"
FT                   /translation="MYAVFQSGGKQHRVSEGHVVRLEKLELATGSTVEFDSVLMIVNGE
FT                   DIKIGTPVVTGAKVVAEVVSQGRGEKVKIVKFRRRKHSRKQQGHRQWFTEVKITGIQA"
FT   gene            245672..245929
FT                   /gene="rpmA"
FT                   /locus_tag="HS_0246"
FT   CDS_pept        245672..245929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="HS_0246"
FT                   /product="LSU ribosomal protein L27P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24524"
FT                   /db_xref="GOA:Q0I1P7"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1P7"
FT                   /protein_id="ABI24524.1"
FT                   /translation="MATKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKF
FT                   HAGSNVGMGKDHTLFATADGKVKFEVKGEKSRKYVSVVAE"
FT   gene            246065..246985
FT                   /locus_tag="HS_0247"
FT   CDS_pept        246065..246985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0247"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24525"
FT                   /db_xref="GOA:Q0I1P6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1P6"
FT                   /protein_id="ABI24525.1"
FT                   /translation="MKQKPLLGFIFALTTAIAWGSLPIALQQVMNAMSMQTIVWFRFMV
FT                   ATVALAILLKLANRLPKLSDLNRYFFGLVILGVIGLSGNFSLFNSSLKFIEPSVTQIFV
FT                   HFSSFAMMFCGVVIFKEKLGLHQKIGLVILIIGLILFFNERAEQLFDINIYSIGVFLSM
FT                   SASLIWVTYGLAQKLLLRRFNSQQILLMIYTGCAFVFTPFVEIEQLQNLNTFTLICFIY
FT                   CCLNTLIGYGAYAEALNHWDVAKVSVVITLVPLFTILFAHLLNLIYPQYFSAPELNTLS
FT                   YIGAFIVVFGAMTSAIGYKFIKNKI"
FT   gene            246995..248173
FT                   /locus_tag="HS_0248"
FT   CDS_pept        246995..248173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0248"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24526"
FT                   /db_xref="GOA:Q0I1P5"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1P5"
FT                   /protein_id="ABI24526.1"
FT                   /translation="MKFIDEALIRIEAGDGGNGCVSFRREKFIPKGGPDGGDGGDGGDV
FT                   YLIADENLNTLIDYRFEKRFAAERGENGRSSDCTGRRGKDITLRVPVGTRAIDNDTKEV
FT                   LGDLTKHGTKMLVAKGGYHGLGNARFKSSVNRAPRQKTNGTPGEKRDLQLELMLLADVG
FT                   MLGLPNAGKSTFIRAVSAAKPKVADYPFTTLVPSLGVTRVDTSRSFVIADIPGLIEGAS
FT                   EGAGLGVRFLKHLERCHVLIHLVDIAPIDESDPADNIAIIEGELFQYSEKLANKPRWLV
FT                   FNKIDTLSDEEATARAKNIMQRLGGEDDYYLISAATGKNVDVLCRDIMDFIEENPRQEQ
FT                   EKIDAQEVKFKWDDYHQEQLSEQVFTEDDQEGDDWDDWSEDDEEGVEIIYKP"
FT   gene            complement(248415..248984)
FT                   /gene="ampD"
FT                   /locus_tag="HS_0249"
FT   CDS_pept        complement(248415..248984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="HS_0249"
FT                   /product="N-acetyl-anhydromuramyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24527"
FT                   /db_xref="GOA:Q0I1P4"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1P4"
FT                   /protein_id="ABI24527.1"
FT                   /translation="MNNKHKNICTGWFSEARKLPSPHFDQRPENSDISLLVIHYISLPP
FT                   EQFGGSYIDDFFLGNLDPLAHPYFATIANMRVSAHCLITRDGAITQYVNFNDRAWHAGL
FT                   SSFEGREKCNDFSIGIELEGSNLQPFTEEQYQSLERLTLDIMHSYPLITKQRIVGHCHI
FT                   SPNRKIDPGQYFDWQRYFNNLEEETS"
FT   gene            249107..249565
FT                   /gene="pilA"
FT                   /locus_tag="HS_0250"
FT   CDS_pept        249107..249565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilA"
FT                   /locus_tag="HS_0250"
FT                   /product="fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24528"
FT                   /db_xref="GOA:Q0I1P3"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1P3"
FT                   /protein_id="ABI24528.1"
FT                   /translation="MKITYIFSSVKKGFTLIELMIVIAIVAILATIAIPSYQNYTKKAA
FT                   ITELLQASAPYRAEVELCVYNNDAPTNCNAGTNGIQAAINTPKGKVKSITVKGGAITVT
FT                   GNGNLKDITYTLTPTGDASTGVTWSANCNNKADLFPAGFCSSTSTNSP"
FT   gene            249639..250448
FT                   /gene="artP"
FT                   /locus_tag="HS_0251"
FT   CDS_pept        249639..250448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="artP"
FT                   /locus_tag="HS_0251"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24529"
FT                   /db_xref="GOA:Q0I1P2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1P2"
FT                   /protein_id="ABI24529.1"
FT                   /translation="MHIYSNGDNVCVNQLITKTRSFIQMTISVKNLNFFYGASQALFDI
FT                   NLTAEDGDTVVLLGPSGAGKSTLIRTLNLLEVPTSGELSIANNKFDLSQDIANPKQMRQ
FT                   LRQDVGMVFQQYNLWPHLTVMENLIEAPIKVLGIAKEKAKEQAIELLKRLRLEEFAERF
FT                   PLHLSGGQQQRVAIARALMMKPQVLLFDEPTAALDPEITAQIVSIIQELQEMGITQVIV
FT                   THEVAVAKKVATKVVYMEQGRIVEMGDSSCFEQPSTEQFKQYLSHSH"
FT   gene            250466..251191
FT                   /gene="artI"
FT                   /locus_tag="HS_0252"
FT   CDS_pept        250466..251191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="artI"
FT                   /locus_tag="HS_0252"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24530"
FT                   /db_xref="GOA:Q0I1P1"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1P1"
FT                   /protein_id="ABI24530.1"
FT                   /translation="MKKLLLATMLAGATIGANAQDITFAMEPSYPPFELTNEKGEIIGF
FT                   DVDIANAICKEIQANCSFKAQAFDALIPSLIKGRGGFDAAISAIDITEARAKQVAFTDS
FT                   YYESSASFIALKGKADLTTAKVVGVQNGTTYQQYVNKESKQYQSKSYASLQDAILDLKN
FT                   GRIDLIFGDTDVLRDMFDKNPELQFVGERVTDKRYFNNGLGIAVNKKNTALVEQLNKGI
FT                   SAIKANGEYQKIYDKWMTK"
FT   gene            251196..251867
FT                   /gene="artQ"
FT                   /locus_tag="HS_0253"
FT   CDS_pept        251196..251867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="artQ"
FT                   /locus_tag="HS_0253"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24531"
FT                   /db_xref="GOA:Q0I1P0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1P0"
FT                   /protein_id="ABI24531.1"
FT                   /translation="MFIDYLPLMYTATLMTLGLAVCSLLLGLALSIFFVVLETHKWACI
FT                   RKPTATIVTLLRGLPEILVVFLIYFGVPEILEWVIGEYVEFGAFGCGVVALSIIFASYA
FT                   SQSLRGAIQAIPLGQWESGAALGLSRSYTFIFLIMPQVWRHALPGLSNQWLVLLKDTAL
FT                   VSLIGVHDLMRQAELINTNTHQPFTWYGFAALLYLLITLFSQFIIRKLERRVTRFERAT
FT                   N"
FT   gene            251878..252561
FT                   /gene="artM"
FT                   /locus_tag="HS_0254"
FT   CDS_pept        251878..252561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="artM"
FT                   /locus_tag="HS_0254"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24532"
FT                   /db_xref="GOA:Q0I1N9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1N9"
FT                   /protein_id="ABI24532.1"
FT                   /translation="MIKDYFLTIAQGIPTSLILTIVALLVAFFLALTLTFALSMEKKWL
FT                   SLPINLFLTIFTGTPLLVQFFLIYAGPGQFSWIVNSFLWPLLSSAWFCAILTLALNSTA
FT                   YSTQLFYGAVKAISKGQWESCVALGLSRWQTLKILVPYALKRALPSYSNEIILVFKGTS
FT                   LASIITILDIMGYARQLYGTEYDALTIYGIAGVIYLIITGIATLLLRRLERKVLVFERL
FT                   ETERV"
FT   gene            complement(252667..252954)
FT                   /locus_tag="HS_0255"
FT   CDS_pept        complement(252667..252954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0255"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24533"
FT                   /db_xref="InterPro:IPR020493"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1N8"
FT                   /protein_id="ABI24533.1"
FT                   /translation="MNIMLKPRSVMIILASVFATITTTHVQANTLPEQCQKLFKETENL
FT                   IAEAEKQPGTHVQLAKIKSKLKQSKQQILAMEHDIQIKSCDIGLAKLHTK"
FT   gene            253414..254979
FT                   /gene="cydA"
FT                   /locus_tag="HS_0256"
FT   CDS_pept        253414..254979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="HS_0256"
FT                   /product="cytochrome bd quinol oxidase subunit 1
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24534"
FT                   /db_xref="GOA:Q0I1N7"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1N7"
FT                   /protein_id="ABI24534.1"
FT                   /translation="MLDVVELSRLQFALTALYHFLFVPLTLGLSFILVIMETLYVATGK
FT                   EVYKDMTKFWGKLFGINFALGVTTGITMEFQFGTNWSYYSHYVGDIFGAPLAIEALLAF
FT                   FLESTFVGLFFFGWDRLSKAKHLLTTYCVAFGSNFSAMWILVANGWMQNPVASEFNFET
FT                   MRMEMTSFMDLWLNPVAQSKFLHTLSAGYVTSACFVLAISSYYLLKRRDVGFAKRSFSI
FT                   ASVFGIIATVSVLIMGDESGYEIGQTQPVKLAAMEGEWHTQPAPASWNMIVVPNQAEQK
FT                   NDFALQIPYAAGIIVTRSLDKQFTGLVDLQALNEQRVRNGMVAYGLLQQLKTEKKVNGQ
FT                   VNEETKAQFNAVKDDLGFGLLLKRYTDAVVDATDEQVKQAAADTIPNVGPTFWSFRIMM
FT                   LAGGLILVLMIAAFVQNMRKTVGRSPLLLKALLWGLPLPWIAMESGWFLAEYGRQPWAI
FT                   YDVLPVGVAASNLTTADLWLSIGLICALYTIFLVVEMYLMFKYGRLGPSSLKTGRYYFE
FT                   QLSK"
FT   gene            254994..256130
FT                   /gene="cydB"
FT                   /locus_tag="HS_0257"
FT   CDS_pept        254994..256130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="HS_0257"
FT                   /product="cytochrome bd quinol oxidase subunit 2
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24535"
FT                   /db_xref="GOA:Q0I1N6"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1N6"
FT                   /protein_id="ABI24535.1"
FT                   /translation="MIDYEFLRFIWWILVGVLLIGFAVTDGFDMGVLSLLPFAGKKEVE
FT                   KRIMINSIAPHWDGNQVWLLTAGGAMFAAWPIVYAASFSGFYIAMILVLAALFFRPVGL
FT                   EYRAKIDNPTWRKFWDWGLFAGGFVPSLVFGVAFGNLLQGVPFEFNDLMQVTYTGSFFE
FT                   LLNPFAILCGLISFSMLTTQGAAWLQMKTTSELRERARVITQVGAFVTLLTFILAGVWL
FT                   YFKEGFIVTSVLDHNAPSDPTVKTVAVEVGAWFKNYFDAPVLFILPALAVGGALLNILA
FT                   SKANRSGFAFFFSSITMAGIILTCGVAMFPFVMPSISHPNMSLLMWDSTSSELTLTLML
FT                   GFALFFVVILLSYTIWAYAKMFGRLDADFIEENKNSLY"
FT   gene            256504..256929
FT                   /locus_tag="HS_0258"
FT   CDS_pept        256504..256929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0258"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24536"
FT                   /db_xref="GOA:Q0I1N5"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR008272"
FT                   /db_xref="InterPro:IPR014166"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1N5"
FT                   /protein_id="ABI24536.1"
FT                   /translation="MPVFKLPVRVYYEDTDAGGVVYHARYLHFFERARTEYLRTLNFSQ
FT                   QNLLNERKVAFVVKSIQIDYCVPAKLDDLLIVETYVVAIKGASIVFSQILKRDDEIISQ
FT                   AVVKVASVDLVKMRPVAIPQEIKAEIKLNDNIFGVMS"
FT   gene            256926..257609
FT                   /gene="tolQ"
FT                   /locus_tag="HS_0259"
FT   CDS_pept        256926..257609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolQ"
FT                   /locus_tag="HS_0259"
FT                   /product="Cell division and transport-associated protein
FT                   TolQ"
FT                   /note="TC 2.C.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24537"
FT                   /db_xref="GOA:Q0I1N4"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1N4"
FT                   /protein_id="ABI24537.1"
FT                   /translation="MTAELDFLELFLKASIVVQIVIVILISFSIISWAIIIQRSRILTR
FT                   ALKDSTLFEERFWSGEDLYKLYDGLSNRRNGLNSSERIFYVGFKEFNRLKQANPDAPEA
FT                   IIQGSSRAMNLAMNREVEDLETRVPFLATVASISPYIGLFGTVWGIMHAFMALSGAKQA
FT                   TLQMVAPGIAEALIATAIGLFAAIPAVMAYNRLSLRVNKLEQNYANFIDEFTTILHRQA
FT                   FGKNH"
FT   gene            257677..258099
FT                   /gene="tolR"
FT                   /locus_tag="HS_0260"
FT   CDS_pept        257677..258099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolR"
FT                   /locus_tag="HS_0260"
FT                   /product="Cell division and transport-associated protein
FT                   TolR"
FT                   /note="TC 2.C.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24538"
FT                   /db_xref="GOA:Q0I1N3"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1N3"
FT                   /protein_id="ABI24538.1"
FT                   /translation="MSYRRKRRDIKSEINIIPFLDVLLVLLLIFMATAPIISQSVQVEL
FT                   PEAVESQNVSKEDKTPVILEVSGIGQYALSIGGERTEGITEELVTQLSKQEFDKDNNTL
FT                   FLVGGAKDVPYEEVIKALNLLHVAGIKSVGLMTNPL"
FT   gene            258118..259173
FT                   /gene="tolA"
FT                   /locus_tag="HS_0261"
FT   CDS_pept        258118..259173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolA"
FT                   /locus_tag="HS_0261"
FT                   /product="Cell division and transport-associated protein
FT                   TolA"
FT                   /note="TC 2.C.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24539"
FT                   /db_xref="GOA:Q0I1N2"
FT                   /db_xref="InterPro:IPR014161"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1N2"
FT                   /protein_id="ABI24539.1"
FT                   /translation="MCNHRQKNELGAILLSIFLHILLLSLLVLGSNYNNVEIMGGGEGD
FT                   GEVMSAVMVDTGTIAKEWGRLQEKKKSNPDKQETFVEATQEDELMENVDVFEEKIREDE
FT                   EVQKRLAEQKIKEEKIQQERLAKQLEEDNAKKEAVAKLKAEAEEMRLQALAKKIEEEKK
FT                   VRDAEEKQKAEKLAKERAEKLAKEKADRLAKQKALKEAKIKAEKAAKAKAELAQRKAEQ
FT                   AALDDFFNGGDIAGSSKNGGNMTMKGSQGVGAGFENGKGGRTGEQYAAQIKREIQRRFL
FT                   KEPRFANKVCVIEVELARDGTITNFRKLSGSDDICTAGLSAVSRTKKVPEAPTDEIYRK
FT                   YKKFPLEFRLK"
FT   gene            259201..260505
FT                   /gene="tolB"
FT                   /locus_tag="HS_0262"
FT   CDS_pept        259201..260505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolB"
FT                   /locus_tag="HS_0262"
FT                   /product="biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24540"
FT                   /db_xref="GOA:Q0I1N1"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1N1"
FT                   /protein_id="ABI24540.1"
FT                   /translation="MKFSAYLTTLFIVLFSLFIQTVQAESEVRIVIDEGVDSARPIAII
FT                   PFKWNGSDSMPIDVADIISADLRNSGKFNPIAVSKMPQKPTSASEVISDVWSSLGIDAV
FT                   VVGQVTPNEKGYSIAYQLVDTIGASGNAGEVLSQNQYAVPKNAIRLGAHTISDEVFEKL
FT                   TAIRGAFRTKIAYVVQKHGGSKPYQVRVADYDGHNQFIVYSSSQPLMSPAWSPDGSKLA
FT                   YVSFENRKSQLIVHDLQSGARRVIAAFPGHNGAPAFSPDGSKIAFASSKDGVLNIYVMN
FT                   LGNGTISQLTSGAGNNTEPSWSPDGQSIIFTSDRAGGPQIYQMDVFGNGISLVSAGRGY
FT                   SGKISADGSILVMIYGDNIVKKDLATGVTEMLSSTFLDESPSISPNGIMIIYSSTQGLG
FT                   KVLQLVSADGRFKARLPSSDGQIKFPAWSPYLNKN"
FT   gene            260563..260970
FT                   /gene="pal"
FT                   /locus_tag="HS_0263"
FT   CDS_pept        260563..260970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pal"
FT                   /locus_tag="HS_0263"
FT                   /product="peptidoglycan-associated outer membrane
FT                   lipoprotein (outer membrane protein P6)"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24541"
FT                   /db_xref="GOA:Q0I1N0"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1N0"
FT                   /protein_id="ABI24541.1"
FT                   /translation="MAACSSSDNASKTNAQMFGGYSVTDLQQRYNTVYFEFDSYDVQGE
FT                   YAQILDAHSAYLKSTPASKVLVEGHADERGTPEYNMALGLRRADAVKNFLLNKGVQASQ
FT                   LSTLSYGEEKPAELGHNEAAYSKNRRAVLAY"
FT   gene            261158..261236
FT                   /locus_tag="HS_tLys01"
FT   tRNA            261158..261236
FT                   /locus_tag="HS_tLys01"
FT                   /product="tRNA-Lys"
FT   gene            261259..261337
FT                   /locus_tag="HS_tLys03"
FT   tRNA            261259..261337
FT                   /locus_tag="HS_tLys03"
FT                   /product="tRNA-Lys"
FT   gene            261360..261438
FT                   /locus_tag="HS_tLys02"
FT   tRNA            261360..261438
FT                   /locus_tag="HS_tLys02"
FT                   /product="tRNA-Lys"
FT   gene            261644..262171
FT                   /gene="pulG"
FT                   /locus_tag="HS_0264"
FT   CDS_pept        261644..262171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulG"
FT                   /locus_tag="HS_0264"
FT                   /product="type II secretory pathway, pseudopilin"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24542"
FT                   /db_xref="GOA:Q0I1M9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1M9"
FT                   /protein_id="ABI24542.1"
FT                   /translation="MKALKGFTLLEILIVLLIISMTVTFSFPMWQTANTKMILEKEQNK
FT                   LYIFIRELQARVENSNDIWFLIANRDLVSKRWCLVAQPKNTDICDCLNPRSCNRNIPMK
FT                   FYYPYFADKTMLISKVYYPREMTRLNGTRNTSTTTCFVLQSDQQRTVFSFFNVGSLKLK
FT                   GYQSLSACVNDH"
FT   gene            262220..262897
FT                   /locus_tag="HS_0265"
FT   CDS_pept        262220..262897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0265"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24543"
FT                   /db_xref="InterPro:IPR016419"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1M8"
FT                   /protein_id="ABI24543.1"
FT                   /translation="MIALSLSMMLLMSVSAFYSYSQQQNKQILLHLYLQSELQRTIQLL
FT                   GKDIRRSGFRAISDKLVRSNFDLFEQDKSGKSIVVAQADNEPPNSCVLFIYDLDATGCV
FT                   GTTYRNNVCVRNKQNTAREIERELFGYRLNKQMIETRLTYKNSISANCNQKQCQSYLQQ
FT                   PACNSGGWVDLLDENDIAITALKFNWIADYNGLEVYLKGHLKRNKQVEYETSAIIPLLN
FT                   QKR"
FT   gene            262900..263580
FT                   /locus_tag="HS_0266"
FT   CDS_pept        262900..263580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0266"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24544"
FT                   /db_xref="GOA:Q0I1M7"
FT                   /db_xref="InterPro:IPR022543"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1M7"
FT                   /protein_id="ABI24544.1"
FT                   /translation="MNIQKGVVTLTLLMLLSSVLLILLFFDGDLISLHSSIVSQRKIYL
FT                   EQSLILQRQSISQKEKLCENQPLNNNLKSLKIEFESRRKIDRTSQFIWCERKYLFKKRP
FT                   KKATYEAGLSQYINLELLDLFQHKLHSPPAILPRDKANYLYWVEEKSAELEIQGNINAV
FT                   VIAEGDLKLTGKGKISGTVITGGKLSIEPAVKIVYRSKTIIDLIRSYSYWQFAENSWYD
FT                   FQPL"
FT   gene            263561..263878
FT                   /locus_tag="HS_0267"
FT   CDS_pept        263561..263878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0267"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24545"
FT                   /db_xref="GOA:Q0I1M6"
FT                   /db_xref="InterPro:IPR020511"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1M6"
FT                   /protein_id="ABI24545.1"
FT                   /translation="MIFNHYKFPQRGTSLITLLVTMMIFSTLFLFVNQWVSYQRKSVVN
FT                   IYLRYQALQIAENQHQRLFLEPHFHCPHNIEQNGYKFKINCEGKNVRVSYANQQVNLLL
FT                   D"
FT   gene            263931..267365
FT                   /gene="recC"
FT                   /locus_tag="HS_0268"
FT   CDS_pept        263931..267365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recC"
FT                   /locus_tag="HS_0268"
FT                   /product="DNA helicase/exodeoxyribonuclease V, gamma
FT                   subunit"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24546"
FT                   /db_xref="GOA:Q0I1M5"
FT                   /db_xref="InterPro:IPR006697"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041500"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1M5"
FT                   /protein_id="ABI24546.1"
FT                   /translation="MFTLYYSNQLETQKDILLHLMDQQPLSDPFQKEVILVQSGGMAQW
FT                   IQWQIAEKKGISANLSFPMPASFIWQLYVDNLPQVTASSQFSKENMTWRLMEIIPHYID
FT                   QPEFYILRQYLQQSYQSSQQRYYQLASKIAELFDQYLVYRPEWIISWEQNKGVEIIQQI
FT                   QYYQKNLFVSESCFSQVEQHIVWQGILWRALVCSVPKETQKNVLHRAHLHLLFLKHIAG
FT                   EKPKNLPTRIFVFGISALPKVHLDTLSALSQHCDVHLFFNNACREYWGDIIDQSHWQRL
FT                   KVRERISWQDFQQPQNTQAWLSDEQIHTFEQNVFEQIYDEKLQVGNPLLSSWGKLGRDY
FT                   LYLLTELEANEINAYVELSEKTLLSQVQALILDLVPSKHKFLNLAENDRSLTFHSCYSP
FT                   IREVQALQDYLLHLFNQAQDLTPKDVVVMVADIDKYAPYIQAVFSQGEHYIPYSIADSK
FT                   LSENDPLVSAFLQLLNLKESLFSAEEVLTFLDHPVIRQSFNITLEDLAQIRHWVEHSGI
FT                   RFGLEKYPQQSLQNYNAWQAGLERMLLGFAMREEHGLWLDTLGFDDTYGLKGQLVGYLK
FT                   DFITRLYQWHQFLQADHVIEKWEEHLIELVSSFFVVDGMDIPQQYKTTFNYLIDTIQQL
FT                   TELILDSSFQQEISAEVIYEVFVERLKDIPNSLKFLMGKVTFCTLLPMRSIPFKVVCLL
FT                   GMNDGDYPRQQTPNSFDLMQYHRKKGDRFRRDDDRYLFLEALISAQQYFYVSYIGRSII
FT                   DDSEREPSVLVTQLLDYIAENINAQGDLKGQDILKKSLIQQHAMTAFSRENFTKRDRSF
FT                   FKQWLVLANKKDSGNLANFLQPINDTEIVKEISLNDLIAFIQDPVRYFFEQKLRVFLRK
FT                   TEQNIADTENFTLDNLELYQIKEELIYLSEQEWEDFFARMKIKGIMPQGAFAKIYQQKT
FT                   KNEIITLKSLVTPYLDQISEQIPVDLSVETEYGKVCLTGSIDSLYHQKMRRVTWRASAV
FT                   KTKDIIQTWIYYLLQTLVGEPNSQVEHYALDSRLSFEKIEKSTALQQLQTYVEAYLLGQ
FT                   VSVLLMPMKNFDQYLQLLFTPKSNKWKEEKDIDLSACFELLSELGSGRKERNFYVKTDL
FT                   YWQRILAQTKLDDSHILEINQRVIQWFDLMLMLKRVE"
FT   gene            267444..268058
FT                   /gene="ruvA"
FT                   /locus_tag="HS_0269"
FT   CDS_pept        267444..268058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="HS_0269"
FT                   /product="Holliday junction DNA helicase subunit RuvA"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24547"
FT                   /db_xref="GOA:Q0I1M4"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1M4"
FT                   /protein_id="ABI24547.1"
FT                   /translation="MIGRVTGILVEKQAPEILLDVQGVGYELLLPMTSFYNLPEVGQET
FT                   TLFTHFVVREDAHLLFGFSHKQDRSLFRELIKTNGVGPKLALAILSAMSVNEFVYAIEQ
FT                   EELSKLVKIPGVGKKTAERLLVELKGKFKGLQQTDFFIKSSHLPGIKCSKLDQSLQLDE
FT                   AVSALIALGYKPIEAEKMVKKVLKADLTSEQLIREALKAAL"
FT   gene            268069..269076
FT                   /gene="ruvB"
FT                   /locus_tag="HS_0270"
FT   CDS_pept        268069..269076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="HS_0270"
FT                   /product="Holliday junction DNA helicase subunit RuvB"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24548"
FT                   /db_xref="GOA:Q0I1M3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1M3"
FT                   /protein_id="ABI24548.1"
FT                   /translation="MIEVDRIVSANAKVDDEYIDRAIRPKLLSDYIGQPQVREQMEIFI
FT                   QAAKLRQDALDHLLIFGPPGLGKTTLANIVANEMGVNIRTTSGPVLEKAGDLAAMLTNL
FT                   EPHDVLFIDEIHRLSPAIEEVLYPAMEDYQLDIMIGEGPAARSIKLDLPPFTLIGATTR
FT                   AGSLTSPLRDRFGIVQRLEFYSVEDLASIVTRSAVCLQLEIDVEAGQEIACRSRGTPRI
FT                   ANRLLRRVRDYADVKNGGKITALIAQEALKMLDVDLAGFDFMDRKLLQAIIERFDGGPV
FT                   GLDNLAAAIGEERDTIEDVLEPYLIQQGFLQRTPRGRIATSRTYRHFGLEQIEK"
FT   gene            complement(269211..270416)
FT                   /locus_tag="HS_0271"
FT   CDS_pept        complement(269211..270416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24549"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1M2"
FT                   /protein_id="ABI24549.1"
FT                   /translation="MNYSQTIIIGAGAAGLFCAGQLGKAKHQVTILDNGKKVGRKILMS
FT                   GGGFCNFTNLNVTPQHYLSQNPHFVKSALARFTQWDFIALITDYGISYYEKESGQLFCH
FT                   NSAEDIVNMLRAECDKFQVNTQLRQQIEYIEKLDGNEKARFQLQSDGKIWQCENLVIAT
FT                   GGLSMPALSSTPFGYQVAEQFGLNVIAPRAGLVPFTWREIDKFYTALSGISLPVCVTAK
FT                   CGQSFSNNLLFTHRGISGPAILQISNYWQVNENIEIDLLPMENIQFFLNKLRQTSPKLH
FT                   LKTALSRLLPQKLVDLWLNHNIIQDEVIANLSKVQLKNLDDLIHHWQIQPNGTEGYRTA
FT                   EVTIGGVDTQEISSKTMESHKIKGLYFIGEVLDVTGRLGGYNFQWAWSSAYVCANGILS
FT                   NK"
FT   gene            complement(270419..271384)
FT                   /locus_tag="HS_0272"
FT   CDS_pept        complement(270419..271384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24550"
FT                   /db_xref="GOA:Q0I1M1"
FT                   /db_xref="InterPro:IPR010017"
FT                   /db_xref="InterPro:IPR027555"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1M1"
FT                   /protein_id="ABI24550.1"
FT                   /translation="MFDFRPFYQQIATSTLSAWLETLPLQLKQWEKQTHGDYIKWSKII
FT                   DFLPHLTADHIDLKSAVKAETKTPLSSGERQRIIHHLKQLMPWRKGPYHLYGIHIDCEW
FT                   RSDFKWERVLPHLAPLQNRLVLDVGCGSGYHMWRMVGEGAKMVVGIDPTELFLCQFEAV
FT                   RKLLNNDRRANLIPLGIEEMQPLAAFDTVFSMGVLYHRKSPLDHLTQLKNQLVKDGELV
FT                   LETLVVEGDINTTLVPTDRYAKMKNVYFIPSVLALINWLEKCGFHNIRCVDVETTGLEE
FT                   QRKTDWLENESLIDFLNPQDHSKTIEGYPAPKRAVILANK"
FT   gene            complement(271387..272901)
FT                   /gene="putP"
FT                   /locus_tag="HS_0273"
FT   CDS_pept        complement(271387..272901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putP"
FT                   /locus_tag="HS_0273"
FT                   /product="sodium/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24551"
FT                   /db_xref="GOA:Q0I1M0"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1M0"
FT                   /protein_id="ABI24551.1"
FT                   /translation="MFSFDPTIITFIVYILGMLLIGALAYYYTNNLSDYILGGRRLGSF
FT                   VTAMSAGASDMSAWLLMGLPGTIYLSGLIEGWIAIGLTIGAYFNWLFVAGRLRIYTEFN
FT                   NNALTLPEYFHNRFGSRHNLLKIVSASIILVFFTIYCASGVVAGAKLFQNLFSIPYSTA
FT                   LWYGALATIAYTFIGGFLAVSWTDTIQATLMIFALILTPIMIILSLDGIDNFHFYLKQA
FT                   ESAVGKNFTDIFTGTTTIGLLSLASWGLGYFGQPHILARFMAAHTVKSLNNARRISITW
FT                   MILCLVGAIGIGFFGIAYFAANPQLAGIVNKESEQIFIELSKLLFNPWIAGILLSAILA
FT                   AVMSTLSAQLLISSSAVTEDFYKGFIRPKASDKELMWLGRLMVLAIAAIAIWIAQDEKS
FT                   QVLKLVEFAWAGFGSAFGPVVLFSLFWKRMTSSAAMAGMLTGTIIVFSWKTIVPTTSEF
FT                   SKLYEMIPGFALASIVIIVVSLLSVKPEKSILETFEQAKNAYKASK"
FT   gene            273032..274507
FT                   /gene="rng"
FT                   /locus_tag="HS_0274"
FT   CDS_pept        273032..274507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rng"
FT                   /locus_tag="HS_0274"
FT                   /product="RNAse G"
FT                   /EC_number="3.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24552"
FT                   /db_xref="GOA:Q0I1L9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1L9"
FT                   /protein_id="ABI24552.1"
FT                   /translation="MESVELLANITPSETRIALVDNGILKEVHIERQAKRGSVGNIYKG
FT                   RVTRVLPGMQSAFVDIGLEKAAFLHASDIVSHTECVDVDEQKQFVVKDIAQLVHEGQDI
FT                   VVQVVKDPLGTKGARLTTDITLPSRYLVFMPENSHVGVSQRIESEEERARLKELVLPLC
FT                   DELGGFIIRTAAEGATETELVQDAEFLKRLWRKVLERRAKYTTRSMLYGELALTQRILR
FT                   DFIGANFSKIHIDSKLCFSEVKQFTEEFMPELTDKLVLYSGSQPLFDVYSVENAIQTAL
FT                   NSRVNLKSGGYLIIEQTESMTTIDINTGAFVGHRNLEETIFNTNIEATKAIAQQLQLRN
FT                   LGGIIIIDFIDMQTEEHRDRVLESLRLALSKDRVKTNVNGFTQLGLVEMTRKRTRESLE
FT                   HILCDECPTCSGRGSVKTVETVCYEIMREIIRVNHLFASEKFVVYASRAVADYLINEES
FT                   HGLLAELEVFIGKQIQIKTEVYYSQEQFDVVVM"
FT   gene            274562..275341
FT                   /locus_tag="HS_0275"
FT   CDS_pept        274562..275341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24553"
FT                   /db_xref="GOA:Q0I1L8"
FT                   /db_xref="InterPro:IPR005076"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1L8"
FT                   /protein_id="ABI24553.1"
FT                   /translation="MVKNIGILYIATGRYHVLWEDFYKSAEKHFLPELPKKYFLFSDYE
FT                   GSFLGEESGNVHRIYQKKLGWPYDTLMRFDMFLKEKERFKELDYLFFVNANMIFIKDIH
FT                   QNEVLASDKELIMILQPWFIGLDIDKTTYDRNPLSTSYIPYGEGEHYVMGSFNGGKTSA
FT                   FLEMCQQLNDNIYLDLKKDIIALWHDESHLNHYCWRNKEKIFILPDSYLLDEGQQYFPS
FT                   KKSHYINPLYLKNHDVRLVMRNKNHYRFGGELHERDY"
FT   gene            275479..276927
FT                   /gene="tldD"
FT                   /locus_tag="HS_0276"
FT   CDS_pept        275479..276927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tldD"
FT                   /locus_tag="HS_0276"
FT                   /product="microcin-processing peptidase 2, Unknown type
FT                   peptidase, MEROPS family U62"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24554"
FT                   /db_xref="GOA:Q0I1L7"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1L7"
FT                   /protein_id="ABI24554.1"
FT                   /translation="MLNKVQESILAPNNLELDNLKNTFDMLSHRQIDYADLYFQLSQDE
FT                   NWVLEDGIIKEGGFHIDRGVGVRAVTGEKTGFAYSDQIDLVSLQQCANAVKGIALPNQG
FT                   NIIKPIGFNAVNAVTRYPAVNPLNSLNKEQKIELLHLVDRTARAYSPYVTKVVANLTAL
FT                   YEEILVVATDGTLAADVRPLIRLSIFVMAEKAGKREQGSAGVGARVGLDWFFEPYKGEQ
FT                   RAIYFAKEAARQALVNLDAIEAPAGLMPVVLGAGWPGVLLHEAVGHGLEGDFNRKGSSL
FT                   FTGKIGELVTSPLCTIVDDGTLPNRRGSLTIDDEGVPSQCNVLIKDGVLQGYMQDKMNA
FT                   RLMGVKPTGNGRRESYAHLPMPRMTNTYMLAGQSKFEDLIASVDYGIFAPHFGGGQVDI
FT                   VSGKFTFSMSEAYLIEKGRITKPIKGATMIGQGIEVMQQVSMVADNMEIDHGIGVCGKD
FT                   GQSVPVGVGQPACKIEQITVGGTA"
FT   gene            277139..278587
FT                   /locus_tag="HS_0277"
FT   CDS_pept        277139..278587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24555"
FT                   /db_xref="InterPro:IPR018773"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1L6"
FT                   /protein_id="ABI24555.1"
FT                   /translation="MLEIGCSFGGNLLPFAIRHPNSQLVGIDLSEYQINIGQQMMEQVG
FT                   VKNVELVAADISQVSFNIKFDYIICHGVFSWVPEAVRHAILKTIQEYLSPNGIAHISYN
FT                   TYPGWKIRDVAKELMCFGSNPNLSSLERIDQSFELLKFTSSILQRKNADLYKVLSHSFQ
FT                   EIPDKDKFYVAHEYFEDFNQPFYFREFISQLEAYHLAYLTDSSFPAIYSDVHFEHDEYE
FT                   KVCAYFDYRLEAVEQFIDFLNNRSFRHSIITHQQNLADKGITNNISQYNHCHHFYDIYF
FT                   RTDVRYSPATDDKEAHWQLLDIGAEISDTPLNNLLCTYLQEHNNPCKIGDICEYAKKFP
FT                   EYDETELYKLILSIIYSNHVYLCFEPETSTGYDSKPKLFEPYRKLIELVRYNPNVTGLS
FT                   NRYYQVLNLDFLPQYIAQFLDGTRTVKDLIKQLREDIENNTIILHDENGNELSNKKIKD
FT                   KDLKEVIVRQLDALKEYGYFTEYK"
FT   gene            complement(278668..279474)
FT                   /gene="suhB"
FT                   /locus_tag="HS_0278"
FT   CDS_pept        complement(278668..279474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="HS_0278"
FT                   /product="inositol-1(or 4)-monophosphatase"
FT                   /EC_number="3.1.3.25"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24556"
FT                   /db_xref="GOA:Q0I1L5"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1L5"
FT                   /protein_id="ABI24556.1"
FT                   /translation="MNPMLNIAIRAARKAGNIIAKGYERRDEIQTMQKGINDFVTNIDK
FT                   ASEAAIIEVVRKSYPEHTIVTEESGVHEGQKNDIQWVIDPLDGTTNFVKGLPHFAVSIA
FT                   VRVKGRTEIGVVYDPIRNELFTAVRGEGAKINELRLRVDSSKRDLQGAILATGFPFKKP
FT                   SLMPTQFAMMSNLAENVADFRRAGSAALDLCYVAANRVDGYFEMGVKPWDITAGDLILR
FT                   EAGGLVCDFYGGHKYFTDSHIVAATPRLVKEILNKIQPCLAPDFKV"
FT   gene            279646..280386
FT                   /locus_tag="HS_0279"
FT   CDS_pept        279646..280386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0279"
FT                   /product="possible tRNA/rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24557"
FT                   /db_xref="GOA:Q0I1L4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1L4"
FT                   /protein_id="ABI24557.1"
FT                   /translation="MLENIKIVLVETSHSGNIGSAARAMKTMGLNQLCLVAPKQGIDEQ
FT                   AVALAAGAEDVVKSAVVADSFSQAVADCSLIIGTSARLRHLQSTLIEPRECAEKVIQSL
FT                   SSQKVAIVFGRERVGLTNDELLKCHYHLTIPANPEYSSLNLAMAVQLISYELRLAWLAS
FT                   LKELKQPFSVIANNYPTFQELEHFFAHTEQLYQQLGFIQNQGVMKKLRRLYQRVQLEKN
FT                   ELNILRGMLSAVEKRINCKKLEVD"
FT   gene            280440..280847
FT                   /locus_tag="HS_0280"
FT   CDS_pept        280440..280847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0280"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="possible transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24558"
FT                   /db_xref="GOA:Q0I1L3"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR010242"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1L3"
FT                   /protein_id="ABI24558.1"
FT                   /translation="MKLTSKGRYAVTAILDIALNAELGPVSLADISERQHISLSYLEQL
FT                   FAKLRRGGLVKSVRGPGGGYQLGLSTEQISIGMVINAVNENINVTKCLGNGDCQGGVKC
FT                   LTHSLWEELSVRIENFLNEITIAELVAKQAK"
FT   gene            280926..282140
FT                   /gene="nifS"
FT                   /locus_tag="HS_0281"
FT   CDS_pept        280926..282140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifS"
FT                   /locus_tag="HS_0281"
FT                   /product="cysteine desulfurase IscS"
FT                   /EC_number="2.8.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24559"
FT                   /db_xref="GOA:Q0I1L2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1L2"
FT                   /protein_id="ABI24559.1"
FT                   /translation="MKLPIYLDYAATCPVDERVVKKMMEFLSIDGNFGNPASRSHKFGW
FT                   QAEEAVDVARNHIADLIGADSREIVFTSGATEADNLALKGVMRFYQTKGKHLITCKTEH
FT                   KAILDTCRQLEREGFEVTYLDPKSDGLIDLEELKSVIRDDTVLVSIMHANNEIGVVQDI
FT                   AKIGEICRERKVLFHTDATQSVGKLPINLSELKVDLLSMSSHKLYGPKGIGALYVCRKP
FT                   RVRLEAIIHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMPRLTALRDRLYNGL
FT                   KDIEETYVNGSMEQRLGNNLNISFNYVEGESLMMALRDIAVSSGSACTSASLEPSYVLR
FT                   ALGLNDELAHSSIRFTVGRYTTAEEIDYAIGLVKSAVEKLRDLSPLWDMFKEGIDLNSI
FT                   EWTHH"
FT   gene            282216..282599
FT                   /gene="iscU"
FT                   /locus_tag="HS_0282"
FT   CDS_pept        282216..282599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscU"
FT                   /locus_tag="HS_0282"
FT                   /product="iron-sulfur cofactor synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24560"
FT                   /db_xref="GOA:Q0I1L1"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1L1"
FT                   /protein_id="ABI24560.1"
FT                   /translation="MAYSEKLLDHYENPRNVGSFDKKDPTVGSGMVGAPACGDVMQLQI
FT                   KVNDEGIIEDAKFKTYGCGSAIASSSLITEWVKGKSLDEAQAIKNSQIAEELELPPVKV
FT                   HCSILAEDAIKAAIADYKAKKAE"
FT   gene            282765..283088
FT                   /locus_tag="HS_0283"
FT   CDS_pept        282765..283088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0283"
FT                   /product="HesB-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24561"
FT                   /db_xref="GOA:Q0I1L0"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR011302"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1L0"
FT                   /protein_id="ABI24561.1"
FT                   /translation="MSITLTQAAANRVRTFLEKRGKGIGLRLGIKTSGCSGLAYVLEFV
FT                   DILNEDDEVFEQDGVKVIVDRKSLVYLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGES
FT                   FNV"
FT   gene            283097..283615
FT                   /gene="hscB"
FT                   /locus_tag="HS_0284"
FT   CDS_pept        283097..283615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscB"
FT                   /locus_tag="HS_0284"
FT                   /product="co-chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24562"
FT                   /db_xref="GOA:Q0I1K9"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1K9"
FT                   /protein_id="ABI24562.1"
FT                   /translation="MINPFALFDLEIDFNLDQQILSQRYLTLQKSLHPDNFAHRSAQEQ
FT                   RLALQKSAEINDALQILKDPISRADSIINLHLGEQNIEQKTNQDMMFLMQQMEWRERLE
FT                   QVEQQQNMDKLLHFSQEVECVQRDILAELQEFLAQQNWQQAQLLNDRLRFIKKLFVEIE
FT                   RVEEQLAGF"
FT   gene            283657..285507
FT                   /gene="hscA"
FT                   /locus_tag="HS_0285"
FT   CDS_pept        283657..285507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscA"
FT                   /locus_tag="HS_0285"
FT                   /product="chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24563"
FT                   /db_xref="GOA:Q0I1K8"
FT                   /db_xref="InterPro:IPR010236"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="InterPro:IPR042039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1K8"
FT                   /protein_id="ABI24563.1"
FT                   /translation="MALLQIAEPGQSAAPHQHKLAVGIDLGTTNSLVAAVRSGSSEVLR
FT                   DEQDRLLIPSIVHLTEDQVIVGYEAGKLASQDPQNTIISVKRLIGRSCTDVQQRYPNLP
FT                   YQFSATENGLPLLKTRRGLLSPVEISAEILKKLTALAEQRLGGELTGAVITVPAYFDDA
FT                   QRQSTKDAAKLAGLKVLRLLNEPTAAAIAYGLDSGQEGVIAVYDLGGGTFDVSILRLSK
FT                   GVFEVLATGGDTALGGDDFDHLLAEWIVKKSTVAPQNDREKRQLIEVANQVKVALTTND
FT                   KIRISYAEQNLEITRDEFNSLISGLVKRSLLACRRTLKDANLTPSDILEVVMVGGSTRI
FT                   PYVREQVGEFFQCTPLTSIDPDKVVALGAAIQADILVGNKPDSEMLLLDVIPLSLGIET
FT                   MGGLVEKIIPRNTTIPVARAQEFTTFKDGQTAMSVHVLQGEREMVTDCRSLARFTLRGI
FT                   PAMVAGAARIRVTYQVDADGLLSVTAVEKSTGVQASTQVKPSYGLTDDEIANMLKSSME
FT                   HAKEDIQTRLLTEQRVDATRVIESVYSALQQDEDLLDDNELSAVKNALVSLQKLIQEED
FT                   SLAIKQGIKMLDQATQEFASRRMDKSIRRALSGQHIEHIK"
FT   gene            285519..285860
FT                   /gene="fdx"
FT                   /locus_tag="HS_0286"
FT   CDS_pept        285519..285860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdx"
FT                   /locus_tag="HS_0286"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24564"
FT                   /db_xref="GOA:Q0I1K7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR011536"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1K7"
FT                   /protein_id="ABI24564.1"
FT                   /translation="MPKIVFLPHQDFCPEGMVVDAAPGENLLDVAHNAGVEIHHACDGS
FT                   CACTTCHVVIREGFDSLNETTEQEEDMLDKAWGLEMDSRLSCQCVVGEEDLVVEIPRYN
FT                   LNHANEAAH"
FT   gene            285995..288268
FT                   /gene="gshA"
FT                   /locus_tag="HS_0287"
FT   CDS_pept        285995..288268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /locus_tag="HS_0287"
FT                   /product="glutamate-cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24565"
FT                   /db_xref="GOA:Q0I1K6"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR006335"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR040657"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1K6"
FT                   /protein_id="ABI24565.1"
FT                   /translation="MKIQHLIKQHQLGLLFQQGSFGLEKESQRVYQDGSVVTTEHPKCF
FT                   GNRSYHPYIQTDFAESQLELITPPNKNLEDSLRWLSAIHEVVLRSLPEDEFIFPLSMPA
FT                   GLPSDELIKVAQLDNPEDVAYREHLVQSYGKNKQMVSGIHYNFQLDPALIQTLFNLQQE
FT                   QKSAVDFQNNLYLKMAKNFLRYQWVLLYLLSATPTVESNYFKDSSPLGKGEYVRSLRSS
FT                   KYGYVNDPEVIVSFDSLEQYAESLEHWVKSGKLIAEKEFYSNVRLRGAKKARDLIQNGI
FT                   KYLEFRLFDLNPFEQYGMSLADARFIHHFVLLMIWLDEMPDQQGVELGRSRLAEVALEN
FT                   PLAQTAYREEGEWLLNQLISMLQSIGADQSAVSFVREKLAQFADPGLTLCGRLVQEIEQ
FT                   KGGYQKLGAELAKQYKENAFERFYALTAFDNMELSTQALMFDLIQQGISFEILDERDQF
FT                   LRLQFGEHVEYVKNGNMTSRDSYISPLIMENKVVTKKVLENAGFNVPQSQEFTSVKQAI
FT                   AGYSLFEKRAVVIKPKSTNYGLGITIFQQGVNNREDFAKAVEIAFREDKEIMVEDYLVG
FT                   TEYRFFVLGEETLAVLLRVPANVVGDGIHTVAELVAQKNTHPLRGDGSRTPLKKIALGD
FT                   IEQLQLKEQGLTVESIPAKDQIVQLRANSNISTGGDSIDITDEMHLSYKQLAVGIAKAM
FT                   GAAVCGVDLIISDLKEPAQPDLSSWGVIEANFNPMMMMHIFPYAGQSRRLTRNVINMLF
FT                   PEVK"
FT   gene            complement(288437..289153)
FT                   /gene="deoD"
FT                   /locus_tag="HS_0288"
FT   CDS_pept        complement(288437..289153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoD"
FT                   /locus_tag="HS_0288"
FT                   /product="purine-nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24566"
FT                   /db_xref="GOA:Q0I1K5"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1K5"
FT                   /protein_id="ABI24566.1"
FT                   /translation="MTPHINAPAGAFADVVLMPGDPLRAKYIAETFLENAQEVTNIRNM
FT                   LGYTGTYKGRKISVMGHGMGIPSCSIYAKELITEYGVKKIIRVGSCGAVNMDVKIRDVI
FT                   IGLGACTDSKVNRIRFKDNDFAAIADFGMAQAAVQAAKNKGIDVKVGNLFSADLFYTPD
FT                   PEMFDVMEKYGILGVEMEAAGIYGVAAEFKAKALTICTVSDHIRTHEQTSAEERQLTFN
FT                   EMIEIALESVLLGDSL"
FT   gene            complement(289282..290541)
FT                   /locus_tag="HS_0289"
FT   CDS_pept        complement(289282..290541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0289"
FT                   /product="transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24567"
FT                   /db_xref="GOA:Q0I1K4"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="InterPro:IPR018270"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1K4"
FT                   /protein_id="ABI24567.1"
FT                   /translation="MSSLISIIGIFALLLIAFLLSNNRKAINYRTVLGALLIQFLFGAF
FT                   ILYVPVGRQALQSVAGAVQSVINYGNEGIRFLFNGLAPQADGSMGSAGFVFVINVLPNI
FT                   VFFSALISLLYYIGVMQWLIKIIGGALQKALGTSKSESMSAAANIFVGQTEAPLVIKPY
FT                   ISKMTESELFAVMCGGLASIAGSVMAGYAGMGVPLTYLIAASFMAAPAGLLFAKILIPQ
FT                   TEKFNDNFEQIQQEKPTNILDAAAGGASSGMQLALNVGAMLIAFVALIALLNGILGTIG
FT                   NWIGQEGLSLGMIFGWVFKPLAFIIGVPWEEAEIAGRMIGTKLAINEFVGYLDFVPYLA
FT                   ADAAVQLSDKTKAIITFALCGFANFSSIAILIGGLGAMAPNRRGDIARLGIKAVIAGSL
FT                   ANLMSATIAGLFIGLSGAAL"
FT   gene            290717..291352
FT                   /locus_tag="HS_0290"
FT   CDS_pept        290717..291352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24568"
FT                   /db_xref="GOA:Q0I1K3"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1K3"
FT                   /protein_id="ABI24568.1"
FT                   /translation="MKKFNELPQTPWAAKSLWEIETKSLLVLCFSLSLLGIGDGLLVLS
FT                   NLGSAPWTVLSQGIALQAQFSVGWASFIVSILVMLMWIPLRLKVGFGTILNVVLIALFL
FT                   GLSTFYISPPSSLLARFCYLIMGIIFFGIGTAFYLTCHQGAGPRDGLMVGLCYRFKLRI
FT                   GIVRTLMEVSVCFLGFLLGGTVGIGTLLFATSIGWIIQLGVYFIMKIK"
FT   gene            291438..292208
FT                   /gene="lgtF"
FT                   /locus_tag="HS_0291"
FT   CDS_pept        291438..292208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgtF"
FT                   /locus_tag="HS_0291"
FT                   /product="UDP-glucose--lipooligosaccharide beta 1-4
FT                   glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24569"
FT                   /db_xref="GOA:Q0I1K2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1K2"
FT                   /protein_id="ABI24569.1"
FT                   /translation="MSTIGVAMIVKNEQQDLAKCLDTVKDWVDEIVILDSGSTDATQSI
FT                   ALQYGVKFYVNEDWKGFGKQRQLAQQYITSDYVLWLDADERVTDELRQSILSAVEKNEE
FT                   NVVYQILRISEVFGRLIKHSGWYPDYVTRLYKANIAQYNDALVHEKVVYEGSISVKKLS
FT                   GHLLHYTYKDVYHYLVKSAHYAKAWAVQKDDQGKKVYLFQSVTHAITSFVKMYILKAGF
FT                   LDGRQGFLLASLSAFSVFSKYADLWVRQVNNSEK"
FT   gene            292198..293244
FT                   /locus_tag="HS_0292"
FT   CDS_pept        292198..293244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0292"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24570"
FT                   /db_xref="GOA:Q0I1K1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1K1"
FT                   /protein_id="ABI24570.1"
FT                   /translation="MRNKMSEKQTTILIINMASDFGGGEIQTEELMLNLTNYNICFFGK
FT                   SSGKFIPRLKEKAPHIKIVNLWEMLKLVFCCSSLIIHAQDGRGAHIAGFLKKISGRPVV
FT                   ITRHVSFPFKRKFSLSSYKNADMLVGVSQQVTENLKLLNSNCRTIYGCIKPLLENAEFE
FT                   QRYFVKKHILAIAHIGNLQAVKNFQLTLSLAKNFSQIQFFIVGSGELEQELKQQAINLP
FT                   NITFIPFTPYIGSVFKKVDLQIVPSHSEGLGAVILEGYQYRVSVIAHQTGGISEIVQNE
FT                   KTGFLVENNDPMIYHKILTTLLDNPQKLCELKQNVERYIFEHDFSARRMALEYEQVYSA
FT                   ILANRTQK"
FT   gene            293372..293620
FT                   /gene="rpsP"
FT                   /locus_tag="HS_0293"
FT   CDS_pept        293372..293620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="HS_0293"
FT                   /product="SSU ribosomal protein S16P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24571"
FT                   /db_xref="GOA:Q0I1K0"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1K0"
FT                   /protein_id="ABI24571.1"
FT                   /translation="MVTIRLSRGGSKKRPFYQIVVADSRSPRDGRFIERVGFFNPLASG
FT                   NVERVRINLDRVNHWIGNGASLSDRVASLVKEAQKAA"
FT   gene            293647..294174
FT                   /gene="rimM"
FT                   /locus_tag="HS_0294"
FT   CDS_pept        293647..294174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="HS_0294"
FT                   /product="16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24572"
FT                   /db_xref="GOA:Q0I1J9"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1J9"
FT                   /protein_id="ABI24572.1"
FT                   /translation="MEQQRIEVVGKLGSTYGIRGWLRLYSSTEQAESIFDYQPWFLKIK
FT                   GQWQPIELESWKFHNHELIVKLKGINEREVAQTLANVEIGVNLSVFPLLDEGDFYWHDL
FT                   IGCQVVNLQGYAMGVVSEMMETGANDVLVVRASTKDAFGKKERLIPFLYEQVVKRVDLS
FT                   SKTIEVDWDAGF"
FT   gene            294228..294965
FT                   /gene="trmD"
FT                   /locus_tag="HS_0295"
FT   CDS_pept        294228..294965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="HS_0295"
FT                   /product="tRNA (Guanine37-N(1)-) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24573"
FT                   /db_xref="GOA:Q0I1J8"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1J8"
FT                   /protein_id="ABI24573.1"
FT                   /translation="MWIGIISLFPEMFKAITEYGVTGRAVRQNLLEIQYWNPRDFTFDK
FT                   HKTVDDRPYGGGPGMLMMVQPLRDAIHCAKSVAGDGVKVIYLSPQGRKLDQNGVQELAR
FT                   NQKMIFVCGRYEGIDERLIETEIDEEWSIGDYVLTGGELPAMTLIDAVARFVPCVLGKQ
FT                   ASAQEDSFAEGLLDCPHYTRPEQLNGLTVPPVLMSGNHEEIRKWRLKQSLQRTWLRRPE
FT                   LLESLALTDEQSKLLSQIKQENS"
FT   gene            295001..295351
FT                   /gene="rplS"
FT                   /locus_tag="HS_0296"
FT   CDS_pept        295001..295351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="HS_0296"
FT                   /product="LSU ribosomal protein L19P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24574"
FT                   /db_xref="GOA:Q0I1J7"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1J7"
FT                   /protein_id="ABI24574.1"
FT                   /translation="MSNIIKQIEQEQLKQNVPSFRPGDTLEVKVWVVEGSKRRLQAFEG
FT                   VVIAIRHRGLHSAFTLRKISNGVGVERVFQTHSPIIDSITVKRKGAVRKAKLYYLRERS
FT                   GKSARIKERLGN"
FT   gene            complement(295486..296304)
FT                   /locus_tag="HS_0297"
FT   CDS_pept        complement(295486..296304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24575"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1J6"
FT                   /protein_id="ABI24575.1"
FT                   /translation="MKNTNYYLKMEEHFLYVPYYNRTRRIRVLLPKDYYTDTWDSYAVL
FT                   YMHDGQNIFYSKESYSGYSWKIIPTIKHHKEFPKIIIVGIDNSGVDRLDEYGPWRTDVG
FT                   SSPEIKKCGGKGMEYGKWVVEIVKPFIDQHYRTKPQKEHTLLAGSSMGGIITAYMGSAY
FT                   PQIFGHLGVFSLASWFSEKDFLHFIHHNPIDKNSKVFIQVGTKEGDDVDSLFISNMNQA
FT                   YIDCTLHYYQALLRTGHPLDNIRLRMMANEIHHEKHWADHFVEFLHFSLL"
FT   gene            complement(296341..297342)
FT                   /gene="gntR"
FT                   /locus_tag="HS_0298"
FT   CDS_pept        complement(296341..297342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntR"
FT                   /locus_tag="HS_0298"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24576"
FT                   /db_xref="GOA:Q0I1J5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1J5"
FT                   /protein_id="ABI24576.1"
FT                   /translation="MPDKRKRPTLQDIASHLGITKMTISRYLRDPRLVAPKTGVRIAEA
FT                   IEHFGYIPNRAPEILSNAKSKAIGVLVPSLTNHVFADVIKGIENITDQAGYQTMLAHYG
FT                   YCQEKEEKRIESLLSYNIDGLILSETEHSARTLKMLDVANIPVVEIMDTSEFGLQQVVG
FT                   FNNIAAAQSMVETMIKRGYKNIVYFSARMDKRTRLKMQGYEQAMKKHQLTPHSLLTEEP
FT                   SSFTLGAEQLKLALKKHPQIDGIFCTNDDLAIGALFECQRQGIDVPKEIGIAGFHGLNV
FT                   GLSLTTQIATVRTPRLNIGEVAAKELLNRIEGIVPENYMINLGYNIHLGESI"
FT   gene            complement(297351..298445)
FT                   /locus_tag="HS_0299"
FT   CDS_pept        complement(297351..298445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0299"
FT                   /product="tRNA/rRNA methyltransferase"
FT                   /EC_number="2.1.1.34"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24577"
FT                   /db_xref="GOA:Q0I1J4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR016479"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1J4"
FT                   /protein_id="ABI24577.1"
FT                   /translation="MLTLSFSNLKLISNMKTKKPIFQQANNEKRFAERFVSNKRYEKST
FT                   SKSPHVDNNSKRALSNRHSRPQNTQNTASHTHIINTTMEKPNGTGQVQVVLKRSSLVAK
FT                   TEKKTGPLSPRAPEKIKKNRAEEMKVYGENACLSLFAQRPESIVRVWTTVEMAHKVGDL
FT                   FSYLASNKKVYHVVDNSELALVSGTEHHGGICMLVKKRRPFTLHGYLDIPHQKNCLLVL
FT                   NGVRNAHNIGGIIRTCVCYGISAVVIDDVELLHSAVAMRVAEGGMEYIHPLEIDRTETA
FT                   LVKLRQAGYQIVHLSSNKHAKTIKQLQLNDKVAFVLSEADTESLADKADELINLSLVNP
FT                   LKHGLNVSVATGILLAKWTEIKLC"
FT   gene            298569..299936
FT                   /gene="pssA"
FT                   /locus_tag="HS_0300"
FT   CDS_pept        298569..299936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="HS_0300"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24578"
FT                   /db_xref="GOA:Q0I1J3"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR016270"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1J3"
FT                   /protein_id="ABI24578.1"
FT                   /translation="MLINKTKRAKQNLERLPCIPLQAEQVEFIYHSSDFKQQIIQCIRQ
FT                   AKSRIYFTALYWQNDEAGQQILDEIYRAKQANPELEVKILVDWHRAQRNLLGAEKSATN
FT                   ADWYCDERSKYQLADDPNIFFGVPINTREVFGVLHIKGFVFDDTVLYSGASINNVYLHQ
FT                   QTKYRYDRYHKIENKRLADILVSFVKNYLFDPNVVYPLDSGDRPKTKEIRQYIRNFRKY
FT                   LAGEGQYYVESSVTLNDSLTICPLFGLGANHNLLNQTIEDLFQVVEDKLTICTPYFNFP
FT                   RLLQQKVRRLLAKGKQIEIIVGDKTASDFYIPPSEPFKMAGALPYLYEKNLRHFSKKFT
FT                   KQIEQGQLVVRIWKDGENSYHLKGIWVDDCYMLLTGNNLNPRAWRLDAENGLFIHDPKQ
FT                   QLQTQIQQELTYIRRNTTILKHYTELSDLTQYPKPVQKILKKFARIKADKLVKMIL"
FT   gene            complement(299966..300676)
FT                   /gene="dnaQ"
FT                   /locus_tag="HS_0301"
FT   CDS_pept        complement(299966..300676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="HS_0301"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24579"
FT                   /db_xref="GOA:Q0I1J2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1J2"
FT                   /protein_id="ABI24579.1"
FT                   /translation="MIKNFLNKFHPLNKLEKQRKIFINQDNLPVQWKRLFEKPYPKSST
FT                   DLTALSYLVIDFETTGLNSMMDNILSVATVPIDNLTLDISKAWHQFVAEQQEIKEDTVI
FT                   INHILPQMLNGAETLDDTMNKLFELMQGRILIAHGSTIEKRFILHYLNVRYNLSQFPLF
FT                   WLDTLKIERSLCQDNENNYQLSHIRNKYNLPEYIGHNALIDAISAGELFLAQLEKVFGK
FT                   SSKEIGEIYRRSIG"
FT   gene            complement(300673..302619)
FT                   /locus_tag="HS_0302"
FT   CDS_pept        complement(300673..302619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible signal-transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24580"
FT                   /db_xref="GOA:Q0I1J1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1J1"
FT                   /protein_id="ABI24580.1"
FT                   /translation="MQLCRVNFCYSCSSLSIKQRSHMDSSLIPNIELFIAQVPPFTHLP
FT                   HDLIRLAAQNIEIRYIPKGELITNDEIDSLNNNENLYIVRMGSVEQVNKSGQLRARLES
FT                   GDCFGFSIFNHHEQDKYQAYALENTLIYQIPFQRLNELLKKFPEYASYFSSDAGKRLNS
FT                   LAKNNFLKNQNDIFMKKVIDIANPKIALVDTNTTLQQAAIRMCEQRRSSALVMQQNKLI
FT                   GIIHDRDMTKKVVAQGLDVNTLVTEIMNINPPVIRGDELVLQAISMMMQHNIRSLPVIV
FT                   DDKVQGILTATDLVKQNSMQSVFIINRIFQANTLPLLVEIAKQQRDLFRALLERGVAYN
FT                   NIMHVMTLIADAFARKLLMMAEHELGTPPCRYAWVVAGSQARYEMHPLSDQDNAIILER
FT                   KLTALEQEYFVQLTKFVNNGLHECGYPYCTGNYMAINARWCVSLQEWKENFRSWIIAPE
FT                   LEGLLNASVFMDMRGIYGDLNLADQLQQYFVDLVAHNKRFLAFLVANSIRVKPPLSIFR
FT                   NFVLIKEGEHKNKLNLKKRAISLLVDLARIYALAAGLAQTMSTEQRFRHCYKQGILNKE
FT                   TLNNALEVYQFVCNMRFKYQSDALQQQQELTNHIDPSELSALERNHLKDAFRLIAQFQE
FT                   AAEIRFSQRGIMR"
FT   gene            complement(302655..304565)
FT                   /gene="iolC"
FT                   /locus_tag="HS_0303"
FT   CDS_pept        complement(302655..304565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolC"
FT                   /locus_tag="HS_0303"
FT                   /product="5-dehydro-2-deoxygluconokinase"
FT                   /EC_number="2.7.1.92"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24581"
FT                   /db_xref="GOA:Q0I1J0"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018659"
FT                   /db_xref="InterPro:IPR023314"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030830"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1J0"
FT                   /protein_id="ABI24581.1"
FT                   /translation="MKKEKTLDLICLGRVAVDLYAQQIGSRLEDVSSFAKYLGGSSGNV
FT                   AYGTAVQGVKSSMLARVGDEHMGRFLREELQRLGVDTSHLITDKERLTALVILGIKDQD
FT                   TFPLIFYRDNCADMAITADDFDEEYIASAKALAITGTHLSHPKTRHAVLTALEYAGRNG
FT                   TKRLLDIDYRPVLWGLTSLGDGETRFIDSEAVTQSLQEVLHHFDVLVGTEEEFHIAGGS
FT                   TDTLTALKNVRKVSNATLVCKRGALGCSVFEGDIPNHIDGGINVYGVRVEVLNVLGAGD
FT                   AFMSGLLRGYINGESWEQCCRYANACGALVVSRHGCAPAMPTKEELDNYLSRAESVPRP
FT                   DLDEQLNHLHRVTTRKQQWHDLCIFAFDHRKQLVDMAEKCGADLKRIPTLKTLLLKAAE
FT                   QTAQKEGIYNGNAGVLADTTFGQEALNEITGKKWWIGRPIEMPSSRPLRLEHGDLGSQL
FT                   ISWPAEHVVKCLAFYHPADKAELKADQDATLKEVYRACCRTGHELLLEIILPADMEQKE
FT                   SYYTDMIAHFYSLGIKPDWWKLPGVSAKTWADISQVIEKNDKHCRGILILGLDAPEAVF
FT                   ENVFKASANAPLVKGFAVGRTIFGQPSADWLAGKIDDEQLIKETSERYRRLIKLWKNRK
FT                   N"
FT   gene            304808..305650
FT                   /locus_tag="HS_0304"
FT   CDS_pept        304808..305650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0304"
FT                   /product="possible transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24582"
FT                   /db_xref="GOA:Q0I1I9"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1I9"
FT                   /protein_id="ABI24582.1"
FT                   /translation="MQEHSQLVTLQNEIRSRYSTLSKRLKQVAQYVLDNHNSVIFDTVA
FT                   TISERAGVPPSTLIRFANAFGFSGFNEMKQIFRENLIEETANYTERLQVFRQLEPEKSE
FT                   QHNLQDILNIFAQANNQALKQLSSQTTTKQLKSAVEILKNAQNIFIIGLKRSFSIACYL
FT                   DYVLHHLDCRSFLINGLGGMFDEQLMQVKNGDVIVAVSFSPYAKETLEIVSATSQKGVK
FT                   HIAITDSQISPLIASSDVAFVVKEAQVSGFRSQCATMTLVQTLAILLGLEKEKETQNS"
FT   gene            complement(305687..306451)
FT                   /locus_tag="HS_0305"
FT   CDS_pept        complement(305687..306451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24583"
FT                   /db_xref="GOA:Q0I1I8"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1I8"
FT                   /protein_id="ABI24583.1"
FT                   /translation="MVNQKIQLICETESAVQFTALCQQKGLIHDPDSYLALVQTKVEGQ
FT                   VRLELRKLDEPKLGAVYVDFVTGTMAHRRKYGGGRGEAVAKAVGIKGNYLPTVIDATAG
FT                   LGRDAFVLAALGCKVRLVERHPIVHLLLQDGLKRAYADVEIGTMMQANMQLLDIAHIQE
FT                   LNSSEEGADVVYLDPMYPHKQKSALVKKEMRIFQHLIGADLDADMLLEPALLLAQKRAV
FT                   VKRPDYADFLAKKTPHFSHQTKNHRFDIYLKT"
FT   gene            complement(306427..307626)
FT                   /gene="trmA"
FT                   /locus_tag="HS_0306"
FT   CDS_pept        complement(306427..307626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmA"
FT                   /locus_tag="HS_0306"
FT                   /product="tRNA (uracil-5-)-methyltransferase"
FT                   /EC_number="2.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24584"
FT                   /db_xref="GOA:Q0I1I7"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1I7"
FT                   /protein_id="ABI24584.1"
FT                   /translation="MLTIRMISLPNNLRLSKRVRNSHLFIFSSILKIMQRLPIEQYSAL
FT                   LAEKQQKLTELLAPFNSPPLDVFASETSHFRMRAEFRIWHEQDDFYHIMFDQKTKQRFR
FT                   IDQFPIASQLINQMMLALLPLLKQHNILTHRLFQIDYLSTLSNKIIVSLLYHKTLNEEW
FT                   LQAATQLKQQLIKQGFDVQIIGRANKQKICLQQDFVDEILPVKNQQYIYRQVENSFTQP
FT                   NATVNCKMLEWAIDCTKNSQGDLLELYCGNGNFSIALAQNFRKVLATEIAKPSVSAAQF
FT                   NIAANKIDNLHIIRMSAEDFTQAMNGVRAFNRLKGINLQDYQCNTIFVDPPRAGLDMAT
FT                   VKLVQNYERILYISCNPYTLCENLQELTKTHRIEKAALFDQFPYTEHMESGVWLIKKSN
FT                   "
FT   gene            complement(307592..307921)
FT                   /locus_tag="HS_0307"
FT   CDS_pept        complement(307592..307921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0307"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24585"
FT                   /db_xref="InterPro:IPR007335"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1I6"
FT                   /protein_id="ABI24585.1"
FT                   /translation="MAESFSVTRRFFDDKNYPRGFARHGDYTIRESQTLEQYGQAFKAL
FT                   DLGMRMPVTEEEKAFVAFCRGERSAETYFEKTWNKYRTRISASKRVYTLSGVVSADNPD
FT                   DFSAE"
FT   gene            complement(307975..308583)
FT                   /gene="dsbA"
FT                   /locus_tag="HS_0308"
FT   CDS_pept        complement(307975..308583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="HS_0308"
FT                   /product="protein disulfide-isomerase (thiol:disulfide
FT                   interchange protein)"
FT                   /EC_number="5.3.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24586"
FT                   /db_xref="GOA:Q0I1I5"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1I5"
FT                   /protein_id="ABI24586.1"
FT                   /translation="MKKFLWALASFFFLNSTQALALQEGKQYIELEQPRSVQPEVIEFF
FT                   SFGCIHCFNFEKTYQIPQQIKADLPKDVTFKQYHVDWMGEDIVRAWSLAILLGIEEKVK
FT                   MPLFELIIEKRKAPTLDNIREVFLANGITAAQFDGGINSFAVTAQTNKQIALAKKLGVR
FT                   ATPEFYVNSKYKVNAEGLSRTTDGFIKDYVETVKGLLQK"
FT   gene            complement(308593..308859)
FT                   /locus_tag="HS_0309"
FT   CDS_pept        complement(308593..308859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0309"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24587"
FT                   /db_xref="InterPro:IPR009383"
FT                   /db_xref="InterPro:IPR038134"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1I4"
FT                   /protein_id="ABI24587.1"
FT                   /translation="MKCHRLNEVLELLQPYWSNNPDLHLIQVLQKIAEETGFDKPIAEL
FT                   TDEVIIYHLKMYGTDKNEPIPGIKKDYEDDFKTALLKARGIID"
FT   gene            308926..309513
FT                   /gene="mobA"
FT                   /locus_tag="HS_0310"
FT   CDS_pept        308926..309513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobA"
FT                   /locus_tag="HS_0310"
FT                   /product="molybdenum cofactor guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24588"
FT                   /db_xref="GOA:Q0I1I3"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1I3"
FT                   /protein_id="ABI24588.1"
FT                   /translation="MATTISAVILAGGQAKRMAGLDKGLQLLQGKPLYQHCLQRLTHQV
FT                   SSISINANRHQAIYQQSGVEVFGDELEDFQGPLSGILTALERANTDFVLFVPCDSPFLP
FT                   LNLCEKLQSAVENSKSLLAYANDGEREHPAFSLLSTQLKLPLRAYLQSGHRQMLQFFRQ
FT                   HKGISVDFRLQKQAFVNMNTLQDIEKYQNIYA"
FT   gene            309632..311638
FT                   /locus_tag="HS_0311"
FT   CDS_pept        309632..311638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0311"
FT                   /product="integral membrane protein"
FT                   /note="possible oligopeptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24589"
FT                   /db_xref="GOA:Q0I1I2"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1I2"
FT                   /protein_id="ABI24589.1"
FT                   /translation="MLSKQQSLKELTFRGMLLGALITVVFTASNVYLGLKVGLTFASSV
FT                   PAAVISMAVLKFFKGSNILENNMVQTQASSAGTLSSVIFVIPAMLMLGYWQGFPFWQTL
FT                   LICISGGMLGVIFTVPLRNVMVVKSDLPYPEGVAAAEVLKAGNDEIGGRGVKELTIGGL
FT                   IAAVAGFLTNGLRVIADSASLWFKGGNAIFQVPMGFSLALLGAGYLVGMIGGLAILLGI
FT                   FVAWGVAVPYFTSVAPMPADADMIGYAFSIWKNKVRFIGVGTIGIAAIWTLLVLMKPMI
FT                   QGMIESFRALKDPNAKNTDRTSQDLSPTTLIFTTLVSVVLIVLALYSFINPVGIEAGTA
FT                   IILILVCTLLAVVIGFLVAAACGYMAGLVGSSSSPISGIGIISVVTTSLVLMLVGSATG
FT                   LLDTAEGQKFLTALTLFTGSIVVCIAAISNDNLQDLKTGQLVEATPWRQQFALIIGVIV
FT                   GALVIAPVLEILYHAYGFAGAMPRETMDPSQALFAPQATLMMTIANGIFSHNLEWNYIF
FT                   FGIGFGAVLIFIDSVLKKASNKRLALPALAVGMGIYLPPSVNAPIVVGALLAWLINRHL
FT                   ENFAKRTGKDLADVKKKAERFGTLFAAGLIVGESLIGILLAFIVAGSVTSGGSDAPLAL
FT                   HLENWESLAQVLGLMMFATGITIFALRVLKAKQ"
FT   gene            complement(311761..312432)
FT                   /locus_tag="HS_0312"
FT   CDS_pept        complement(311761..312432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0312"
FT                   /product="conserved hypothetical protein, with TPR repeat
FT                   (tetratrico peptide repeat)"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24590"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1I1"
FT                   /protein_id="ABI24590.1"
FT                   /translation="MTTKEHKMNLKKSLLIALLSFGIAQSALAETDSEKFDRATQLYKQ
FT                   QNYSAAFPLLKQLGEKGNAKAQAVLGTMYMFGQGITQNSQQAVYWWTKAAEQGAAEVQA
FT                   MLGFMYENGRGVTQNHQQAVYWFIKAAGQGLADAQFNLGMMYELGRGVTQNSQQAVYWF
FT                   IKAAEQGLADAQFNLGMMYELGRGVLTHVSTAKAFYGQACDNGNAQGCKDFARLDKQGV
FT                   R"
FT   gene            complement(312490..313248)
FT                   /locus_tag="HS_0313"
FT   CDS_pept        complement(312490..313248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0313"
FT                   /product="conserved hypothetical protein, with TPR repeat
FT                   (tetratrico peptide repeat)"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24591"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1I0"
FT                   /protein_id="ABI24591.1"
FT                   /translation="MKLKKFLLIALLSFGIAQSALAETNSEKFDRAYQFIEQQNYSAAF
FT                   PLFKQLAEQGLANAQYNLGVMYKKGRGVAQSDTQAVYWWKKAAEQGLADAQYNLGLMYK
FT                   KGRGVAQSDTQAIYWYTKAAEQGIAEAQSKLGGMYAKGRGVTQNYQQAVYWFTKAAEQG
FT                   DAKVQLLLGLMYENGRSVTQNYQQAVYWYTKAAEQGIAEAQLYLGVMYEFGRGVQKNVS
FT                   TAKEFYGKACDNGNAQGCKDFARLDRKGGR"
FT   gene            complement(313269..313532)
FT                   /locus_tag="HS_0314"
FT   CDS_pept        complement(313269..313532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0314"
FT                   /product="hemophilus-specific protein, uncharacterized"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24592"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1H9"
FT                   /protein_id="ABI24592.1"
FT                   /translation="MSNRIEITVNIYKNYFGDTSDSPYVYDNIKAINPNEQKEVDEIVN
FT                   KMIANGSSQLFDANLNILNPITPLETGRRCFLNPQTLCIEFK"
FT   gene            complement(313770..314714)
FT                   /gene="lipA"
FT                   /locus_tag="HS_0315"
FT   CDS_pept        complement(313770..314714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="HS_0315"
FT                   /product="lipoate biosynthesis protein A (lipoate
FT                   synthase)"
FT                   /EC_number="2.8.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24593"
FT                   /db_xref="GOA:Q0I1H8"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1H8"
FT                   /protein_id="ABI24593.1"
FT                   /translation="MERGVKYRDAAKTSIIPVKNIDPNQELLKKPEWMKIKLPANSAKI
FT                   NSIKNGMRRHGLHSVCEEASCPNLHECFNHGTATFMILGAICTRRCPFCDVAHGKPLPP
FT                   DPDEPKKLAETIQDMKLRYVVITSVDRDDLPDRGAGHFAECVKEIRKLNPGIKIEILVP
FT                   DFRGRIEQALEKLKDNPPDVFNHNLENVPRLYREIRPGADYNWSLKLLKEFKTIFPHIP
FT                   TKSGIMVGLGETNEEILQVMQDLRDNGVTMLTLGQYLQPSRHHLPVARYVPPEEFDDFR
FT                   DKAEKMGFEHAACGPFVRSSYHADLQASGGLVK"
FT   gene            complement(314750..315406)
FT                   /gene="lipB"
FT                   /locus_tag="HS_0316"
FT   CDS_pept        complement(314750..315406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="HS_0316"
FT                   /product="lipoate biosynthesis protein B
FT                   (lipoyltransferase)"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24594"
FT                   /db_xref="GOA:Q0I1H7"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1H7"
FT                   /protein_id="ABI24594.1"
FT                   /translation="MTDTTLIIRQLGIQDYQQVWQQMREFTDTRNALTPDEIWLVQHPA
FT                   VFTQGQAGKPEHLLNPTDIPVVQSDRGGQITYHGLGQQIMYVLIDIKRHKANGSELNVR
FT                   QLVTALEQSVVSTLADYGIKSYPKADAPGVYVNEQKICSLGLRIRKGCSFHGLALNINM
FT                   DLSPFRQINPCGYIGLEMCQMADFIPTEQAQCDKVAPKLVTHFTQLLGYNDVTTY"
FT   gene            complement(315415..315711)
FT                   /locus_tag="HS_0317"
FT   CDS_pept        complement(315415..315711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0317"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24595"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1H6"
FT                   /protein_id="ABI24595.1"
FT                   /translation="MTDKTVKLNDIPQKQLKDLLEFPCSFTFKVVGKNRADLIDDVVMV
FT                   TQKYAKGDYNPRQNISSKGTYNSISVDIIAENIEQVEILYTELAKIDGVRMVL"
FT   gene            complement(315766..316932)
FT                   /gene="dacA"
FT                   /locus_tag="HS_0318"
FT   CDS_pept        complement(315766..316932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="HS_0318"
FT                   /product="penicillin-binding protein 6, Serine peptidase,
FT                   MEROPS family S11"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24596"
FT                   /db_xref="GOA:Q0I1H5"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1H5"
FT                   /protein_id="ABI24596.1"
FT                   /translation="MKKTKIALMSGLISLPALSQDIQYGIASPELSAQSYILMDYHSGA
FT                   VLAAFNPDQRQHPASLTKMMTSYVVGDAIKQGKISLTDTVTIDESAWGKNFPGSSKMFL
FT                   NLNQQVSVADLNRGIVIVSGNDACVAIAEHIAGSERNFIELMNKYVAKFGLKNTNFMTV
FT                   HGLDDDNQYSSARDMAIIGRHIIHDLPEEYKIYAEKEFTFNKIKQHNRNGLLWDKSIKV
FT                   DGMKTGHTNKAGYNLVASAVNNNNMRLISVVMGVATHKGREIESKKLLQWGFANFETFK
FT                   SLQANQSIVEEKVYYGNTSKVQLGVLEDAYITLPKGRQNDVKTRYELNQKMLTAPLAKG
FT                   QIVGKIIYQLDGRDIASANLKIMSEVQEGGFFSKLWDWLVLTVKGLFN"
FT   gene            complement(317042..317602)
FT                   /gene="rlpA"
FT                   /locus_tag="HS_0319"
FT   CDS_pept        complement(317042..317602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlpA"
FT                   /locus_tag="HS_0319"
FT                   /product="possible rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24597"
FT                   /db_xref="GOA:Q0I1H4"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1H4"
FT                   /protein_id="ABI24597.1"
FT                   /translation="MKSNKIFKLCTALFMALVSLSIQADTKKLYGIEGAKLVYQKLSKK
FT                   PYTYVVKGVRYTTLPYEKAKNYSQKGMASFYHKKFHGRKTANGEIFNNNAYTAAHKTLP
FT                   LNSYVVVTNLRNNRKVIVRINDRGPFSKARIIDLSEAAAKELGMIPAGIAKVKVESLYV
FT                   DAYGKISGPGTKTLAKTRKNIKS"
FT   gene            complement(317645..318760)
FT                   /gene="mrdB"
FT                   /locus_tag="HS_0320"
FT   CDS_pept        complement(317645..318760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdB"
FT                   /locus_tag="HS_0320"
FT                   /product="cell elongation-specific peptidoglycan
FT                   biosynthesis regulator RodA"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24598"
FT                   /db_xref="GOA:Q0I1H3"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1H3"
FT                   /protein_id="ABI24598.1"
FT                   /translation="MEKKNIWLILWRRLHIDFWLFLGLVTISSYGLLVLYSAVGGSEKM
FT                   FRNRIIQVALGFTVMFVMAQFSPRFYQRIAPYGFVIGVILLLLVDLFGTTSKGAQRWLD
FT                   LGIFRFQPSEIVKLSVPLMVATYLGKRPLPPKLSEIFIALLLIIVPTLLVAIQPDLGTS
FT                   ILVSASGIFVVFLSGINWWFILIAIVGLAAFTPIVWLYLMHDYQRTRVLTLLDPEKDPL
FT                   GAGYHIMQSKIAIGSGGIWGKGWMQGTQSQLEFLPEPHTDFIFAVLSEEYGMTGFTILM
FT                   LIYLFIVARGLIIGVNAQNSFGRILSGALTLIFFVYVFVNIGMVSGILPVVGVPLPLMS
FT                   YGGTSFVTLMAGFGLIMSIHTHKNNFFKGTK"
FT   gene            complement(318760..320673)
FT                   /gene="mrdA"
FT                   /locus_tag="HS_0321"
FT   CDS_pept        complement(318760..320673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdA"
FT                   /locus_tag="HS_0321"
FT                   /product="cell elongation-specific peptidoglycan
FT                   D,D-transpeptidase"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24599"
FT                   /db_xref="GOA:Q0I1H2"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1H2"
FT                   /protein_id="ABI24599.1"
FT                   /translation="MNLKKLLSQPLQTPIRDKKAERNLFARRALIAFLGVLGLSALLFT
FT                   NLYYLQIVNYETYQTRSNGNRIKLLPLPPTRGLIYDRYGKLLAENITFLGLYIVPEKVE
FT                   DLNRTFEELRYIVGLNDDDIENFKKERRRSSRYMPILLKGDLSEEQIARFAVNQYHYPS
FT                   LDIRPYFKRHYLYGEPLTHILGYVAKINEKDVERLKKNEKYANYAGTHDIGKLGIERYY
FT                   EDDLHGKVGFEEVEVNNRGKVIRKLREQPAIAGKSIHLTIDLELQRYIANLLGNLRAAV
FT                   VVLDPKDSGILAMVSTPSYDNNLFVGGISSADYKQLLTDPNRPLYSRVTQGAYPPASTI
FT                   KPFVAIAGLQENLITTNTTIFDPGYWILPNTTKRFRDWKKSGHGYTDLNKAIVESSDTY
FT                   FYQLAYDMGISRLSQWMKRFGFGIPTGIDIQEETAALMPSREWKQKRYKRPWVQGDTIS
FT                   VGIGQGYWTATPLQVAKATAVLVNNGKVNTPHLMKAVEGSEMQPYQDPRLYEDITEPQA
FT                   VFWETIKQSMYNVIHAPNGTGRKSFIDVSYPVAGKSGTAQVFSLKENQTYNANELDNKL
FT                   HDHAWFIGYAPYDNPKMVVVVILENAGGGSSKAGPVVRKIMDYYLNIRLPQVQLQNEKG
FT                   KS"
FT   gene            complement(320690..321157)
FT                   /locus_tag="HS_0322"
FT   CDS_pept        complement(320690..321157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0322"
FT                   /product="23S rRNA (pseudouridine-1915-N(3)-)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24600"
FT                   /db_xref="GOA:Q0I1H1"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1H1"
FT                   /protein_id="ABI24600.1"
FT                   /translation="MKIQLIAVGTKMPDWVTKGFEEYQRRFPKDMPFELIEIPAGKRGK
FT                   NADIKRILEQEGKAMLSACQKSRIITLDIPGKPWTTEQLAQQLEAWKHDGRNVALLIGG
FT                   PEGLSPECKAATEQSWSLSPLTLPHPLVRIIVAESLYRAWSLSTNHPYHRE"
FT   gene            complement(321161..321481)
FT                   /locus_tag="HS_0323"
FT   CDS_pept        complement(321161..321481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0323"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24601"
FT                   /db_xref="GOA:Q0I1H0"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1H0"
FT                   /protein_id="ABI24601.1"
FT                   /translation="MNLVDFLVSKLDDLKGTDILALDVRGKSSITDHMILCTGTSSRHV
FT                   ISLAQKLIDESKQAGIDTFGEESKYTADWIAIDFGQAIVHIMQADSREMYQLEKLWGDR
FT                   TY"
FT   gene            complement(321635..322288)
FT                   /locus_tag="HS_0324"
FT   CDS_pept        complement(321635..322288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0324"
FT                   /product="IS1016C2 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24602"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1G9"
FT                   /protein_id="ABI24602.1"
FT                   /translation="MKITHCKLKKSIQKKLLEFFVLEVTARSAANILGINPNSSALFYR
FT                   KIREVISYHLALEADDVFDGQIELDESYFGGHRKGKRGRGATGKVAVFGLLKRQGKVFT
FT                   VVVENTKTETIMPVITRKIKPDSWVYTDTYRSYDALDVSQFHHERINHSELFAVKENHI
FT                   NGIENFWSQAKRILRKYNGIDRKNFPLFLKECEFRFNFGTPKEQLKTLRKWCGI"
FT   gene            complement(322555..323397)
FT                   /gene="yfeD"
FT                   /locus_tag="HS_0325"
FT   CDS_pept        complement(322555..323397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeD"
FT                   /locus_tag="HS_0325"
FT                   /product="chelated iron ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24603"
FT                   /db_xref="GOA:Q0I1G8"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1G8"
FT                   /protein_id="ABI24603.1"
FT                   /translation="MFNTIVAWFTEPLVYPFMQQAIIIAPIIGAVCAILSCYLVLKGWS
FT                   LMGDAISHAVLPGIILAYVLAIPIAIGAFWAGIFCAVSVGYLRDNSRIKEDTVMGIVFS
FT                   GMFAFGLVLFSKVETDQHLMHILFGNILGIIKQEFWQSIGIALLAFILIALKRKDLLLY
FT                   CFDPSHTRVAGLNTKFLHYGLLVILALVIISAMQVVGVILVVAMLITPGITGYILAKRF
FT                   DYMMLIAVCTAVFSGIFGVLLSFHFNVATGPCIILLQASLFLCALGYSKYIAMRVVNI"
FT   gene            complement(323390..324280)
FT                   /gene="yfeC"
FT                   /locus_tag="HS_0326"
FT   CDS_pept        complement(323390..324280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeC"
FT                   /locus_tag="HS_0326"
FT                   /product="chelated iron ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24604"
FT                   /db_xref="GOA:Q0I1G7"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1G7"
FT                   /protein_id="ABI24604.1"
FT                   /translation="MLELLLEPFSYDFMFKAIVVSGAIGAVCAFLSAYLMLKGWSLIGD
FT                   ALSHAVVPGVAIAYALALPYAVGAFFSGLLATIAILAVKYVTKLKEDAVIGFIFTSFFA
FT                   LGLLIISINPTSVNVQSIVLGNILGIADEDMIQVAIILGISFVLLLLFWKDLMLVFFDE
FT                   IQAKAVGLSPLKFKILFFTLLSACIVTALQGVGAILVIAMVITPGATAYLLTDRFDRLL
FT                   IISILLGGTTSSLGAYLSYFADSATGGFIVSLQTFIFLLAFFFAPKYGLIPRKRSTQKA
FT                   VTSSPNLANQEKPNV"
FT   gene            complement(324285..325043)
FT                   /gene="yfeB"
FT                   /locus_tag="HS_0327"
FT   CDS_pept        complement(324285..325043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeB"
FT                   /locus_tag="HS_0327"
FT                   /product="iron ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24605"
FT                   /db_xref="GOA:Q0I1G6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1G6"
FT                   /protein_id="ABI24605.1"
FT                   /translation="MKTHISSLSVRDITVRYSNGHTALHDVSFHLEGGTICALLGINGS
FT                   GKSTLFKSIMGLVKPQGSIEICNMPANRALKQNLIAYVPQSEEVDWQFPVSVYDVVMMG
FT                   RYGYMNFFRMPKAQDKKKVLDAMERVNIAHLRDRQIGELSGGQKKRVFLARALAQESQI
FT                   ILLDEPFTGVDVGTENAIIALLKQLRQEGHLVLVSTHNLSTVPSFCDQAVMINRTLLAA
FT                   GSIESTFTQENLARVFGGVLRYQHFIQDAE"
FT   gene            complement(325053..325913)
FT                   /gene="yfeA"
FT                   /locus_tag="HS_0328"
FT   CDS_pept        complement(325053..325913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeA"
FT                   /locus_tag="HS_0328"
FT                   /product="chelated iron ABC transporter,
FT                   periplasmic-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24606"
FT                   /db_xref="GOA:Q0I1G5"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1G5"
FT                   /protein_id="ABI24606.1"
FT                   /translation="MGVILGSVFSLPSYAKFKVVTTFTVIQDIAQNVAGDAAVVESITE
FT                   PGAEIHDYEPTPQDIVKAQSADLVLWNGMNLERWFERFFTQVKDKPAVVVTKGIDPISI
FT                   YEGPYKGMPNPHAWMSTKNALVYIENIREALVKYDPKNADTYNANAKAYADKIVALDAP
FT                   LRAELEKVPASQRWLVTSEGAFSYLAHDYGFKELYLWPINAEEQGTPKQIKNVIKKVRE
FT                   HKIPVVFSESTISDKPAKQVAKETNAKYGGVLYVDSLSTKDGKVPTYIDLLNVTVSTIV
FT                   NGFKK"
FT   gene            complement(326040..326369)
FT                   /locus_tag="HS_0329"
FT   CDS_pept        complement(326040..326369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0329"
FT                   /product="sulfite reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24607"
FT                   /db_xref="GOA:Q0I1G4"
FT                   /db_xref="InterPro:IPR007453"
FT                   /db_xref="InterPro:IPR025526"
FT                   /db_xref="InterPro:IPR042072"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1G4"
FT                   /protein_id="ABI24607.1"
FT                   /translation="MLSVNQVQIETDVEGYLLDMNQWNKDVAIAIAKSENIELTEAHWE
FT                   IINFVRDFYQEYKTSPAMRMLVKALGQKLGADKGNSRYIQRLFPEGPAKQASKLAGLPK
FT                   PIKCL"
FT   gene            complement(326447..327109)
FT                   /locus_tag="HS_0330"
FT   CDS_pept        complement(326447..327109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0330"
FT                   /product="conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24608"
FT                   /db_xref="GOA:Q0I1G3"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1G3"
FT                   /protein_id="ABI24608.1"
FT                   /translation="MQSRFIVDTKEESVLATNKVLRNTYFLLALTLAFSSVVAFSAMQL
FT                   NLPPLHFGVMLVGFYGLLFLNNMLANSAWGLLSTFALTGLLGYSLGPILSYYVGSGLGD
FT                   LVVLALAGTASVFFTCSAYVLTTKKDMSFLSGMMLALFIVLVIGMIASFFFNMSGFHIV
FT                   FSSLFIVFSTMAILYETSNIIHGGETNYIRATVSLYVSLYNLFVSLLNLLGIFNRDE"
FT   gene            327339..327431
FT                   /locus_tag="HS_tSer03"
FT   tRNA            327339..327431
FT                   /locus_tag="HS_tSer03"
FT                   /product="tRNA-Ser"
FT   gene            complement(327531..329060)
FT                   /gene="comM"
FT                   /locus_tag="HS_0331"
FT   CDS_pept        complement(327531..329060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comM"
FT                   /locus_tag="HS_0331"
FT                   /product="competence-related protein"
FT                   /note="possible magnesium chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24609"
FT                   /db_xref="GOA:Q0I1G2"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1G2"
FT                   /protein_id="ABI24609.1"
FT                   /translation="MSLAVVYSRASMGVQAPLVTIEVHLSNGKPAFTLVGLPEKTVTEA
FT                   QGRVRSALLNAQFKYPAKRITVNLAPADLPKEGGRFDLPIALGILAASEQINAKKLQQF
FT                   EFVAELALTGELRGVHGVIPAILAGQKSKRQLIVAQQNANEASLVSQHETFFARNLLEV
FT                   VQFLNDDSSLPSSTTLCMQSAVDFSPQSNKDLTDIIGQQHAKRALMIAAAGQHNLLFLG
FT                   PPGTGKTMLASRLTGLLPDMTDQEAIETASVTSLVQNELNFQNWKQRPFRAPHHSASSP
FT                   ALVGGGTIPKPGEISLAHNGVLFLDELPEFERRVLDALRQPLESGEIIISRANAKIQFP
FT                   ARFQLVAAMNPSPTGHYTGIHNRTSPQQVLRYLNRLSGPFLDRFDLSIEVPLLPQGALQ
FT                   NTEDRGETTAQVKEKVLRVREIQLARAGKVNAYLTGKEIERDCKLTEQDALFLENTLTR
FT                   LGLSVRAYHRILKVARTIADLNGDSDIKQNHLAEALSYRAMDRLLRKLSDQ"
FT   gene            complement(329162..329857)
FT                   /gene="engB"
FT                   /locus_tag="HS_0332"
FT   CDS_pept        complement(329162..329857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="HS_0332"
FT                   /product="cell division checkpoint GTPase YihA"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24610"
FT                   /db_xref="GOA:Q0I1G1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1G1"
FT                   /protein_id="ABI24610.1"
FT                   /translation="MYKKMSWLLLVFHNAIFPIGNDLSENKMTNIKLNYHKTHFLMSAP
FT                   NIKVLPEDSGIEIAFAGRSNAGKSTALNALTQQKNLARTSKIPGRTQLINLFQVEPNCK
FT                   LVDLPGYGYAAVPEQMKLQWQKSLGEYLQKRECLGGLVILMDIRHPLKDLDQQMIEWAV
FT                   SADLPVLLLLTKADKLSQSARSKQVKMVREAILPFQGDVQVEAFSAQNKIGIERLSEKL
FT                   DQWFSPLFS"
FT   gene            complement(329778..331139)
FT                   /gene="glmU"
FT                   /locus_tag="HS_0333"
FT   CDS_pept        complement(329778..331139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="HS_0333"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase /
FT                   glucosamine-1-phosphate N-acetyltransferase"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.157"
FT                   /note="bifunctional; glucosamine-1-phosphate
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24611"
FT                   /db_xref="GOA:Q0I1G0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1G0"
FT                   /protein_id="ABI24611.1"
FT                   /translation="MNKLSVVILAAGKGTRMYSDLPKVLHKIAGKPMVKHVIDTAKKLS
FT                   AAQIHLIYGHGADLLKQHLADEPVNWVFQSEQLGTGHAMQQAAPFFQDDENIVMLYGDV
FT                   PLISKETLECLISQKPENGIALLTVNLDNPTGYGRVIRENGTVTAIVEQKDANPEQLKI
FT                   TEVNTGVMVSDGASFRKWLARLDNNNAQGEYYMTDVIGLANQDGLKVVAVQAKDLMEVE
FT                   GVNNRLQLANLERHFQRKQVEKLLLAGVTFADPARFDLRGELTHGKDVEIDINVIIEGT
FT                   VRLGNNVFIGAGCVLKNCTIADNVEIKPYSVIEDAIVGNNAKIGPFSRLRPGAELSENT
FT                   HVGNFVEIKKAQIGKGSKVNHLSYIGDAEVGHHCNIGAGVITCNYDGANKFKTLIGDNV
FT                   FVGSDSQLVAPLTIASGATIGAGTTVTKDVQENELVITRVPQRHISNWQRPKRK"
FT   gene            331242..332363
FT                   /locus_tag="HS_0334"
FT   CDS_pept        331242..332363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0334"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24612"
FT                   /db_xref="GOA:Q0I1F9"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1F9"
FT                   /protein_id="ABI24612.1"
FT                   /translation="MQKNNHYYIGIMSGTSLDGVDIALMDFNQRPPKLLASYCFSMPEN
FT                   LRQKLTALLSSGTIGLQQLGELDHQLGLLYANSVQRFLAQNQMTADNIQAIGCHGQTIW
FT                   HSPQGQYPFTMQIGDANLISVLTGITTIADFRRKDMAYGGQGAPLSTAFHQALFAQPDR
FT                   ITVVLNIGGISNISCLIPEQEVIGYDTGVGNALMDSWIEQHLGVPFDQDGEWAKSGSVH
FT                   QDLLKDLLDEPFFQQLPPKSTGRELFNLAWLNKKLKKHTALSAQDVQATLLEFTVQCTV
FT                   QELVKLANPNHLPCLLLVCGGGAKNRQLMARLQACLPQWHVATTTEHGLSVDYVEAAAF
FT                   AWLAYQRINHLPSNLPSVTGAKSAVSLGVIYPK"
FT   gene            332366..333277
FT                   /locus_tag="HS_0335"
FT   CDS_pept        332366..333277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0335"
FT                   /product="glucokinase regulator-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24613"
FT                   /db_xref="GOA:Q0I1F8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1F8"
FT                   /protein_id="ABI24613.1"
FT                   /translation="MNKQNLINQFAQLITEQPNPRSVNLDQMSALEIVQLMNKEDQQVP
FT                   LVIAKALPEIAVVVEKIVAAFRQGGRLVYLGAGTSGRLGVLDASECPPTFGVNHEMVKG
FT                   IIAGGEQAIRYPVEGAEDNQQAAIVDLQAIQLCSKDILVGIAASGRTPYVISGLKYAKE
FT                   IGSFTVAIASNPQSAMAKIADMSIETIVGPEILTGSSRLKSGTAQKLVLNMLTTASMVL
FT                   LGKCYQNFMVDVQASNEKLVDRATRIIMQATGCERAKAEQTLTQADNNAKLAILMILMD
FT                   LDKQSAVDLLAKNQDKLRQTLD"
FT   gene            333498..334103
FT                   /gene="kefF"
FT                   /locus_tag="HS_0336"
FT   CDS_pept        333498..334103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefF"
FT                   /locus_tag="HS_0336"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /EC_number="1.6.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24614"
FT                   /db_xref="GOA:Q0I1F7"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1F7"
FT                   /protein_id="ABI24614.1"
FT                   /translation="MSLLNIIKSFFSSKKEQAMPNILVISGHSNLQQSTANSAILGELA
FT                   NNLPNAEIRKLDELYPDFNINIEAEQAALLKADIIIWQFPVNWYHFPAIMQKWLSDVFT
FT                   YGFAYGSEQKLTGKKLYISCTTASPEEAYQHDGAQKHTIEEFSYAYQQTAALCGLEFCG
FT                   IIHSGNMLYIPGMNTEEDKENVIAKAKQHAERLVSAVK"
FT   gene            334320..335087
FT                   /locus_tag="HS_0337"
FT   CDS_pept        334320..335087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0337"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24615"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1F6"
FT                   /protein_id="ABI24615.1"
FT                   /translation="MRYKLSLVLLSMLPALSHAGGGNFNFYGKAGIDLTSRFETFQLTA
FT                   NNDGPPISAIPASSRKNTFSPSVFLEATYNVLPQTEIGLGLGYIKRKGFDHSASWFIKP
FT                   AGGDGTYSPDPSKHSAIETYKINRYSSLPIYMVLKQNIVLNQNTKLYFTGNLGYSLNKI
FT                   DDTKYNFYRDIDSPGTFKKDEELSKTRKMKAKNGLYLGLGVGLEYHSFLAEIGYYHTKS
FT                   KVTRPNFVEGQGLVDQTTSYNNDAVRFSIGFKF"
FT   gene            complement(335169..336857)
FT                   /locus_tag="HS_0338"
FT   CDS_pept        complement(335169..336857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0338"
FT                   /product="sodium/glucose cotransporter (symporter)"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24616"
FT                   /db_xref="GOA:Q0I1F5"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1F5"
FT                   /protein_id="ABI24616.1"
FT                   /translation="MLSLISFIGFTALVAVLAWWYTRKDDLSNSEGYYLAGRSLTATFI
FT                   AGSMLLTNLSTEHLVGLNGLAYREGFIVMAWEVLAAITIAMFALYFLPKYLKLGIATIP
FT                   EFLEKRFDKGTLLITSLLFLGCYVISLLPIVLYTGALALESLFDVSTVFNIDKTTAIWI
FT                   MVWGIGILGSVYAIFGGLKAVAVSDTINGIGLLVGGILVAVLGLAYVGDGNAWHGLKTI
FT                   YETNPDKFNSIGDDNSVVPFSTLFTGMIISNLFFWCTNQSIIQRALGAKSLKEGQKGVL
FT                   LCAFLKLLGPLLIILPGIIAYHIYQGKLDIPDQAYPNLVHLVLPDALVGFFAAVVVGAV
FT                   LSTFNSALNSSVTLFSRNVYKTQINPHASDMKLVSVGKWVGTGLAIMAMIVAPLVANAP
FT                   DGLFFLIQELQGIFNAPILSVVVVGLLTKRVPAIAAKFGLVFGMVAYILCKFVIKVEIH
FT                   FFHLIAILFVVNVVVMLIIGRIMPMETPYNEEYTKQVDIQPWAYAKAVSLVITFISISL
FT                   YIFMAKDVLPAVWIGYYCFGAATVLYFIYSFVQHRNQQFRLKENN"
FT   gene            337178..338944
FT                   /locus_tag="HS_0339"
FT   CDS_pept        337178..338944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0339"
FT                   /product="conserved outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24617"
FT                   /db_xref="GOA:Q0I1F4"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1F4"
FT                   /protein_id="ABI24617.1"
FT                   /translation="MNMKLLSKYFVRSILNTSIFCIYLASSFSFAEHLVDLKVVGVTGV
FT                   QKTTNVDAYINTIDEEERDGSERYQQLVRTAIDKALRAYGYYSSTVNFTLQPAKSPNKP
FT                   VLVANVDMGRPSIIQRADVTILGEAKDDEVFQDLLRRTAQKGEHVSHPVYEDYKSRLQK
FT                   QLLARGYFDAKFEVSRFEIKPSTYQGWWKMVLNSGTRYKFGQFNFKHSQIREDYLRNMM
FT                   PIKTGDKYLINDLSSLTNDYTSSNWFRSVLLEPKVDEKRKVVDINVLLYPRKKNAIDVG
FT                   IGYSSDVGTRFKLSWIKPWINNRGHSFNSNLYISAPKQTLEANYKIPLLKNPQRYYYEL
FT                   SGGFEKENTKDTQTIAASFAALRYWNRVTGWQHSFGLRVRYDSFTQANVSDRTLFIYPT
FT                   ISANRTRLRGELFPTWGDSQRITVDFGSKRWKSDVNFFRIKASTVWIRTFKENHRFLTR
FT                   GEIGWLHTKDINKIPPALRFFAGGERSVRGYGYKKISPTSSDGKPIGAPYLLTVNTEYQ
FT                   YQVLEDWWLAAFADTGLAANKFNVKELRYGAGFGVRWVSPVGAIKLDIATPIRDREKNK
FT                   NIQFYIGLGSEL"
FT   gene            338955..342479
FT                   /locus_tag="HS_0340"
FT   CDS_pept        338955..342479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24618"
FT                   /db_xref="GOA:Q0I1F3"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1F3"
FT                   /protein_id="ABI24618.1"
FT                   /translation="MTQIPNENTTTERQETRSVKPKRKVLRWILCTISAVILLLILFLV
FT                   TALTNSGQRLFIQLADHFIDNLHIAQIDGGLQDGLQLKQIAFHTQGIKADIEQANIKLD
FT                   LHCLLSGKICLKDLTLNQPKIQIDTAQLPKSETKTSQPIQQIKLPVEVDINGIEINQLD
FT                   LTIDQQQVKLAKFRTALTLNNEQGLTLLPTEINGLTIVHRHLTEKTAKKKKSEKTVRSP
FT                   VDWEKLTQRLNQPLLPNMPEIELPFDLHIQGIQGKNWLYQQIGNSNIPQSDLHQIEIST
FT                   IYLHADSIDNSIQLQTFQLESNLGQLRGEGTLRLKQEFPIELQVQATLNELKHDGKLLL
FT                   PHSNINLTLSGNLKKQTALFLQTQGTFESILQAKIELYSQKTPFDIELKVINGQYPFEK
FT                   NFTEPLKIQDMFFTAKGDLLNYQATLQGKLIGMGMPETDVDLALQGGLTQFTLQQLQVN
FT                   ALNMKANANANVSWKDKLKLKSNIDLKGHNVRLNNMRINKIDLLANISLQDIVQGQVDL
FT                   DIDGFSLNNIKLNSTKLQIKGTEQQHYLILKSKGEPASATLNLQGKFDRTLQQWQGILS
FT                   QVNIHSLIGNLTNSENILLSYDNKKTIAQVSAHCWRSSDIHLCFPQEFIVGKTGEIPFD
FT                   FKTINLALVNKLISQEIFKGHLSGQGKFAWFTESSPYLTLQLKGDNLNVAKKLDYRTFR
FT                   LAIPTLNITTELQNNNLTLNSNFNIQNRGDVNMELKLADLTNQKRLSGHLKISDMNLNI
FT                   VNQLIASSEKVDGQVNAKLSFAGDLSNPLLNGEFAVSQVRAKLKSVPFGITNGNIILSF
FT                   YGDRSILKGNIQTHESHLNVEGQANWRKIDDWQAGLHINADKFKVDIPSIAKLQVSPNI
FT                   EIHATPKLLALSGNVDIPWARIEIERLPDNIVAPSKDEVILDGPQKTKVVKLMKGEIET
FT                   TTKSGIQIHSDLKIKLGDHVRLEAYGLKTELNGLLSVKQEKGNLGLFGQINLHNGHYES
FT                   FGQDLLIRKGIISFSGLPSQPMLNIEAIRNPTSMENTNMTVGAKIVGIADSPEITIFSE
FT                   PSTSQDQALSYLLTGRSLENSGNNGSGGSLGAALLGIGLAKSGKLVGGIGKVFGIQNLN
FT                   LDTSGVGDSSKVVVSGNITPTLQIKYGIGLFDGLAELTLRYRLLPKLYLQSVSGINQAV
FT                   DLLYQFEF"
FT   gene            342482..344032
FT                   /gene="ppx"
FT                   /locus_tag="HS_0341"
FT   CDS_pept        342482..344032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppx"
FT                   /locus_tag="HS_0341"
FT                   /product="exopolyphosphatase"
FT                   /EC_number="3.6.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24619"
FT                   /db_xref="GOA:Q0I1F2"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR022371"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1F2"
FT                   /protein_id="ABI24619.1"
FT                   /translation="MNNENLLQKVTALVQHRGEAKEIAAIDLGSNSFHMVIARIINGSI
FT                   QVLSRLKQKVQLAEGLDENNMLSQAAITRGVNCLALFAERLQGFDPQNINVVGTYTLRS
FT                   AVNKIEFLQQAAEVFPYPINIISGETEAKTIYSGVSHTQPESGRKFVIDIGGGSTEMII
FT                   GDDFIPLIANSRNMGCVSFAKKFFPCGKISRDNFQRAKKTAKQCIEDLAKPYLDLNWDC
FT                   VLGSSGTIKTVHQVISTNYNQHAIITLSHLNKLITQVLKAHHFNKLHINGLNEDRVDVF
FT                   VPGLAILTALFETFAIKEMRYSDGALREGIIYSLEKDFQVKNIRQRTALGIMQQFNVDL
FT                   AQAERTYQSTLLLSEQYQSWQAVELKTEMQDILLWAARLHEVGVVINHKNLQKHSAYIL
FT                   QNMELPGFDKEQQRLLTTIIHHQFNHFKMPDIGKFARYPRADVIALVRLLRLAILLNKS
FT                   RQATSKTNNITLKIDRTLKKWSLYFDAEYLEHNPLVKNELMEEQKRLSEFNLALDFYS"
FT   gene            344205..346040
FT                   /gene="ilvD"
FT                   /locus_tag="HS_0342"
FT   CDS_pept        344205..346040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="HS_0342"
FT                   /product="dihydroxyacid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24620"
FT                   /db_xref="GOA:Q0I1F1"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1F1"
FT                   /protein_id="ABI24620.1"
FT                   /translation="MPKLRSATSTQGRNMAGARALWRATGMKENDFGKPIIAVVNSFTQ
FT                   FVPGHVHLKDMGQLVATEIEKFGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRDLIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMAALRLNIPTVFVSGGPMEAGKTKLSDQIIKLD
FT                   LVDAMIQGANPNVSDDVSEQIERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSCL
FT                   ATHADRKQLFLAAGKQIVELCKRYYEQDDTSVLPRSIATKEAFDNAMSLDIAMGGSTNT
FT                   VLHLLAAAQEAEVNFTMADIDRLSRVVPCLSKVAPNTQKYHMEDVHRAGGIMAILGELD
FT                   RAGLLNSQTRTILGMSIGEQIAKYDIKLTQDKAIHKFFRAGPAGIRTTQAFLQDCRWDT
FT                   VDDDRENGCIRSKEFAYSQDGGLAMLSGNIALDGCIVKTAGVDESILKFSGKAIVFESQ
FT                   EDAVSGILGGKVQAGHVVVIRYEGPKGGPGMQEMLYPTSYLKSMGLGKACALLTDGRFS
FT                   GGTSGLSIGHCSPEAAAGGLIGVVKDGDIIEIDIPNRRIELMVSEEELAERRAEQDKLG
FT                   WKPANRQREVSFALKVYGYFATSADKGAVRDKTKI"
FT   gene            complement(346369..346554)
FT                   /locus_tag="HS_0342a"
FT   CDS_pept        complement(346369..346554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0342a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0342a"
FT                   /db_xref="EnsemblGenomes-Tr:ABI26067"
FT                   /db_xref="GOA:Q0I1F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1F0"
FT                   /protein_id="ABI26067.1"
FT                   /translation="MYASNAFYFTSILLIFQHLATLHVHYIAETSLTFPSNLVKKLLFT
FT                   YGLVFSKIQPHGYNAI"
FT   gene            347041..348198
FT                   /gene="chaA"
FT                   /locus_tag="HS_0343"
FT   CDS_pept        347041..348198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chaA"
FT                   /locus_tag="HS_0343"
FT                   /product="calcium/proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24621"
FT                   /db_xref="GOA:Q0I1E9"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1E9"
FT                   /protein_id="ABI24621.1"
FT                   /translation="MEPSYKEQNNCTETIKINEVKKLWLDSKFSLNLPVWTLLLPLFAL
FT                   LVLAFHLLTHPTGWLINTVTTVLLIGSVFAAVHYAEVIAHKVGEPFGTLVLAIAVTVIE
FT                   VALIVILMSNSTQENSLVLARDTVYAALMLICNGIVGIGLLIGGMKNYVQLFSLHGIKA
FT                   AVSVLLAISLIVFVLPNFTLSAEGGGMVNSQLLFVAMCCLVLYGSFIFTQTIRHRNYFV
FT                   DEDENESHHNDNWLTIGVSIVFLLISLVSVVGLAKMLSPTIESALVSFGLPKIMLGIIV
FT                   AGLVLLPESIASIKAAYNNQLQNSLNLGLGSALASIALTVPVIAIISVISGQPIVFGLT
FT                   AKESLMLIITLLLTMNTLSTGRSNFLLGVIHLVMLATFIFFSIIP"
FT   gene            348297..349274
FT                   /locus_tag="HS_0344"
FT   CDS_pept        348297..349274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0344"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24622"
FT                   /db_xref="GOA:Q0I1E8"
FT                   /db_xref="InterPro:IPR004630"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1E8"
FT                   /protein_id="ABI24622.1"
FT                   /translation="MGFIALLTIIVSWLANTQFAHQAKISALTIAILLGILIGNTFYPA
FT                   LSSKLDKGVLFAKGTLLRIGIILYGFRLTLQDISHVGINAIVTDSVMLLSTFFLAIGIG
FT                   IYWLKMDKQTVYLTAGGCSICGAAAVMAMEPVTKAESHKVSVAVAVVVIFGTIAMFLYP
FT                   FAYSYLQHWLTDHQFGIYIGSTVHEVAQVYAAGGNIGPTVADTAVITKMIRVMMLAPFL
FT                   LVLSWALSKQKSDKSKINIPWFAFLFILMAIFNSFDILPKSAVKFIVKLDDLLLIAAMI
FT                   ALGLTTHISAIKKAGVKPLLLGMLLFIWLVLGGLAVNLLMQGFL"
FT   gene            349291..350403
FT                   /locus_tag="HS_0345"
FT   CDS_pept        349291..350403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0345"
FT                   /product="PhoH-like ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24623"
FT                   /db_xref="GOA:Q0I1E7"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1E7"
FT                   /protein_id="ABI24623.1"
FT                   /translation="MNNLTETFTLEPQDNARLQSLCGTFDEHLQLIESSFNLVVSRRNF
FT                   TFTVQSADGEEKNTYHPTLLKSAVKLIKNLYADTAKIRGKVKELDLEDIHLAIQESRML
FT                   LQDNTQTKREDSKVYSTTIKTKRGLIKPRGKNQIEYLHNILTHDISFGIGPAGTGKTFL
FT                   AVAAAVEALERQEVRRILLTRPAVEAGEKLGFLPGDLGQKIEPYLRPLYDALFEMLGFE
FT                   RVQKLIERNVIEIAPLAYMRGRTLNDSFIILDESQNTTVEQMKMFLTRIGFNSKAVVTG
FT                   DVTQIDLPRSQKSGLRHAIEVLENVPELSFNYFDSKDIVRHPVVAKVVQAYEVWEIKDE
FT                   FRRQQLAEQKQQERLEKEQFTEERVKALQE"
FT   gene            350425..350889
FT                   /locus_tag="HS_0346"
FT   CDS_pept        350425..350889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24624"
FT                   /db_xref="GOA:Q0I1E6"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1E6"
FT                   /protein_id="ABI24624.1"
FT                   /translation="MKNVIIDLQIASEDVTNLPSVEQIQLWANAAIRAENSQPEMTVRI
FT                   VDEEESHHLNLTYRGKDKPTNVLSFPFECPDEIELPLIGDLVICRQVVEREATEQEKPL
FT                   MAHWAHMIVHGSLHLLGYDHIEDDEAEEMERLETEIMLSLGFTDPYIIEK"
FT   gene            350879..352831
FT                   /locus_tag="HS_0347"
FT   CDS_pept        350879..352831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0347"
FT                   /product="tRNA(Met)-cytidine N(4)-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24625"
FT                   /db_xref="GOA:Q0I1E5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032672"
FT                   /db_xref="InterPro:IPR033442"
FT                   /db_xref="InterPro:IPR038321"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1E5"
FT                   /protein_id="ABI24625.1"
FT                   /translation="MRNNQPEMISPRHVQISIAPNLQDFGPHFLSHFDVLWLGWEKPDF
FT                   NVHFCHVQKAKKLLGQEFLNVIFDARQGFHLESLAIVAGTVKAGGTLNILLNHWDLLEQ
FT                   QADIDSLRWSGVEGMIATPHFIRHFQRIVNQFQFPVNHFAIPAITQNNLSDLFCSVQLS
FT                   ATKAQQKIIDSILQQQADIYFLTAKRGRGKSALLGLLSQQVKQKVYLTAPNKSAVDILQ
FT                   KFAGQSVTFIAPDEFVQCLTENPQEYQHAWLFVDEAAMLPVSTLNFFSTYFKHIVFSTT
FT                   IHSYEGTGRGFGLKFKQRILQQRRKCLEFELKEPLRWREDDKLEPFIDVLLLLNSEDDF
FT                   RQYHYKSNLDVHIKSLNQQALLTQIADFYGLLSLAHYRTSPIDLRRLLDAPKQRFYLAQ
FT                   TEGHLLGGVWALEEGGLSDRGLIAGICRGERRPRGNLGAQLLAFQYLNSQACELRSLRI
FT                   SRIALQPNWQRRGVGRDLIAALKVESNIDFLSVSFGYSSELVSFWHKCGFNLVYLSEYK
FT                   ESSSGTYNAMAICPLTLRGKEFSQQCMSQFRRDFVLSDHPLLNEIINNQTIEVELNAFD
FT                   VYSLQKFAFYYRTLSAARPALWRLLKMIASSECPVLRKYFCGEKDFLSYGGYRQGVIIC
FT                   RNEVKEVLQKYKNFL"
FT   gene            352864..353037
FT                   /locus_tag="HS_0347a"
FT   CDS_pept        352864..353037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0347a"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0347a"
FT                   /db_xref="EnsemblGenomes-Tr:ABI26068"
FT                   /db_xref="InterPro:IPR035292"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1E4"
FT                   /protein_id="ABI26068.1"
FT                   /translation="MPDQSEKKGFFRRMLDAYNQFCNEMEVDKGTCRGCVPIVKFDENA
FT                   KQETDNEAGKAS"
FT   gene            353182..354765
FT                   /gene="cstA"
FT                   /locus_tag="HS_0348"
FT   CDS_pept        353182..354765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cstA"
FT                   /locus_tag="HS_0348"
FT                   /product="carbon starvation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24626"
FT                   /db_xref="GOA:Q0I1E3"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1E3"
FT                   /protein_id="ABI24626.1"
FT                   /translation="MLWFFFCVALLILGYFTYGKFVEKVFVINPNKKTPAYSMTDGVDY
FT                   VPMSKKKIWLIQLLNIAGTGPIFGPIMGALYGPVAMLWIVLGCVFAGAVHDYFCGMLSV
FT                   RNGGASMPTLAGRYLGTPVKVFINVLAVVLLFLVGIVFVTSPAQLLSTITLDMFGSAST
FT                   ATTNAHEVVSAVQNAGEIRVWGMDKPTVVAVWTGIIFLYYIVATLLPIDKIIGRIYPLF
FT                   GGLLLFMSAGMVYGLVSSHLNGADPIEFFRSVDGMSFEKFLQNFETRKELPLWPLLFLT
FT                   ISCGALSGFHATQSPLMARCAENEKEGRFIFYGAMIAEGVIALVWCTVGLSFYENLGEL
FT                   LAATQQGSPSKVVYDSSIYFLGTIGGVFAVLGVVVLPITSGDTAFRSARLIIAEFLKIE
FT                   QRTLVKRLLIAVPLFAVGFWIIASKIDFGVLWRYFTWANQATAMVMLWTAAAYLYRYNK
FT                   FHWVCTIPAAFISAVCFTYLAYNKIGFGLDYQLSVYIGIGLTILCLVAFFTLLKPLGSK
FT                   DPDAFINDAT"
FT   gene            354994..355452
FT                   /gene="mraZ"
FT                   /locus_tag="HS_0349"
FT   CDS_pept        354994..355452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="HS_0349"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24627"
FT                   /db_xref="GOA:Q0I1E2"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1E2"
FT                   /protein_id="ABI24627.1"
FT                   /translation="MFRGASAVNLDSKGRIAIPTRYRPEILEINQGQMVCTVDIRQSCL
FT                   LLYPLNQWEIIEQKLSKLSNFNPEERSLQRVMLGYATECELDSAGRILISAPLRQHAKL
FT                   EKSIMLVGQLNKFEIWSESEWQAQIEKDMTLGASGQFAMSEALSMLSL"
FT   gene            355570..356529
FT                   /gene="mraW"
FT                   /locus_tag="HS_0350"
FT   CDS_pept        355570..356529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="HS_0350"
FT                   /product="S-adenosyl-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24628"
FT                   /db_xref="GOA:Q0I1E1"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1E1"
FT                   /protein_id="ABI24628.1"
FT                   /translation="MQDTFSSPEHFTVLLREAVGGLALKENGIYIDGTFGRGGHSRFIL
FT                   SQLSKKGQLIAIDRDPQAIQVAQNIQDSRFRIVHDSFSAIPDICEKLGLTGKIDGILLD
FT                   LGVSSPQLDNAERGFSFMKDGPLDMRMDTTQGLSATEWLRLVSEQDLAWVLKTFGEERF
FT                   AKRIAQAIVGYNKSAVQSGAEPLNRTLQLAELIAQSVPFKDKYKHPATRSFQAIRIFIN
FT                   SELDELEKVLNGALNVLAPQGRLSIISFHSLEDRMVKHFIRKQSKGDDLPKGLPLREEQ
FT                   IQHNQKLKPVGKAIMPTEQEMAANVRSRSAVLRIAERI"
FT   gene            356529..356849
FT                   /gene="ftsL"
FT                   /locus_tag="HS_0351"
FT   CDS_pept        356529..356849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="HS_0351"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24629"
FT                   /db_xref="GOA:Q0I1E0"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1E0"
FT                   /protein_id="ABI24629.1"
FT                   /translation="MVRDFERYPLYKVIFEDLVSANKLLIVLTILVVLSALSTVWITHQ
FT                   TRILVAKKSNLVVENQSLEQEYLNLRLEEKAHSLHSDIESFATQKLKMKSVPAEQEVVI
FT                   IE"
FT   gene            356874..358673
FT                   /gene="ftsI"
FT                   /locus_tag="HS_0352"
FT   CDS_pept        356874..358673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="HS_0352"
FT                   /product="peptidoglycan synthetase FtsI"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24630"
FT                   /db_xref="GOA:Q0I1D9"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1D9"
FT                   /protein_id="ABI24630.1"
FT                   /translation="MTHNKINRKNKRAFENGAKRNQPKKIYENSFLKWRFMVVVGLIIL
FT                   SLTALVGRATYVQMIKSDVLSNEADERSLRKEKILSMRGTIVDRNGQLLSVSVPMFSIS
FT                   AEPKKIFSKNGLQDEERWSALAKALGMSYKDLRKILEKNPKSGFVYLARQVSPTIAEYV
FT                   KELNLYGVNLKTEPRRFYPKTEETAHLLGYTNIDGEGIEGIEKSFNSFLVGKSGSRTVR
FT                   KDRHGRIIENISDLKKYDPQNVILSIDEKLQSVAYREIKKAVEKYKAESGTAVLVDIHT
FT                   GEVLAMANAPSYNPNIRTSFKTEVMRNRAITDTFEPGSTIKPFVILTALEKKVVRRDEI
FT                   IDTGRLVLDGYEVRDVAVRDRQTLDQILENSSNRGVSRLALRMPANALIDTYKKAGLGQ
FT                   RTELGLVGEQAGFLNADRKKWSDIDRASVSFGYGISTTPLQLARAYVTLGSFGIYRPLS
FT                   ITKVDPPVIGQRVFSEKMTREVVNMMEKVAIKNKRAMVEGYRVGIKTGTAKKIENGKYV
FT                   NKYIAYTAGLAPISNPRYALVVLINDPKGREYYGGVVSAPVFSNIMSYALKANNIPPDS
FT                   SNYTKTVRRTVYLNSQENKAKAN"
FT   gene            358689..360176
FT                   /gene="murE"
FT                   /locus_tag="HS_0353"
FT   CDS_pept        358689..360176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="HS_0353"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24631"
FT                   /db_xref="GOA:Q0I1D8"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1D8"
FT                   /protein_id="ABI24631.1"
FT                   /translation="MKKLTALWDIDEQLDSVHRDIELQEMILDSRLANTGCLFVAIKGH
FT                   RVDGREFIMQAIQNGASAVLFETDLVEQHLTVSFEQNIPLIAYYELSKHLSHIADRFYS
FT                   SPSQRLTLVGVTGTNGKTTIAQLLAQWTQILGHTSAVMGTIGNGLFGQIKEASNTTGSA
FT                   IEIQSSLDKFIRQGADFAAIEVSSHGLVQHRVEALTFRAGIFTNLSRDHLDYHHTMENY
FT                   AQAKKRLFSELNCQHKILNVDDEIGATWLIELSKDDPDVVAVSCRADYQPDTKNWLKAT
FT                   ALSFHSKGTTIEFASSWGNGILSSPLIGGFNVSNLLLVLATLLSLGYDIGKLLATVRQL
FT                   TGVCGRMEMLSAKHKATVIVDYAHTPDALENALQSAAVHCQGKLWCIFGCGGDRDRGKR
FT                   PLMAAIAEKFADSVIVTDDNPRTENPEQIMQDILTGFQQSSAVQIIHQREQAIKTALQS
FT                   AVENDVVLIAGKGHENYQIIGTTKYHFSDQEIVKKYF"
FT   gene            360257..361651
FT                   /gene="murF"
FT                   /locus_tag="HS_0354"
FT   CDS_pept        360257..361651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="HS_0354"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24632"
FT                   /db_xref="GOA:Q0I1D7"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1D7"
FT                   /protein_id="ABI24632.1"
FT                   /translation="MIKLSTKELADIFSARLIGAKDICVEKVSTDTRKPCLRSLFFALK
FT                   GENFDAHDYLTQAVEQGCSAVVVERECDVDVPQLIVPDTRLALGQLAKWLRVKINPKTI
FT                   AITGSSGKTTVKEMTASILQKVAQDPDAVLFTQGNFNNDIGVPLTLLRLESKHKFAVIE
FT                   LGANHQGEIAYTVDLVQPDVALVNNVAAAHLEGFGSVEGVAQAKGEIYQGLSENGIAIM
FT                   EYEHSVRYQKKYWYEQIGNADTRLFSVMGKVSDYYAQEIKLTETGSQFTLCCIREGEIK
FT                   INLPYLGLHNVSNAVAAASLALCLGVSLEQIKAGLEKKSYVKGRLFPIEPCPNLLLLDD
FT                   TYNANVSSLKSAIDVLRQYDKFFRIFAVGDMAELGGNSVSCHKQVADFAQMANLDLVVS
FT                   FGTQSAVISSACDGVHFSDKTELVNYIIPIIQQKLASQKVVLLVKGARCMQMEDVINLV
FT                   KDKFQC"
FT   gene            361645..362730
FT                   /gene="mraY"
FT                   /locus_tag="HS_0355"
FT   CDS_pept        361645..362730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="HS_0355"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24633"
FT                   /db_xref="GOA:Q0I1D6"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1D6"
FT                   /protein_id="ABI24633.1"
FT                   /translation="MLVWLAEYLHQYQSVFNVFSYLTVRAILALFTALLLSLWIGPKVI
FT                   RRLQILKFGQEIRNDGPDSHLSKKGTPTMGGIMILFAIGVSTLLWANLANPYVWFCLFV
FT                   LFGYGAVGFVDDYRKITRKNTAGLVARWKYFWLSVIALISAFGMYAIGKDTDATRLVVP
FT                   FFKDVMPQLGLFYIVLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAAFALIAWATGNI
FT                   EWSKYLYIPYIKHTSELVIFCTAIVGAGLGFLWFNTYPAQLFMGDVGSLALGGVLGTIA
FT                   VLVRQEFLLVIMGGVFVVETLSVILQVGSYKLRNGKRIFRMAPIHHHYELKGWPEPRVI
FT                   IRFWIISLMLVLLGLITLKLR"
FT   gene            362739..364049
FT                   /gene="murD"
FT                   /locus_tag="HS_0356"
FT   CDS_pept        362739..364049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="HS_0356"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24634"
FT                   /db_xref="GOA:Q0I1D5"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1D5"
FT                   /protein_id="ABI24634.1"
FT                   /translation="MTNQYQNKNICVVGLGKTGLSCVDFLLRQQANVRVIDTRQQPTGA
FT                   EKLPENVPLHTGSLNQQWLLEADLIVISPGLSVKTLEIQTALQAGVEVVGDIELFCRHA
FT                   NKPIIAITGSNGKSTVTTLVSEMAKEDGLKVGMGGNIGIPALELLQQDYDIYVLELSSF
FT                   QLETTYSLKATAATILNISEDHMDRYLDIEDYRQAKLRIYENCQRAVINAEDVLTTTED
FT                   LKSPITFGESQADYWLKTENGKQYLMAKERLILPCDEMKLVGRHNYMNALAASALVQAV
FT                   DISFTAIRTALRKFTGLAHRFQLAYQKDDVRWINDSKATNVGSTVAALTGLYVANKLHL
FT                   LLGGDGKSADFSELATLINQPHIYCYCFGQDGKELAALSVQSQLFDTMEQAIEAIRPNL
FT                   QQGDMVLLSPACASLDQFKSFEHRGDVFSDLAKLAQG"
FT   gene            364063..365247
FT                   /gene="ftsW"
FT                   /locus_tag="HS_0357"
FT   CDS_pept        364063..365247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="HS_0357"
FT                   /product="cell division-specific peptidoglycan biosynthesis
FT                   regulator FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24635"
FT                   /db_xref="GOA:Q0I1D4"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1D4"
FT                   /protein_id="ABI24635.1"
FT                   /translation="MGQNNVKQHIDRWLRITPTTALYDRALLWLFIILLCLGLISVSSA
FT                   SIPISTRLFNEPFYFIKRDIGYIFISLIAFAFVVLIPMRMWQKYNVILFWIAVILLLLV
FT                   LTGIGKDANGAKRWIPLQLFNFQPAEFAKLALTCYLADYFTRRYNDVRSKKLSAFKPFF
FT                   VMAILGGLLLLQPDLGSAVVLFVITFGLLFIVGANFWQFVGLGGIAFFLFLWLVASASY
FT                   RLKRFTGFLEPFKDPLGAGYQLTNSLMAFGRGELWGEGLGNSVQKLEYLPEAHTDFVMA
FT                   IVGEEFGLVGIIVVVFLLALLVFRVMKIGRESLLLEERFKGFLAFGIGFWIFFQGFVNL
FT                   GMALGMLPTKGLTFPLVSYGGSSLLIMSVSIAILLRIDYENRVVRVGSARLRDD"
FT   gene            365263..366336
FT                   /gene="murG"
FT                   /locus_tag="HS_0358"
FT   CDS_pept        365263..366336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="HS_0358"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24636"
FT                   /db_xref="GOA:Q0I1D3"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1D3"
FT                   /protein_id="ABI24636.1"
FT                   /translation="MSKRKKLLVMAGGTGGHVFPAIAVAQYLQKQDWDICWLGTRDRME
FT                   AKLVPKHGIPIEFIQISGLRGKGLITLLKAPFVILRAVLQARKIIKKYQPDVVLGMGGY
FT                   VSGPGGVAAKLCNIPVVVHEQNAVLGLTNSLLAKIATRVLQAFPNTFPNAEVVGNPVRE
FT                   AFFSVPMPQERFNTTCETLKVLVVGGSQGAHILNTILPEVLAQLPNRLEIVHQVGSGSV
FT                   ENVTALYHDKVNLTQESVQITEFIDDIAQAYAWADIVICRSGALTVCELAAVGTPAIFV
FT                   PFQHKDKQQYLNAKYLADVGAAYIVEQHELDAEKIAQLLKNVDKEKLLEMAEKAKNMST
FT                   PLSTQRVAEVIMDTVKT"
FT   gene            366390..367820
FT                   /gene="murC"
FT                   /locus_tag="HS_0359"
FT   CDS_pept        366390..367820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="HS_0359"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24637"
FT                   /db_xref="GOA:Q0I1D2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1D2"
FT                   /protein_id="ABI24637.1"
FT                   /translation="MQAFRQRIRQTVPEMRRVKQIHFVGIGGAGMGGIAEVLLNEGYQV
FT                   TGSDIAESAVTSRLISLGAKISFSHHAENIEGASVVVVSSAIKGDNIEVITAHEKRIPV
FT                   IQRAQMLAEIMRFRHGIAIAGTHGKTTTTAMVAMIYAQAGLDPTFVNGGLVKSAGTNAY
FT                   LGCSRYLIAEADESDASFLHLQPMVSVVTNIEPEHMETYHGDFEEMKQTYVNFLRNLPF
FT                   YGLSVMCADDPVLMELSSQVGRQVVTYGFSDEADYRIEDYQQTGFQGHYTVVAPNGERI
FT                   DVLLNVPGKHNALNATAALTVAKEEGIENEAILTALAEFQGAGRRFDQLGQFIRPNGKV
FT                   MLVDDYGHHPTEVNVTIQAARQGWENKRIVMIFQPHRYSRTRDLFDDFVQVLSQVDVLI
FT                   MLDVYAAGEQAIAGADSRSLCRSIRNLGKVDPILVSDHKQLAEIVDQVIQDGDLILAQG
FT                   AGNVSKLSRELALAWGKE"
FT   gene            367865..368791
FT                   /gene="ddl"
FT                   /locus_tag="HS_0360"
FT   CDS_pept        367865..368791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="HS_0360"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24638"
FT                   /db_xref="GOA:Q0I1D1"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1D1"
FT                   /protein_id="ABI24638.1"
FT                   /translation="MAKPLKQQKIAVLLGGTSAEREVSLNSGNAVLTALRNQGFDAHPI
FT                   DPKEYPVAMLKEQGFDRVFNILHGRGGEDGTIQGLLEQIGLPYTGCGVMASALTMDKMR
FT                   TKMLWKAFGLPVADMEVVTRTSFSQLNPQVVVEKLGLPLMVKPSLEGSSVGLTKVNAID
FT                   DLKSAVEFALQYDETVLIEEWLSGDELTVPILGNEVLPSIKIVPQGEFYDYEAKYIADN
FT                   TQYFCPSGLTEEREQELRQLVKQAYDVVGCRGWSRIDVMLDGEGKFRLVEVNTNPGMTS
FT                   HSLFPKSAATVGYSFEQLVVKILELSL"
FT   gene            368792..369565
FT                   /gene="ftsQ"
FT                   /locus_tag="HS_0361"
FT   CDS_pept        368792..369565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="HS_0361"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24639"
FT                   /db_xref="GOA:Q0I1D0"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1D0"
FT                   /protein_id="ABI24639.1"
FT                   /translation="MRTTHKVTENLKVTKRKSYRFVNIKFIVMLLLVAILIFIVSNRQS
FT                   ILEKLDDSSINSFAIAGITNFTDDNDVREVLSRISDSGELKGFFGQDIDLVKQQIEMIP
FT                   WVKSVAVRKIWPNRLSIWVTEHLPIARWNETEFLSSEGIIFQLPISKLKTQGLPHLSGP
FT                   DHKSAEVLEAWNKIYLDLKRKNLLLKKIAINERGSWQIVLENDVVLKLGRGEWKDKLDR
FT                   FFTIYPQIEIPENKKLSYVDLRYGVGAAIGVVDSD"
FT   gene            369596..370870
FT                   /gene="fstA"
FT                   /locus_tag="HS_0362"
FT   CDS_pept        369596..370870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fstA"
FT                   /locus_tag="HS_0362"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24640"
FT                   /db_xref="GOA:Q0I1C9"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1C9"
FT                   /protein_id="ABI24640.1"
FT                   /translation="MARIVEDKIFVGLEVGTSKVVAVVGELLPDGVVNVLGAGSCPSKG
FT                   IDKGSITDLNAVVTSIQRAIDSTEAVADSQIFSVTLAITGEHIQSLNENGFVPIAEEEV
FT                   TQEEVEAALHTASSVRIGDGLALLHIIPQEFAVDKQVNIKDPLGLQGVRLSAQAHLIAC
FT                   HQDWLNNLKKAVERCKLKVNKVVYSGYASSQAVLTEDEKELGVCLIDFGAGTMDIVVYT
FT                   NGFIRFSKVIPYAGNRVTDDIAYACATSRTEAESIKVAYGSAVSPPLDPLDKKIEVASI
FT                   GGRAPRVISKEQLSIITSARYAELLGVVKSELDQLKYQLENKQIKFELIAGIVITGGGA
FT                   QIEGLRECATQVFGSQVRIGVPLNITGLTDYVNKPQYSTVVGLLHHHNNDFEDILSESD
FT                   TETDGVGKKFWNICKKVVNKVRSEF"
FT   gene            371056..372171
FT                   /gene="ftsZ"
FT                   /locus_tag="HS_0363"
FT   CDS_pept        371056..372171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="HS_0363"
FT                   /product="cell division protein FtsZ"
FT                   /note="hydrolyzes GTP"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24641"
FT                   /db_xref="GOA:Q0I1C8"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1C8"
FT                   /protein_id="ABI24641.1"
FT                   /translation="MVANMIQNDIGGTLLGVDELAYPMSDDNHGKIIFYAVNTDAQALR
FT                   KSNVQKTVQIGGETTKGLGAGANPNVGRKAAEDDQDAIRAMLEGADMVFIAAGMGGGTG
FT                   TGAAPIVAQIAKELGILTVAVVTKPFSFEGKKRMHFAELGIKELSKHVDSLIIIPNEKL
FT                   LKVLGKNISLINAFAAANDILRNAVTGISDMITSPGLINVDFADVRTVMSEMGRAMMGS
FT                   GVVQGTAADGRAEKAAQEAVASPLLEDVDLSGARGVLVNVTAGFDLTLDEFSTVGETIR
FT                   SFASEEATVVVGTTLVPEMSDEIRVTIVATGIGDIERQDVQIMSTSPMNEPVKPVEQQH
FT                   IRPEPRHDLDTPITERLKAFRPVDPTSFSRD"
FT   gene            372212..373129
FT                   /gene="lpxC"
FT                   /locus_tag="HS_0364"
FT   CDS_pept        372212..373129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="HS_0364"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24642"
FT                   /db_xref="GOA:Q0I1C7"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1C7"
FT                   /protein_id="ABI24642.1"
FT                   /translation="MIKQRTLKQSIKVTGVGLHSGNKVTLTLRPAMPNTGVIYCRTDMN
FT                   PPVTFPANANAVRDTMLCTCLINEDGVRISTVEHLNAALAGLGIDNIIIEVDAPEIPIM
FT                   DGSASPFIYLLLDAGIEEQNVAKKFIRVKKPIRIEDGDKWAEFKPYDGFRLDFTIDFEH
FT                   PAIGKDVRNYVMDFSAQAFVQQISRARTFGFMKDIEYLQSQGLALGGSLDNAIVLDDYR
FT                   ILNEDGLRFKDELVRHKMLDAIGDLYMCGYNIIGDFKAYKSGHGLNNKLLRALLENQEA
FT                   WEFVSFEDKEEIPQGYVSPAQVFI"
FT   gene            373254..374411
FT                   /gene="pheA"
FT                   /locus_tag="HS_0365"
FT   CDS_pept        373254..374411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="HS_0365"
FT                   /product="chorismate mutase / prephenate dehydratase"
FT                   /EC_number="5.4.99.5"
FT                   /EC_number="4.2.1.51"
FT                   /note="prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24643"
FT                   /db_xref="GOA:Q0I1C6"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR010952"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1C6"
FT                   /protein_id="ABI24643.1"
FT                   /translation="MSLDLSEIRQQITQIDRSLLKLLSERHRLAFDVVRSKEISQKALR
FT                   DVEREQQLLKELVQFAENENYQLEPQYITQIFQKIIEDSVLTQQVYLQKKLNEQREKNI
FT                   HIAFLGKRGSYSHLAARNYATRYQEQLIELSCASFDEVFSSVQNEEASYGILPLENTTS
FT                   GAINEVYDLLQHTDLSLVGELAYPIKHCVLVNAQDDLDKIDTLYSHPQVIQQCSQFIRT
FT                   LARVHIEYCESSSHAMQLVASLNKPNIAALGNEDGGNLYGLKVLKSGIANQENNITRFI
FT                   VLAKNPIAVSPQIHTKTLLLMSTAQKAGALVDALLVFKKYNINMTKLESRPIYGKPWEE
FT                   MFYLEIEANINNPIAQQAFTELKAFSNYLKILGCYPSEIVKPAEV"
FT   gene            complement(374473..375261)
FT                   /gene="comL"
FT                   /locus_tag="HS_0366"
FT   CDS_pept        complement(374473..375261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comL"
FT                   /locus_tag="HS_0366"
FT                   /product="DNA uptake lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24644"
FT                   /db_xref="GOA:Q0I1C5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1C5"
FT                   /protein_id="ABI24644.1"
FT                   /translation="MHKLKSLALVAFASLALGACSSSGKAIEEGTAQTLYEKGHSYLQD
FT                   ADYSQAIRYLDTAKKRFPGSQYNEQVQLDLIYAYYKSQDYTNALVTIDRFIQQYPQSSH
FT                   LDYVIYIAGLSNSALGDNWFQDLFGVDRATRESTSIKTAFANFQTLVQHFPNSPYAADA
FT                   LARMAYIRASLARHELEIAKFYAKRNAHVAVANRVVGMLQQYPDTKATLDALPLMKNAY
FT                   EKMGLTKLAQQADSLIQANQNKSFENVAKPQEPELLAPKK"
FT   gene            375371..376336
FT                   /gene="sfhB"
FT                   /locus_tag="HS_0367"
FT   CDS_pept        375371..376336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfhB"
FT                   /locus_tag="HS_0367"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24645"
FT                   /db_xref="GOA:Q0I1C4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1C4"
FT                   /protein_id="ABI24645.1"
FT                   /translation="MILSADIQPQHMGQRLDQTLAELFPDYSRSRLKTWIEGDLVKVNG
FT                   EIINVARTKVYGGELVELCVEIEEESRFEPENLPLNIVYEDEHILVINKPKDFVVHPGA
FT                   GNQRGTVLNALLYHYPKIVEVPRAGIVHRLDKDTTGLMVVAKTIPAQTKLVQDLQKRKI
FT                   IREYEAVAFGVMTQGGKVDQPMSRHPTKRTQMAVHPLGKPAVTHYRIMERFRNYTRLRL
FT                   RLETGRTHQIRVHMAHISHPLLGDQTYGGRPRPPKNASEEFMQVMRDFKRQALHAIMLR
FT                   LTHPITGEIMEWEAPLPDDFVTLINALKADYQLHKDELDY"
FT   gene            376338..377078
FT                   /locus_tag="HS_0368"
FT   CDS_pept        376338..377078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0368"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24646"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2I5"
FT                   /protein_id="ABI24646.1"
FT                   /translation="MQIIKANLGQVANVQGLMTTRQGGISVAPYDSLNLGDHVGDDESA
FT                   VKINRTLLVKELGLPQDPIFLNQTHSTKVLRLPYQEGMDLNADAVYSDQANQVCLVMTA
FT                   DCLPVLFTNRQGNEVAAAHAGWRGLCDGILEETVKQFRVPKEDIIVWLGVAIGPKFFQV
FT                   GKEVVEQFIAKDHQAKNAFTPDREQENKFLGNLYQIAKQRLNALGITEIYGGEHCTYSD
FT                   KERFFSYRRDGKTGRLASLIWFSK"
FT   gene            complement(377132..378082)
FT                   /gene="cysK"
FT                   /locus_tag="HS_0369"
FT   CDS_pept        complement(377132..378082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="HS_0369"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24647"
FT                   /db_xref="GOA:Q0I2I4"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2I4"
FT                   /protein_id="ABI24647.1"
FT                   /translation="MTIYADNSYSIGNTPLVRLKNFGNNGNIIAKIEGRNPSFSVKCRI
FT                   GANMVWQAEKDGILTKDKEIIDATSGNTGIALAYVAAARGYKITLTMPETMSSERKRLL
FT                   RGLGVNLVLTEGVNGMKGAIAKAEEIVASNPNHYVMLKQFENPANPAIHQQTTGPEIWS
FT                   GTEGKIDVLVAGVGTGGTISGISRYIKQDQGKKIITVAVEPEESPVITQTLAGEETKPG
FT                   PHKIQGIGAGFIPKNLDLSLVDQVEKVSSETAIITARRLMAEEGILGGISSGAALAVAD
FT                   RIAQRPEFSDKLIVVILPSASERYLSTALFDGFEG"
FT   gene            complement(378200..378973)
FT                   /gene="cysZ"
FT                   /locus_tag="HS_0370"
FT   CDS_pept        complement(378200..378973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysZ"
FT                   /locus_tag="HS_0370"
FT                   /product="cysteine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24648"
FT                   /db_xref="GOA:Q0I2I3"
FT                   /db_xref="InterPro:IPR022985"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2I3"
FT                   /protein_id="ABI24648.1"
FT                   /translation="MLKLTEIKKAFHYFIMGWDLIRQRGLRRFVVMPILLNILLLSGLL
FT                   WLFINRFSTWLESMITFIPDWLSWLSMILLILAVLMLLSIFYFMFTTLSGFIAAPFNAL
FT                   LAEKVEKMLTGESPTEGSAVDFLKDIPRMLKRELQKLTYSLPRIIALSLLSFIPFIGQS
FT                   IIPILAFLFTVWMMTIQYCDYPFDNHKVPFQRMKTELGQKHTLTLTFGTLVTLCTFIPL
FT                   INLLIIPVAVCGATAMWVEQYRYAGKNDINKPLAD"
FT   gene            379133..380140
FT                   /gene="zipA"
FT                   /locus_tag="HS_0371"
FT   CDS_pept        379133..380140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zipA"
FT                   /locus_tag="HS_0371"
FT                   /product="cell division protein ZipA"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24649"
FT                   /db_xref="GOA:Q0I2I2"
FT                   /db_xref="InterPro:IPR007449"
FT                   /db_xref="InterPro:IPR011919"
FT                   /db_xref="InterPro:IPR036765"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I2I2"
FT                   /protein_id="ABI24649.1"
FT                   /translation="MDLNAILIILGVIALIILVAHGIWSNRCEKSQYFENSKNFTREAR
FT                   IREPQENQQYQTADQSQSDFQRNLLETDNDCFSSESAHNSHQPLYHYSEQSAVQSVDQI
FT                   KIRLPDSEPNYVMQERFSPKHTDYASMSIEELEKSIDLDEGINSSSQHLRQELAQISGQ
FT                   SIADDKVNIEEHMFTESTISFVEPQTNTESQQVVEKTKSGNSSFIMLYVVASENQGFSG
FT                   LQLTKTLDELGFIFGKKQIYHRHVDLSITSPVLFSVANIEQPGTFDLTNIADFYTVGIA
FT                   LFMQSPSYGNATANLRMMIRAAKTIAQDLDGVVVTEQQEIFDEQAERDYLARVS"
FT   gene            380653..382323
FT                   /locus_tag="HS_0372"
FT   CDS_pept        380653..382323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0372"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24650"
FT                   /db_xref="GOA:Q0I2I1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2I1"
FT                   /protein_id="ABI24650.1"
FT                   /translation="MSSQFVYTMHRVGKVVPPKRHILKDISLSFFPGAKIGVLGLNGAG
FT                   KSTLLRIMAGIDKDIEGEARPQPGIKIGYLPQEPKLEPQQTVRETIEEAVAEVKNALVR
FT                   LDEVYALYADPEADFDKLATEQANLEAIIQAHDGHNLENQLERAADALRLPDWNAKIEH
FT                   LSGGERRRVALCRLLLEKPDMLLLDEPTNHLDAESVAWLERFLHDYEGTVVAITHDRYF
FT                   LDNVAGWILELDRGEGIPWEGNYSSWLEQKEKRLAQEQATESARQKSIEKELEWVRQNP
FT                   KGRQAKSKARMARFEELNSSEYQKRNETNELFIPPGPRLGDKVIEVQNLTKSYGDRTLI
FT                   DNLSFSIPKGAIVGIIGANGAGKSTLFRMLSGQEQADSGSITLGETVVMASVDQFRDAM
FT                   DDKKTVWEEVSGGLDIMKIGNFEIPSRAYVGRFNFKGVDQQKRVGELSGGERGRLHLAK
FT                   LLQVGGNVLLLDEPTNDLDVETLRALENAILEFPGCAMVISHDRWFLDRIATHILDYGD
FT                   EGKVTFYEGNFTDYEEWKKKTFGAEATQPHRIKYKRIAK"
FT   gene            382622..382969
FT                   /locus_tag="HS_0373"
FT   CDS_pept        382622..382969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24651"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2I0"
FT                   /protein_id="ABI24651.1"
FT                   /translation="MKIFSTAPDGNEMADMANARYFNLAIKQIEENAEWLKTANKPTQA
FT                   LLAHIEILIMLAKRFPIDANLSIKKDKVKEWKNTFNDWFERVGNKIPAKYRDGIKANGD
FT                   ELFKQLEQYGH"
FT   gene            383108..383317
FT                   /locus_tag="HS_0374"
FT   CDS_pept        383108..383317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24652"
FT                   /db_xref="InterPro:IPR028956"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2H9"
FT                   /protein_id="ABI24652.1"
FT                   /translation="MGALAKVFLEEQKTELIEIIKFDPEADMFCVYSSNPDALKSFIIA
FT                   FKETCENETLIQDLSEAYYKLAIK"
FT   gene            383505..384167
FT                   /gene="ktrA"
FT                   /locus_tag="HS_0375"
FT   CDS_pept        383505..384167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ktrA"
FT                   /locus_tag="HS_0375"
FT                   /product="potassium uptake protein"
FT                   /note="K+ transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24653"
FT                   /db_xref="GOA:Q0I2H8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2H8"
FT                   /protein_id="ABI24653.1"
FT                   /translation="MQFAIIGLGKFGKSVARELYKLGNQVVGMDINEKKVEQCSHFLSA
FT                   SLILDATDKTALRELNIQEFDAVLVSIGESLESNLLCTLNLIDLKANQIWAKAKNAAHH
FT                   AILSSLGIQHIVRPENDMGILVGQSMNCPSVTHCIPLGSDLFLIHFRVQFQTTITLGML
FT                   KKRYKDIVITAIQRGEQLISNPDDETEIHPQDHLLIIGYLNNLRTLTGELNKIQNEI"
FT   gene            384157..385476
FT                   /gene="ktrB"
FT                   /locus_tag="HS_0376"
FT   CDS_pept        384157..385476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ktrB"
FT                   /locus_tag="HS_0376"
FT                   /product="potassium uptake protein"
FT                   /note="cation transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24654"
FT                   /db_xref="GOA:Q0I2H7"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2H7"
FT                   /protein_id="ABI24654.1"
FT                   /translation="MKFEHIKTKPPYVLAGGFLFIILIGTLLLELPFAHHKSISWLHAL
FT                   FTSTSAVTVTGLSVEDTANFTLFGQVVLMCLIQIGGLGFMTFAIYIARRMGARIGLFGN
FT                   AIAQEALGDVPFNLLLHTAKNVLKFALTFELIAMIILTVHFYGDVSFFQALYQSLFYSI
FT                   SAFNNAGFALSSESLMPYVDDIIVNIVITVLIIIGGLGFVVLMDIKNQCQYKKFSLNTK
FT                   VVLWATLILNIVSFLIFYILERQNPLTFGPLSETGKLFAAWFQAITPRTAGFNTVDTAG
FT                   LTDASSLLTMFLMFIGGGSLSTASGIKIGTFCIIVVATFAYLHKESHVNLFKHNLPDEL
FT                   IKKSFALFFTSLSCIGISSFLLLAVEPQFHFLDVLFEVVSALGTVGLSRGITAELSPFG
FT                   ESILIILMFIGRVGLLTMIYLIMQPHSSKIKYPKEYIQIG"
FT   gene            complement(385592..387613)
FT                   /gene="lig"
FT                   /locus_tag="HS_0377"
FT   CDS_pept        complement(385592..387613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lig"
FT                   /locus_tag="HS_0377"
FT                   /product="DNA ligase (NAD+)"
FT                   /EC_number="6.5.1.2"
FT                   /note="DNA repair enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24655"
FT                   /db_xref="GOA:Q0I2H6"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I2H6"
FT                   /protein_id="ABI24655.1"
FT                   /translation="MKQGIFMIKQQIEELRQLLRHHEYQYHVLDNPQIPDSEYDRLFHQ
FT                   LKALEQQYPEYASENSPTQRVGAKPLSNFAQVKHDIPMLSLDNAFSDEDFFAFVKRIQD
FT                   RLIHVHHSLTFCCEPKLDGLAVSILYINGQLVQAATRGDGTTGEDITANIRTIRNIPLQ
FT                   LLTDNPPARLEVRGEVFMSQAGFEKLNKTALAKGEKTFANPRNAAAGSLRQLDPKITGQ
FT                   RPLMLNAYGIGIAEGVELPDTHFARLQWLKSIGIPVNNEIQLCHGIEKVLDFYRTIKQK
FT                   RSSLGYDIDGTVLKINDIDLQQQLGFISKAPRWAIAYKFPAQEELTILNNVEFQVGRTG
FT                   AITPVAKLEPVFVAGVTVSNATLHNGDEIARLDIAIGDTVIVRRAGDVIPQIIGVLHER
FT                   RPENAKSIIFPSNCPVCDSVISKIEGEAVARCTGGLICAAQRKEALKHFVSRKAMDIDG
FT                   IGAKLIEQLVERELVHTPADLFKLDQVTLMRLERMGAKSAENALASLAKAKKTTLARFI
FT                   FALGIREVGETTALNLATHFKTLEAFENATFEQLQKVQDVGEVVAKRIRSFWSEPHNVA
FT                   VVKDLIAQGIHWDDVEVKEVRDNPLKGKTVVLTGTLTKMGRSEAKEYLLQLGCKVSGSV
FT                   SSKTDFVIAGESAGSKLTKATELGINILSENEFLALLA"
FT   gene            complement(387723..389057)
FT                   /gene="gntP"
FT                   /locus_tag="HS_0378"
FT   CDS_pept        complement(387723..389057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntP"
FT                   /locus_tag="HS_0378"
FT                   /product="gluconate permease"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24656"
FT                   /db_xref="GOA:Q0I2H5"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2H5"
FT                   /protein_id="ABI24656.1"
FT                   /translation="MIASIALLLLLIIKFKVHAFVALVLVSLLTALATGMSVDKILPTL
FT                   LGGFGNTLASVALLVGLGAMIGRLLEITGGAKVLSDTLINKFGEKKAPFALGVASFLFG
FT                   FPIFFDAGLVVMLPIIFSVAKQFGGSLFRYAFPAAGAFAVTHAFLPPHPGPVASGDILG
FT                   ANIGLLTIVGFILAVPTWYFATYLYGLYLGKKFDLPLPKTFLNAAPINETAVQNPPSFK
FT                   KVLFILLLPLCLIMLDTVLNTLAVAKVIDGSTLWVQSLRLIGKTPIALLISLLMTIILL
FT                   KEQRSFEQIEKICDNALGPICAIVLVTGAGGMFGGVLRASGIGDVLAKMFSDTGMPIIV
FT                   AAFLISTALRVAQGSATVALTTTSALIAPMVSSATGLSQFDLCFIVIAIASGATVLSHV
FT                   NDSGFWLVSRFLEMDTKTTLKTWTVMETLIGLVGFALALIGSIIL"
FT   gene            389391..389909
FT                   /gene="glk"
FT                   /locus_tag="HS_0379"
FT   CDS_pept        389391..389909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glk"
FT                   /locus_tag="HS_0379"
FT                   /product="gluconate kinase, SKI family"
FT                   /EC_number="2.7.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24657"
FT                   /db_xref="GOA:Q0I2H4"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2H4"
FT                   /protein_id="ABI24657.1"
FT                   /translation="MSKGKSIILMGVSGTGKTSVGTEVAYRLGLKLIDGDDLHPRANII
FT                   KMRQGQPLNDEDRMPWLERIRDAAFSLEQKSEKGIIICSALKKQYRDQIRDGNQNIKFI
FT                   YLSGSFELVLSRLQKRQGHYMKTEMLRSQFATLEVPQADETDIYHIDIDATFEEVVQRC
FT                   VEAIKPLLD"
FT   gene            390391..391419
FT                   /locus_tag="HS_0380"
FT   CDS_pept        390391..391419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible periplasmic-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24658"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2H3"
FT                   /protein_id="ABI24658.1"
FT                   /translation="MKKMKVVLTSATVLLATLLAACGDNNKASKDVTASNVAANSSSAE
FT                   SAVPATVQSKFVTIATGGASGPYNIIATTLTGIYSKNLKTNSKTQTTGASVENLNLMAQ
FT                   KKVEMAFVMSDALNDALNGTGSFKNKIENVEQIAALYPNYVQIVTSKRSGIKTITDLKG
FT                   KRVATGDQNSGVEVNARNLLAGFGISYADIKVDYLGYAAAADALKAGTIDAAFLTSGLP
FT                   NSALMELQQSFDLQLVSIPADGIKKLAADKPYFNAMDIPANTYGNPEPIPTAAIKNALV
FT                   IRKELSEADGYLLTKTFFESLPQLQTAHQAAKGINVKEAQEGAVAPLHPGAKKYYDEVN
FT                   AK"
FT   gene            391450..391914
FT                   /locus_tag="HS_0381"
FT   CDS_pept        391450..391914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0381"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24659"
FT                   /db_xref="InterPro:IPR015001"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2H2"
FT                   /protein_id="ABI24659.1"
FT                   /translation="MPRNGWFVLVPLAVIGLYPVHFISVTTKQGECIIGDDHFALRWRH
FT                   SVEHQLWYEHYQRQGDNLHLYQTWLQTFGAGTPSQGEVVTHVPVGYVGFKQDVVLPEIN
FT                   WIVSHRMEGTILLDDKQFPVYQTLPNYSAVTIKPAKSVIATLWLRKSCYD"
FT   gene            391907..393883
FT                   /locus_tag="HS_0382"
FT   CDS_pept        391907..393883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0382"
FT                   /product="conserved integral membrane protein"
FT                   /note="possible transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24660"
FT                   /db_xref="GOA:Q0I2H1"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2H1"
FT                   /protein_id="ABI24660.1"
FT                   /translation="MTDSVKIDTALGAKEQEILEKYDRESVTRQSSSQFNKGLITLVSV
FT                   LYSLFHLYTTFYPLPTLIQRAVHVGVGAILILLIYPASKKRRQGSVAWYDWLWVIAGTS
FT                   GMLYLINQYNDIMTVRGGIPNSTDIVMAIITVLVVLEVTRRVTGWILVIFSLLFLIYPF
FT                   ISSMDFMPDSLLTRPYDVGDIFGQLYLKTEGLYSSAVGASVSFIFLFILFGAFLSKSGM
FT                   GQLFNDLALAIAGDKQGGPAKVAVISSGFMGSINGAAVANVVSTGAFTIPLMKKIGYHK
FT                   NFAGAVEASASVGGQILPPIMGASAFIMAETTGVSYGTIALAALLPALLYYLGVIAQVH
FT                   FRAGKQNLKGVPKDQLPRVKAVMKARGHMLLPILALIIFLAQSVPVGYAASYTIVLTIL
FT                   VSQLRQETRMGIKDVIEALADGAKQSLSVMSACATVGIVIGVMNLTSFGTVITSSIVTL
FT                   GAGSLFLTLFLTMIASMILGMGLPSIPAYIITATMAAPALATFDVPVLVAHMFVFYFGI
FT                   FANITPPVALAAFAGAGIAQGDPMKTGWQSLRLALAGFIVPFIFVYNPNMLMIDVTNAA
FT                   VIAKTFPLPSAFEIINVIVSSVIGVLGLSAAVEGYLKNTIPIWQRIILAIGSLMLIIPE
FT                   WITDIIGIAVVVVIALLNVRQCD"
FT   gene            complement(394115..406831)
FT                   /locus_tag="HS_0383"
FT   CDS_pept        complement(394115..406831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible large adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24661"
FT                   /db_xref="GOA:Q0I2H0"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2H0"
FT                   /protein_id="ABI24661.1"
FT                   /translation="MNKIFKTKYDVTTGQTKVVSELANNRQVASRVEGSSVAEKCGVFL
FT                   GNFLGAFKVLPLALVMSGVFSSIGYGATVFLDNNKTSSIGSDNKSTAVWSDEGVGKFNN
FT                   TLKDKLKKSESILLSHIDNTAGADTSLTNKDFFRTVVIGSRTVAGGNDATAIGYRAIVG
FT                   KNKKETNTKDSHQGTAVGYRAFANGTESVSMGNDTIAWGDSSIAIGSDNANGKEAKNLS
FT                   KEIYKLFHALRDDFNYTSEYAAVNHKTLRQGKEKSHDMLDNDGNLMAKDGFYIGYNGGY
FT                   YFREPDESGQLKNENLKYMLKDGILYEKIDQQGFSKIENKKRHDEIMNSLKNNEDYKRY
FT                   EQYMAILDADYQNYKVTPNSKKTHTWARGNNSIAIGGRSIAFGNNSTALGTASVAARDY
FT                   ATAIGSDTIAYGKQSLAVGNRAIVYSDGSVGIGHKVQALNAGAMVYGRESFAGGTGSLA
FT                   IGDRTFANVTMGDDFKTTVEDLYLKGDTDTIQNSHKEKFYPKTVLQDGTEENKAEQSRD
FT                   SEGRYNQGAVALGSYATALGDNTLALGRFAYAKEDSAVALGRFAFARNKESLALAPFSR
FT                   AMGERSVALGHQSLVEAKDSMAIGVGARVSGEIPEELKAATNKNIKVPNEDSMAIGNKA
FT                   EAYFPKSIALGVESKTDYSRKEMAQDAWAPKHAISLPSSQKIGYLSVGGKNAERRIVNV
FT                   APGASDTDAVNVSQLRALEEAILYGSSLEEEEAYNGVKYLSIKGIDEYKKIVRKEQDYK
FT                   NYLKVKKEYLKLKARRDVNNEEINLTNIESKVTAYESKYGDFANTSNKLTEEKNKEYKI
FT                   LLTEDVKNNPEKEKERRKNYLKIKYEEIEDAYEKDIAQDKIDNLLTEEQKTKFKNSNFL
FT                   SDGAKASGSMAMGVGALTNSVESIVIGRNAMIENKAANNTVLLGNNTSSDTANAVALGN
FT                   FSVADRKPEPASKLDATGRSNAYISDDLANLIDEHHAYAAVSVGRYGGDLKDLTNNVQT
FT                   EKDYDKWLKDNKHRTKEPAYEQERLAETAKIKKFALRKITNVAPGTKDTDVVILAQLKE
FT                   AMKGVGPATHYVSVKGTDQSDDSNYKNDGAKGTDSVAIGVSAATDKSATAGIAIGKGAK
FT                   SEAENAVAIGNGASIDVPNSFVMGSNNIVNQSNKETRGAVVVIGSGIKLDESKSSIAIG
FT                   AVYLEGRDGEKDGTVIENAAWTASIGNKNKIKNGTDIIAVGNNIKIQGDLTAEEESKYA
FT                   ERIRQRPRQKTKIESEKTDTIKNFNTEVVAIGNGADAIRAKNSVLIGAKTKAESNATQA
FT                   VIIGYEATAKENAVGAVVIGQGASVETLAGDSIALGQGSKATKKETAPSKATSSKNVNF
FT                   TWTAGIGNNTSVVSLGDTSKERQIKHVAAGEVTKASTDAINGSQLYAVADEFSKLAVDV
FT                   LGAEADTTSGFKKSTFNQLIGANGSPAAATPATAKTFKQAIDDNIAKINEGFKFGDGNT
FT                   DGTHYLGSTLNIKAGNIDSGAFTSDNIKTHYETNNKNILIGIKKAPSFEKVTVTQDVTD
FT                   NSDKMVLTTKNYVDTKFNSAGSTLKFTADNGNTQTLAKNGTLQVKGTSGEITTTASNND
FT                   TVTIALDQTLKGKINTAATTAATAAQKAEAATTKADANAQAIATVTDTANQNKTTISAV
FT                   KATADQNKTDIASAKSDIAENKQSIATVTETANQNKGDISALKSQTETNTQAIAQKEDK
FT                   LTKGNITAKADGLVEVTGGTDAVIGSGVTIGLNEATKTKLSSIGSGAIGDTTTTNSDKT
FT                   VTGQTVYNYLQNFSQTLTLSTDGTADSGSVNLKNGKLHVTGSDGVGVDISGSKITVKLD
FT                   DTTKGKINNALSGSDADGKYAKIDGSNITKSSWRTKLDVYTKSETNSAVEKAKETVTNG
FT                   TGIKVDSSDSTNGGKQFTVSLDSDTQTKLGNIGTGEVTANNDKTVTGGKVHTAIETAKT
FT                   TLNAAINGKATKSLDNIDSSGKTVIKNLTKVKHGKNVTVDSSIEGDAQVFTINAVDTSA
FT                   KVTAESGSKIHVTTTEGTEGNTTVKEFKLDLTEETKTKIDNALSASDAATNYAKVDASN
FT                   ITDGSAWRTKLDVYSKAETTTEINKAKETVASGDGITVTSTNGDAKTFTVALSQETRTK
FT                   LNNIGTGKVEASNAHTVTGGTVHTAIEKAKNALKGELANTATFGLQGNDSQDVVTKTLN
FT                   NTLKITGSESAKADKTNIYVSKNASNDGLNIELGENLAGIKKISNGDTEITIDTDGVKI
FT                   KSGKDGAESKITLSADHILSDKDIYVGPKDDKGSNKLVKQSDVDGLSITFEDENSSTES
FT                   QSNGTQNVKVGKKVIYGKSSEITPTVSASGDDAKVTFSINDKSISESKLEDTLKGKIDK
FT                   IATNESGISNLSAHKLTFKDGGTSSFERANNTSKNVVFKGTGNLNVKLATETNNDTGTF
FT                   TISVNETDSINEKAGTDKPDTEPKGKHENKLTTEKAVVDYVQGKISAIQTNLDNTIGTG
FT                   TIDDADTNQKTVTGQTVKTYVDGKTFKLAGNDSDAVSSQLDGTIHIKGSNKTYQASGDT
FT                   EKSNIYVSKVTETAQGADPKEYLQIQLADALTGIKTIELKDDKGSRSKTIAINNKGDLV
FT                   VRREINENNQPKSVENEIITSENIGDQTITYKSNGSNKNGKTDKEFTVKLSEGLDFTKT
FT                   DNIAVEVSDNGVVKHTLVNNLTQIDSISSGKDAKGAKISFTSDTDTTADPANNDVKNKI
FT                   EFTIGTQSTSTQGQDSATVTSTTFSFSEKGLDLGSKQIKNVASGISQNASSDVGDATSN
FT                   VSDVLTGTSIENIKNNAVNVKDLSDVAKAIIDKGLTFKGTELKDDKTQQQATISLGSTI
FT                   EIDSSESKNSKASDGKDAPKEKDIKVSVGANKITLALNKSEALSLEDERVVTSKAVKTA
FT                   LDDMQSEINNKISKTDANNPFETTYKDKDGKELEKHGDNFYKKDEIPDGAKYNADKGKF
FT                   TDKDGRELPQQPTAIAKNEVKEEINLKGDTPKKIANVDSGLGLEKYQEPNTDNLDDEAK
FT                   NKEIAKAKENHQKAKKDAIDKLLGNNADKANNIKDSDPMLNNVATIRDLQALGQAGLDF
FT                   AGNDATSVHRNLGQKLVIKGDQDAPAGSFESAKDNINVAVEGEALVVQLSKNLKNLTSA
FT                   EFTSEETKDGTKQTFKTTINGKSIALEGKDGTTTNMSSDKITLKDKDGNTADMTGNEIA
FT                   LKGKDGKPTIAKLNQDGLTVGDKDATNGDKTHAVYGKDGLTVHGKDGKSAVSLKMKMSE
FT                   KNGKSVPTLEFAKGADDKGTGVITGLADLTKDSDGTSVANKNYVDTQLTAAKAEADKTA
FT                   MKYDDENKTSITLGGKPQAGGTAPSPVMIDNLKSGLGIDDIQSGGVASIKQGKQGELVK
FT                   QLVAGELDTTKDASGKAKDNLHKAVNLADLKAVAQAGLNFAGNDGQDIHKNLSEKLEIV
FT                   GQGLDKDKVTAFKGTNGNIAVKTDNGKLSISLNEALTGLKSAEFISEETNSDGTTQKTK
FT                   TTINGKGTTIVELDKEGNTKENGKSASYTLDKVELKDGNKSNTSTAEGNAIVNGDKIHT
FT                   STAESDLLLDKATGDSNTRTATANVIADKAGNQSVLDKDGLTVGDKDATNGDKTHAVYG
FT                   KDGFTVKGKDGSTEAISLKVTEKDGKETATLAFGKGTDGKGTGVITGLADLTKDSDGTS
FT                   VANKNYVDEKVESINDKLKNNLGLKEIDNPDYVKAEEDLAKAKEALEKENNLAKKAELQ
FT                   KAVTDAEAKVNELSKNKKLIVTPDGRDGKSYLEAGAAATHGPTDKDGLNGKNATEKVNA
FT                   LRNGEAGAVVFTDKDGNRLVKANDGEYYKADNVNADGTVKIATDGKDKPKPVEKPQLSL
FT                   VNHEGNTTTPTVLGNVASGLDINAEKVKQAEKEVKAKRSEAERKATMLKAKAALVEQKE
FT                   AEITALKQEIENLSGDEKTQKEAELKAIEAELSQFNDELATATKDLKTANDALKTANDE
FT                   LTNFTENRIGNLVKGENINPTNGANIGDLQAVARAGLNFEGNDGVPVHKNLGEKLTIKG
FT                   EGTFNSDSTAAGNIKVEMAQDGKGLEVKLSDQLKNMTSFETREVDGKKSRLDSNGLQAS
FT                   SPDSETFVNAQGTRITGKGNHAGQSASYTLDGIKLQGKAGEPSLMATHAGLMVSGNNGN
FT                   IVINGNRGEILIPDVKPDASGFVAINKNYVDARNHELRTQIHHADRRLRAGIAGANAAA
FT                   ALASVSMPGKSMVAIAAAGHDGESALAIGYSRISDNGKVMLKLQGNSNSQGKVSGAVSV
FT                   GYQW"
FT   gene            407469..409049
FT                   /gene="prfC"
FT                   /locus_tag="HS_0384"
FT   CDS_pept        407469..409049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="HS_0384"
FT                   /product="bacterial peptide chain release factor 3 (bRF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24662"
FT                   /db_xref="GOA:Q0I2G9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I2G9"
FT                   /protein_id="ABI24662.1"
FT                   /translation="MSYSQQVNKRRTFAIISHPDAGKTTITEKVLLYGNAIQKAGSVKG
FT                   KGSQAHAKSDWMEMEKQRGISITTSVMQFPYHDCLVNLLDTPGHEDFSEDTYRTLTAVD
FT                   SCLMVIDSAKGVEERTIKLMEVTRLRDTPILTFMNKLDRDIRDPMELLDEVESVLKIRC
FT                   APITWPIGCGKLFKGVYHLYKDETYLYQSGQGHTIQDVRIIKGLNNVDLDRAVGEDLAR
FT                   QLRDELELVKGASNEFDHDLFIRGELTPVFFGTALGNFGVDHFLDGLTQWAPAPQARQA
FT                   DCRLVESAEEKLTGFVFKIQANMDPKHRDRVAFMRIVSGKYEKGMKLKQVRLGKEVVLS
FT                   DALTFMAGDRSHAEEAYAGDIIGLHNHGTIQIGDTFTQGEDLKFTGIPNFAPELFRRIR
FT                   LKDPLKQKQLLKGLVQLSEEGAVQVFRPLTNNDLIVGAVGVLQFDVVVSRLKSEYNVEA
FT                   VYETVNVAAARWVECSEAKKLEEFKRKNEQNLALDGGDSLTYIAPTMVNLNLTQERYPD
FT                   IQFFKTREH"
FT   gene            complement(409166..411601)
FT                   /gene="plsB"
FT                   /locus_tag="HS_0385"
FT   CDS_pept        complement(409166..411601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsB"
FT                   /locus_tag="HS_0385"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24663"
FT                   /db_xref="GOA:Q0I2G8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I2G8"
FT                   /protein_id="ABI24663.1"
FT                   /translation="MSSILNFYRNLLSVPLSFLVKNNPIPQQPIEELSLDISQPIIYLL
FT                   PYTSQTDLIIIRKNCLSVGLPDPLEENELGGQCLPRYVFLDEGRRFFKSKGAKSATIQI
FT                   VEKYLELHRSLPDLNVQLVPVSVLWGRSPGHEKQVGLPKLRLLNSIQKTAVAIWFGRDT
FT                   FVRFSQAVSLRYMADEYGTDASIALKLARVAKIHFAKQRMSATGPRLPNRQAMFNKLLQ
FT                   SPAILNAIADEAKSKRISKEKARKEAYKILDEIAANVNYEGLRVADRFLGWLWNKLYQG
FT                   IDVQNAERVRKLALEGHEIVYIPCHRSHIDYLLLSYVLYHQGLVPPHIAAGINLNFWPV
FT                   GMMFRRGGAFFIRRTFKGNRLYSTIFREYLAELFHRGYSVEFFIEGGRSRTGRLLAPKT
FT                   GMMSMTVQALQQNQIRPISVVPVYVGYEHVLEVDTYAKELRGAAKEKENAGLVLRVIRK
FT                   LRNLGQGYVNFAEPITLSNYLNQHFPEWKDSQLEEHSQWFNPAVNAISNQVMININKAA
FT                   AINAMNLTGTALLSSRQRALSREQLLEQLKSYQRFLQHAPYSNDIIVPTDTPEEILTHV
FT                   LNLERVGLIVEKDNFGEMLRLERSAAVLMTYYRNNIQHVFVLPSLIASIIFHHGAIQKE
FT                   LVSNAARKIYPFLKEELFLHFSQDELDEYVEKIIEEFTRQKLILCAENLLSINKERVRV
FT                   LQLWMAGVREILQRYYITVSILQDTPNIAKATLEKESQSIAQRLSVLHGINAPEFFDKA
FT                   VFSAFIGSLRSNGYFDKNGVAITEKLNDISDILDRIISTEVQLTIKSAVGKHEEVQEY"
FT   gene            411763..412395
FT                   /gene="lexA"
FT                   /locus_tag="HS_0386"
FT   CDS_pept        411763..412395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lexA"
FT                   /locus_tag="HS_0386"
FT                   /product="SOS-response transcriptional repressor, LexA"
FT                   /note="repressor of lexA"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24664"
FT                   /db_xref="GOA:Q0I2G7"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I2G7"
FT                   /protein_id="ABI24664.1"
FT                   /translation="MSSIKSLTTRQQEVFDLIKRHIESTGMPPTRVEISKELGFRSPNA
FT                   AEEHLKALARKGVIEIVSGVSRGIRLLTDIEEPENEGLPLIGRVAAGEPILAEQHIEAT
FT                   YQVDANMFKPQADFLLKVYGQSMKDIGILDGDLLAVHSTKDIRNGQIVVARIEDEVTVK
FT                   RFERKGSVVYLHAENEEFEPIVVDLTQQPYFEIEGIAVGIIRNNAWM"
FT   gene            complement(412482..412907)
FT                   /gene="ndk"
FT                   /locus_tag="HS_0387"
FT   CDS_pept        complement(412482..412907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="HS_0387"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24665"
FT                   /db_xref="GOA:Q0I2G6"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I2G6"
FT                   /protein_id="ABI24665.1"
FT                   /translation="MTLEQTLAIIKPDAVERNLIGNIISRLEDKGFQIIAMKMLHLNQE
FT                   QAEGFYTEHSDKAFFAELIRYMTSAPIVVLVLQKENAVKDYRTFMGTTNPEIAENGTLR
FT                   YEFAINQTQNSVHGSDSLENAQREIAYFFAEAEIYAR"
FT   gene            complement(412919..414217)
FT                   /gene="pepB"
FT                   /locus_tag="HS_0388"
FT   CDS_pept        complement(412919..414217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepB"
FT                   /locus_tag="HS_0388"
FT                   /product="aminopeptidase B, Metallo peptidase, MEROPS
FT                   family M17"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24666"
FT                   /db_xref="GOA:Q0I2G5"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR001346"
FT                   /db_xref="InterPro:IPR008330"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2G5"
FT                   /protein_id="ABI24666.1"
FT                   /translation="MQIKIEISPAKEQWGKKALISFTHDQAIIHHPTRNQDISLIQKAA
FT                   RKLRNQGIKEVELIGSEWDLENCWAFYQGFYTAKQDYTIEFPHLEDEPQAELLARIQCG
FT                   DFVREIINLPSSIITPIELAKRAAQFITEQASLYADESAVSFQIISGQELAEKNYQGIW
FT                   QVGKGSENLPAMLQLDFNPTGNENAPVLACLVGKGITFDSGGYSIKPSDSMSTMRTDMG
FT                   GAALLTGALGMAIAGGLNKRVKLFLCCAENMVSHNALKLGDIIHYRNGISAEILNTDAE
FT                   GRLVLADGLIDADLAKPKFILDCATLTGAAKVAVGNDYHAILSMDNELTQQFFDCAKST
FT                   KEPFWRLPFDELHRHQISSSFADIANIGTVPMGAGASTAMAFLSYFVENYQENWLHIDC
FT                   SATYRKSASDLWATGATGIGVQTLANFLLNKAE"
FT   gene            complement(414327..414929)
FT                   /gene="leuD"
FT                   /locus_tag="HS_0389"
FT   CDS_pept        complement(414327..414929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="HS_0389"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24667"
FT                   /db_xref="GOA:Q0I2G4"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I2G4"
FT                   /protein_id="ABI24667.1"
FT                   /translation="MAGIKQHSGLVVPLDAANVDTDAIIPKQFLQAITRVGFGKHLFHE
FT                   WRYLDEEGTVPNPKFVLNFPEYQGATILLARKNLGCGSSREHAPWALADYGFKVMIAPS
FT                   FADIFYNNSLNNHMLPIRLNEEEVEEIFQWVWKNKGCEIHVNLENLTVTTGNKIYHFEL
FT                   DEFRRHCLLNGLDNIGLTLQHEDKIAEYEKNIPAFLR"
FT   gene            complement(414939..416348)
FT                   /gene="leuC"
FT                   /locus_tag="HS_0390"
FT   CDS_pept        complement(414939..416348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="HS_0390"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24668"
FT                   /db_xref="GOA:Q0I2G3"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I2G3"
FT                   /protein_id="ABI24668.1"
FT                   /translation="MKKTLYQKLFDSHIVHEAPGEVPILYINRHLIHEVTSPQAFDGLR
FT                   VAGRQVRQVNKTFGTMDHSISTQVRDVNKLTGQAKIQVLELDKNCKATGISLFDMNSKQ
FT                   QGIVHVMGPEQGLTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQARA
FT                   KSMKIEVRGEVAKGITAKDIILAIIGKTTMAGGTGHVVEFCGEAIRALSMEGRMTVCNM
FT                   AIEMGAKAGLIAPDETTFAYLKDRPYAPKGKDWESAVEYWKTLKTDEGAEFDTVVILDA
FT                   KDIAPQVTWGTNPGQVIGIDQKVPNPAEMQDPVTKASAEKALAYIGLSPETDLKDISVD
FT                   QVFIGSCTNSRIEDLRAAATVMKGRKKADNVKRVLVVPGSGLVKEQAEKEGLDKIFIAA
FT                   GAEWRNPGCSMCLGMNDDRLGEWERCASTSNRNFEGRQGRNGRTHLVSPAMAAAAAVFG
FT                   KFVDIRYMELN"
FT   gene            complement(416449..417525)
FT                   /gene="leuB"
FT                   /locus_tag="HS_0391"
FT   CDS_pept        complement(416449..417525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="HS_0391"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24669"
FT                   /db_xref="GOA:Q0I2G2"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2G2"
FT                   /protein_id="ABI24669.1"
FT                   /translation="MKSYTIAVLSGDGIGPEIMAEAIKVLDAVQKKYNFKLNYRTFDVG
FT                   GIAIDNHGTPLPASTLNGCEESDAILFGSVGGPKWEHLPPNQQPERGALLPLRKHFKLF
FT                   CNLRPATLYQGLEKFCPLRADIATKGFDMMTVRELTGGIYFGQPKGRDGEGMQTRAFDT
FT                   EVYYKYEIERIAKVAFETAMKRRKHVTSVDKANVLISSVLWRETVNEVAKNYPDVTLDH
FT                   IYIDNATMQLIKQPEFFDVLLCSNIFGDIISDEAAMITGSMGMLPSASLNEHGFGLYEP
FT                   AGGSAPDIAGKGIANPIAQILSAAMMLRYSFNLNEAADSIENAVKQVLSQGYRTADLAD
FT                   EHPPISTAEMGDLIVNAI"
FT   gene            complement(417549..419102)
FT                   /gene="leuA"
FT                   /locus_tag="HS_0392"
FT   CDS_pept        complement(417549..419102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="HS_0392"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24670"
FT                   /db_xref="GOA:Q0I2G1"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I2G1"
FT                   /protein_id="ABI24670.1"
FT                   /translation="MQNNIIIFDTTLRDGEQALKASLTVKEKLQIALALERLGVDVMEV
FT                   GFPVSSAGDFESVQTIARHIKNSRVCALSRAMDKDIDIAADALKVAEAFRIHTFIATSA
FT                   LHVEAKLRRTFDDVVEMAIQAVKRARRYTDDVEFSCEDAGRTGVDNICRIVEAAIKAGA
FT                   TTVNIPDTVGFCLPTEYGNIINQVMNRVPNIDKAVISVHCHNDLGMATANSLTAVQNGA
FT                   RQIECTINGIGERAGNTALEEVVMAIKTRQDIFKGLDTRINTQEIHRVSQMVSQLCNMP
FT                   IQPNKAIVGSNAFAHSSGIHQDGMVKNKNTYEIMSPETIGLKKEKLNLTARSGRAAVKS
FT                   HMDAMGYQQNDYDLDKLYAAFLKLADKKGQVFDYDLEALAFIDMQQGDEDRLSLDVITS
FT                   QTISNLPASAFVQVELDGKKISQVSNGGNGPVDAVYNAILAITDMDITMLHYNLTAKGE
FT                   GAEALGQVDIVVEHKGRRFHGVGLATDIVESSARALIHAINAIYRANKVADLKSHKISQ
FT                   "
FT   gene            419699..420352
FT                   /gene="ccmA"
FT                   /locus_tag="HS_0393"
FT   CDS_pept        419699..420352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmA"
FT                   /locus_tag="HS_0393"
FT                   /product="heme ABC transporter, ATP-binding protein
FT                   (heme-transporting ATPase)"
FT                   /EC_number="3.6.3.41"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24671"
FT                   /db_xref="GOA:Q0I2G0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I2G0"
FT                   /protein_id="ABI24671.1"
FT                   /translation="MQNNHLQLEQLACQRGDKILFTDLNLDAKSGDFVQIEGHNGIGKT
FT                   SLLRIIVGLSFPAKGKVRWNKIEINKNREEYQHNLLYLGHLAGIKPELSAWENLQFYQK
FT                   IGNCRQSEELLWDILQKVGLLGREDLPAGQLSAGQQKRIALARLWLSNAALWILDEPFT
FT                   AIDKQGVNVLTQLFEQHVENGGIVILTSHQEIPSNKLQKVRLDQYKFFDQGNMA"
FT   gene            420349..421014
FT                   /gene="ccmB"
FT                   /locus_tag="HS_0394"
FT   CDS_pept        420349..421014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmB"
FT                   /locus_tag="HS_0394"
FT                   /product="heme ABC transporter, permease (heme exporter
FT                   protein B)"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24672"
FT                   /db_xref="GOA:Q0I2F9"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2F9"
FT                   /protein_id="ABI24672.1"
FT                   /translation="MIFVQIIKRELKIACRKQAEILNPLWFFLIILTLFPLVIGPDPKL
FT                   LAKIAPGIAWVAALLSALLSFERLFRDDFVDGSLEQLMLTAQPLAMTALAKVIAHWLLT
FT                   GLPLILLSPIAGLLLSLELHIWWALVLTLLLGTPTLSCLGAIGVALTVGLRKGGVLLSL
FT                   LVLPLFIPVLIFSAAVLDAATLNLSYNGQLAILGAIFVSVATLSPFAISIALRVSLDQ"
FT   gene            421064..421795
FT                   /gene="ccmC"
FT                   /locus_tag="HS_0395"
FT   CDS_pept        421064..421795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmC"
FT                   /locus_tag="HS_0395"
FT                   /product="heme ABC transporter, permease (heme exporter
FT                   protein C)"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24673"
FT                   /db_xref="GOA:Q0I2F8"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2F8"
FT                   /protein_id="ABI24673.1"
FT                   /translation="MWKWLHPYAKAETQYHLCGKFVPLFATVSILLLITGVIWGLAFAP
FT                   ADYQQGNSFRIIYIHVPAAIFSMGIYVSMAIAGVIGLVWQIRQAYLSILAMAPIGIVFT
FT                   FLTLVTGAIWGKPTWGTWWVWDARLTSSLILFFLYLGVIALYSAFQDRLIGMKAAAILS
FT                   IVGVVNIPVIHFSVQWWNTLHQGASITKFEKPSIATPMLIPLILCIFGFMALTMWFTLM
FT                   NYRTQLLKDESKRPWVKALVK"
FT   gene            421805..422017
FT                   /gene="ccmD"
FT                   /locus_tag="HS_0396"
FT   CDS_pept        421805..422017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmD"
FT                   /locus_tag="HS_0396"
FT                   /product="heme ABC transporter, substrate-binding protein
FT                   (heme exporter protein D)"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24674"
FT                   /db_xref="GOA:Q0I2F7"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2F7"
FT                   /protein_id="ABI24674.1"
FT                   /translation="MFFQSWSDFFYMGGHGLYVWLSYGISFLAIIGLGLQNIYLRKALF
FT                   KEIQREQLRSVRQKNTQAENNGENL"
FT   gene            422014..422538
FT                   /gene="ccmE"
FT                   /locus_tag="HS_0397"
FT   CDS_pept        422014..422538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmE"
FT                   /locus_tag="HS_0397"
FT                   /product="cytochrome c-type biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24675"
FT                   /db_xref="GOA:Q0I2F6"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I2F6"
FT                   /protein_id="ABI24675.1"
FT                   /translation="MNPRRKSRLSVVLFIFLGISVASALVLYALRQNIDLFYTPTEVVN
FT                   GKNNESHTKPSIGQRIRIGGMVVEGTVERDPKSLKVRFDLNDIGPSVTVIYEGILPDLF
FT                   REGQGIVAQGVLIEPTVLNATEVLAKHDENYVPPELEAQMQKIHKPMGISDLKNESDRD
FT                   RQEKQFKEGNQ"
FT   gene            422535..424484
FT                   /gene="ccmF"
FT                   /locus_tag="HS_0398"
FT   CDS_pept        422535..424484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmF"
FT                   /locus_tag="HS_0398"
FT                   /product="cytochrome c-type biogenesis protein F"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24676"
FT                   /db_xref="GOA:Q0I2F5"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2F5"
FT                   /protein_id="ABI24676.1"
FT                   /translation="MIAELGNYALALSLAISVLLSIFPLWGAEKGNVQMMALARPMTYG
FT                   LFVSLTVSFVALFYLFLTNDFSVQYVVNNSNTNLPLQYRLSAVWGSHEGSLLLWIWLLT
FT                   LWSAAVAFLSKQLPQEAVARVLAIMGIITIGFLLFVMFTSNPFDRTFPDFPVEGRELNP
FT                   LLQDIGLIFHPPLLYMGYVGFSVAFAFAIASLMTGKLDTAWARWSRPWTMAAWVFLTLG
FT                   IVLGSWWAYYELGWGGWWFWDPVENASLMPWLAGTALLHSLAVTEKRGSFKAWTVLLAI
FT                   LAFSLCLLGTFLVRSGILVSVHAFASDPTRGLYILAYLIVVIGGSLALYAYKGNLIRTR
FT                   NNAERYSRETMLLINNILLMTALSVVFLGTLLPLVHKQLGLGTISIGSPFFDQMFLLIM
FT                   IPLSLLLGVGPLVKWRRDQFCAIRLPVIISSIIMLITGFVLPYFLQDRIAVSAVLGVMM
FT                   AMFILLLALYELQQRATHKHSFWIGITKLSRSHWGMVLAHLGVAMTIWGIAFSQNYSIE
FT                   RDVRMNVGDTVKIADYEFTFQGISDANGVNYLGGKAQIDISRNGKFETTLFAEKRFYTV
FT                   SKMTMTEAAIDWGLSRDLYVALGESLNDGSWALRLYYKPFIRWIWLGGIFMAFGGLLCI
FT                   FDRRYRFGKLLKQG"
FT   gene            424488..425033
FT                   /gene="dsbE"
FT                   /locus_tag="HS_0399"
FT   CDS_pept        424488..425033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbE"
FT                   /locus_tag="HS_0399"
FT                   /product="thiol:disulfide interchange protein"
FT                   /note="cytochrome c-type biogenesis protein G"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24677"
FT                   /db_xref="GOA:Q0I2F4"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2F4"
FT                   /protein_id="ABI24677.1"
FT                   /translation="MNKKLYIPLILFLGLAFAFFVQLQRNAQSDDPKALESALIGKSVP
FT                   NKLLTDLLTDKQYDNRLFKQGKPLLVNVWATWCPTCYAEHQFLNELHKQGINIIGINYK
FT                   DKTDKAIKWIKKLGNPYQVIVKDEKGSFGLDLGVYGTPETFIVDGNGIIHYRHTGDINE
FT                   RIWKEKIQPIYQQVSEKK"
FT   gene            425030..425500
FT                   /gene="ccmH"
FT                   /locus_tag="HS_0400"
FT   CDS_pept        425030..425500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmH"
FT                   /locus_tag="HS_0400"
FT                   /product="cytochrome c-type biogenesis protein H"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24678"
FT                   /db_xref="GOA:Q0I2F3"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2F3"
FT                   /protein_id="ABI24678.1"
FT                   /translation="MMTKLRYFLTALFLSFSAQAAIDALNFTSMQQEKDYHSLTQELRC
FT                   PQCQNNNIADSNASIAVDMRAKVYELLQKGQNKQQIIDYMVERYGNFVTYNPPVTGSTI
FT                   ILWVAPLALMILGVVIVLRRKSGSSSKSAVEAQPNLTQEQQKRLEELLKERE"
FT   gene            425504..426388
FT                   /locus_tag="HS_0401"
FT   CDS_pept        425504..426388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0401"
FT                   /product="cytochrome c-type biogenesis protein, with TPR
FT                   repeats"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24679"
FT                   /db_xref="GOA:Q0I2F2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017560"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2F2"
FT                   /protein_id="ABI24679.1"
FT                   /translation="MIFWVICLLLTLAIAFICFYPLLRNKTEKSTNLKRDELNKAFYFN
FT                   RLKEIEEDEQYGLLENSQEFKTELQQTLLEDIPEKMAVEKSNKQYGQIWFISGFLTLAI
FT                   IAPFTYMSVGSWQSEIMLEKTYEKLPHFYARVKEEANKPLNENELQQFAVALRLKLQKE
FT                   PNNAADWWTLGQVAMNLEKAQLAFDSFSQANKLAPQNIEYKLSLARILMFSQDQIDRQR
FT                   GMNLLKEVLRIDHTNMQALSLLAFQYFESEDYQRAAVTWTMMLRFMPKNDPRVPLIEKS
FT                   IRTARDAIKEDSK"
FT   gene            426401..428257
FT                   /gene="arcB"
FT                   /locus_tag="HS_0402"
FT   CDS_pept        426401..428257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcB"
FT                   /locus_tag="HS_0402"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24680"
FT                   /db_xref="GOA:Q0I2F1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR014409"
FT                   /db_xref="InterPro:IPR027460"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR040642"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2F1"
FT                   /protein_id="ABI24680.1"
FT                   /translation="MKNLKYFAQKYVDWVIRLGRIRFSLLGVCILAVVALLTQIVVSLI
FT                   FIGTIYWQDVARSIIFGLFSAPFVLYFFTLLVEKLEKSRLDLAKLVDNLRNEVSERILA
FT                   ERKLSVALSEIEKTSQDKTALMTTISHELRTPLNGIIGLSQILLDDKLTEQQRNYLKTI
FT                   NVSAISLTHIFSDIIDLEKIDANRIELHYQPTNLCSFLNDITNFATLMAAQRKLKFELV
FT                   CDKDLPDWLMLDSARLSQILWNLINNAVKFTPAGKIKLKVSRLTDDTFSFALSDTGVGI
FT                   AKGELDKIFTMYYQVQETDHKPIGSGIGLAVSKAIAGLMGGDLTVESQLHQGATFTLTL
FT                   QAKAVEKPAESESNVPNTLTILLVEDIEVNIIVAKSVLEKLGYCVDVAMTGKEAIQKFE
FT                   QNYYDLVLLDIQLPDMSGFTIAQYLREKYEQGVYDFLPPLIALTANIMQSKTEYQKQGM
FT                   DDVLRKPLSLEALVNCLSDYFGDELNTKIIKKSSFVEFSALSDVLNMELLVELNDILGK
FT                   EFIGKNLLLFKQTMPSYVNELLDSYEQYKQDSAVKKDLLSNVHKIKGAAASVGLLRLQQ
FT                   VASLAQDANHENWETHIDEWINTLANDWLVDTATLEDWLNDL"
FT   gene            428344..429300
FT                   /locus_tag="HS_0403"
FT   CDS_pept        428344..429300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0403"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24681"
FT                   /db_xref="GOA:Q0I2F0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR025194"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2F0"
FT                   /protein_id="ABI24681.1"
FT                   /translation="MTNLTEKLEETASNNELLLGERFRMAREKLQLSLDDVSKQINLRP
FT                   AILQLLENNEFTHKSIPTTFMKGYVRNYAKFLRIPEEIWTKAISSVEENTRHNLGKNTC
FT                   LMKAVNGHSSHGRWIGYVTVLVLLIVSGMTALWWWGNYQKSNQERDTFVQHYVENVPSE
FT                   RIEIQADQVLEKNLTIPVEKPQVVSVNETTVVNKDSMAENKLTSVSTQEQSAVQNPQEI
FT                   VSNKTSETEKTVKNTETFVGGDLQIEIIGASCWISVKDAKHKVLAQKEYKQGEVLVFTD
FT                   GSPYSLIIGAPSNVKITYKGEHYPLKVDGRVAKFKLQ"
FT   gene            429307..430413
FT                   /gene="ispE"
FT                   /locus_tag="HS_0404"
FT   CDS_pept        429307..430413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="HS_0404"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24682"
FT                   /db_xref="GOA:Q0I2E9"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I2E9"
FT                   /protein_id="ABI24682.1"
FT                   /translation="MSSFKPTINRRQSTKIYVGNVPIGGDAPIAVQSMTNTRTTDIEAT
FT                   VAQIKALERVGADIVRISVPTMDAAEAFKSIKQQVNIPLVADIHFDYRIALKVAEYGVD
FT                   CLRINPGNIGREDRIRAVVDCAKDKNIPIRIGVNAGSLEKDLQEKYGEPTPEALLESAL
FT                   RHVEILDRLNFDQFKVSVKASDVFLAVESYRLLAKAIKQPLHLGITEAGGARAGAVKSA
FT                   VGLGMLLAEGIGDTLRVSLAADPVEEIKVGFDILKSLRIRSHGINFIACPTCSRQEFDV
FT                   IGTVNALEQRLEDIVTPMDVSIIGCVVNGPGEALISDLGVTGGNKKSGYYLDGKRQKER
FT                   FDNEDLINQLEAKIRAKVAQQDPKNRII"
FT   gene            430426..431703
FT                   /gene="hisS"
FT                   /locus_tag="HS_0405"
FT   CDS_pept        430426..431703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="HS_0405"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24683"
FT                   /db_xref="GOA:Q0I2E8"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I2E8"
FT                   /protein_id="ABI24683.1"
FT                   /translation="MAKTIQAIRGMNDCSPTESLLWQWVEEKVRSVLQTYGYSEVRMPI
FT                   VESTPLFARAIGEVTDVVSKEMYTFWDNDEQLTLRPEGTAGCVRAAIEHGWIYNNEQRL
FT                   WYMGPMFRHERPQKGRYRQFHQAGVEVFGIANPEIDAELILLTARLWKQLGIFDHVTLQ
FT                   LNSIGSLESRQNYRSALVEFLQQHTDLLSEEEKERLVKNPLRILDTKNQVLQEVLNDAP
FT                   KLLDYLDQESREHFSQLCDLLDAVGIQYEINPKLVRGLDYYNKTVFEWVTSALGAQGTV
FT                   CGGGRYDGLVEQLGGHATCSVGFAMGLERLVLLVQEVNKQIVLPSAVDIYVVYFGEKTT
FT                   LPAFQLAEKIRTELPHLRTMTHCGGGNFKKQFKRADKVGAKFALVIGETEVKTQQVVVK
FT                   DLLGGAEQLSLALTDVVIYLKQAITQ"
FT   gene            431714..432325
FT                   /locus_tag="HS_0406"
FT   CDS_pept        431714..432325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0406"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24684"
FT                   /db_xref="GOA:Q0I2E7"
FT                   /db_xref="InterPro:IPR004934"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018704"
FT                   /db_xref="InterPro:IPR026039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2E7"
FT                   /protein_id="ABI24684.1"
FT                   /translation="MAYTIEEEQELNELKTWWKENYKSIIVIVVLAFSGVFGWRYWQDY
FT                   QTTKKQTLSAQYDQLISSAENQSIYNAQLDRFVQENGETTYAVFALLDKAKLEVSQQNF
FT                   VQAEETLKQAIVNTSDDILMSITAIRLATVQYQLQKFDEALASLNQVKGQSWDVSKLLL
FT                   SGDIQLAKGNKEIAKDNFEQALTKATSWEKSFIQVRLNSL"
FT   gene            432401..433828
FT                   /gene="attK"
FT                   /locus_tag="HS_0407"
FT   CDS_pept        432401..433828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="attK"
FT                   /locus_tag="HS_0407"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24685"
FT                   /db_xref="GOA:Q0I2E6"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2E6"
FT                   /protein_id="ABI24685.1"
FT                   /translation="MKTQAYINGEFISAKNHRTFPVINPANQQVICEIACCGKEETELA
FT                   IKSAKQAQVHWKKYTAKERSKILKKWFELIMQHQESLAYLLSLEQGKPLSESRAEIAYG
FT                   ASFVEWFAEEAKRAYGEIIPQVREDHRLLVIKQPVGVVAAITPWNFPNAMITRKAAPAL
FT                   AAGCAIIIKPAPETPLSALALAALAEQAGIPKGIFNVLPTVYAEEVGSVLTRSTDVRKL
FT                   TFTGSTKIGKILMQQCADTVKKISLELGGNAPSLIFNDADLDRTVDSVIASKFRNSGQT
FT                   CICTNRIYVQSEIYRAFADKLKQKVRSFIVGDFQQEAVNIGPLINESAVRKIERHIEDA
FT                   LSKGAILTLGGQRHSLGGTFFEPTILENVSQDMLVCHEETFSPLAALIPFDTEEQAISM
FT                   ANDSEFGLAAYVYTQDFSRIWRLSEELECGLVGVNEGIISNEVSPFGGVKQSGLGREGS
FT                   RHGLDEFLEMKYLCMKV"
FT   gene            complement(433984..435240)
FT                   /gene="proA"
FT                   /locus_tag="HS_0408"
FT   CDS_pept        complement(433984..435240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="HS_0408"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24686"
FT                   /db_xref="GOA:Q0I2E5"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I2E5"
FT                   /protein_id="ABI24686.1"
FT                   /translation="MNLKEMGKNAKQAATILAQLSQQQKNTALQIIAEQLELQSNKILV
FT                   ENAKDIQLAKENGLSDAIIDRLLLTKERINSIANDVRHIISLPDPIGQIIDGGILESGT
FT                   KLERVRVPLGVIGVIYEARPNVTVDVATLCLKTGNAVILRGGKETSYSNKILVTVIQDA
FT                   LEQTGLPKNAVQAITDPDRNFVLELLKLDKYVDMIIPRGGAGLHEFCKQNSTIPVIIGG
FT                   VGVCHVFVEESAEQDKALAVIDNAKTQRPSTCNTLETLLVQESIATEFLPKLVAHLKHK
FT                   NVKYHADPTALSILEKQNAEVSIVQEQQLRQEWGSLDLNVVIVKDIQQAIAHITEYGTQ
FT                   HSEAILTSSPRLAHQFVSLVDAAAVYVNASTRFTDGGQFGLGAEVAVSTQKLHARGPMG
FT                   LEALTTYKWVCSGDYTVRQ"
FT   gene            complement(435250..435921)
FT                   /locus_tag="HS_0409"
FT   CDS_pept        complement(435250..435921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0409"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24687"
FT                   /db_xref="GOA:Q0I2E4"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2E4"
FT                   /protein_id="ABI24687.1"
FT                   /translation="MLLSILYIIGITAEAITGALAAGREKMDIFGVIIIASMTAIGGGS
FT                   IRDILLGHYPLGWVKNPHYFLIVTGAAILTVFIAPFIKHFIRYFRTIFLVLDALGLIVF
FT                   SIIGAQIALDMGHGFTVTCIAAIVTGAFGGVLRDSLCNRIPLVFQKELYASIALLATGI
FT                   YVGLQQLQINQNLVIIITLISGFIIRLLAIYFEWGLPIFDYQEQEAEKVKTHDKLPKKT
FT                   K"
FT   gene            complement(436082..436669)
FT                   /gene="tdk"
FT                   /locus_tag="HS_0410"
FT   CDS_pept        complement(436082..436669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdk"
FT                   /locus_tag="HS_0410"
FT                   /product="thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24688"
FT                   /db_xref="GOA:Q0I2E3"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR020633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2E3"
FT                   /protein_id="ABI24688.1"
FT                   /translation="MAKLYFYYSTMNAGKSTTLLQSDYNYRERNMNTLVYTAAIDDRFG
FT                   KGKVSSRIGIHRQANLFHKDTDLFTEIALHIKQQKLHCILIDEAQFLTKAQVYQLSNVV
FT                   DELNIPVLCYGLRTDFQAELFEGSKYLLAWADQLEELKTICYCGRKANFVLRLNEQGKA
FT                   VKDGEQIQIGGNDSYMSVCRKHYKEILYSSNE"
FT   gene            complement(436731..437759)
FT                   /gene="gcp"
FT                   /locus_tag="HS_0411"
FT   CDS_pept        complement(436731..437759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="HS_0411"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24689"
FT                   /db_xref="GOA:Q0I2E2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2E2"
FT                   /protein_id="ABI24689.1"
FT                   /translation="MRILGIETSCDETGVAIYDEKKGLIANQLYTQIALHADYGGVVPE
FT                   LASRDHIRKTAPLIQAALQQAGLEAKDIDGIAYTCGPGLVGALLVGSTIARSLAYAWNI
FT                   KAIGVHHMEGHLLAPMLENNPPKFPFVALLVSGGHTQLVRVNAVGQYELLGESIDDAAG
FT                   EAFDKTAKLLGLDYPGGSALSRLAEKGNPERFFFPRPMTDRPGLDFSFSGLKTFAANTI
FT                   NQAIKQEGELTEQTKADIAYAFQQAVVDTLAIKCRRALKETGFKRLVIAGGVSANKQLR
FT                   QSLADMMKQLKGEVFYPQPQFCTDNGAMIAYVGFLRLKQGEYSPLEIDVKPRWAMTELK
FT                   AI"
FT   gene            437995..439101
FT                   /gene="dprA"
FT                   /locus_tag="HS_0412"
FT   CDS_pept        437995..439101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dprA"
FT                   /locus_tag="HS_0412"
FT                   /product="DNA processing chain A"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24690"
FT                   /db_xref="GOA:Q0I2E1"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2E1"
FT                   /protein_id="ABI24690.1"
FT                   /translation="MDKRNELLLRLLQVPKLGASGITQLLSHIDLKTLEDYDDVAFHYL
FT                   GWKPEQINRWLYPDLRYIEPALFWASKKGHYLMNFYQENYPYLLKQTIGAPPLLFIKGN
FT                   PEILAQQQVAIVGSRHCSHYGEYWAKYFATELFLAGFVITSGLALGIDGFCHQAVVDIQ
FT                   GQTIGVLGGGLEELYPKQHKKLAQQMLDYGGALVSEFLPHQPPKPQHFPQRNRIISGLS
FT                   KGVLVVEATEKSGSLITARYALEQNREVFALPGQIQNEYSQGCHRLIKDGALLVENVAD
FT                   IVENLSPFMHYERQLTAKQIETQFPPAYKLPASPTYPELYAHIGYTPVGLDELSNKSGL
FT                   SVDTLLIQLLELELQDLVIAEKGLYRRT"
FT   gene            complement(439084..439686)
FT                   /locus_tag="HS_0413"
FT   CDS_pept        complement(439084..439686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0413"
FT                   /product="16S rRNA m(2)G-966 methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24691"
FT                   /db_xref="GOA:Q0I2E0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2E0"
FT                   /protein_id="ABI24691.1"
FT                   /translation="MKKNQPNRIQEKNKGEVRIIAGLWRARKLPVLNSTGLRPTGDRVK
FT                   ETLFNWLMPHIVDSNCLDCFAGSGSLGFEALSRQAKNVTFLELDKTIANQLNKNVAILK
FT                   CTNANVINQNSLHYLNKTQTEPHFDIVFIDPPFYFNLAEQAIKLLVQHNWLHANALIYV
FT                   ETEREKTLTTPANWQLLKEKNTKQVSYRLYQHLSPSI"
FT   gene            439750..441093
FT                   /gene="ftsY"
FT                   /locus_tag="HS_0414"
FT   CDS_pept        439750..441093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="HS_0414"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="signal recognition particle (docking protein)"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24692"
FT                   /db_xref="GOA:Q0I2D9"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2D9"
FT                   /protein_id="ABI24692.1"
FT                   /translation="MSEEKKKGRFWSWLGLGQKTEDPISEQQLEQQSGQQESVAREQES
FT                   TSNIEQVIKEPEHIDDTSSDLVLSAHLQEQEVKEYSLHERELSQNTVIEIESAVEKTDI
FT                   FIEEDTTYQAINKEQREETTITSVKEVIPQEQEKTAENGFFSRLVKGLLKTKQNIGIGF
FT                   RSLFLGKKIDDELFEELEEQLLIADIGVPTTTKIINNLIQHASRKQLQEADLLYQQLKV
FT                   ELADILKPVEQPLQLDNSKKPYVILMVGVNGVGKTTTIGKLANQFQRQGKSVMLAAGDT
FT                   FRAAAVEQLQVWGERNQIPVIAQSTGSDSASVIFDAMQSAVARNIDVLIADTAGRLQNK
FT                   NNLMDELKKIVRVIKKCDETAPHEIMLTLDSGTGQNAISQAKLFNEAVGLTGISLTKLD
FT                   GTAKGGVIFAIADQFNLPIRYIGVGEKIDDLRPFQADEFIDALFIQEE"
FT   gene            complement(441256..442812)
FT                   /gene="mviN"
FT                   /locus_tag="HS_0415"
FT   CDS_pept        complement(441256..442812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="HS_0415"
FT                   /product="conserved membrane protein"
FT                   /note="possible virulence factor"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24693"
FT                   /db_xref="GOA:Q0I2D8"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2D8"
FT                   /protein_id="ABI24693.1"
FT                   /translation="MKSGIIVSAMTLLSRILGLIRDVITAQILGAGVVADVFLFANRIP
FT                   NFLRRLFAEGAFSQAFVPVLAEYQKSGDLSKTREFIGKVSGTLGGLVSVVTLLAMLFSP
FT                   VITAIFGTGWFIDWLNDSPNAIKFEQASLLLKITFPYLWFITFVALSGAILNTIGKFGV
FT                   MSFSPVLLNIAMICTALFLAPRLESPDLALAIGIFIGGLLQFLFQIPFLKQAGFLTKPQ
FT                   WAWHDEGVKKIRTLMIPALFGVSVNQINLLLDTFIASFLMTGSISWLYYSDRLLEFPLG
FT                   LFGIAISTVILPTLSRHYVNRTDNIEKSAVDFRQTMDWGVRMILLFGIPAMIGIAVLAQ
FT                   PMLLVLFMRGKFSFSDVQAASYSLWAFNAGLLSFMLIKILANGYYARQDTQTPVKIGII
FT                   AMVSNMGFNLLAIPFSYIGLAIASAMSATLNAYLLYRGLAKADIYHFTRQSAVFFVKVL
FT                   ISAIIMGAVIWYYSPALSLWKQMTFFTRVHWLGWLIFVAVITYFVMLILLGIRKHHLIS
FT                   K"
FT   gene            443105..443368
FT                   /gene="rpsT"
FT                   /locus_tag="HS_0416"
FT   CDS_pept        443105..443368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="HS_0416"
FT                   /product="SSU ribosomal protein S20P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24694"
FT                   /db_xref="GOA:Q0I2D7"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I2D7"
FT                   /protein_id="ABI24694.1"
FT                   /translation="MANIKSAKKRAVQSEKRRQHNASQRSMMRTFIKKTYAAVATGDKA
FT                   VAQAAFVEMQKVVDRMASKGLIHANKAANHKSKLAAQIKKLA"
FT   gene            complement(443430..445280)
FT                   /gene="typA"
FT                   /locus_tag="HS_0417"
FT   CDS_pept        complement(443430..445280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="HS_0417"
FT                   /product="GTP-binding protein"
FT                   /note="elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24695"
FT                   /db_xref="GOA:Q0I2D6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2D6"
FT                   /protein_id="ABI24695.1"
FT                   /translation="MTDKIDIQKLRNIAIIAHVDHGKTTLVDKLLKLSGTLDTSRGDTD
FT                   ERVMDSNDLEKERGITILAKNTAINWNGYRINIVDTPGHADFGGEVERVLSMVDSVLLV
FT                   VDAFDGPMPQTRFVTQKAFSHGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLGATDEQ
FT                   LDFPIIYASALNGVAGLEHEKLASNMDPLFEAIIEHVSPPDVELDAPFQMQISQLDYSK
FT                   YLGVIGIGRIKRGTVKPNQPVTLIDPEGKTRNGRIGQVLGHLGLQRYEAQEAYAGDIIA
FT                   VTGLGELNISDTVCDINNVEALPALSVDEPTVTMFFCVNTSPFCGKEGKFVTSRQILER
FT                   LKKELVHNVALRVEETDDSDIFSVSGRGELHLSVLIENMRREGYELAVSRPKVIFKEID
FT                   GRKQEPFEQVTIDIEEQHQGSVMEALGIRKGEVRDMIPDGKGRTRLEYIIPSRGLIGFR
FT                   NEFMTMTSGTGLLYSSFSHYDDVKPGEIGQRINGVLISNGTGKALAYSLYALQDRGKLM
FT                   VDHGAEIYEGQIIGIHSRSNDLTVNPLEGKKLTNMRASGKDDALTLTTPLKLTLEQALE
FT                   FIDDDELVEVTPISVRIRKKLLTEVERKRANRTTTSTSTR"
FT   gene            445523..446941
FT                   /gene="glnA"
FT                   /locus_tag="HS_0418"
FT   CDS_pept        445523..446941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="HS_0418"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24696"
FT                   /db_xref="GOA:Q0I2D5"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2D5"
FT                   /protein_id="ABI24696.1"
FT                   /translation="MSNTTAITNVFKLIEENDIKFVLLRFTDVKGKEHGVSLPVSLVDE
FT                   DLFEDGKMFDGSSVEGWKAINKADMLLMPIAETAVVDPFAQIPTLSIRCSIFEPTTMQS
FT                   YDRDPRSIAMRAENYMRSTGVADDVFFGPEPEFFLFDDVRFDVSMNGNSYTVDDIEAAW
FT                   NTNKHYEGGNKAYRPLKKGGYCAVAPNDVAHDIRSEMCLLMEEMGLVIEAHHHEVATAG
FT                   QNEIATKFNTLTLKADETQIYKYIVQNVAYEHGKTACFMPKPIINDNGSGMHCNMSLSK
FT                   DGKNIFQGDKYAGLSETALYFIGGIIKHAKALNAFTNPSTNSYKRLVPGFEAPVLLAYS
FT                   ASNRSASIRIPAVTNPKAIRIEARFPDPLANPYLAFSALLMAGLDGIQNKLYPGDAMDK
FT                   NLYDLPPEELKDIPAVASSLSEALDNLEKDYEFLTHGKVFSKEFIDTFIAMKRKEVERL
FT                   NMTPHPVEFEMYYA"
FT   gene            complement(447166..448098)
FT                   /gene="birA"
FT                   /locus_tag="HS_0419"
FT   CDS_pept        complement(447166..448098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="HS_0419"
FT                   /product="biotin operon repressor"
FT                   /EC_number="6.3.4.15"
FT                   /note="bifunctional; biotin--[acetyl-CoA-carboxylase]
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24697"
FT                   /db_xref="GOA:Q0I2D4"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2D4"
FT                   /protein_id="ABI24697.1"
FT                   /translation="MIKLLSILARCKPYSYKNLTALLDLTRVQLEKQIAQLRQQGICIV
FT                   DNEQNISLKPQLPLLNLSYLETELSPYKIYYHPIINSTNQYLMENILQLNKGDLCFTEY
FT                   QFAGRGRRGREWQSPFAGQLMVSFYWTFNPTVSLNGLSSVLGLATAEVLNEMGAEVKLK
FT                   WPNDLLLFGRKLAGILVEIVNAKNGLLNFIVGIGINLSLPQENKIDQPWAELLETLPEI
FT                   DRNDLAIQLVKKWYQYLTIFEQQGMHAFFQRWIKLDYFFGQEVNIISEKEIVCGIEQGI
FT                   DEEGYLLVALNNGVLRKFNGGEVSLRKKE"
FT   gene            448262..449725
FT                   /gene="guaB"
FT                   /locus_tag="HS_0420"
FT   CDS_pept        448262..449725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="HS_0420"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24698"
FT                   /db_xref="GOA:Q0I2D3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2D3"
FT                   /protein_id="ABI24698.1"
FT                   /translation="MLRIKQEALTFDDVLLVPAHSTVLPNTANLSTNLTKEIRLNIPML
FT                   SAAMDTVTEAKLAISLAQEGGIGFIHKNMTIERQADRVRKVKKFESGIVSEPVTVSPTM
FT                   TLTELAELAKKNGFAGYPVVDEQKGLVGIITGRDTRFVSDLNKTVADFMTPKDRLVTVK
FT                   EGATREEIFHLMHEHRVEKVLVVDDSFKLKGMITLKDYQKAESKPNACKDEFGRLRVGA
FT                   AVGAGPGNEERIEALVNAGVDILLIDSSHGHSEGVLQRVRETRAKYPNLPIIAGNIATA
FT                   EGAIALADAGASAVKVGIGPGSICTTRIVTGVGVPQITAIADAAEALRERGIPVIADGG
FT                   IRYSGDIAKAIAAGASCVMVGSMFAGTEEAPGEIELYQGRAFKSYRGMGSLGAMSKGSS
FT                   DRYFQSDNAADKLVPEGIEGRIPYKGLLKEIIHQQMGGLRSCMGLTGCATIEELRTKAQ
FT                   FVRISGAGIKESHVHDVTITKEAPNYRMG"
FT   gene            449845..451416
FT                   /gene="guaA"
FT                   /locus_tag="HS_0421"
FT   CDS_pept        449845..451416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="HS_0421"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24699"
FT                   /db_xref="GOA:Q0I2D2"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I2D2"
FT                   /protein_id="ABI24699.1"
FT                   /translation="MTNIHHHKILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQI
FT                   REFNPTGIILSGGPESTTEANSPRAPEYVFNAGVPVLGICYGMQTMAMQLGGLTETSTH
FT                   REFGYAEVSLRNPTALFDHLNDDATTSQTTLDVWMSHGDKVTRLPDNFQITGMTSTCPI
FT                   AAMSDESRRFYGVQFHPEVTHTKCGQKLLQNFVVDICGCETNWTAENIIEDAVARIKAQ
FT                   VGGDEVILGLSGGVDSSVTALLLHRAIGKNLHCVFVDNGLLRLNEGDQVMEMFGDKFGL
FT                   NIIRVEAEDRFLEALKGIDEPEAKRKTIGKVFVDVFDDEAKKLTDVKWLAQGTIYPDVI
FT                   ESAASKTGKAHVIKSHHNVGGLPDYMKLGLVEPLRELFKDEVRKIGLALGLPAEMLNRH
FT                   PFPGPGLGVRVLGEIKKEYCDLLRKADAIFIEELHKADWYYKVSQAFSVFLPVKSVGVM
FT                   GDGRKYDWVISLRAVETIDFMTAHWANLPYDLLGKISNRIINEVNSISRVVYDISGKPP
FT                   ATIEWE"
FT   gene            complement(451591..452031)
FT                   /locus_tag="HS_0422"
FT   CDS_pept        complement(451591..452031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0422"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24700"
FT                   /db_xref="GOA:Q0I2D1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2D1"
FT                   /protein_id="ABI24700.1"
FT                   /translation="MISGKKLKQIRLFRKLTQKELAIMSGLTDAAIRNYELGNRSPNIE
FT                   QLQKIADALNCDISALIDHDPNSIFEIMHIIFDYEKEMKFRPIAGNGEPTALLSHNPHF
FT                   DDFLVEWDEMRKKHYNEEITDEEFEDWKLSFPKKSRFLKKHK"
FT   gene            452273..452509
FT                   /locus_tag="HS_0423"
FT   CDS_pept        452273..452509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24701"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2D0"
FT                   /protein_id="ABI24701.1"
FT                   /translation="MDVEPYNKSERRTVMQKVFMTAKEVQDFLEVSRTTAYQLINEMNQ
FT                   ELMNLGYRVQRGKVNRQYFMEKYCYGKELRREV"
FT   gene            452512..453636
FT                   /locus_tag="HS_0424"
FT   CDS_pept        452512..453636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0424"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24702"
FT                   /db_xref="GOA:Q0I2C9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2C9"
FT                   /protein_id="ABI24702.1"
FT                   /translation="MGAYRDENKNGTWYCKLSYVNWKGQKLSKKKRGFSTKKEAVAWEK
FT                   EFLNGQAGSIELTFREFFELYKRDKKPRIRENTWRTKEAIVNSKIMPYIGDLLMIDITN
FT                   VTIIQWQNELMKVKDDRGRNYSPTYLRSIHAQLSSILNHACRYYNLKTNVARDVGTMGE
FT                   KEADEMSFWTQEEYEKFIAAIKDKPQSFYAFEILYWCGLRMGELLALTKEKFNFNTNTL
FT                   KVDESLQKIDGENIITPPKTKKSIRKIVMPDFLAEEIQNYLDGFYKLKPKDLIFTFSKS
FT                   YLHHEMDRGAKKANVKRIRVHDLRHSHVSLLIELGFSATAIADRVGHESIDITYRYAHL
FT                   FPSKQNEMADTLSQMRSSKQNDWDSLLKEDKNDI"
FT   gene            453626..453988
FT                   /locus_tag="HS_0425"
FT   CDS_pept        453626..453988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24703"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2C8"
FT                   /protein_id="ABI24703.1"
FT                   /translation="MIFSQETIQKQAKQIRKKKKRENNRKRNHILNFRVSDEEYELINK
FT                   KIELSQMSKQDYFIQLLTEHEISVRADYRVADAIAKEIFQLARVIKKVGKLNEIEDETL
FT                   LYILEIYEEIKKEKSL"
FT   gene            454096..455007
FT                   /locus_tag="HS_0426"
FT   CDS_pept        454096..455007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0426"
FT                   /product="possible phage DNA-polymerase or DNA-primase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24704"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2C7"
FT                   /protein_id="ABI24704.1"
FT                   /translation="MIEKYRRNIPLELKSYNQWLWFKKIKNIDKKGKVKTIKIPVSPIT
FT                   LSSKEWNLREQWGDFETAIDGLQNSGCDGLSFILTKDDPFICIDLDNVSEDKKTFIDDF
FT                   SNTYIEISQSGRGLHIFAKGSIKKNFNNQIEKVEMYHENKCIAMTGELFIVNYLVENKQ
FT                   DAIDKYYELYSPKESIYKAIDGYNDFVNTIPNANMVLDAMLKHNEKARGLFYGSNLSGD
FT                   ASKDDFQLLLFLNSFTHGNHEIMKSIFLQSALNRLGDKSKRKTEIGYLKYLDESIEKAI
FT                   KCGNRKYWDYDYHRKKKGFYLE"
FT   gene            454967..456397
FT                   /gene="virE"
FT                   /locus_tag="HS_0427"
FT   CDS_pept        454967..456397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virE"
FT                   /locus_tag="HS_0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible virulence-associated protein E"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24705"
FT                   /db_xref="InterPro:IPR007936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2C6"
FT                   /protein_id="ABI24705.1"
FT                   /translation="MTITEKRKDFILNSWIKISDDCLKEYLSRELELTDKGQVKSTTTN
FT                   IITAIVNPDYCVSHKILNGSVFFDTCSQTIRLIGSIKGESEVNLKAPRKWTDQLTNLLG
FT                   VEIEMNFGIKYSKGRMEEAVIFIANKRRVNLPKLYMKSLKYDGEDYISKLLPKYLGVDD
FT                   TALNRWIMEHMLIGMVNRVFYPGCKFDEIMVLTGEQGVGKTSFIEKLALLPDWYCSLNN
FT                   IKGKDAVSNLVGKIVVELEEFVALKNAKTADEAKLFISTRTSTVRLSYERFSADVDRTC
FT                   IMIATTNDMTFLGDFSGERRYLPVQVHKEKVGLPVMYDQEKFPQLKGVSREEYSKIVKK
FT                   DFEGAVAQAVYLFENKLYSPVLPVELRKDLNQVIQMHKNENRHVQNFFEFMDWKDTKSD
FT                   TPNRVCSGEFLSQYPQTNEKVFAELMANEMADKWELEPTDKSRKFKIDGRVRVSKKFYV
FT                   RKNMPDFIEVTDDIEIPF"
FT   gene            456719..457060
FT                   /locus_tag="HS_0428"
FT   CDS_pept        456719..457060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0428"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24706"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2C5"
FT                   /protein_id="ABI24706.1"
FT                   /translation="MKNRERNERIEIRLTEEERTIFEKKMKMAKCKTMSHFIRKCVMES
FT                   DIYIIDLQPFREIQGLLFKYASSVNQIAKRVNSTGVIYSDDIKDMQSQIEHLSKEIWDI
FT                   HSLLVKRKK"
FT   gene            457204..457629
FT                   /locus_tag="HS_0429"
FT   CDS_pept        457204..457629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0429"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24707"
FT                   /db_xref="GOA:Q0I2C4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2C4"
FT                   /protein_id="ABI24707.1"
FT                   /translation="MKSENEDKKRLKVELGKLIKSNRETKGDSQRGLAKFIDLPNSNLK
FT                   YIEDGINAPSPEVYKKIILRLNPNDKDRGRMDYLYSLIRGTPPPDICEFMIENNEVFNA
FT                   IRKNKCKLTRTQTGQLNKLLESFAEENLVYMEKIDNG"
FT   gene            457622..459592
FT                   /gene="bcgIA"
FT                   /locus_tag="HS_0430"
FT   CDS_pept        457622..459592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcgIA"
FT                   /locus_tag="HS_0430"
FT                   /product="site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /note="bifunctional; restriction enzyme, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24708"
FT                   /db_xref="GOA:Q0I2C3"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2C3"
FT                   /protein_id="ABI24708.1"
FT                   /translation="MAKKEIMTDLWVYDMLKEIGVQNDFSAQGSTIKEIDEALATASKK
FT                   GTGNVGFPEYVGVIKDFLVVIEDKASLNKHVNRDEHDLIAEDVKSITDYAVNGALFYGK
FT                   HLAKNTTYKKIIAIGVSGNEKNHRISPLFVDERGGYKELHDVETFISFSADNINEYYER
FT                   EILEVKTNDELKTEELLKVARSLHEDLRNYGNLEDKNKPLIVSGILLALSEIEYKNFDI
FT                   SDLIGDKIRTDGSKIYKAIEDNLKRANVSPEVKRDKLLNQFNIIKDNNKINEKNSNLGK
FT                   TPLRYFTEVLYNGIFTNIKYNSSTEDYIGRFYGEFMSYSGGDGQSLGIILTPRHITDLF
FT                   CELLDIQPTDKVLDPCCGTAGFLIAAMHHMLSKTEDENEQIEIRKNRLFGIELQDYMFT
FT                   IATTNMILRGDGKSNLENQDFLAQNPSKIQLKGCTVGMMNPPYSQGSKQNSELYEINFV
FT                   NHLLESLVEGAKVAVIVPQSTFTGKTKDEQNLKTKILKKHTLEGVITLNKNTFYGVGTN
FT                   PCIGVFTAGIPHSKTKKAKFINFENDGYIVSKHIGLIDDGSAKDKKQHLLDVWNEEIEA
FT                   PTKFCVSTTVEDTDEWLHSFYYFNDEIPSDEDFEKTIADYLTFEVNMITHGRGYLFGLN
FT                   KEEDLSSDEVLKVAEDGENYV"
FT   gene            459573..460649
FT                   /gene="bcgIB"
FT                   /locus_tag="HS_0431"
FT   CDS_pept        459573..460649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcgIB"
FT                   /locus_tag="HS_0431"
FT                   /product="restriction enzyme, beta subunit"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24709"
FT                   /db_xref="GOA:Q0I2C2"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2C2"
FT                   /protein_id="ABI24709.1"
FT                   /translation="MVKTMYKYHLADVKWKEMYFIDIFDNIYIAKSTDQNKLKVGNVPF
FT                   IGRSSINNGLQGEYFVEKEKINKGNSLTISMVGEPKCFYQKYSFTCSQNILVLQNNEFI
FT                   NITNSKFLIPIIDNYLKAKGYGYGYPVGKERVLRNKLLLPVDENNQINWHFMEEYIKER
FT                   ENKQRNDLKEYYKSRLLDLVINPDVLNDVEWKEIFIEEVAEIYSGKDIYERERTIGNTP
FT                   YITATANNNGIGYFVGNENKTMESECISVNRNGSVGYAFYHCYEALYGNDTRKLKPFIK
FT                   NKYTALFITHAITSQKDKYGYGYKMGTGRLKRQKIMLPVSDGEVNYKYMENFIKNIEQK
FT                   QIKNILKYLDEYIYIYNV"
FT   gene            460618..461151
FT                   /gene="bcgIB"
FT                   /locus_tag="HS_0432"
FT   CDS_pept        460618..461151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcgIB"
FT                   /locus_tag="HS_0432"
FT                   /product="restriction enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24710"
FT                   /db_xref="GOA:Q0I2C1"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2C1"
FT                   /protein_id="ABI24710.1"
FT                   /translation="MTNIYIYIMYNHFDKVEWKEFFLNEICNINSGVRLTKANMNEGKM
FT                   PFIGATDSNNGITSFISNTNKSLDKNVLGVNYNGSVVENFYHPYECIFSDDVKRVSFKD
FT                   EQGQNKRCYMFLKQMILQQKEKYRYAYKFNGDRMARQKVMMPVDKLGNIDFKFMNRYIA
FT                   SKEMKNLVAILKDI"
FT   gene            461158..462090
FT                   /locus_tag="HS_0433"
FT   CDS_pept        461158..462090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0433"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24711"
FT                   /db_xref="InterPro:IPR025364"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2C0"
FT                   /protein_id="ABI24711.1"
FT                   /translation="MNKLKLGKLEEVDIRELWKHEQYDFSEWLSKEENIEMLGDEIGLT
FT                   LTEINKEVFVGSYRCDLVAKDETTGIKVIIENQLEATNHDHLGKIITYASGLDANVVIW
FT                   IVKEAREEHRSAIEWLNNKTTKDISFFLMEICAYKIGDSLPAPKFVIIEKPNDFVKIAN
FT                   TNIDSGELSKAQAERLNFWNRFNEFLISRNKPFNVRKATTDHWYDVALGTSEAHISITL
FT                   VNKINSIGIQVCINDNKELFDRLYSVSEEIQNELGFSMDWQRLDNKKASRIIYYIGGLD
FT                   FDNHENYDELINEVINKVIAIRNIFRNHL"
FT   gene            complement(462435..462677)
FT                   /locus_tag="HS_0434"
FT                   /note="transposase; fragment"
FT   gene            463494..464132
FT                   /gene="alfA"
FT                   /locus_tag="HS_0435"
FT   CDS_pept        463494..464132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alfA"
FT                   /locus_tag="HS_0435"
FT                   /product="alpha-L-fucosidase"
FT                   /EC_number="3.2.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24712"
FT                   /db_xref="GOA:Q0I2B9"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR016286"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2B9"
FT                   /protein_id="ABI24712.1"
FT                   /translation="MVLTTKHHDGFCLYPSKYTDFNCTQAGPQRDLMGELTDNVREKGL
FT                   KMGAYYSGIIDWTYSSAPIFTESQNFSNACPTYEYADYAYKQVVELIDKYKPDVLWNDI
FT                   GWPKAGEHMLPHLFAHYYNNVPHGVVDDRWNKLWCDFTSKEYKHGVASRDKKWEMCRGM
FT                   GLSFGYNKVEDESHLISVKDLISLLVETVADNGNLLLNIGPKADGTIPQ"
FT   gene            464154..464462
FT                   /locus_tag="HS_0436"
FT   CDS_pept        464154..464462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0436"
FT                   /product="uncharacterized protein"
FT                   /note="Haemophilus-specific protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24713"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2B8"
FT                   /protein_id="ABI24713.1"
FT                   /translation="MGKWLEQNGEGIYRSRCSKYSPETVNGVTVRYTKVGQDLYLYIDG
FT                   LAEGKTSLPLSVFGELQALNPALDFAVEQTAAGRVLHINNYQADWYVLGFKIVDGEK"
FT   gene            464465..465805
FT                   /locus_tag="HS_0437"
FT   CDS_pept        464465..465805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0437"
FT                   /product="PTS system glucosamine dimer-specific IIC
FT                   component, Lac family"
FT                   /EC_number="2.7.1.69"
FT                   /note="TC 4.A.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24714"
FT                   /db_xref="GOA:Q0I2B7"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2B7"
FT                   /protein_id="ABI24714.1"
FT                   /translation="MSISHRFIDFMNTNVAPVARRMENQPHISAIRDGFIVVLPFLIVG
FT                   SFIMILLIPPFDENTTNVFGQAWWRFANWASPYGWNFFQMSFNAISLFTSASIAYNLAK
FT                   AYKREPLPAAFLSVMAFLLVAAPVKDGTMDIKFFGGIGLFSAIFIAIYTVEMTRLLEFL
FT                   KIKIRLPKEVPHAVAESLNIVIPILAVLVTIYPFSIWVEEYSSRNIPQLIMDVMAPLIA
FT                   VSDSLGAICLFVIATHLLWFLGINGSLVLMQLWTPFLLQNMAANLAAFQAGEPLPFIIT
FT                   NSFWDFYIVHGASGGVIALAFLLVRSKSAHLRSIGKIGLVPSFFSIGEPIVYGVPMVVN
FT                   PLFFIPLIFAPLANSIIAYLILDFDLIHRIYLMAPWTTPAPIGAYLVSAGDIWAPVLSI
FT                   ALIILDILIYYPFFKMYEKICVEKERNQVLDEAAQKELIEKAKMAAQ"
FT   gene            465880..466239
FT                   /gene="rusA"
FT                   /locus_tag="HS_0438"
FT   CDS_pept        465880..466239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rusA"
FT                   /locus_tag="HS_0438"
FT                   /product="ribosomal small subunit pseudouridine synthase A"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24715"
FT                   /db_xref="GOA:Q0I2B6"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2B6"
FT                   /protein_id="ABI24715.1"
FT                   /translation="MDIDTTGLVLLTDDGQWSHRVTSPKHLCDKTYLVTLADPVEDFYQ
FT                   AEIEKGILLRGEKTPTKPATLEILDDYNVNLTISEGRYHQVKRMFAALGNKVVDLHRWK
FT                   IGVIMLDDNLYEFYS"
FT   gene            466559..466792
FT                   /locus_tag="HS_0439"
FT   CDS_pept        466559..466792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0439"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24716"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2B5"
FT                   /protein_id="ABI24716.1"
FT                   /translation="MKNSIVKIYFKSSFIMAIVVAFNSIKGGVGKSTLAAQTAVYLARL
FT                   GRVAVMDCDPQQNLNRWAMRRAEAGEIFQQKI"
FT   gene            466802..467053
FT                   /locus_tag="HS_0440"
FT   CDS_pept        466802..467053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24717"
FT                   /db_xref="InterPro:IPR041535"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2B4"
FT                   /protein_id="ABI24717.1"
FT                   /translation="MKRLSRATTAVDFISQATSGEIMISESEKEMRREAVEYAKASVGL
FT                   EGITLSDGLLEIADKYIQGLLTREEFTKEYIIAVRAGV"
FT   gene            467055..468053
FT                   /locus_tag="HS_0441"
FT   CDS_pept        467055..468053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0441"
FT                   /product="cell filamentation-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24718"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2B3"
FT                   /protein_id="ABI24718.1"
FT                   /translation="MGKGYSEEEIKDKLSFIRLSELRENPIKGNFDLEHLKKLNGYIFQ
FT                   DSPDVAGKFRPEVKISGNELWQKVRSYSGFGSITVCYSPMDSKSIKEAESVLNSVNIER
FT                   LKTLDKSEFAKEIASIYKKLDYIHPFPDGNSRTLREFTRTLSEEAGFKLDWAKSTQTEV
FT                   YLARDFEVNSISLLRASTPTQKMALQDEIDAIRYHKEYKPLEKIIECSLSKLSVEQSKV
FT                   YKIEFSFNKELSEKIGKKSYDVLVNGIKSDVLLKRDNQLSKALEGLANHKDLREKGISA
FT                   ESLKSGTIQPLMLPNEFKVNRPENRKIDALGSKIESKSTSDLQKKSKGFSL"
FT   gene            complement(468080..468301)
FT                   /locus_tag="HS_0442"
FT   CDS_pept        complement(468080..468301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0442"
FT                   /product="resolvase/integrase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24719"
FT                   /db_xref="GOA:Q0I2B2"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2B2"
FT                   /protein_id="ABI24719.1"
FT                   /translation="MKLITAKDIKNNDIAINVNEIRAFYQYIKQLNELLNYIREGDVVV
FT                   TKLDRLGRSLSQCLKLLDMLTENKNRLR"
FT   gene            468440..469108
FT                   /locus_tag="HS_0443"
FT   CDS_pept        468440..469108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0443"
FT                   /product="plasmid segregation oscillating ATPase ParF"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24720"
FT                   /db_xref="InterPro:IPR009744"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2B1"
FT                   /protein_id="ABI24720.1"
FT                   /translation="MAIVVAFNSIKGGVGKTTLAAQFTAYLSKFSKVGVLNSDSENALE
FT                   MWISRRGDKDLALIENIELLPVDFDFDKQGKHYDYIICDLAGGDNKISRQVLAKNANIV
FT                   ISPFKPSQFDIDTVVKHNTLLSHIKKEFNPTLKSFYWFNLCNTNLKSKAFTESSQIFSD
FT                   LIKQKIIDSTLIKSPLFAREILSTSAADGLSCFDLGYKAKKSAAEIEPVIKKILKLKDK
FT                   "
FT   gene            469110..469553
FT                   /locus_tag="HS_0444"
FT   CDS_pept        469110..469553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0444"
FT                   /product="hemophilus-specific protein, uncharacterized"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24721"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2B0"
FT                   /protein_id="ABI24721.1"
FT                   /translation="MKSPVLSTKKLDSFINAADGGTPSEKPKKKAVRNGFNFTERQREV
FT                   FYKIKEVANKSSVEVLLFIALEYSKENPFSYEDYLDFMDLLTEKHKKIYKTMYTKGQYF
FT                   EEYDQITAKIKSEFMNIPLKGVVLMYLLHYAKHKLNMDISEFM"
FT   gene            complement(469567..470145)
FT                   /locus_tag="HS_0445"
FT   CDS_pept        complement(469567..470145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0445"
FT                   /product="resolvase/integrase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24722"
FT                   /db_xref="GOA:Q0I2A9"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2A9"
FT                   /protein_id="ABI24722.1"
FT                   /translation="MALLGFARVSTQSQSLLEQENALKAFGCTKIFSGKHSGKASDNKQ
FT                   ALDELLSYVREGDRVVVTRLDRLGRSLNQCLNTLEYFRENKIGFVAIQQGIDTEKKNDP
FT                   LATAYIHLLGLFAEMERSFIVERTQGGKIAKIAAGDNSAIGGRPRKIGKDTEKALIKDI
FT                   KKGVKIGAIAEKYKVSRITIYNYKKRLNI"
FT   gene            470536..471993
FT                   /locus_tag="HS_0446"
FT   CDS_pept        470536..471993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0446"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24723"
FT                   /db_xref="InterPro:IPR007655"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2A8"
FT                   /protein_id="ABI24723.1"
FT                   /translation="MKLTLSAILLLFPVSVLAHSPKSPSEHLDDHRIADERVRENIQYA
FT                   LATQPKQTVVPNIQPQQTVALSESQLQQHPDLLERALIAALLQGNGENASLLLPHYQKL
FT                   PENLQDPTFHLWAKALIARWRHQYTQSVRLYRQALAQQPDWSVLRLQTAAALLSNKEFD
FT                   AAEAQFRKVQSENQLPAGLAQEIESVLLYIKRQSRWQFSGNTTYINDKNINNAPKNPDL
FT                   GGGWRGDQAESGQGLAVNLGTNKKWFWKNGLFNEWRLDSNSKFYWNNKRFNEANVRASM
FT                   GIGYQNAKNSITVLPFFEQAWYAGGKKGNETLRRFSNSRGIALEATHTFSPKWQGSLTA
FT                   ETAQNRYRTRKHLNGNTHFVSLSAVYQHNPSQAWFGGIDWHRNNARDGDDSFDRIGVRA
FT                   GWLQDWKGLSTRLITSYGKKNYRSAGFFNKTQRNRELGVQVSVWHRAVHWQGLTPRLTW
FT                   SYTKTDSNIPLFRYNKQRLFLEINKQF"
FT   gene            complement(472432..472653)
FT                   /locus_tag="HS_0447"
FT   CDS_pept        complement(472432..472653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0447"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24724"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2A7"
FT                   /protein_id="ABI24724.1"
FT                   /translation="MAISVRLNAQDEQLFKSYAKTNNITLSELFRNAVFEKIEDEYDLA
FT                   VYRESLEDYNKTPMSYSHAEVCKMLGIE"
FT   gene            complement(472874..473056)
FT                   /locus_tag="HS_0447a"
FT   CDS_pept        complement(472874..473056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0447a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0447a"
FT                   /db_xref="EnsemblGenomes-Tr:ABI26069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2A6"
FT                   /protein_id="ABI26069.1"
FT                   /translation="MQIKIIIICIFLRNANSFQHAHAADGFLKQPLFVVTIQHSERLRR
FT                   AILVDLRAGNHFQQR"
FT   gene            473089..475053
FT                   /gene="tbpB"
FT                   /locus_tag="HS_0448"
FT   CDS_pept        473089..475053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tbpB"
FT                   /locus_tag="HS_0448"
FT                   /product="transferrin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24725"
FT                   /db_xref="InterPro:IPR001677"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR035313"
FT                   /db_xref="InterPro:IPR035316"
FT                   /db_xref="InterPro:IPR038197"
FT                   /db_xref="InterPro:IPR038669"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2A5"
FT                   /protein_id="ABI24725.1"
FT                   /translation="MTSFKLLGFSVLSVALLSACSSGKGGFDLDDVEHTPPSSSGSSRP
FT                   TYQDVPTGQRQQEIVEEINSPALGYATEIPRRNISPMPTTGTKESNARVAITAQQVAPL
FT                   SMPFNSIKEDFIKRLIAENTKKNARGRDVKYFDDTDDVLFAHDGSNLAHKRDLQYVRVG
FT                   YVLGTRKIELVFSHDKKTRDQFPAGWVGYVFYQGTSPAVTLPTQTVTYKGYWDFVSDAF
FT                   NERTLAEDFTQENSSATSNIPGNQIGATSMDALVNRKVSGEKINIAHSAEFTADFGSKK
FT                   LSGELKSNGYVSRKENDQDVKTRYKINADIKGNRFVGSATSTANGHTIFGKDADKRLEG
FT                   GFFGPKAEELAGKFLTNDNSLFVVFGAKRESKGDEKLETRFDAVKISTDSNKLEKETMD
FT                   TFGNASYLVLDGRQFPLVPESNAGTTGAGNTGKNDFITTIDGNQLSKTNHDKHKNYKVT
FT                   VCCSNLQYVKFGSYGEQTTATTHNGTSTSQLTNGHLFLTGERTSLADMEKEKGTANYRG
FT                   TWQANFSSNDGRVSTVEPGDSRNGNNAKSRAEFDVDFGGKTVAGKFFDADGIQPALTMD
FT                   STMITGNGFSGMAKTQIDGFQLDKGSTTGGTKVSFTDAKVEGAFYGPNAEEIGGTITSN
FT                   GAGDKVGGVFGAKRQEPSK"
FT   gene            475187..478165
FT                   /gene="tbpA"
FT                   /locus_tag="HS_0449"
FT   CDS_pept        475187..478165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tbpA"
FT                   /locus_tag="HS_0449"
FT                   /product="transferrin-binding protein A"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24726"
FT                   /db_xref="GOA:Q0I2A4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR010948"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2A4"
FT                   /protein_id="ABI24726.1"
FT                   /translation="MANRSALLRKHDPSIFYSHGMKKMSTKPLFKLKPITLAISTIFLP
FT                   FTEAVADTESPSSNTEAVLELEAIQVQAKHEISRHDNEVTGLGKVVKSSEDIDKELILN
FT                   IRDLTRYDPGISVVEQGRGATSGYAMRGVDRNRVAMLVDGLGQAQSYSTLKSDANGGAI
FT                   NEIEYENIKSIELSKGSSSAEYGSGALGGAVGFRTKEADDVIKEGQNWGLDSKTAYSSK
FT                   NSQFIQSVAGAFRVGGFDSLAIFTHRKGKETRVHPAAEEIQHTYQPLEGYFNRYEVDQN
FT                   SNGTPVRANAYYILADECSNLSDPSCRHAKAKTNRVGAPENNPNWTPEEQAQAAKMPYP
FT                   TRTASAKDYTGPDRISPNPMDYQSHSFFWKGGYRLSPNHYVGGVLEHTKQRYDIRDMTQ
FT                   RAYYTKEDICHSGSSCQTLDKNETDKGNFGITLTDNPLDGLVYDAGNQARGVRYGRGKF
FT                   FDERHTKNRSGIFYRYENPDKNSWADSLTLSIDRQDLKLSSRIHWTYCTDYPHVARCRA
FT                   SLDKPWSNYRTEKNDYQERLNLGQFNWEKTFNLGFTTHKVNIAAGFGTHRSTLQHGDLY
FT                   AEYVTLPPYEEIKAYDDKGAFKTDTTPEDKLQYGNGSYDKPRVYRRKNTPELKTVNGCN
FT                   ETAGDNRDCSPRVITGRQYYLALRNHIAFGEWADLGLGVRYDNHTFRSNDPWTKGGNYH
FT                   NWSWNAGVSLKPTRHFVVSYRVSSGFRVPAFYELYGVRTGASGKDNPLTQKEFLSRKPL
FT                   KSEKAFNQEIGLAVQGDFGVIETSFFQNNYKNLLARADKHVEGLGYVTDFYNTQDVKLN
FT                   GINILGRIYWEGISDRLPEGLYSTLAYNRINIKARKLHDNFTNVSEPTLEAVQPGRIIA
FT                   SIGYDDPEGRWGLNLSGTYSQAKQRDEVVGEKVFGKGGSIKRTINSKRTRAWYIYDLTA
FT                   YYTWKEKFTLRAGIYNLTNRKYSTWESVRQSAANAVNQDLGTRSARFAAPGRNFTVSME
FT                   MKF"
FT   gene            478475..480355
FT                   /gene="htpG"
FT                   /locus_tag="HS_0450"
FT   CDS_pept        478475..480355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /locus_tag="HS_0450"
FT                   /product="chaperone protein, hsp90 family"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24727"
FT                   /db_xref="GOA:Q0I2A3"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I2A3"
FT                   /protein_id="ABI24727.1"
FT                   /translation="MSTNQETRGFQSEVKQLLQLMIHSLYSNKEIFLRELISNASDAAD
FT                   KLRFKALSAPELYEGDGDLKVRISFDAEKGTLTISDNGIGMTREQVIDHLGTIAKSGTK
FT                   EFLAALGQEQAKDSQLIGQFGVGFYSAFIVADKVTVKTRAAGEPIDKAVLWESAGEGEY
FT                   SVADIEKKERGTEITLHLREEEKEFANEWRVREIIGKYSDHIGLPVEILAKEYDEEGKE
FT                   TGIKWEKINKAQALWTRSKGEISDEEYKEFYKHLSHDFADPLLWTHNKVEGNQEYTSLL
FT                   YVPSKAPWDLFNREHKHGLKLYVQRVFIMDDAEQFMPNYLRFMRGLIDSNDLPLNVSRE
FT                   ILQDNKVTAALRKALTKRSLQMLEKLAKDDEEKYLQFWKEFGLVLKEGPSEDFANKENI
FT                   AKLLRFASSKNDSSEQTVSLEDYVARMKEGQKAIYYITADSYIAAKNSPHLELFNKKDI
FT                   EVLLLSDRIDEWMLSYLTEFDGKQLQPITKADLDLGDLADKEQEEQKEQDKTFSSFIER
FT                   VKTLLGERVKDVRLTHRLTDTPAVVSTDNDQMTTQMAKLFAAAGQPVPEVKYTFELNPE
FT                   HHLVKKVADLADEDEFANWIELLLEQAMLAERGSLENPTAFIKRVNSLLS"
FT   gene            481084..482853
FT                   /locus_tag="HS_0451"
FT   CDS_pept        481084..482853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24728"
FT                   /db_xref="GOA:Q0I2A2"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2A2"
FT                   /protein_id="ABI24728.1"
FT                   /translation="MLAFIENFLKSLSSSTITEYFFWILLGIAVLGLLTFLISRKHYHS
FT                   QFTKFAEYTPVLLTSVGILGTFTGIVAGLLNFDIHQIDNSISSLLEGMKTAFFTSVIGV
FT                   ALSILLKIIYTLVGKVKNEKKRDVDIEEIAAAICRQAEENEKQSASLLLLTDWSKDQAI
FT                   TQNGALTALQSIARTLGSEAESSLLGQIKLLRADFNDAFKELKNQKIQAIGFLQKMTEQ
FT                   SEENQVQFTKFEEKLSQRLHDFAQILSKSATETVIEALRQVIVEFNQNLMEQFGENFKE
FT                   LNRAVKDLVQWQENYKTQLNEMIVLYHAGVQSLESTEKSVLSIEQKSQVIPQTMEKLGE
FT                   VIEVNQHQIEHLNAHLSGFAELRDKAIDAIPQTQQQVKLMLNNVETANQSLTEALKKSA
FT                   TQMEADLTSTARTFANKSVELTENLANVIRDSANNFATQSLQGLQALNESSKELKETAH
FT                   SIALHQKELNAEQQKTINQVIKFVENWQKTFEQQSQEIFQNFVRKVEDMSRQQVAENER
FT                   LMRSLQEEGEKTVKGTAEYVNAQLKLIDDSMQREVERVMKEMGSALATISRQFTQDYTK
FT                   LVEAMSNIVRSRI"
FT   gene            482850..483539
FT                   /locus_tag="HS_0452"
FT   CDS_pept        482850..483539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0452"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24729"
FT                   /db_xref="GOA:Q0I2A1"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2A1"
FT                   /protein_id="ABI24729.1"
FT                   /translation="MMIDLEKISSKEDGEDTQWLPMSDLMSGLMMLFLFIAVSFILNTK
FT                   RVAEKYDDNQQKIYQALQSEFQSNLTNWKAKIDKESLTFIFTDPEVLFQTGRADLQSKF
FT                   KEILTAFFPRYMKVIDQYRDFISEVRIEGHTSSDWSRLVSADVAYFENMRLSQERTRSV
FT                   LEYTYYLPEVENYRGWIKKNVSAVGLSSSKIVLNTDGSENREASKRVTFRIITNAEAQL
FT                   RRLSELK"
FT   gene            483539..484348
FT                   /locus_tag="HS_0453"
FT   CDS_pept        483539..484348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0453"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24730"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2A0"
FT                   /protein_id="ABI24730.1"
FT                   /translation="MRLNVDLSELWQSVKQISKIKIDIDLEKLTALNPINTTVGLEIPI
FT                   DEITFTPLPTYQGKQVILFIPDHSYNTLFEETLCDPTKGNKYHLTDCTTLESMRQRNRY
FT                   KRYFATTNLSGEFTISNGAGQSAEVRLQVCQNCLKKLNYKQFNRNRWLVLNMFDLAEFF
FT                   AHYRTSFRRDIETQNMVAEEAGSYSTDWRLISQRYREGQKWCCENCGLNMQSYPHLLDV
FT                   HHRNGNKRDNSDQNLQALCRECHIQQDMHTHMQLSEEERRTFSYLRR"
FT   gene            485040..485282
FT                   /locus_tag="HS_0454"
FT   CDS_pept        485040..485282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24731"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I299"
FT                   /protein_id="ABI24731.1"
FT                   /translation="MKKIIFFGTVIWLTACTTTNLSSSCQRYFSVLEKNMAQFSLSSSE
FT                   LTKFKQNKNKLSQLPEKEQNKICLLRMANIQQYRN"
FT   gene            485279..486055
FT                   /locus_tag="HS_0455"
FT   CDS_pept        485279..486055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0455"
FT                   /product="4'-phosphopantetheinyl transferase family
FT                   protein"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24732"
FT                   /db_xref="GOA:Q0I298"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I298"
FT                   /protein_id="ABI24732.1"
FT                   /translation="MIVSDVFKSFYGINMTTFVAWGHIQQYYPFETIPLRLLNKNLTHS
FT                   ASNYKPVQQRYHCRRLAHFLLWQLLQKAGVNTALLGDIKRSPSNRPYFLQDNIDFNISH
FT                   SDDWVAVVLQVDENNDKSAVGIDIEFVKKTRNYTALLQHFARRQEVIWFQQKPCEARFY
FT                   QIWCGREALLKSQGVGIVKLSEVKHEPEKLLLHSDYCPTGKLIFTAELPFYFALFCHQH
FT                   IEQTQYFMWQDNRFVSKKLTQTIEYQVNPLKQFIQI"
FT   gene            complement(486229..486307)
FT                   /locus_tag="HS_tAla03"
FT   tRNA            complement(486229..486307)
FT                   /locus_tag="HS_tAla03"
FT                   /product="tRNA-Ala"
FT   gene            complement(486393..487835)
FT                   /gene="gltX"
FT                   /locus_tag="HS_0456"
FT   CDS_pept        complement(486393..487835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="HS_0456"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24733"
FT                   /db_xref="GOA:Q0I297"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I297"
FT                   /protein_id="ABI24733.1"
FT                   /translation="MKLEPLFNLDPNTKVRTRFAPSPTGYLHVGGARTALYSWLYAKHN
FT                   QGEFVLRIEDTDLERSTPEATAAILEGMEWLNLAWEHGPYFQTKRFERYNQVIDQMIEQ
FT                   GLAYRCYCTKERLEDLRHSQEQNKQKPRYDRYCLHQSEYPVDAPHVVRFKNPTEGTVVF
FT                   DDAVRGRIEISNRELDDLIIRRTDGSPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQI
FT                   NILKALGAPIPTYAHVSMINGDDGQKLSKRHGAVSVMQYRDEGYLPEALINYLVRLGWG
FT                   HGDQEIFSREEMIALFDIHSVSKSASAFNTEKLQWLNQHYMRSLPVEQVATHLEWHMKK
FT                   HGIDYSNGPNLAEIIPVLSERCKTLKELAISSRYFYQDVENYDEKAVAKNFKPEAIKPL
FT                   AKLAEKLTALSDWTVENIHEVMSQTAQELDIGMGKVGMPFRLAVTGLGQSPSMDITAKL
FT                   VGKDRTISRINNAIAFIHTQNV"
FT   gene            488009..488087
FT                   /locus_tag="HS_tVal04"
FT   tRNA            488009..488087
FT                   /locus_tag="HS_tVal04"
FT                   /product="tRNA-Val"
FT   gene            488125..488203
FT                   /locus_tag="HS_tVal01"
FT   tRNA            488125..488203
FT                   /locus_tag="HS_tVal01"
FT                   /product="tRNA-Val"
FT   gene            488262..488340
FT                   /locus_tag="HS_tVal02"
FT   tRNA            488262..488340
FT                   /locus_tag="HS_tVal02"
FT                   /product="tRNA-Val"
FT   gene            488524..489744
FT                   /gene="pilC"
FT                   /locus_tag="HS_0457"
FT   CDS_pept        488524..489744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilC"
FT                   /locus_tag="HS_0457"
FT                   /product="protein transport protein"
FT                   /note="type IV pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24734"
FT                   /db_xref="GOA:Q0I296"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I296"
FT                   /protein_id="ABI24734.1"
FT                   /translation="MQNLKLFSWKATNFLQQKQAGMLVIENVQEAKRYLLQQGLNNIYL
FT                   QRHWQLNKKPKKIEFCDLLTQLAMLLQSSIPLKDSLQILLRNCVNISLNQWVRYILKNL
FT                   EGGLSFSQSVAQSGLYFSYQERQLISVGEMTGDLASVCQQIAEHRQQALALQRKIQKIL
FT                   LYPMIVLSISIILTALLLIFIVPQFAEMYGSNQSELPFFTQLLLNISSFLQQYFFHMIA
FT                   VSILFFYLIKLRLHNSYSFQLKKDWFLSHVPLLNKIIRLNRTISFCRSLGLMLNSGIPL
FT                   QQSLYSFLPQNSINIQKKIEGDLTLINEVKLTLRGIEQGYKFSQSVSSNLFSIQTQQML
FT                   QVGEKSGNLGLILQHIAENQQQQLDHQIDLLSQMLEPFMMVIIGGLIGLIMLGMYLPIF
FT                   NMGSLIQ"
FT   gene            489741..490448
FT                   /gene="pilD"
FT                   /locus_tag="HS_0458"
FT   CDS_pept        489741..490448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilD"
FT                   /locus_tag="HS_0458"
FT                   /product="prepilin peptidase"
FT                   /EC_number="3.4.23.43"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24735"
FT                   /db_xref="GOA:Q0I295"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I295"
FT                   /protein_id="ABI24735.1"
FT                   /translation="MIYLAYMLFGGLCGLWVYLYVRQFSAQINKQVYSTFCEIFPENAP
FT                   HLMPMSILRRKKCGHFSMYFLCGGLWCNICLNFPQNIYVGLWLACCGYLIFCLVLVDWL
FT                   YQLVSQTLCQALFILGLLGAYQGISPLTLEQSLIGSLSGFSVFYLIYIVAKLFYRYEAL
FT                   GRGDYWLMLGLGSFISWTKLPLLIFLACLTGLIYVVFNARDKKTIFIPFAPFLCLSTII
FT                   VYLLNFLREDILP"
FT   gene            490468..491115
FT                   /gene="coaE"
FT                   /locus_tag="HS_0459"
FT   CDS_pept        490468..491115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="HS_0459"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24736"
FT                   /db_xref="GOA:Q0I294"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I294"
FT                   /protein_id="ABI24736.1"
FT                   /translation="MAYIVGLTGGIGSGKSTIANLFSELGVPIVDADVVARDVVAKDSL
FT                   ILEKIIAHFGEEVRLENGELNRSELRKLVFQNEKEKLWLNNLLHPVIREKMLQQLRSVN
FT                   YPYVLWVVPLLIENKLMKLCDRVLVIDVEPELQILRASRRDSNSIELIKQMIQSQVNRE
FT                   LRLSFADDVIENNLPLEKNVANLKQSVAKLHRTYLHYAKIISRNSEEFEDIK"
FT   gene            491112..491306
FT                   /locus_tag="HS_0460"
FT   CDS_pept        491112..491306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24737"
FT                   /db_xref="GOA:Q0I293"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I293"
FT                   /protein_id="ABI24737.1"
FT                   /translation="MIDEKFTVACPNCKKEVLWSEENRFRPFCSKRCQLIDLGEWATEE
FT                   KIIPGSEITLLPNDEFKEN"
FT   gene            491479..491640
FT                   /locus_tag="HS_0460a"
FT   CDS_pept        491479..491640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0460a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0460a"
FT                   /db_xref="EnsemblGenomes-Tr:ABI26070"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I292"
FT                   /protein_id="ABI26070.1"
FT                   /translation="MARTVTGRTLGEIQCAMHKMDAEGAKERCFFTAFQTLRQKDRGKR
FT                   FFSDRNVA"
FT   gene            491711..493087
FT                   /locus_tag="HS_0461"
FT   CDS_pept        491711..493087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0461"
FT                   /product="D-alanine glycine permease"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24738"
FT                   /db_xref="GOA:Q0I291"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I291"
FT                   /protein_id="ABI24738.1"
FT                   /translation="MSLEIILSSINTFVWGPPLLLLLFGTGLYLTLRLGFIQIRYLPRA
FT                   LYYLFDKERHVSKKGDISAFAALCTALAATIGTGNIVGVATALQAGGPGAIFWMWLVAL
FT                   LGMATKYAECLLAVKYRVRDKQGFMSGGPMYYIEKGLGIKWLAKFFAVCGVLVAFLGIG
FT                   TFPQINAITHAMQDTFNVSIEITATIITALIALIILGGVKRISTVASIIVPFMAVLYVL
FT                   TSLLILILNWQQVPTAIGLIIYSAFNPQAALGGVFGYTVLKAIQSGFARGIFSNESGLG
FT                   SAPIAAAAAQTKEPVRQGLISMIGTFLDTIVVCTMTGIVLVLTGAWQSQELAGAALTNY
FT                   AFSQGLGNNIGATIVTVGLLFFAFTTILGWCYYGERCFVYLAGVKGIKVYRSIFILLVA
FT                   CGAFIKLELIWILADIVNGLMAFPNLIALVGLRHIVINETKDYFIRRKQIFVEPNNVAN
FT                   "
FT   gene            493323..493640
FT                   /locus_tag="HS_0462"
FT   CDS_pept        493323..493640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0462"
FT                   /product="SSU ribosomal protein S30P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24739"
FT                   /db_xref="GOA:Q0I290"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I290"
FT                   /protein_id="ABI24739.1"
FT                   /translation="MTLNITSKQMEITPAIRSHIEERLAKLGKWQTQLINPHFILNKVP
FT                   HGFAVEVAIGTPYGDLFASSESDDMYKAINEVEEKLERQLNKLQHKGEARRASERLKDS
FT                   F"
FT   gene            493844..494383
FT                   /gene="hpt"
FT                   /locus_tag="HS_0463"
FT   CDS_pept        493844..494383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="HS_0463"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24740"
FT                   /db_xref="GOA:Q0I289"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I289"
FT                   /protein_id="ABI24740.1"
FT                   /translation="MKKHHVDVLITEEDVRSRIQELGREITQFYQHKHVNKLVVVGLLR
FT                   GSFMFMADLVREIKLPIEIEFMTTSSYGNEMTTNHDVRIAKDLDGDIKNEDVLIVEDII
FT                   DTGYTLEKVREILLLRSPNSLAICTLLDKPSRREVDVPVEWVGFTIPDEFVVGYGIDYA
FT                   QCYRNLGYIGKVTLEE"
FT   gene            complement(494512..495141)
FT                   /gene="sodA"
FT                   /locus_tag="HS_0464"
FT   CDS_pept        complement(494512..495141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodA"
FT                   /locus_tag="HS_0464"
FT                   /product="superoxide dismutase, manganese"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24741"
FT                   /db_xref="GOA:Q0I288"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I288"
FT                   /protein_id="ABI24741.1"
FT                   /translation="MAYTLPELGYAYDALEPHFDAQTMELHHSKHHQTYVNNANAALET
FT                   LPEFTDLCPGQLITKLVEVPADKRTAIRNNVGGHVNHSLFWKGLKTGTTLQGPLKDAIE
FT                   RDFGSVESFQAEFEKAAATRFGSGWAWLVLNQGKLEVVSTANQDSPLMGKEIAGCEGFP
FT                   ILVLDVWEHAYYLKFQNRRPDYIKAFWNVVNWDVAAERFEKKINNA"
FT   gene            complement(495280..497547)
FT                   /gene="mdh"
FT                   /locus_tag="HS_0465"
FT   CDS_pept        complement(495280..497547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="HS_0465"
FT                   /product="malate dehydrogenase (oxaloacetate
FT                   decarboxylating) (NADP+) (malic enzyme)"
FT                   /EC_number="1.1.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24742"
FT                   /db_xref="GOA:Q0I287"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I287"
FT                   /protein_id="ABI24742.1"
FT                   /translation="MDAQLRQAALDFHEFPKPGKIEVTPTKSLGTQRDLALAYSPGVAV
FT                   PCLEIQADPASAYRYTSRGNLVAVISNGTAVLGLGNIGALAGKPVMEGKGVLFKKFAGV
FT                   DVFDIEIDEQNPDKLVEVIAALEPTFGGINLEDIKAPECFYIEQKLRERLKIPVFHDDQ
FT                   HGTAIISAAAIINGLRIVNKKIEDVRLVASGAGAASIACLNLLVSLGMKRENITVCDSK
FT                   GVIYKGRDEKMDDTKKLYAIDDNGQRSLADAIPDSDIFLGCSAAGALTQEMVKTMGPNP
FT                   LILALANPEPEILPPLAKAVRPDAIVCTGRSDYPNQVNNVLCFPFIFRGALDVSATTIN
FT                   EEMKLAAVYAIADLALAEQSEVVSSAYGESGVSFGPDYIIPKPFDPRLIVKIAPAVAKA
FT                   AMDSGVATRPIEDFEAYIEKLTQFVYKTNLFMKPVFAQAKEDKKRVILTDGEEKRVLHA
FT                   IQEIATLGIAYPVLLGRTHIIEESIKKLGLQLQLGRDFEIIDIENNPYYEECCDTYYNK
FT                   LKRQGMTPTGAKRKMLHNPTALGAVLLELGKVDAMICGLVGPFAAHLATVKEVVGEKEH
FT                   EIPATVNGLVLPTGNLFIADTFVNSSPTAEELAEITIMSAKEVRRFGIEPQVALVSHSN
FT                   YGSINDPSAVKMRQVLELVREKAPDLIIDGEMHCDIALSENLRKEVMPDSPIKGAANLL
FT                   IMPNMETARISLNLLQGTATPITIGPILMGVEKPAHILTSASSVRRIINMVAVAAVKAQ
FT                   NR"
FT   gene            complement(497743..499134)
FT                   /gene="aspA"
FT                   /locus_tag="HS_0466"
FT   CDS_pept        complement(497743..499134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="HS_0466"
FT                   /product="aspartate ammonia-lyase"
FT                   /EC_number="4.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24743"
FT                   /db_xref="GOA:Q0I286"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I286"
FT                   /protein_id="ABI24743.1"
FT                   /translation="MLGERDVPADAYWGIHTLRAVENFNISNVTISDVPEFVRGMVMVK
FT                   KATALANGELGAIPDKIAQAIVKACDAILIDGKCMDQFPSDVYQGGAGTSVNMNTNEVV
FT                   ANLALEILGHKKGEYDILDPMDHVNASQSTNDAYPTGFRIAVYNSIMKLVTKVLYLQQG
FT                   FENKAKEFSNILKMGRTQLQDAVPMTVGQEFKAFSVLLDEEVRNLTRTAELLLEVNLGA
FT                   TAIGTGLNTPQGYSELVVKRLSEVSGLPCTVAPNLIEATSDCGAYVMVHGALKRTAVKL
FT                   SKVCNDLRLLSSGPRAGLNEINLPELQAGSSIMPAKVNPVVPEVVNQVCFKVIGNDTTV
FT                   TFAAEAGQLQLNVMEPVIGQAMFESIEILTNACVNLRDKCIDGITANKEICENYVFNSI
FT                   GIVTYLNPFIGHHNGDIVGKTCAKTGRGVREVVLEMGLLTEEQLDNILSVENLMNPTYK
FT                   ATLHK"
FT   gene            499396..499686
FT                   /gene="groES"
FT                   /locus_tag="HS_0467"
FT   CDS_pept        499396..499686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="HS_0467"
FT                   /product="10 kDa chaperonin (groES protein)"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24744"
FT                   /db_xref="GOA:Q0I285"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I285"
FT                   /protein_id="ABI24744.1"
FT                   /translation="MNIRPLHDRVIIKREEVETRSAGGIVLTGSAATKSTRAKVLAVGK
FT                   GRILENGTVQPLDVKIGDTVIFNDGYGVKAEKIDGEEVLIISENDILAIVE"
FT   gene            499717..501360
FT                   /gene="groEL"
FT                   /locus_tag="HS_0468"
FT   CDS_pept        499717..501360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="HS_0468"
FT                   /product="60 kDa chaperonin (groEL protein)"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24745"
FT                   /db_xref="GOA:Q0I284"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I284"
FT                   /protein_id="ABI24745.1"
FT                   /translation="MTAKDVKFGNDARVKMLAGVNVLADAVKVTLGPKGRNVILDKAFG
FT                   APTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVSEGL
FT                   KAVAAGMNPMDLKRGIDKAVNAVVEELKILSKPCETSKEIEQVGTISANADETVGKLIA
FT                   QAMEKVGKEGVITVEDGSGLSDELDVVEGMQFDRGYLSPYFINKPEAATVELDNPFILL
FT                   VDKKISNIRELLPVLEGVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDIAILTAGTVISEEIGMELEKATLEDLGQAKRVVINKDNTTIIDGIGDEA
FT                   QIKGRVAQIRQQIEEATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDA
FT                   LHATRAAVEEGIVAGGGVALIRAATKVATTLKGDNEDQDVGIKLALRAMEAPLRQIVTN
FT                   AGEEASVVASAVKNGEGNFGYNAGTEQYGDMIAMGILDPTKVTRSALQFAASIAGLMVT
FT                   TECMVADLPKEEKADLTGGMGGMGGMGGMM"
FT   gene            501532..501849
FT                   /gene="metJ"
FT                   /locus_tag="HS_0469"
FT   CDS_pept        501532..501849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metJ"
FT                   /locus_tag="HS_0469"
FT                   /product="met repressor (transcriptional regulator of met
FT                   regulon)"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24746"
FT                   /db_xref="GOA:Q0I283"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I283"
FT                   /protein_id="ABI24746.1"
FT                   /translation="MADWDGKYISPYAEHGKKSEQVKKITVSIPIKVLEILTNERTRRQ
FT                   LRNLRHATNSELLCEAFLHAFTGQPLPTDEDLLKERHDEIPESAKQIMRELGINPDDWE
FT                   Y"
FT   gene            501891..502535
FT                   /locus_tag="HS_0470"
FT   CDS_pept        501891..502535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24747"
FT                   /db_xref="GOA:Q0I282"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I282"
FT                   /protein_id="ABI24747.1"
FT                   /translation="MTAFSLFISEFHSGMLQSATVITIEINTMARTKKTRRITDIMPMR
FT                   KTDKRPENLSRPGKKLTRYELDAKSREEKKKKKRKGLTAGSRHSAVDTSKTIVLNEKKD
FT                   PRVGSRKKVPLIVEFVNKPEKGMFIPSGALEEKAKTIDPMLELTQLENNESLNQLLDEL
FT                   DAGKTLSKKDQIFVNQCLDRIAQLMAELGIEEESEDDLYRTFETIDINQFK"
FT   gene            502539..502982
FT                   /locus_tag="HS_0471"
FT   CDS_pept        502539..502982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0471"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24748"
FT                   /db_xref="GOA:Q0I281"
FT                   /db_xref="InterPro:IPR019617"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I281"
FT                   /protein_id="ABI24748.1"
FT                   /translation="MWITILIILGGLIISVMLGYAIYLLLVLQKQKKVFLQAKQARLKR
FT                   LKESCEIIANAMQSGECNLSEGVIRLKMLLEPLGHSLKNYTSMYQLYEVVMDMPTHDAR
FT                   RTLKKNERMRLDLQRERAEADLEQNIKLEIQRLLNYLKKSKEK"
FT   gene            502983..504350
FT                   /gene="hemN"
FT                   /locus_tag="HS_0472"
FT   CDS_pept        502983..504350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="HS_0472"
FT                   /product="coproporphyrinogen III oxidase, anaerobic"
FT                   /EC_number="1.3.99.22"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24749"
FT                   /db_xref="GOA:Q0I280"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I280"
FT                   /protein_id="ABI24749.1"
FT                   /translation="MSEIIWDLALIQKYNHSGPRYTSYPTALEFNESYTDKDFQQAATR
FT                   YPTRPLSLYVHIPFCHKLCYFCACNKTITRHQHKVEIYLDYLEKEIQTRAPLFRHRIAT
FT                   QIHWGGGTPTYLSEQQSARLMQMLKENFTISDKAEISIEMDPREIELSMLDHLYKIGFN
FT                   RISMGVQDFNKDVQKAVNREQDEEFVRELLIRARELGFRSTNLDLIYGLPFQTVESFMF
FT                   TLHKVIELNPDRLSVFNYAHLPSRFAGQAKIKDKDLPTPETKLTILQKTIETLGQANYR
FT                   FIGMDHFAKPNDELAIAQQKGILHRNFQGYTTQEECDLLGLGVSAISLLGDTYAQNQKD
FT                   LKQYYTHVEETGLALHKGLVMTQEDCLRRDVIKQLICNFKLDFQPIEQQYQIDFKTHFA
FT                   EDLALLQPLATDGLVDINDNALQVSAKGRLLIRNICLCFDTYSRQQAKRQQFSRII"
FT   gene            complement(504384..504866)
FT                   /gene="smpB"
FT                   /locus_tag="HS_0473"
FT   CDS_pept        complement(504384..504866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="HS_0473"
FT                   /product="SsrA-binding protein"
FT                   /note="small protein B"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24750"
FT                   /db_xref="GOA:Q0I279"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I279"
FT                   /protein_id="ABI24750.1"
FT                   /translation="MTKKKAKVASNTIALNKRARHDYFIEDEIEAGLSLQGWEVKSMRA
FT                   GKASIGDSYIIFKHGEAYLFGATIQPLSVASTHIVCDPTRTRKLLLNQKELASLFGKAN
FT                   RDGFTIVALSLYWKGPWAKVKIGLAKGKKLHDKREDIKDREWKVTKDRIMKNAQRG"
FT   gene            504994..506469
FT                   /gene="ubiD"
FT                   /locus_tag="HS_0474"
FT   CDS_pept        504994..506469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiD"
FT                   /locus_tag="HS_0474"
FT                   /product="3-octaprenyl-4hydroxybenzoate decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24751"
FT                   /db_xref="GOA:Q0I278"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I278"
FT                   /protein_id="ABI24751.1"
FT                   /translation="MKYKNLRDFLELLEKQGELKRITQEIDPYLEMTEIADRTLRAGGP
FT                   ALLFENPKGYEIPVLCNLFGTPKRVALGMGQEDVTALRDVGRLLAFLKEPEQPKSFKDL
FT                   WSTLPQFKQVLNMPTKVLSKAECQQIVFSDAEVDLYKLPIMHCWKDDVAPLVTWGLTIT
FT                   KGPSKKRQNLGIYRQQLIGKNKLIMRWLSHRGGALDFQEWKEARPNQPFPISVALGADP
FT                   ATILGAVTPVPDTLSEYAFAGLLRGNKTEVVKSISNDLEIPASAEIILEGYIDPTETAL
FT                   EGPYGDHTGYYNEQEYFPVFTVTHLTMRKDPIYHSTYTGRPPDEPAVLGEALNEVFIPI
FT                   LQKQFPEIVDFYLPPEGCSYRLAVVTIKKQYAGHAKRVMMGVWSFLRQFMYTKFVIVCD
FT                   DDINARDWKDVIWAITTRSDPARDCTIIENTPIDYLDFASPIAGLGSKMGIDATNKWIG
FT                   ETQREWGTPIKKAPNVVKRIDDIWESLNIFAPK"
FT   gene            complement(506509..507699)
FT                   /gene="metC"
FT                   /locus_tag="HS_0475"
FT   CDS_pept        complement(506509..507699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="HS_0475"
FT                   /product="cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24752"
FT                   /db_xref="GOA:Q0I277"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I277"
FT                   /protein_id="ABI24752.1"
FT                   /translation="MSNTTSFTTSTIHAGRNKRVCKNAVNPVIQRASSLVFDTLADKKQ
FT                   ATINRAKGGLFYGRRGTLTHFALQELMCELEGGEGCYLYPCGAAAVSNAILAFVKTGDH
FT                   VLMSGAAYEPTQEFCHIILKKMSITTTFYDPLIGEKIADLVQPNTTVLFLEAPSSLTME
FT                   MPDIVSIVQAARQINPKIVVMIDNTWSAGVFFKALDFGVDISIQAGTKYLIGHSDAMIG
FT                   TAVANARCWEQLRENSYLMGQMVDADTAYMTARGIRTLLVRLKQHQENGIKVAKWLLEQ
FT                   PEVKTVYHPALPSCPGHQYFKRYFTGFSGLFSFELNKKLSQQALENFMDHFKIFTMAYS
FT                   WGGFESLILCTQPEEIARIRPNIERKLTGTLIRLHIGLEDVDDLIADLKAGFERLK"
FT   gene            507852..508454
FT                   /gene="tsaA"
FT                   /locus_tag="HS_0476"
FT   CDS_pept        507852..508454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsaA"
FT                   /locus_tag="HS_0476"
FT                   /product="AhpC/TSA family protein"
FT                   /note="peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24753"
FT                   /db_xref="GOA:Q0I276"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I276"
FT                   /protein_id="ABI24753.1"
FT                   /translation="MVLVTRQAPDFTAAAVLGNGEIVEKFNLKQHIAGKAAVVFFYPMD
FT                   FTFVCPSELIAFDHRYKEFQDRNVEIIGVSIDSEFTHNAWRNTPVDNGGIGQVQYALVA
FT                   DIKHEIAKAYGIEHPEAGVALRASFLIDKEGVVRHQVVNDLPLGRNIDEMLRMVDALQF
FT                   HEEHGEVCPAQWEKGKEGMTGSPEGVAKYLKQNADKL"
FT   gene            complement(508639..508908)
FT                   /gene="rpsO"
FT                   /locus_tag="HS_0477"
FT   CDS_pept        complement(508639..508908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="HS_0477"
FT                   /product="SSU ribosomal protein S15P"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24754"
FT                   /db_xref="GOA:Q0I275"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I275"
FT                   /protein_id="ABI24754.1"
FT                   /translation="MSLSTEKKAAIVAEFGRDAKDTGSSEVQIALLTAQINHLQAHFST
FT                   HKKDHHGRRGLLRMVSRRRKLLDYLKRTDLAKYSEIIARLGLRR"
FT   gene            complement(509163..517718)
FT                   /locus_tag="HS_0478"
FT   CDS_pept        complement(509163..517718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible cell-surface large adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24755"
FT                   /db_xref="GOA:Q0I274"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I274"
FT                   /protein_id="ABI24755.1"
FT                   /translation="MNKIFKTKYDVTTGETKVVSELAKNCPAASGVSCASSVGVGQPKC
FT                   GVFFGGMLGAFKILPLALLISGVLSPLGYAAAEVAAMPKVVEKEKTPAQREEELKNALK
FT                   KELKQELKSEIEKLQRNYERSVSSPLVFNTDVRSAGLPALNYSPRIANPYNTHLKHEGG
FT                   QIRVRNSAQEWSDQTTNKYPTGAHDNWKYDQIDGGRNALGYDEFSYRNEPGWNYIGTDR
FT                   YSGATSDYGLYNNNGKSEYRWSAPNRGAIVLAPYEQVETNKEEKGVFGRIKKHKNEAVA
FT                   DKYKNLSDANLFKAYVDGNRTRRNIVSIGVDSGTLADKTTLVGNESYTFGAQAVVVGHK
FT                   SGAAHQAVSVGSDTYAYGNSSVAIGNDDLSVGGINDTLPETTMIKIYEKLYTLPNVKND
FT                   KEYHEAQEKHIPGVYYAPLDENKKRNYSIVRTSMIDKEKFRDKYLHARQYSPTASMGFA
FT                   SIAIGSRSVAYDTGTTAIGSLSYALGKYSTALGFRSYVDFDANSGMALGNESRVFAKNS
FT                   IALGTNVESTNTGAMSYGYNAKAVGEGAIAIGHTVAANATLKEDVYNHLKSIYEGDDLL
FT                   TRQATTQSSEDNKVSEKIKTINEYLATKGSNFDKGTNDNLFDYEDKEIIKTTVSVKKAK
FT                   KKGDNGLVIGRSSFALGDRALAIGTGVGAFSKNGMAIGDLSYIKEKADNSIAIGTGSMV
FT                   TEKNATAIGYFSKATINNSMALGYKSETDYTDEEFKMAAYTPKGSLSIPSSKNTGVFSI
FT                   ARKGAERRITNVAPGAIDTDAVNVSQLKALEDRLSINIDDEDVEYNELHYISIKPEQKD
FT                   IDARSIELKNKRYIKYKTELLKLDARDKYDSAGIDKSAGSPYDKLKKEVEKLKQELGTA
FT                   NKATKLDAININAKGKNLNKLSKEIDEAKEGSLAELKAYLEKVQDTDTNYNNKGAKTTG
FT                   SVAIGYKVSVGAGDKHANSVAIGSNLAVKGKENQVIGNNIDVGQNTNWSILIGNNIEKT
FT                   DDKTTEAIVLGDRSQIVNGALSIGGFNKKGIDQDKDARFKTRKIHFVKAGEVNPKSNQA
FT                   VNGSQLDPVYEILGITNMQVQADKVTDVANKLGEGGHVTVTRPTFNLTSGANKYSGVTI
FT                   GDGDTARQNVHTIASALAYLDQAITAARPVYYTNGTKDSIGTKVPSTGNISNISFGKEF
FT                   KVTEKTNNGNNEKYLLVELNETEIQQNPALKGPKGDRGQQGARGLKGERGPIGPVGPAG
FT                   ERGLQGERGPQGEPGPEGPKGDTGAKGEPGLPGAPGKDGKDGEKGDRGPAGPQGPRGDK
FT                   GEAGPQGEPGPEGPKGDTGAKGEPGPAGERGPAGPEGKPGIQGPQGEPGLPGAPGKDAF
FT                   EVWKSLDGNSDKSKDDFINSLKGEKGQDGTNGQDGKSAYDIWKEKPENTKKTEEEFLKS
FT                   LKGEKGQDGRAGENGKSAYEVWQEKPENAGKSKEDFFKAIKGDKGQDGTNGQDGKSAYD
FT                   IWKEKSENTGKTEEEFLKSLKGEKGQDGRAGENGKSAYEVWQEKPENAGKSKEDFFKAI
FT                   KGDKGQDGTNGQDGKSAYDIWKEKPENTKKTEEEFLKSLKGEKGQDGRAGENGKSAYEV
FT                   WQEKPENAGKSKEDFFKAIKGDKGQDGTNGQDGKSAYDIWKEKPENTKKTEEEFLKSLK
FT                   GEKGQDGRAGENGKSAFVVWKENLGEEGKDKTENDFINSLKGKDGAPGNTKKITGDSNI
FT                   SVSDKGTTTNVSLNEDLKGINSIGRYKKEGVNKITFIGKNKGTSIGNNSLRNNVTISSN
FT                   GGIFEFNRKGLHINDKKITGVADGALSADSTDAINGGQLVKATGAKLIDDPSSTSDSPK
FT                   PKITVFADGKDGKSGLENGKDPMANKGLTSKDGLNGKNANDKANAIRDGEAGTVVFTDD
FT                   KGNRLVKANDGKYYKKSDVNDDGTVKNETDGKDKPKPVEKPQLSLVNQDGEIINPIVLG
FT                   NVNSGLGLEKYKEPVIEEGTSEESKKQKIGEAKKEHQKAKKIAIDKLLGNNDDENSNIK
FT                   DSDLILNNVANIRDLQALGQAGLDFAGNDADETKKVHRNLGQKLVIKGDQNAPAKPFES
FT                   AKDNINVAVEGEGLVVQLSKDLKNLTSAEFTTEDENNPKTKTTINGKGTTIVELGNDGN
FT                   ENPDGKRAEYTIDGTKVTDGKNTLETNSKGIKLKYKSNDPNNSNEKEVFSINNDDGTVT
FT                   VDFKNTGKITGLADPTESTDAANKGYVDEKVIDLDSNRPFDFYIKDGDKEIKVVKGRNG
FT                   KFYKPEDLNGAKYDESGKKYTKNIENNQSEEVKSSIEDRQNEVVIKAEPTNKAIVVTNI
FT                   ADGKLAADSKDAINGGQLVKATGAKLIDDPSSTSDSPKPKITVFADGKDGLSGLEKTSD
FT                   GKESMAAKGLTGKDGLNGKNANDKANALRDGEAGTVVFTDDKGERLVKAKDGKYYKKED
FT                   IKDDGITPKDVKNEVKNPQLSLVNHEGNTTIPTVLGNVASGLGIDSEQNEKAKKAKDDM
FT                   NNQATIVIEKVTEMLKKRQDVDSLQTAKEAQQSAIDVLSMLPETTVAEKAEKEKRLKIE
FT                   KDKLEQIESNLIKADKALKNAQQEMTEAKEKLDEQKINYQKALEDDSVHQLLSGNSSID
FT                   DKKIKRAANLQDLKALGQAGLNFEGNDGVLVHKNLGEKLTIKGEGTFNSDNTAAGNIKV
FT                   TASDSSMEVKLSDTLKNMTSFETKETAKGNKSRLDGNGLTVTGKNNQSAHYGSEGITLT
FT                   DGKNNVTLTSSSFTFKEGQAEKIVIDGKEGEIRVPDLTSKSSPNAVANKQYVDALQTQT
FT                   DQKFNHLENRFDAFSKESRAGIAGSNAAAALPTISIPGKSLLSVSAGTYKGQSAVAVGY
FT                   SRVSDNGKIFLKVQGNSNSIGDFGGGVGIGWAW"
FT   gene            518592..520658
FT                   /gene="glyS"
FT                   /locus_tag="HS_0479"
FT   CDS_pept        518592..520658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="HS_0479"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24756"
FT                   /db_xref="GOA:Q0I273"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I273"
FT                   /protein_id="ABI24756.1"
FT                   /translation="MTTQNFLAEIGTEELPPKALKKLATAFAENVEQELNQAGLAFEKV
FT                   EWFAAPRRLAVKVLGLAEAQPSKQVEKRGPAVSAAFDAEGKPTKAAEGWARGCGITVEQ
FT                   AERLSTDKGEWLVHRAVIEGQLTKNLLVGIIDKALAGLPIPKTMRWGDKTEQFVRPVHT
FT                   VTLLFGADLIEGEILGVASGRTVRGHRFLGEREFSLDHADQYPQLLKERGSVVADFNER
FT                   KALILATSREKATALGGVADIEEELLEEVTSLVEYPNVLTAKFEERFLAVPAEALVYTM
FT                   KGDQKYFPIYDKDGKLLPHFIFVSNINPDDPSKIIEGNEKVVRPRLTDAEFFFKTDLKQ
FT                   KLEDRLPRLETVLFQQQLGTLRDKTARIEALAGEIAAQIGADQTKAKRAGLLSKCDLMT
FT                   NMVFEFTDTQGVMGMHYARHDGEDEDVAVALNEQYMPRFAGDTLPNSLVACSVALADKI
FT                   DTLTGIFGIGQSPKGSADPFALRRAALGCLRIIVEKNLPLDLADIVAKATALFGDKLTN
FT                   KNVVDEVVDFMLGRFRAWYESEGIAVDVIQSVLARRPTKPADFDARVRAVSHFRTLDSA
FT                   EALAAANKRVSNILAKADIAIGEIDLGVCVESAEKTLAEAVLALKGEVQPLIAQGDYTA
FT                   VLDKLANLRQPIDAFFDGVMVNVEEQTLRQNRLAILSTLQNLFLQVADISVLQ"
FT   gene            complement(520757..521140)
FT                   /locus_tag="HS_0480"
FT   CDS_pept        complement(520757..521140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0480"
FT                   /product="possible acid-induced glycyl radical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24757"
FT                   /db_xref="GOA:Q0I272"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR011140"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I272"
FT                   /protein_id="ABI24757.1"
FT                   /translation="MIKGIQITQAANDNLLNSFWLLDSEKGEARCLAAKAEFVEDQIVA
FT                   VSELGQIEYRELPVDVAPTIKVEGGQHLNVNVLRRETLEDAVNNPEKYPQLTIRVSGYA
FT                   VRFNSLTPEQQRDVITRTFTQSL"
FT   gene            521400..522071
FT                   /gene="ung"
FT                   /locus_tag="HS_0481"
FT   CDS_pept        521400..522071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="HS_0481"
FT                   /product="Uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24758"
FT                   /db_xref="GOA:Q0I271"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I271"
FT                   /protein_id="ABI24758.1"
FT                   /translation="MNTWKEAIGQEKQQPYFQHILQQVQQARQSGRTIYPPQEEVFSAF
FT                   RLTEFDQVRVVILGQDPYHGVNQAHGLAFSVKPGIAPPPSLVNIYKELSTDIMGFQTPS
FT                   HGYLVGWAKQGVLLLNTVLTVEQGLAHSHANFGWETFTDRVIHVLNEQRDHLVFLLWGS
FT                   HAQKKGQFIDRTKHCVLTSPHPSPLSAHRGFFGCRHFSKTNQYLRHHNLTEINWQLPMT
FT                   I"
FT   gene            522087..522863
FT                   /locus_tag="HS_0482"
FT   CDS_pept        522087..522863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0482"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24759"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I270"
FT                   /protein_id="ABI24759.1"
FT                   /translation="MLAIISPAKTLDWESAVPNFTFSQPHLTAYSEKLINICRQLSPAQ
FT                   ISSLMSISDKLAGLNVARFEQWQIEHNEQNSRAAIYAFKGDVYTGLEVETLSRDDIQFA
FT                   QQHLRVLSGLYGVLRPLDLMQPYRLEMGTKLANEKGKDLYAFWGNIITDALQQAIEQQG
FT                   DKILVNLASDEYYKSIQENQLGVKIIKPVFLDNKGGKYKVISFYAKKARGLMCRYIIQH
FT                   RVTDIEQLKEFDLGGYQFNPSSSTQTEFVFKRDVIK"
FT   gene            522860..523414
FT                   /locus_tag="HS_0483"
FT   CDS_pept        522860..523414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0483"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24760"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I269"
FT                   /protein_id="ABI24760.1"
FT                   /translation="MNKILAMLTALLLSACVSHSRVNVPEYIKHHEKSYYLVSAVDLET
FT                   VARYFYLPKEHTVENWQSAVELLHDRNREKRSLSDRITLRRHVYQNNGVKQFNLYLKDN
FT                   ELYSFVIYEPTEKNPTWQVDIAKGKEIPFCGFIQYQYSFKLMKAPTSAMSKRKIERYLK
FT                   KYIVDKEIAQLEQYKIVGCYQ"
FT   gene            523429..524325
FT                   /locus_tag="HS_0484"
FT   CDS_pept        523429..524325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0484"
FT                   /product="cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24761"
FT                   /db_xref="GOA:Q0I268"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I268"
FT                   /protein_id="ABI24761.1"
FT                   /translation="MERIYSQQVKKAANLAIFTALLLILVKSFAWWQTSSVSMLASITD
FT                   SMLDLLVSLMNMLILRFALMPADHNHSFGHGKAEALAGLGQSAFISGSAVFILLQGIHR
FT                   LNTPQPLMNFQIGVFVTLFSILATALLVIYQSKVIKQTGSPAIKADKLHYQTDLLMNFT
FT                   ILISLSLSQLGYQQADAIFALLIAFYILINAGKILFDNLQLLLDVALPDEEIKSIEQII
FT                   LADKRILGFHDLKTRRSGAVRFIQFHLELDDHMSFLQAHQITEDIENQLRQRFSYTDIA
FT                   IHQEPTSVVQVELKSLN"
FT   gene            524438..525403
FT                   /gene="pfkA"
FT                   /locus_tag="HS_0485"
FT   CDS_pept        524438..525403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkA"
FT                   /locus_tag="HS_0485"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24762"
FT                   /db_xref="GOA:Q0I267"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I267"
FT                   /protein_id="ABI24762.1"
FT                   /translation="MIKKIAVLTSGGDAPGMNAAIRGVVRSALSEGLEVYGIYEGYYGL
FT                   YHNKIQQLTRYSVSDIINRGGTFLGSARFPEFKDPAVREKCVEILRSHGIDALVVIGGD
FT                   GSYMGAKLLTEEHDFPCVGIPGTIDNDVAGTDYTIGYQTALETAVEAIDRLRDTSSSHK
FT                   RISIVEIMGRHCSDLTISAAIAGGCEYIVASEIEFNREELIKQIERAIIKGKRHAIIAI
FT                   TELLCDVNELAREIEARVKHETRATILGHIQRGGTPCAFDRILGSRMGVYAVDLLLQGK
FT                   GGYCVGIQNEQLVHHDIIDAINNMRREFKADWLAMSKRLD"
FT   gene            525674..526720
FT                   /locus_tag="HS_0486"
FT   CDS_pept        525674..526720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0486"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24763"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I266"
FT                   /protein_id="ABI24763.1"
FT                   /translation="MFNRALAWQNEQYEQDNNQKFSYSKLTSLLPQWKKELIWLKECHS
FT                   QVLQQSLKDLESAFKNFFQQRADFPKFKKKGIKESFRFPQGCKIQPQNDRLYLPKIGWV
FT                   RYRNSREIVGEVKNVTVSQKCGRFFVSIQTEFEHEIPMHKGGEIGIDMGIARFATLSNG
FT                   EFFEPINAFKTYKGKLAKLQKQLKNKVKFSKNWQKLKEKIGKLHHKIANCRKDFLHKIS
FT                   TQISKNHAMIYVEDLQVANMSKSAKGTVEAHGKNVKQKSGLNRSIRDQSWFEFRRQLDY
FT                   KTQWLGGFLVAVPAQNTSRTCPCCGHIAKENRETQAHFECVECGYTENADVVGAMNVLT
FT                   RGQAIVQA"
FT   gene            527119..528381
FT                   /gene="hflK"
FT                   /locus_tag="HS_0487"
FT   CDS_pept        527119..528381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="HS_0487"
FT                   /product="protease FtsH subunit HflK"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24764"
FT                   /db_xref="GOA:Q0I265"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I265"
FT                   /protein_id="ABI24764.1"
FT                   /translation="MENEMSFNNSDQDPWGKPGSTGKKPENNQSHNEDKQSNWEQPNNQ
FT                   QKNTQQSPPDIEEIFNNLLKKISGKSGNVGKNGKPNSPVGLGKLLPLGVLIGAVIWGLS
FT                   GFYTIKEAERGVVLRFGQLHSIVQPGLNWKPTFIDSVTAVNVERVRELRTQGSMLTQDE
FT                   NMVKVEMTVQYRVQDPAKYLFSVTRADDSLNQATDSALRYVIGHMTMDDILTTGRSVVR
FT                   ENTWKTLNDIIAVYDMGLEVIDVNFQSARPPEEVKAAFDDAIKAQEDEQRYIREAEAYA
FT                   REQEPRARGNAQRIIEQATAYKEQVVLDAQGEVERFQRLLPEFKASPELLRERLYIQTM
FT                   EKVMANTPKVMLDTQSGNNLTVLPLEQILNSKTLAEKSNTLVKTDQSSEKKVPERAVTN
FT                   PEISQPNSLYQVIEGRQGRFN"
FT   gene            528381..529268
FT                   /gene="hflC"
FT                   /locus_tag="HS_0488"
FT   CDS_pept        528381..529268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="HS_0488"
FT                   /product="protease FtsH subunit HflC"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24765"
FT                   /db_xref="GOA:Q0I264"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I264"
FT                   /protein_id="ABI24765.1"
FT                   /translation="MRKFLTPILIVLVALIYSSVVIIDEGTRGIMLRFSKVHRDVDNKV
FT                   VVYSPGLHFKIPFIDHVKILDARIRTLDGQPDRFVTVEKKDLLVDSYVKWRISDFGRFY
FT                   TATSGGDYVQASNLLRRKVNDRLRSEIGSRTIKDIVSGTRGELMEDAKKALNTGQDSTA
FT                   ELGIEVVDVRVKQINLPDEVSSSIYQRMRAERDAVAREHRSQGKEKAAFIQADVDRKVV
FT                   VILATASKKAQELRGEGDATAAKLYSDAFAQEPEFFSFMRSMKAYENSFEGSNNMMILK
FT                   PGSDFFRFMDHPKK"
FT   gene            529557..531968
FT                   /gene="lon"
FT                   /locus_tag="HS_0489"
FT   CDS_pept        529557..531968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="HS_0489"
FT                   /product="ATP-dependent proteinase, Serine peptidase,
FT                   MEROPS family S16"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24766"
FT                   /db_xref="GOA:Q0I263"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I263"
FT                   /protein_id="ABI24766.1"
FT                   /translation="MNAKRTKLEHLPVLPLRDVVVFPYMVMPLFVGRPKSIRSLEEAME
FT                   NNKQLLLVSQRKPDIEEPKIADLYKIGTLVNIIQLLKLPDGTVKVLVEGQQRTKLIDLQ
FT                   DNGEFFLASHELIETQWSDEKELSVLKKITLSEFEKYANLNKKIPADIISALRRINDIE
FT                   RLSDTVAAHLPVSINEKQNILEIGDLSARFEYLLGLMVSEADILQVEQRVRGRVKKQIE
FT                   KNQRDYYLNEQIKALQKELNDDENTVDEVEQLRKKIEEAKMPIEAREKVFAELQKLKMM
FT                   SPMSSEATVLRSYIDWMVQVPWHKRTKVKKDLAKAQETLDADHYGLERVKERILEYLAV
FT                   QSRLNQLKGPILCLVGPPGVGKTSLGHSIANATGRKYVRMALGGVRDEAEIRGHRKTYI
FT                   GSLPGKLIQKMAKVGVKNPLFLLDEIDKMAMDYRGDPASALLEVLDPEQNSHFNDHYLE
FT                   VDYDLSDVMFVATSNSMNIPAPLLDRMEVIRLSGYTEDEKLNIATRHLLNKQIERNGLK
FT                   TDELVINEEAILDIIRYYTREAGVRSLEREISKICRKAVKNLLLDKSLKSIQVNSNNLQ
FT                   EYLGVRRFEFGRADTQNRIGEVTGLAWTEVGGDLLTIETASVIGKGKLIYTGSLGDVMK
FT                   ESIQAAMTVVRTRAEKLGIANDFHEKRDIHIHVPDGATPKDGPSAGIAMCTALVSCLTG
FT                   NPVKSEVAMTGEISLRGKVLPIGGLKEKLLAAHRGGIKTVIIPKENVKDLEEIPENVKN
FT                   NLTIHAVDTIDEVLTIALENPPEGVDFVKLSPIHKIKSSRKRSSRTKSLN"
FT   gene            532146..532550
FT                   /gene="holD"
FT                   /locus_tag="HS_0490"
FT   CDS_pept        532146..532550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holD"
FT                   /locus_tag="HS_0490"
FT                   /product="DNA polymerase III, psi subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24767"
FT                   /db_xref="GOA:Q0I262"
FT                   /db_xref="InterPro:IPR004615"
FT                   /db_xref="InterPro:IPR036654"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I262"
FT                   /protein_id="ABI24767.1"
FT                   /translation="MNRRDKLLQEMGISQWQLRHPEILKGLVNVSVAKNIRLIMISEQP
FT                   VLKEQPFLQDIFRSLELMKEDCLCIDFDFLPYLQVEHEVIYWLLTNDQQKIDRTLSDKQ
FT                   YMPCWKSNELERLKQSPQEKRQFWQQIQEI"
FT   gene            532554..533000
FT                   /gene="rimI"
FT                   /locus_tag="HS_0491"
FT   CDS_pept        532554..533000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="HS_0491"
FT                   /product="[SSU ribosomal protein S18P]-alanine
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24768"
FT                   /db_xref="GOA:Q0I261"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I261"
FT                   /protein_id="ABI24768.1"
FT                   /translation="MISYIDEQDFAELFAIEQKAHIVPWSLSTLKNNQGEHYLNLKKVV
FT                   NGKIVAFAICHLVLDEATLFNIAVDPDYQGLGLGKELLKELIQQLLERNIQTLWLEVRE
FT                   TNIKARQLYHNLGFNEVDIRKNYYPLPDGKRESAVVMALINYFK"
FT   gene            complement(533075..533971)
FT                   /gene="dapA"
FT                   /locus_tag="HS_0492"
FT   CDS_pept        complement(533075..533971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="HS_0492"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24769"
FT                   /db_xref="GOA:Q0I260"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I260"
FT                   /protein_id="ABI24769.1"
FT                   /translation="MTTHRPLFYGSITALITPMNNHGEVDFNALKKLVEYHIVSGTHAI
FT                   VSVGTTGESATLSIAENVKTILKTLEFADGRIPIIAGTGANATSEAITMTKLLNDSGVA
FT                   GCLSVVPYYNKPTQEGMYQHFKAIAECTDIPQILYNVPSRTGSDLLPETVGRLSQIANI
FT                   VGIKEATGDVSRVAKIKQMAGEDFIFLSGDDATGLESMKLGGQGVISVTNNIAAADMAK
FT                   MCELALAGKFDEAEIINDKLRALHKDLFIESNPIPVKWAAYKLGLVPDPILRLPLTTLS
FT                   EQAQPKIINALKNAGLL"
FT   gene            534081..534557
FT                   /gene="bcp"
FT                   /locus_tag="HS_0493"
FT   CDS_pept        534081..534557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcp"
FT                   /locus_tag="HS_0493"
FT                   /product="bacterioferritin comigratory protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24770"
FT                   /db_xref="GOA:Q0I259"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I259"
FT                   /protein_id="ABI24770.1"
FT                   /translation="MKTLKAGDFAPHFSLLNQNNEQVSLENFHGKKVLVYFYPKALTPG
FT                   CTTQACGLRDSKAELENKGVVILGISPDSPKKLANFIEKKALNFDLLSDEQHIVAEQFG
FT                   VWGEKKFMGRTFDGIHRISFLIDEQGKIEQVFDKFKTTDHHQIVLDYLNSLEQR"
FT   gene            complement(534638..535657)
FT                   /gene="ilvE"
FT                   /locus_tag="HS_0494"
FT   CDS_pept        complement(534638..535657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="HS_0494"
FT                   /product="branched chain amino acid aminotransferase
FT                   apoenzyme"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24771"
FT                   /db_xref="GOA:Q0I258"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I258"
FT                   /protein_id="ABI24771.1"
FT                   /translation="MNKNIDWENLGFSYIKTDYRYISYWKNGAWSKGELTQDNVLHISE
FT                   GSTALHYGQQCFEGLKAYRCKDGSINLFRPEQNALRMQKSCQRLLMPEIPVEMFVDACK
FT                   QVVKANADWLGPYGSGATLYLRPFLIGVGDNIGVSPAPEYIFSIFCCPVGAYFKGGMKP
FT                   TNFIVSDYDRAAPQGTGAAKVGGNYAASLYPGKMAKTRHFADCIYLDPTTHKKIEEVGS
FT                   ANFFGITKDNKFITPLSPSILPSITKYSLLYLAKERLGMEVIEGDVYIDQLDQFKEAGA
FT                   CGTAAVITPIGGIQYGDHFHVFYSETDVGEITTKLYNELVGIQFGDVDAPEGWIVKVE"
FT   gene            536097..537002
FT                   /gene="gcvA"
FT                   /locus_tag="HS_0495"
FT   CDS_pept        536097..537002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvA"
FT                   /locus_tag="HS_0495"
FT                   /product="transcriptional activator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24772"
FT                   /db_xref="GOA:Q0I257"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I257"
FT                   /protein_id="ABI24772.1"
FT                   /translation="MGRMMIKRLPPLNSLKSFESSARHLSFTKAADELFVTQAAVSHQI
FT                   KLLEDFLGVILFKRKNRTLELTDFGRAYFSDVSKILNNLADATTKLMAQKNEQYLSISV
FT                   PQTFGMQWLVPKLSEFNQRYPDIEVRLKGVDQDEIPLSNEIDIAIYYGKGNWVGLQVEK
FT                   LAEAKLLILASPKLLAKQPVTQATDLYQHNLIHVHTRDNWRNMANLLQLDKLDIRHGPV
FT                   FSHTFMALQAAVHGQGIVLANKILAQHEIENGNLQVVLSISLPDPKSFYVVNSLNRTNT
FT                   EQINAFRQWIVHAMKQNKHE"
FT   gene            536995..538080
FT                   /locus_tag="HS_0496"
FT   CDS_pept        536995..538080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24773"
FT                   /db_xref="GOA:Q0I256"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR011224"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I256"
FT                   /protein_id="ABI24773.1"
FT                   /translation="MNKLALYCRSGFEKELAAEITEKATALGVFGFARVVENSGYVIFE
FT                   CYQIGEADLLARKITFSQLIFARQLIVVSDLISNLSVQDRISPIIEYYRQQEKILNLKQ
FT                   SSDIWVETADTNEAKTLAAFCRKFTVPLRQALRKQGWLQAKNKKSGITLHIFFTQSNSC
FT                   YIGYSYNNNHAEHIMGIPRLKFPAEAPSRSTLKLEEAILYFIPPNQEATRFNENKYAVD
FT                   LGACPGGWTYQLVRRGVFVYAVDHGKMATSLHETGRIEHCAEDGFKFRPPKHCKIDWLV
FT                   CDMVEQPRRIADLISQWLVKGWCKETIFNLKLPMKKRYFEVQQCLRQIEDKLNKQNISF
FT                   QLQAKHLYHDREEITVYIRLM"
FT   gene            538228..540408
FT                   /gene="uvrD"
FT                   /locus_tag="HS_0497"
FT   CDS_pept        538228..540408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="HS_0497"
FT                   /product="ATP-dependent DNA helicase UvrD"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24774"
FT                   /db_xref="GOA:Q0I255"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I255"
FT                   /protein_id="ABI24774.1"
FT                   /translation="MDISELLNDLNEKQRNAVVAPLGNYLVLAGAGSGKTRVLTYRIAW
FT                   LSAVEKIPESSIMAVTFTNKAAMEMRHRIEATLARYSHQRVFGMWIGTFHSIANRLLRS
FT                   HYADAGLPQDFQILDSEDQLRLVKRLMKLHQYDEKTFPYKQACWYINNKKEEGLRPNQI
FT                   EDNNDRQEREWIKIYKIYQDACDRAGLVDFAELLLRAYELWLKNPHILQYYQQRFQHVL
FT                   IDEFQDTNKIQYAWIKLLAGSQGNVMIVGDDDQSIYGWRGAQIENIHRFLKDFAKAKII
FT                   RLEQNYRSTGNILESANRLISNNSNRLGKDLWTAGEKGEPVGIYAAFNELDEALFVSGQ
FT                   VQNWLDNGGKVDDCAVLYRSNSQSRVIEEAFLRAKIPYRIYGGMRFFERQEIKDALAYL
FT                   RLIANRQDDAAFERVVNTPPRGIGERTLDILRNLTRERQVTLWQATQLAIQENLIPIRS
FT                   VTVLLRFIELINSLQQETAEMPLFVQTDFVIKHSGLYDMYKQEKGDKGEVRIENLEELV
FT                   TATREFIKPDEAEDMSDLVAFLTHASLESGEEQAASHQPCVQMMTLHSAKGLEFPRVFI
FT                   VGMEEGLFPSFRSGEDLARLEEERRLAYVGITRAKQKLTLCYAEVRRLYGKDEKHIPSR
FT                   FIAELPQECIQEVRLRGTVTRAYNRSAVGSIVKTDLSDNSWKVGQKVKHEKFGQGTVIN
FT                   VEGADNNTRLQIAFQGQGIKWLIAHLAKLEKI"
FT   gene            complement(540474..541178)
FT                   /gene="lpxH"
FT                   /locus_tag="HS_0498"
FT   CDS_pept        complement(540474..541178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxH"
FT                   /locus_tag="HS_0498"
FT                   /product="UDP-2,3-diacylglucosamine hydrolase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24775"
FT                   /db_xref="GOA:Q0I254"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR010138"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I254"
FT                   /protein_id="ABI24775.1"
FT                   /translation="MKKTFFIADLHLSENRPHLTELFVQFMQTQALQAEKLYILGDLFD
FT                   FWIGDDEQSALIETVQQQILQLSQKGIPCYFIHGNRDFLVGRHFANSCGMELLPTYQIV
FT                   NLYGKKVLICHGDTLCTDDLAYQQYRKKVQQKWLQWLFLHLPLKVRLKIAEKIRQKSKT
FT                   DKTHKSIEIMDVNKDFVEQIMQQFQVNILIHGHTHKQNIHQNPPHFTRIVLGDWGATAS
FT                   VLEVSANGFQFI"
FT   gene            541289..542014
FT                   /gene="plsC"
FT                   /locus_tag="HS_0499"
FT   CDS_pept        541289..542014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /locus_tag="HS_0499"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24776"
FT                   /db_xref="GOA:Q0I253"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I253"
FT                   /protein_id="ABI24776.1"
FT                   /translation="MLILLRAVVVIFCCILICVVGSLYSLIRFKNPSNVGVMARWFGRL
FT                   YPFFGLKVEHRFPENVDSIGRCIYIGNHQNNYDMVTVSAMVRPRTVSVGKKSLVWIPFF
FT                   GLLYWATGNILLDRENRSKAHNTINQLARRINEDNLSVWMFPEGTRSRGRGLLPFKMGA
FT                   FYAAITAGVPIVPVVCSTTHNRIDLNRWDNGKVICEMMSPVDTSNYTKDNVRELAEYCH
FT                   QIMQQRIAELDAEIQQQSV"
FT   gene            542030..543433
FT                   /gene="sufI"
FT                   /locus_tag="HS_0500"
FT   CDS_pept        542030..543433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufI"
FT                   /locus_tag="HS_0500"
FT                   /product="cell division protein SufI"
FT                   /note="SufI protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24777"
FT                   /db_xref="GOA:Q0I252"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR026589"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I252"
FT                   /protein_id="ABI24777.1"
FT                   /translation="MRSLTRRDFLKSGILAGSLSCIPQSVMAASRLPLFIPPLLEAKRG
FT                   RPIFLTMQAAQTSFIEKKLTEVWGFNGHHLGPTVRVEQGDFVKLNYRNNLTQAVAMNIQ
FT                   GLQAHSELIGGIGRVLMAGEGWAPILPITQPASTCFYHACTLANSAYQTYRGLVGMWII
FT                   NDKDTHQSKLPKKYGVDDIPLILQDVLLNSKGEQVFQNQPHFLGERLLVNGVEAPYLNV
FT                   PKGLVRLRLLNASLSRSYDLTFDDDRAFFLIAREQGYLPQTKIVKKVSLAPSERVELLV
FT                   DLSEGGNATLITGSKRNLLNKIGTIFSSDMLVDNVIVELRTEGVKSVFYNPSHWQFHTD
FT                   APSLLAKKNMKTREFYFDVSNATINQQRFEPNRIDISTKRGQIERWILSSSRPVGFKIQ
FT                   GARFVMKSINDQPVEQSDIAWKDSLWIDGKVEILVQFNHASSTKFPFIFGSSDLVLADQ
FT                   GCLGSIVVQ"
FT   gene            complement(543483..544139)
FT                   /gene="rnt"
FT                   /locus_tag="HS_0501"
FT   CDS_pept        complement(543483..544139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnt"
FT                   /locus_tag="HS_0501"
FT                   /product="RNAse T"
FT                   /EC_number="3.1.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24778"
FT                   /db_xref="GOA:Q0I251"
FT                   /db_xref="InterPro:IPR005987"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I251"
FT                   /protein_id="ABI24778.1"
FT                   /translation="MTALSEQAVDYNLLKNRFRGFFPVIIDVETAGFNAQTDALLELAA
FT                   ITLKMDENGLLVPDEKCHFHIQPFEGANINPESLKFNGIDIDNPLRGAISENVAMSELF
FT                   KMVRHGQKKADCQRSVIVAHNATFDQSFVMAAAERTKIKRNPFHPFSIFDTATLSGFMF
FT                   GQTVLVKGCQVANISFDGKKAHSALYDAERTAELFCYMVNHLKKLGGFPHVAINS"
FT   gene            complement(544227..544637)
FT                   /gene="gloA"
FT                   /locus_tag="HS_0502"
FT   CDS_pept        complement(544227..544637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloA"
FT                   /locus_tag="HS_0502"
FT                   /product="lactoylglutathione lyase (glyoxalase I)"
FT                   /EC_number="4.4.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24779"
FT                   /db_xref="GOA:Q0I250"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I250"
FT                   /protein_id="ABI24779.1"
FT                   /translation="MRILHTMLRVGDMDRSIHFYQQVLGMRLLRTSENTEYKYSLAFLG
FT                   YDDEENSSVIELTYNWGVSKYEMGTAYGHIAIGVEDIYATCKAVKEAGGKITREPGPVK
FT                   GGKTVIAFVEDPDGYKIEFIENKMAQAGLGNQ"
FT   gene            complement(544887..545978)
FT                   /gene="engD"
FT                   /locus_tag="HS_0503"
FT   CDS_pept        complement(544887..545978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engD"
FT                   /locus_tag="HS_0503"
FT                   /product="noncellulosomal endoglucanase"
FT                   /note="GTP-dependent nucleic acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24780"
FT                   /db_xref="GOA:Q0I249"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I249"
FT                   /protein_id="ABI24780.1"
FT                   /translation="MGFKCGIVGLPNVGKSTLFNALTKAGIEAANYPFCTIEPNTGVVP
FT                   MPDPRLDALADIVKPERILPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIGHVV
FT                   RCFENDDIVHVAGKIDPLDDIETINTELALADLDSCERAIQRLQKRAKGGDKEAKFELS
FT                   VMEKILPVLENAGMIRSLDLDKDELHAIKSYNFLTLKPTMYIANVNEDGFENNPYLDKV
FT                   REFATKEGSVVVPVCAAIEAEIAELDDDEKTDFLQDLGIEEPGLNRVIRAGYALLNLQT
FT                   YFTAGVKEVRAWTVSVGATAPKAAAVIHTDFEKGFIRAEVIAYDDFIQYKGEAGAKEAG
FT                   KWRLEGKDYIVQDGDVMHFRFNV"
FT   gene            complement(546045..546629)
FT                   /gene="pth"
FT                   /locus_tag="HS_0504"
FT   CDS_pept        complement(546045..546629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="HS_0504"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24781"
FT                   /db_xref="GOA:Q0I248"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I248"
FT                   /protein_id="ABI24781.1"
FT                   /translation="MSEIKLIVGLGNPGDKYADTRHNAGEWLIERLARRFNFNLSVESK
FT                   FSGKTARAVISGQEMRFLVPTTFMNLSGKAVSALANFYRIPPEQILVLHDELDFSPGIA
FT                   KIKQGGGHGGHNGLKDIIAQLANNKNFYRLRIGIGHPGDKNLVASYVLNKPSPTDRQLI
FT                   DRSLEEATDCIEILMKEGITKATNRLNAFKA"
FT   gene            546715..547242
FT                   /locus_tag="HS_0505"
FT   CDS_pept        546715..547242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0505"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24782"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I247"
FT                   /protein_id="ABI24782.1"
FT                   /translation="MLYESFFSILSLISTALFRYNCNIFCSTSYFMPSINQRALVSYSA
FT                   KQMYDIVNDYESYPQFLPHCIAAKALQSIDNETIGELTISTAGIKQVFATKNQLIPNQE
FT                   ITMQLASGPFKYLQGKWVFREIDEQSCEIALQLEFEFSNPVIAFAFGRIFSQLTTKMIE
FT                   AFKQRAKDVYLD"
FT   gene            547235..547567
FT                   /locus_tag="HS_0506"
FT   CDS_pept        547235..547567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0506"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24783"
FT                   /db_xref="InterPro:IPR005346"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR037021"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I246"
FT                   /protein_id="ABI24783.1"
FT                   /translation="MINIEITYALPHKYYLKKLQVEKGTIIQAAIFQSGILQEFTEIDL
FT                   RENKVGIFSRPAKLTDIVNEGDRIEIYRPLLADPKEIRRKRAEQQQKELEEKKKAEKFA
FT                   KKVGTM"
FT   gene            547721..548173
FT                   /gene="ntpA"
FT                   /locus_tag="HS_0507"
FT   CDS_pept        547721..548173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpA"
FT                   /locus_tag="HS_0507"
FT                   /product="dihydroneopterin triphosphate pyrophosphatase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24784"
FT                   /db_xref="GOA:Q0I245"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003564"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I245"
FT                   /protein_id="ABI24784.1"
FT                   /translation="MNYKNPNSILVVIYAKKTNRVLMLQRQDDSEFWQSVTGTMEIGET
FT                   PVQTAIREVREETGIDILAENLPLFNCHKQIEFEIFPHFRYKYAPDITHCIEHWFLLPL
FT                   ADERVINLSEHSAYQWCSVQDAIKLTKSPNNAEAINEYKSTIIKGI"
FT   gene            548175..548915
FT                   /locus_tag="HS_0508"
FT   CDS_pept        548175..548915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0508"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24785"
FT                   /db_xref="GOA:Q0I244"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I244"
FT                   /protein_id="ABI24785.1"
FT                   /translation="MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKLGGGDVGA
FT                   NPRLRAAVDKALSNNMTRDTINRAIERGVGGGDGTNMETRIYEGYGPGGTAVMVECLSD
FT                   NANRTISQVRPSFTKCGGNLGTEGSVGYLFSKKGLILVESADEDALTEAAIEAGADDIQ
FT                   VQEDGSVEIYTAWEDLGLVKDGIEVVGFKVVNAEVTMIPSTMVDLDAETAPKLLRLIDM
FT                   LEDCDDVQNVYHNGEISDEVAALL"
FT   gene            549074..549643
FT                   /gene="ruvC"
FT                   /locus_tag="HS_0509"
FT   CDS_pept        549074..549643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="HS_0509"
FT                   /product="Holliday junction endonuclease RuvC"
FT                   /EC_number="3.1.22.4"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24786"
FT                   /db_xref="GOA:Q0I243"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I243"
FT                   /protein_id="ABI24786.1"
FT                   /translation="MSIILGIDPGSRVTGYGVVRQVGHKLEYLGSGVIRTSIDDLPTRL
FT                   KRIYAGITEIITQFNPNEFAIEQVFMAKNPDSALKLGQARGTAIVAAVNQNLPVFEYSP
FT                   RTIKQTVVGTGAAEKSQVQEMVVRLLQLSDKPQVDAADALAIAITHANSIHNSLQIANS
FT                   IAIKTPDKITALLRTKYRRGRLRLKG"
FT   gene            complement(549723..550808)
FT                   /gene="glpQ"
FT                   /locus_tag="HS_0510"
FT   CDS_pept        complement(549723..550808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="HS_0510"
FT                   /product="glycerophosphodiester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24787"
FT                   /db_xref="GOA:Q0I242"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I242"
FT                   /protein_id="ABI24787.1"
FT                   /translation="MKLATPLCAIALVAATLSGCSAQFENNVNQKDKIIIAHRGASGYL
FT                   PEHTLESKALAFGQHADYLEQDLAMTKDNHLIVIHDHFLDGLTDVAKKFPHRHRKDGRY
FT                   YVVDFTLKEIQSLEMTENFSLKDGKQVQVYPNRFPLWQSHFRIHTFEDELEFIQGLEKS
FT                   TGQKIGIYPEIKAPWLHHQEGKDIALATLKVLKKYGYTKKDDLVYLQTFDFNELKRIKT
FT                   ELLPKLGMDVKLVQLVAYSDWGETQEKNAQGKWVNYDYDWMFKPGAVEKIAKYADGIGP
FT                   GWYMMIDQEKSKPNAVAYTPLAEELAKYKLEVHPYTVRKDALPDFFDNVDQMYDALFKG
FT                   GATGVFTDFPDTGVNYLKTHK"
FT   gene            complement(550922..552367)
FT                   /gene="glpT"
FT                   /locus_tag="HS_0511"
FT   CDS_pept        complement(550922..552367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="HS_0511"
FT                   /product="glycerol 3-phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24788"
FT                   /db_xref="GOA:Q0I241"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I241"
FT                   /protein_id="ABI24788.1"
FT                   /translation="MFGPFKPAPYIEELSKDRIDPTYRRLRWQVFMGIFFGYAAYYFVR
FT                   ANFDLAQKGLIEAGLYNKAELGIIGTGAGLAYGLSKFVMAGISDRSNPKVFLPFGLLLS
FT                   GLCMTMMGLMPWATSGIAVMFVMIFLNGWFQGMGWPPCGRTMVHWWSKSERGTIVSIWN
FT                   CAHNIGGMVPGLMVLLASAIYFSEFGVQATAKDIWQQALYYPGIAAMICAIPVYFVMKD
FT                   TPQSCGLPAIEKWRNDYPDDYNEKTYENNLTTKEIFVTYVLKNKLLWYIAIANVFVYLI
FT                   RYGVLKWSPVYLGEVKHFNIKGTAWAYTIYELAAVPGTLLCGWVSDKVFKGKRGLTGFI
FT                   FMILTTIAVVALWMNPATPEHELAQYAGKAWYQNPYQLTDFILMTTVGFLIYGPVMLIG
FT                   LHALELAPKKAAGTSAGFTGLFGYLGGTVSASAVVGWAAEYYGWDGGFYVMITGGILAI
FT                   LLMFITMIEEGKHKAKLDDHYGK"
FT   gene            552693..554381
FT                   /gene="glpA"
FT                   /locus_tag="HS_0512"
FT   CDS_pept        552693..554381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpA"
FT                   /locus_tag="HS_0512"
FT                   /product="glycerol 3-phosphate dehydrogenase (quinone)
FT                   subunit A"
FT                   /EC_number="1.1.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24789"
FT                   /db_xref="GOA:Q0I240"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017752"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I240"
FT                   /protein_id="ABI24789.1"
FT                   /translation="MSMSSQKFSKDFPPLSADVIIIGGGATGAGIARDCALRGIDCILL
FT                   ERYDIATGATGRNHGLLHSGARYAVNDHESAEECILENKILKRIARHCVEDTKGLFITL
FT                   PEDDLNYQKIFIQSCTKAGIEAVPIEPDLARIMEPSVNPELIGAVVVPDGSIDPFRLTS
FT                   ANMLDAREHGAKIFTYCAVTQLIREGGRVIGTEVYDHKNKINRRFFAQVIVNAGGIWGQ
FT                   GIAEYADLKVKMFPAKGALLVMGHRINNLVINRCRKPADADILVPGDTICVIGTTSDRI
FT                   PYDQIDNMIVTPEEVDILFREGEKLAPSLRHTRVLRAYAGVRPLVASDDDPSGRNVSRG
FT                   IVLLDHASRDGLEGFVTITGGKLMTYRLMAEWATDLVSKKLGKQTVCTTAQELLPGSES
FT                   DQNVPHINKIISLPTPLQISARYRHGQRASRLIGKERSDCTLVCECEAVTAGEVRYAVE
FT                   ELKVNNLVDLRRRTRVGMGTCQAELCACRAAGLMARFHMATPRQSTLQLSSFMEERWRG
FT                   IEPIAWGEAIREAEFSSWIYYSLLGLNSVQSLTEQAQQGTDGNEI"
FT   gene            554371..555669
FT                   /gene="glpB"
FT                   /locus_tag="HS_0513"
FT   CDS_pept        554371..555669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpB"
FT                   /locus_tag="HS_0513"
FT                   /product="glycerol 3-phosphate dehydrogenase (quinone)
FT                   subunit B"
FT                   /EC_number="1.1.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24790"
FT                   /db_xref="GOA:Q0I239"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR009158"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I239"
FT                   /protein_id="ABI24790.1"
FT                   /translation="MKFDVVIIGGGLAGLTCGIMLQQKGKCCAIINNGQSAMNFSSGSM
FT                   DLLSQLPNGEKINSFEQGYDSLEEQLPNHPYCLFGKQHVLQKAKQFEQLIEKINLNVTG
FT                   SYKQNHFRVTPLGGLHRTWLSADCIPTMDLHDEHFGYQKITVLGIEGYHDFQPHLLAEN
FT                   LIQHPQFTHCSITTALLHLPELDQLRLTSREFRSVNISQLLEHRLAFRELVQEIKQASG
FT                   DGEAIFLPACFGLDNQDFFNKLTLETGLNLYELPTLPPSLVGLRQHKKLKTYFEKLGGF
FT                   ILNGDKALRAVIEDQQVKQIYTQLHQEHGIFAEHFVLASGSFFSNGLVSVFDRLLEPIF
FT                   DVDMIGNSMIDIQNRLTWTARRFSSPQPYQSAGVAINSCCQLKKSGQIIKNLYAAGNVI
FT                   GGYNALELGCGSGVAVVTALTVADNIIEAQNRV"
FT   gene            555680..556951
FT                   /gene="glpC"
FT                   /locus_tag="HS_0514"
FT   CDS_pept        555680..556951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpC"
FT                   /locus_tag="HS_0514"
FT                   /product="glycerol 3-phosphate dehydrogenase (quinone)
FT                   subunit C"
FT                   /EC_number="1.1.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24791"
FT                   /db_xref="GOA:Q0I238"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR017753"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I238"
FT                   /protein_id="ABI24791.1"
FT                   /translation="MNIQQLIENAKQHAAFPITQHHTDESFESCIKCTACTVVCPVSRQ
FT                   NPFYPGPKQAGPDGERLRLKSAALYDEALKYCINCKRCEVACPSDVKIGDIIIRARNKY
FT                   LDQQHKSPIHKLRDAVLSNTDIMGKMNTPFAPIVNAITGLKATRYVLDKTLKVSKHRTL
FT                   PKYSFGSFRQWYKKYALDRQIYFRDKIVYYHGCYVNYNYPQLGKDLIKVLNSIDIGVIL
FT                   LEKEKCCGLPLMVNGFPEKAKKQAEFNIKQIERVIQEKALDIIGTSSSCTMNLRDEYHH
FT                   ILGMDNARIRPHVNIATKYLYRLYLDGKIPHFKSTPLKVAYHTACHVEKAGWAPYTLAL
FT                   LKQIPDLDVTILPSQCCGIAGTYGFKSENYQTSQAIGKSLFEVIEQGCFDYVITECETC
FT                   KWQIDMSTSASCLHPVSLLARALN"
FT   gene            complement(557001..557759)
FT                   /gene="glpR"
FT                   /locus_tag="HS_0515"
FT   CDS_pept        complement(557001..557759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpR"
FT                   /locus_tag="HS_0515"
FT                   /product="glycerol-3-phosphate regulon repressor (glp
FT                   operon repressor)"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24792"
FT                   /db_xref="GOA:Q0I237"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I237"
FT                   /protein_id="ABI24792.1"
FT                   /translation="MKQSLRHKKIIELIKQKGYLSTEELVNFLSVSPQTIRRDLNELAE
FT                   NNLITRHHGGATSLSTSENSDYSERQHFFSSEKRRIGQEVAKIIPNGSSLFIDIGTTPE
FT                   AVAKALLDHQNLRIVTNNLNAAYILMQNKTFDITMASGSLRQDGGIIGEATIAFIGQFR
FT                   LDFGILGISSIDLDGSLLDYDYHEVQVKRAIMESSRNTILVTDHSKFTRRAMVYLGSLT
FT                   EVDYLFTNTTPPDSMLSLIHSSNVKLHICQ"
FT   gene            complement(558033..559520)
FT                   /gene="pepA"
FT                   /locus_tag="HS_0516"
FT   CDS_pept        complement(558033..559520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="HS_0516"
FT                   /product="aminopeptidase A, Metallo peptidase, MEROPS
FT                   family M17"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24793"
FT                   /db_xref="GOA:Q0I236"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I236"
FT                   /protein_id="ABI24793.1"
FT                   /translation="MKYSAKNTALSQIDSNIILAVFEDGELSPTAMQFDQLSQGYLTRL
FT                   IQVGEVSGKQGQVLILRDIPNCQAQRIFIVGCGKKDKITERQYKQIIQKTIQTILETQA
FT                   SEVVSFLNEIELKNRDIHWNIRFAIETIEASFYQFDAFKTKKGDENSVLNEFIFDVQPE
FT                   LQQDALLAITYAQAIALGVKHAKDIANCPPNICNPTYLAEQAQSLAKHSNLINVQVLGE
FT                   KEMAELNMFSYLAVSQGSANEAKMSVIEYRNHPDKNAKPIVLVGKGLTFDAGGISLKPA
FT                   DSMDEMKYDMCGAASVFGVMYALATLQLPLNVIGVLAGCENLPDGNSYRPGDILTTMSG
FT                   LTVEVLNTDAEGRLVLCDALTYVERFNPELVIDVATLTGACVVALGQHNSGLIATDEKL
FT                   AEKLLNAAEETTDKAWRLPLSEEYQEQLKSNFADLANIGGRWGGAITAGAFLANFTKNY
FT                   PWAHLDIAGTAWLQGTNKGATGRPVSLLTQFLINQSK"
FT   gene            559639..560742
FT                   /locus_tag="HS_0517"
FT   CDS_pept        559639..560742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0517"
FT                   /product="conserved permease"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24794"
FT                   /db_xref="GOA:Q0I235"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030922"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I235"
FT                   /protein_id="ABI24794.1"
FT                   /translation="MILIRYLTKEVFRSQIAILSILLLLFFSQQLVRVLGSASVGKIPA
FT                   DLVFALLSLGMPTMAQLIFPLCLFIAILLTFGRLYAESEITVMRACGVGQRILVGVALI
FT                   LSLLTAGLATYNVFYLSPWAMQKQIQLIDDAKANPTMGALASGQFVNVGNTDVVLFINE
FT                   IKNNQIQDIYVFQMENKKNQKPSVTVAETGQLKVLPNGDQVLSLENSQRVEGSALLPDF
FT                   RITHFDQYQAYLDYKTTDKDTSETEILSLKELINSKSPAAKAELHWRLTLIFAVPIMAL
FT                   IAVPLSRVNPRQGRFAKILPALLLYLIYFLLQSSLKSAGASGKIEAHIFMPLVSIFFLF
FT                   LAVLLNSWNSVFMYKIRYLFNFNSSKR"
FT   gene            560755..561825
FT                   /locus_tag="HS_0518"
FT   CDS_pept        560755..561825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0518"
FT                   /product="conserved permease"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24795"
FT                   /db_xref="GOA:Q0I234"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I234"
FT                   /protein_id="ABI24795.1"
FT                   /translation="MMNTLDRYIGKNILGAILATLLMLVGLSAIIKFVEQFRSIGKGTY
FT                   DVIQATLFTLLTMPKDIETFFPMAALLGSLIALGNLASRSELIVIQSAGFSRFRIGLAV
FT                   MKTALPLMLITMIIGEWGIPQTEHFARDMRAKAISGGSMLSVKNSIWARDSNDFIYVGR
FT                   ITNDIRLNDIYIYSFDDKRQLKQVTHANQASFEHGKWKLSGINQSQIFADEIKTINRLK
FT                   DNWSTTLTPDKLGIASLRPTSLSMTGLYNYIKFMKETGQDAKRFELTFWQKVFQPVSVA
FT                   VMMMLALSFIFGSLRSVTAGARIVTGIFFGFLFYVINEILGRLSLLYDIPIVLAALIPS
FT                   LLFMILIWWLLNRKRE"
FT   gene            561972..562061
FT                   /locus_tag="HS_tLeu01"
FT   tRNA            561972..562061
FT                   /locus_tag="HS_tLeu01"
FT                   /product="tRNA-Leu"
FT   gene            562270..563574
FT                   /gene="intA"
FT                   /locus_tag="HS_0519"
FT   CDS_pept        562270..563574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="intA"
FT                   /locus_tag="HS_0519"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24796"
FT                   /db_xref="GOA:Q0I233"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I233"
FT                   /protein_id="ABI24796.1"
FT                   /translation="MILKGAKHFIFFFFYTTKLMARLIKPLSNTEIEKAKIKKKAYPLR
FT                   DGNGLFLSVEISGSKIWRFNYYKPYTKKRTEISIGKYPEISLLQARKIRDEYLALLAQN
FT                   IDPKTHRDQKQNTQALERNTFKYVCAKWYAEIYPTKAPNEDTRARNWQRLERHIFPKLA
FT                   EIPLSEITPRLLIDVYREIGASNTLDKLHRLVKATLDYGIKLGIIEGHNCNLAKDDFIA
FT                   PLAKNHPAITPAELPELLKAINTAFKEGKLEFNTLFAFNLTLLTGLRQKELTRIEWAFI
FT                   DDGNKLLIIPSENMKQTRKLREQPKDHIIPLSSQMIKLIGTIRQFNGSSPYLFPRVRNR
FT                   NKTIGLDTVSNALRDNGYRDKQDAHGLRVVFRSYLSQIGFSVVVGELAIAHNSTGKGKI
FT                   QAIYDRYDYLEERKQAYQAWGDYCEKCGILLSLSE"
FT   gene            564106..564357
FT                   /locus_tag="HS_0520"
FT   CDS_pept        564106..564357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24797"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I232"
FT                   /protein_id="ABI24797.1"
FT                   /translation="MNQISQNEDDYISVYELIEWAREVSNGSIGHAAYLLLTDLDKKTI
FT                   QTYRKSPLTNIISKTKTNLFDMLKEANTFNSYDCDIPF"
FT   gene            564367..564879
FT                   /locus_tag="HS_0521"
FT   CDS_pept        564367..564879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24798"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I231"
FT                   /protein_id="ABI24798.1"
FT                   /translation="MKPFFEYDFKTTLINRAEIEKVLGISIPNKEKQDGHRAVKIDQTK
FT                   NYDNEDIKQVVTAKDEEIAKLKAEIENLLKSIDQSKSAVDYKKHSIHGHFSDNFEVLFK
FT                   ISKLIAEKCDPDNPHSYPNKEQIREHVKTYYSDSKELADAFYKIIIPEKVKNRGRPPQG
FT                   VETFKGF"
FT   gene            565047..565268
FT                   /locus_tag="HS_0522"
FT   CDS_pept        565047..565268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible phage transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24799"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I230"
FT                   /protein_id="ABI24799.1"
FT                   /translation="MTTQSETIQTIEQAQSVQPYQKKLINIEEVKAITGFSTTTIYKLM
FT                   NKGEFPKAKKCGRSTRWRLADIESYIAS"
FT   gene            565278..565523
FT                   /locus_tag="HS_0523"
FT   CDS_pept        565278..565523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0523"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24800"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I229"
FT                   /protein_id="ABI24800.1"
FT                   /translation="MVGVLKDNSKATQCRTILKVLRERSSSTFDFRQMGIASPAQRIKE
FT                   LREKGYQIETTRINSIDHTGQPHGGIALYQLISEPD"
FT   gene            565524..565763
FT                   /locus_tag="HS_0524"
FT   CDS_pept        565524..565763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24801"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I228"
FT                   /protein_id="ABI24801.1"
FT                   /translation="MQKPKRRIKAFYVVTGKTIDGNNENIAEFTHKGQIFKGLRKIGLD
FT                   FDKYQSITIHKSPIVVYEYEKEHNSNHYRPKSTK"
FT   gene            565777..566259
FT                   /locus_tag="HS_0525"
FT   CDS_pept        565777..566259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0525"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24802"
FT                   /db_xref="InterPro:IPR018880"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I227"
FT                   /protein_id="ABI24802.1"
FT                   /translation="MILKKCDLDHFTKCGQFFTISTHLKKASASRRKLKNTKANSTPQA
FT                   CFFIRNLRTPKINLAIDLFSMVERKGQPLAVGYVPLYVVSYPFTLYRPTVGSLAESLLN
FT                   ITKDTAKMLYKFLLLGENRLKLSIRAKSIQQARQQLNLTQHQAVFVARINTRGRYV"
FT   gene            566252..566476
FT                   /locus_tag="HS_0526"
FT   CDS_pept        566252..566476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24803"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I226"
FT                   /protein_id="ABI24803.1"
FT                   /translation="MSNRNLSNEITTLKAALKSLLDDLSAAEIYLNNDRTQWAEDDLED
FT                   VYCQLFKLAEQIDKLKTKYSSYKGDLDDE"
FT   gene            566469..566729
FT                   /locus_tag="HS_0527"
FT   CDS_pept        566469..566729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24804"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I225"
FT                   /protein_id="ABI24804.1"
FT                   /translation="MSNTNYQANQENAFKPDLEGIKNTLETSRDLIIQLKEKKPVIAFN
FT                   DEGQEVQLSQEKILDIVLTKLFCSIDDIDEIQTALLSLVAI"
FT   gene            566868..567359
FT                   /locus_tag="HS_0528"
FT   CDS_pept        566868..567359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0528"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24805"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I224"
FT                   /protein_id="ABI24805.1"
FT                   /translation="MSLKRYRNMTKIKFSVLPKNQSAVSIGDTITNNGYRTRKTCGIFL
FT                   PQIPIINGLSLLSSICLSEFVARSIRRDKAEFIRTNKASRLLAVVEALLHPLGNSNSHL
FT                   LTTNKRKIKMLFKFILFLGENRLKLAIRANSEQQARNLLNLKSNALFIARINDKGGIYA
FT                   "
FT   gene            567352..567585
FT                   /locus_tag="HS_0529"
FT   CDS_pept        567352..567585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24806"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I223"
FT                   /protein_id="ABI24806.1"
FT                   /translation="MLNQINKLNDFHSFRTNLMLERLEETEAQITLLRRYVENDEDKTV
FT                   NHGLSLLQDSLNHLLQAIRLNPDFEKKRGKDE"
FT   gene            567578..567829
FT                   /locus_tag="HS_0530"
FT   CDS_pept        567578..567829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24807"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I222"
FT                   /protein_id="ABI24807.1"
FT                   /translation="MNNSYLESDYPIPSELSVELTNPELEEAFKNAIAEGKRLAIEMTE
FT                   TKDNRRINEMMGISSEYKKECREGNIHKAQQGGNDEQK"
FT   gene            567813..568184
FT                   /locus_tag="HS_0531"
FT   CDS_pept        567813..568184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24808"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I221"
FT                   /protein_id="ABI24808.1"
FT                   /translation="MMNRNNKTYWKLLTAFVFKEFTIPVIYRFAHTEQQARKFQETFLL
FT                   ERGELLRIEPMRESEVLLMCELANVENITRAFLLNSVKKKEVQSVIKNFSIAFPIFSNF
FT                   QQKTIHDLDVARFILQGDK"
FT   gene            568181..568708
FT                   /locus_tag="HS_0532"
FT   CDS_pept        568181..568708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0532"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24809"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I220"
FT                   /protein_id="ABI24809.1"
FT                   /translation="MRTTINALTELKQLKGRFKPSNNKKGHISKTQYKSHDEDLANKQP
FT                   NTNTKAKNTDTAQSIPFRFTLSQTNRLFELNKQAIERCKLNFPDHYHHKYKLAEECTEI
FT                   AKRLATARYLIKCLKSYTVEQSQEQDSMTKESLAVLHYLADKFGEMSEFVKLVDENGNK
FT                   LEHFDNKNDLEG"
FT   gene            568711..570621
FT                   /locus_tag="HS_0533"
FT   CDS_pept        568711..570621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0533"
FT                   /product="phage DNA primase-like protein"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24810"
FT                   /db_xref="GOA:Q0I219"
FT                   /db_xref="InterPro:IPR006500"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I219"
FT                   /protein_id="ABI24810.1"
FT                   /translation="MRKLINAPNLKKIIKQNIHPAQEILILIGDNPWSFYRKNPRDEKT
FT                   NGQGSGWMLLADNIDGENPNRYKELPIIIDERNYKELDKLALLPNEHKSASLVDTSGLF
FT                   KVKSNNNGITIRENEELLRNICINLAKYTQVNAFSLRDLLGQHLEDLSTYIERLRDEYS
FT                   QESEGEPELIELDADTLKKATPSDKAGYFLKWLKKPLAYNQTQGLIYFYNGQIWQVKDE
FT                   NALQREIKTFFSEYNANYGSVETINNMIKCLTVDLPLFDDEIKAAMDYQFLAFKNGVLN
FT                   KRTLAFLPHKKEYYLTAINPCDYLETQTPTPNFDKWLDFISNDSIERKKALLAALYMIL
FT                   NNRSDWQLTLEFIGEPGSGKSTFLNVAKMLSGDANHVAIDLETLQRDSKTRDMLLNKTF
FT                   LYAPDQGRYIGESSVLKAISGGDEILVNPKGKKTFSARINAIIAICSNTLPIYKNDGGG
FT                   MERRRVVFPFYKAIDDSARDDKLTEKIQAELGGIIRKLYDEFKDPEDAKQALKQQKASA
FT                   EALKMKTENDHILEFIQEFELISQPSNDCLILGSSRGIPAYESPLIFERFYWCYLYYCY
FT                   ITGREGKFILKPVEFKKEVIQAFKTIGEKPFTARQLGGGYNYTNAKFKNKHETVNKWRN
FT                   A"
FT   gene            571152..571433
FT                   /locus_tag="HS_0534"
FT   CDS_pept        571152..571433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0534"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24811"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I218"
FT                   /protein_id="ABI24811.1"
FT                   /translation="MNASAMNNKIIITSKADKQLERIDSRYKKAIIETISTLTNFPDLV
FT                   LDITKLKGYMSKYRARVGKYRILFEWIEGEPRIIEIQEIKKRDERTYN"
FT   gene            571469..571864
FT                   /locus_tag="HS_0535"
FT   CDS_pept        571469..571864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24812"
FT                   /db_xref="GOA:Q0I217"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I217"
FT                   /protein_id="ABI24812.1"
FT                   /translation="MNNLQYIRDNSGKPLYVILPIAEFEKLVEVDEYGFRIEEDDSEEW
FT                   QDVPYEKDDNDAVTIPFDVVKIKHENNINLLGAWRIYRGLSQKDVAVKVGITQGAISQM
FT                   EQPDNKPQKKTLEKFAAIYECEVEQMY"
FT   gene            572003..572296
FT                   /locus_tag="HS_0536"
FT   CDS_pept        572003..572296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0536"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24813"
FT                   /db_xref="GOA:Q0I216"
FT                   /db_xref="InterPro:IPR018669"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I216"
FT                   /protein_id="ABI24813.1"
FT                   /translation="MRIIAISTLVRYYHAHPEAEQPLKAWIAEVKKADWQNAHDIKAKY
FT                   KNASVLKNRRVVFNIKGNEHRLIVAIAFKIEKICLIPFLKIIQYEPIKTQQT"
FT   gene            572309..572896
FT                   /locus_tag="HS_0537"
FT   CDS_pept        572309..572896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24814"
FT                   /db_xref="InterPro:IPR025272"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I215"
FT                   /protein_id="ABI24814.1"
FT                   /translation="MFNELKVAQATAYLLHKAGGTMEHIKAMKLLYLADRLSWQKYNYS
FT                   ISNDEYYSLPYGPVLSNTLNLMRGEEASLYQNNSIWGEWIADKEDHKISLKRTVDTADE
FT                   YFFDCLSESDTEILDEIFATFGSYKPFALVEYTHNPKYIPEWENPQGRSKPIYLATLLS
FT                   NLGKTEREIADILEQIEEKKTMDSFFTGVDNA"
FT   gene            572889..573335
FT                   /locus_tag="HS_0538"
FT   CDS_pept        572889..573335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0538"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24815"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I214"
FT                   /protein_id="ABI24815.1"
FT                   /translation="MPEIKRQVTILRPTDYGKDESNYKHLYILLTDPCFDGESGKEDMI
FT                   LSVNCSSIKDGKALDETCILKAGIHEFITRDSFIFYRHLRIDSSKEIQANIEAGYFIQK
FT                   ALINDEIYQQILRGVLSSKSVDRKYKRFLKNAIRQNACHDINEY"
FT   gene            573579..573782
FT                   /locus_tag="HS_0539"
FT   CDS_pept        573579..573782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24816"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I213"
FT                   /protein_id="ABI24816.1"
FT                   /translation="MKSNLRNGRKNCETAKRYFFSRFNAVKHGGYASSNYFTAIANDER
FT                   LQQRKRGRFVDKISYATYQKTA"
FT   gene            complement(574743..575204)
FT                   /locus_tag="HS_0540"
FT   CDS_pept        complement(574743..575204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24817"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I212"
FT                   /protein_id="ABI24817.1"
FT                   /translation="MAISTDLSQANSQVAKPKEVKKLLVEQKEIARAVGHISQAANVYA
FT                   NNKAKETQYVEWQEGGSKRRKLDAVVATVGAILSGGTAGQVVAAAISPELNAQIHTMTK
FT                   DSKMANLLAHALLSATEAHLSGTNALVGATAGVAGETTAMFLSDVVFNR"
FT   gene            complement(575341..576051)
FT                   /locus_tag="HS_0541"
FT   CDS_pept        complement(575341..576051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24818"
FT                   /db_xref="GOA:Q0I211"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I211"
FT                   /protein_id="ABI24818.1"
FT                   /translation="MKNISSIFNDQQKKRALIILSFFHIFIITASNYLVQIPFEITIPL
FT                   TTLGFAENFSFHNTWGAFTFPFIFLATDLTVRVFGAREARWIIFVVMIPALIISYLVST
FT                   LFSDSQYQGLHVLTSFNTFVFRIAFASFAAYLFGQLLDVYVFNHLRKLKTWWIAPSCSM
FT                   VFGSLADTFIFFGIAFYASNDPFMAEHWVEIGSVDYLFKIFISILFFVPAYGILLNYIM
FT                   NKLRLFSMEPATTA"
FT   gene            576234..577019
FT                   /gene="ubiE"
FT                   /locus_tag="HS_0542"
FT   CDS_pept        576234..577019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="HS_0542"
FT                   /product="2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
FT                   / demethylmenaquinone methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24819"
FT                   /db_xref="GOA:Q0I210"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I210"
FT                   /protein_id="ABI24819.1"
FT                   /translation="MSEPENLAQNQPHFFEETTHFGFQTVAKSEKQKLVANVFHSVAAK
FT                   YDLMNDLLSFGIHRVWKRFTIDCSGVRKGHKVLDLAGGTGDFSAKFSRIVGETGKVILA
FT                   DINSSMLDVGREKLRNLGIVGNVDYVQANAEELPFADNTFDCVIISFGLRNVTDKDKAL
FT                   RSMFRVLKPGGRLLVLEFSKPILDPLSKIYHFYSFNVLPKIGEIVVNDSDSYRYLAESI
FT                   RMHPKQDILKEMMINAGFEQVGYYNLTAGIVALHRGYKF"
FT   gene            577028..577663
FT                   /locus_tag="HS_0543"
FT   CDS_pept        577028..577663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0543"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24820"
FT                   /db_xref="GOA:Q0I209"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I209"
FT                   /protein_id="ABI24820.1"
FT                   /translation="MLPDFNSLKTQFMLPQFINAGCELLLNYLLRRTSHRERYLRQLQG
FT                   KILKLTLQKTHFSLYFVFSAQQVDLLNHYEGEADCTVDIAVNLLLQMPKKSEISRFIND
FT                   NSLQFSGDLQILQNFVELMEMLEKAPAELISPYVGDVIAHSAVSFLKNLTESIKYRLTQ
FT                   SQQFWAERLTEEWTVLSPKLAVMDFCDQVESLAKQTALLEQKINQILA"
FT   gene            577663..579297
FT                   /gene="ubiB"
FT                   /locus_tag="HS_0544"
FT   CDS_pept        577663..579297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="HS_0544"
FT                   /product="2-octaprenylphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24821"
FT                   /db_xref="GOA:Q0I208"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I208"
FT                   /protein_id="ABI24821.1"
FT                   /translation="MKLNDIKRLYKIVRVFLSYGIDEILPHNKYTRSIRCWRMLFFWLK
FT                   NKHKNKAFGLCLRLALQELGPVWIKLGQMLSTRRDLFPAEIADELALLQDNVEAFSGKI
FT                   ARQQIEQALGSSLENWFTDFDENALASASIAQVHTAKLKLGEEQEKEVVIKVLRPNIQP
FT                   QIEADLSWMYKLAGLLPKLFREGYRLRAVEVIQEYEKTLRDELDLRVEMANAIKLRENF
FT                   LDSPMLYIPKMYEAFCHKNVIVMERIYGIPVSDVETLQRNGTDMKLLAERGVQVFFTQV
FT                   FRDSFFHADMHPGNIFVNPHYPENPQYIGIDCGIVGKLNESDKRYLAESFVAFFNRDYR
FT                   RVAQMHVDAGWTPQDTNIDDFEQAFREVCEPIFAKPLSEISFAQVLLNLFNVAREFNMQ
FT                   VQPQLVLLQKTLLYIEGLGRQLYPQLDLWDTAKPFLQNWLNEQIGMKVTFKKLKAKLPY
FT                   LQEHLPDFPETLMDALKQQKFISQQLVEINKKLAKQQRWQKKMFVLIVGIVIFSVTLWQ
FT                   FAALPLAISAGLFLVGFLVWLIGFLLP"
FT   gene            579402..579623
FT                   /gene="tatA"
FT                   /locus_tag="HS_0545"
FT   CDS_pept        579402..579623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="HS_0545"
FT                   /product="Sec-independent protein translocase protein,
FT                   tatA/E family"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24822"
FT                   /db_xref="GOA:Q0I207"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I207"
FT                   /protein_id="ABI24822.1"
FT                   /translation="MGLSWQQLLILLLVVVVIFGTKKLRNIGSDLGGAVKDFKKAMNDD
FT                   QPKDAEFKKISEEVEQTSVENSKQKEQA"
FT   gene            579627..580181
FT                   /gene="tatB"
FT                   /locus_tag="HS_0546"
FT   CDS_pept        579627..580181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatB"
FT                   /locus_tag="HS_0546"
FT                   /product="Sec-independent protein translocase TatB"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24823"
FT                   /db_xref="GOA:Q0I206"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I206"
FT                   /protein_id="ABI24823.1"
FT                   /translation="MFDIGFSELVLLFVVGLIVLGPQRLPVAVRTVMGWVRTVRSLATN
FT                   VQNELSQELKLKELQESIKKAEDLNISQLSPELSETVEELRQSAQKIKMNLEEKAAETN
FT                   SSVEEQVQELKSAVQNSQGTATTEIEKNFDFPSGELSPAELAELAEEGEPMLEMGESDF
FT                   SEDEQATASSNETIENIKEKV"
FT   gene            580178..580915
FT                   /gene="tatC"
FT                   /locus_tag="HS_0547"
FT   CDS_pept        580178..580915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="HS_0547"
FT                   /product="Sec-independent protein translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24824"
FT                   /db_xref="GOA:Q0I205"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I205"
FT                   /protein_id="ABI24824.1"
FT                   /translation="MTVEKSQPLISHLLELRDRLLRCIVFVVVIFLALVYFANDIYNFV
FT                   ASPLLDVLPAGATMIATNIATPFFTPIKLTAVVALFISVPFLLYQVWAFVAPALYQHEK
FT                   RLVYPLLFSSTLLFYLGVAFAYYVVFPLVFAFLTKTAPEGVAIATDISSYLDFVLALFL
FT                   AFGICFEVPVAIVLLCWSGVTTPDDLRKKRPYIIVAAFFIGMLLTPPDAISQTLLALPM
FT                   CLLFEIGVICAGFYQPKDEQEKS"
FT   gene            580981..582003
FT                   /gene="hemB"
FT                   /locus_tag="HS_0548"
FT   CDS_pept        580981..582003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="HS_0548"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24825"
FT                   /db_xref="GOA:Q0I204"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I204"
FT                   /protein_id="ABI24825.1"
FT                   /translation="MTKQIFTGYPQRRLRRMRKQDFSRRLMSENKLTVDDLIYPVFIIE
FT                   GENHRESVPSMPNVERLTLDQLLLEAELMVKYGVPVIALFPVIEQEKKSLMAEEAYNQD
FT                   GLVQRAVKALKANFPELGVLTDVALDPYTVHGQDGIIDEYGYVLNDVTSDVLIKQALSH
FT                   AQAGADIVAPSDMMDGRIGRIRTALEKQGFVNTLIMAYSAKYASNYYGPFRDAVGSASN
FT                   LKGGDKKTYQLDPANSNEGLQEVALDIEEGADMVMVKPGMPYLDMVYRVKDQFGVPTFA
FT                   YQVSGEYAMHMAAIQNGWLKEKECIMESLLCFKRAGADGILTYFAKQVAEWLYLDEKNK
FT                   "
FT   gene            complement(582060..583241)
FT                   /gene="purT"
FT                   /locus_tag="HS_0549"
FT   CDS_pept        complement(582060..583241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purT"
FT                   /locus_tag="HS_0549"
FT                   /product="formate-dependent phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /EC_number="6.3.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24826"
FT                   /db_xref="GOA:Q0I203"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I203"
FT                   /protein_id="ABI24826.1"
FT                   /translation="MTILGTALTPKATKVMLLGSGELGKEVVIELQRLGVEVIAVDRYE
FT                   NAPAQQVAHRSYTISMLDGNALKALIEKEKPDYIVPEVEAIATSTLVELEQAGFNVVPT
FT                   AKATQLTMNREGIRRLAAEKLKLPTSNYQFVDNFDDFQSAVENLGIPCVIKPIMSSSGH
FT                   GQSILKSKDDLQKAWDYAQQGGRAGAGRVIVEGFVKFDYEITLLTVRHAEGTSFLAPIG
FT                   HRQEKGDYRESWQPQAMSVQALAKAQHIAEKITTELGGRGIFGVEMFVCGDEVIFNEVS
FT                   PRPHDTGMVTLISQELSEFALHARAILGLPIPEINLISPAASKAIVVEGKSNQVQFGNL
FT                   FEVLQEPNTNIRLFGKGEVNGHRRLGVILARDISVDKALEKVSRAYDKLDIQL"
FT   gene            complement(583282..583788)
FT                   /gene="luxS"
FT                   /locus_tag="HS_0550"
FT   CDS_pept        complement(583282..583788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="HS_0550"
FT                   /product="S-ribosylhomocysteinase (autoinducer-2 production
FT                   protein)"
FT                   /EC_number="3.13.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24827"
FT                   /db_xref="GOA:Q0I202"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I202"
FT                   /protein_id="ABI24827.1"
FT                   /translation="MPLLDSFKVDHTRMNAPAVRIAKTMQTPKGDNITVFDLRFCIPNK
FT                   EILSSKGIHTLEHLFAGFMRDHLNNEQVEIIDISPMGCRTGFYMSLIGTPNEQQVAEAW
FT                   LISMQDILNIKNQDEIPELNEYQCGTYTEHSLEEAQNIAQNILHRGVGINKNEDLLLDD
FT                   NLLNS"
FT   gene            584087..586075
FT                   /gene="tktB"
FT                   /locus_tag="HS_0551"
FT   CDS_pept        584087..586075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tktB"
FT                   /locus_tag="HS_0551"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24828"
FT                   /db_xref="GOA:Q0I201"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I201"
FT                   /protein_id="ABI24828.1"
FT                   /translation="MANAIRFLSMDAVQKAKSGHPGAPMGMADIAEVLWRDFLNHNPTN
FT                   PQWANRDRFVLSNGHGSMLIYSLLHLTGYDLSIEDLKQFRQLHSKTPGHPEYGYAPGIE
FT                   TTTGPLGQGITNAVGMAIAEKTLAAQFNRAGHDIVDHHTYVFLGDGCLMEGISHEACSL
FT                   AGTLGLGKLIAFYDDNNISIDGHVDGWFTDDTQKRFEAYGWHVIPAVDGHNAEQIVGAI
FT                   KQAQAEKNKPTLIMCKTIIGYGSPNKQNTHDSHGAPLGDEEIALTRQALNWNYAPFEIP
FT                   ADIYAKWNAHEKGQVAENAWNEKFAAYEKAYPELAVEFKRRLNGELPANWATESQSFIE
FT                   KLQANPANIASRKASQNAIEAYAKLLPEFLGGSADLAGSNLTLWSGSKPIRATENVDGN
FT                   YINYGVREFGMSAIMNGIALHGGFIPYGATFLMFMEYAHNAVRMAALMKQRSLFVYTHD
FT                   SIGLGEDGPTHQPVEQTTALRLIPNLETWRPCDQVESAIAWKAAVERQDGPSALIFTRQ
FT                   NLAQMNRTSEQLENVKRGGYILRACCEKGDCPDLILIATGSEVELAMKAAEALDAEGVK
FT                   VRVVSMPSTNVFDKQDVAYREAVLPSAVTKRVAIEAGISDFWYKYVGTNGRIIGMNSFG
FT                   ESAPADQLFKLFGFTVENIVSKAKEIL"
FT   gene            586239..587930
FT                   /gene="pyrG"
FT                   /locus_tag="HS_0552"
FT   CDS_pept        586239..587930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="HS_0552"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24829"
FT                   /db_xref="GOA:Q0I200"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I200"
FT                   /protein_id="ABI24829.1"
FT                   /translation="MFVVKANSPTLIFISKTHRFNMATNYIFVTGGVVSSLGKGIAAAS
FT                   LAAILEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTQDGAETDLDLGHYERFIRTK
FT                   MTKRNNFTAGKIYSEVLRKERRGDYLGATIQVIPHITNEIKSRVIDGAAGYDVAIVEVG
FT                   GTVGDIESLPFLEALRQLAVQVGRERTIFMHLTLVPYIPTAGEVKTKPTQHSVKELLSI
FT                   GIQPDVLICRSDRMIPPNERAKIALFCNVPERAVISLKDVSSIYQIPALLKSQGLDDFI
FT                   CQRFRLDCQEADLSEWEKVLYQEANPTGEVTIGMVGKYTELPDAYKSVNEALKHAGLTN
FT                   RLTVNIKYIDSQDVETKGIDILKDLDGILIPGGFGYRGVEGKILTAQYARENNVPYLGI
FT                   CLGMQVAFIEYARHVAGLKGANSSEFDRTCEYPVIALITEWQDAEGNVEVRSDESDLGG
FT                   TMRLGAQQCHLVAGSLAHQLYGSDIIEERHRHRYEVNNVIRPQVEKAGLKVTGLSADKK
FT                   LVEIIEVPNHPWFVACQFHPEFTSTPRDGHPLFAGFVKAASENRKK"
FT   gene            complement(587978..589612)
FT                   /locus_tag="HS_0553"
FT   CDS_pept        complement(587978..589612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0553"
FT                   /product="possible acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24830"
FT                   /db_xref="GOA:Q0I1Z9"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1Z9"
FT                   /protein_id="ABI24830.1"
FT                   /translation="MIKHFFPIQINPLLDNQEKIATKQSIFVHHEYEQLRKTIKSATLL
FT                   LSNFYLAHKQGYFDLSANENPILHIWSLAVEEQYYLFFPLLLVVAYKKFKTHQVFKPIV
FT                   LGLTLLFILTSFIPQSIYIKIGWSNTYYISFIRFPELLIGSYLALSKPRVKPANHFVGF
FT                   GIFIALILTLFFYHKSMPLMPGIVLLLPCILTALLIHFSSQNSWGGVKTLLSLKPIVWV
FT                   GKLSYSLYLFHWIFIAFTYYISGEKELPQGAILPIIVLTFICSALSYYLLEQPIRKSKL
FT                   TFKQSFFLLYLIPSLVVIGYNLSVRSHIKHKTSALQAQKAEQEVLPLNIPSKILTIGDS
FT                   HAGHLEDFLNYVGAKEGWRSDILRTSDCLSFEDKDCAKYWQKIESYPVIFISMFYELKR
FT                   GGTPVPRFNPNSFVIADFDQKFQAMVKHLAKTKKVYVFANNISLNRSALRNAFLAKYDL
FT                   DKYLNPIQKLADNTASNNEIFQLIKDIPNVTWVDAAKYLGDTVYVGNKSIYGDQDHFTP
FT                   FGSYYMGTLFHEKERLLSPQFVSELYQ"
FT   gene            589932..590333
FT                   /locus_tag="HS_0554"
FT   CDS_pept        589932..590333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0554"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24831"
FT                   /db_xref="GOA:Q0I1Z8"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1Z8"
FT                   /protein_id="ABI24831.1"
FT                   /translation="MIRRDDIGIDIKYDQKSTQTYKRVSPGQFVIHLRSFQGGFAWSDI
FT                   EGITSPAYTIIDFKKKENHSSNFWKLIFTSSSFIKKLETVTYGIRDGRSISFSDFSDLR
FT                   LFYSQIQEQQKIGTFFTALDRYITIHQRK"
FT   gene            590355..591281
FT                   /locus_tag="HS_0555"
FT   CDS_pept        590355..591281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0555"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24832"
FT                   /db_xref="GOA:Q0I1Z7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1Z7"
FT                   /protein_id="ABI24832.1"
FT                   /translation="MNEVNSNKELFYQYYSRWIHMYKEGAIRKVTMAKYLMTLEWLKKL
FT                   IPNLLLCDLNRISYQQLLNDYACYHERQTTMDFHHQLKGAILDAVDEGLLPRDPTRKAI
FT                   IKGRPPRLKKTKYLNQFELHTLITQLNLTKEINWDWFILLIAKTGMRFSEALALTPKDF
FT                   DFAHQTLTINKTWNYKDGGGFQPTKNRSSVRKIPLDWQTIIQFAELIKNKPEEQPIFVR
FT                   KKIFNSTVNNILIRRCKKANIPIISLHGLRHTHASLLLFAGVSIASVARRLGHSNMTTT
FT                   QKTYLHIIQELENRDIDIVMRSLSNLS"
FT   gene            complement(591294..591845)
FT                   /gene="hsdS"
FT                   /locus_tag="HS_0556"
FT   CDS_pept        complement(591294..591845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdS"
FT                   /locus_tag="HS_0556"
FT                   /product="possible type I restriction enzyme, specificity
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24833"
FT                   /db_xref="GOA:Q0I1Z6"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1Z6"
FT                   /protein_id="ABI24833.1"
FT                   /translation="MNNEKRLVPKLRFPEFTHAWEQRKAKEIFISVSEKGFPHLPVLSA
FT                   SQEFGMIRRDDIGIDIKYDQKSTQTYKRVSPGQFVIHLRSFQGGFAWSDIEGITSPAYT
FT                   IIDFKKKENHSSNFWKLIFTSSSFIKKLETVTYGIRDGRSISFSDFSDLRLFYSQIQEQ
FT                   QKIGTFFTALDRYITIHQRK"
FT   gene            complement(592009..592530)
FT                   /locus_tag="HS_0557"
FT   CDS_pept        complement(592009..592530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0557"
FT                   /product="phage P1-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24834"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1Z5"
FT                   /protein_id="ABI24834.1"
FT                   /translation="MDDENNWLPELLLLENFGGDWENYFNAVYQVFEQDFEQTKPRFAG
FT                   HKVNLKRHPTYNSKSATFWHMISEGKDESERTPDIRRCERIAWIKTIIEEFQEIQPTKN
FT                   SKVLWWLEMRGSEERYHLALPDFTYLIVIAKRKDFVLPWTAFYVEYEHQRRKYRKKYEK
FT                   YWESVGSQKS"
FT   gene            complement(592523..593221)
FT                   /gene="rlfA"
FT                   /locus_tag="HS_0558"
FT   CDS_pept        complement(592523..593221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlfA"
FT                   /locus_tag="HS_0558"
FT                   /product="enterobacteria phage P1"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24835"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1Z4"
FT                   /protein_id="ABI24835.1"
FT                   /translation="MSFNIYCDESCHLPNDKMPVMVLGAIRCPVEKTKEIAKRLREIKV
FT                   KHGFHPNFEIKWNKISKSKVDFYLDIIDYFFDDDDLSFRGLIIDKSKLNHVHYNQTHDD
FT                   WYYKMLFLLLKNLLMPKVSSFIYLDKKDTQSAIKVKKLHDVLCHSTYDFEQKYIKRVQV
FT                   VESHHVEQLQLADLLLGALGYYHRHLSSNEGKKIVINRIKERSGYVLDKNTLPTESKFN
FT                   LFHWEGNYYG"
FT   gene            complement(593223..596423)
FT                   /gene="hsdR"
FT                   /locus_tag="HS_0559"
FT   CDS_pept        complement(593223..596423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdR"
FT                   /locus_tag="HS_0559"
FT                   /product="type I site-specific deoxyribonuclease,
FT                   restriction subunit"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24836"
FT                   /db_xref="GOA:Q0I1Z3"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022625"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1Z3"
FT                   /protein_id="ABI24836.1"
FT                   /translation="MTKKIPELKFEKTLIEYLCTGTITATDNMIGEPPADYVVRTKLWQ
FT                   YEPSIKTTEDLWKNFKRILEKLNQKTLDRPLSAVEFAQVKRTISNLSTPYAAGQFLYGT
FT                   NGVSQIEIDLDDDRHVFLTVFDQKQIGAGDTVYQIVNQIKRPAIIAGKENRQFDTTLLI
FT                   NGLPIIQIEEKKETHDINEALNQMHQYIAENQYSDIFSTLQILIAITPNNVKYMANTTA
FT                   DRFNKDFAFNWQRQSDNKPVYHWKAFADSMLSIPMAHQMATNYMILDGTPNKQTLKVMR
FT                   PYQVYATRCVMDKLKRADFDQALNKLGYIWHTTGSGKTITSFKTAWLASRSPKVDKVVF
FT                   LVDRIALTNQTTENYRAYDPDATEDSLGSVLDTNNTTDLNRKLHSKGSQIIITSVQKLD
FT                   TLVKRTSFKAPEKNIVFIVDEAHRSTGSDNFAAIQKKFKHSAWIGYTGTPMFDDTTKGL
FT                   RTEDIFGELLHAYTIREAIADRNVLGFKVDFETTISEKSMKEAHLPKFYRLKYPHWTEE
FT                   QIALKIANLTQQDMDDSIEPSFYDENEEHVKLVVEDIFKHWKNRSNWDNKRNRGRYNAL
FT                   LTTHVGGGKASTPMAMMYFREFQRINKVRSEKGEFLLKVAVTFSQNTSNNDTMLETNQG
FT                   LFEAIQHYNSEFGTNFTMSDVSAYTQDVTSRLNRTAVDKKYLDLVIVVDQLLTGFDAPE
FT                   LNTLYVDRTLKGAGLIQAYSRTNRVADMREKPWGRIINYRWPAHNEKLMNEALSVYANK
FT                   DSAKLSDEERKVNNTKDKITAPKYEELLDDTKQIVENLREITDNFSQLPPSEAKKWEML
FT                   EQLRTYTANIAKIKQYSAEDENGEFIGFDYENPDKLIQELGMTSEEESMLTNTLSNELK
FT                   LHLAKSRNVPVIQIELQMTHVKDVEINYDYLTELISSLLAQVEAGETEKAKETEKELEK
FT                   FANGLEDRSFAQRINRAAKAIMKGVFKLKDGFKKDGISIVEQANNATQDQQFLDFRLQW
FT                   GLTEVITNAQLRQLFAKHQFQQKDLDDNNQLTDLIKQAGLTYPELAQNDEVKKLTKMKY
FT                   RNRLRHTIYELADEFVGE"
FT   gene            complement(596416..596994)
FT                   /gene="hsdS"
FT                   /locus_tag="HS_0560"
FT   CDS_pept        complement(596416..596994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdS"
FT                   /locus_tag="HS_0560"
FT                   /product="type I restriction enzyme, specificity subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24837"
FT                   /db_xref="GOA:Q0I1Z2"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1Z2"
FT                   /protein_id="ABI24837.1"
FT                   /translation="MLLSNIVEISSGQAQFRISEVSDPIAPVYTYYSQANLEQDLYLSD
FT                   GSAVLPKEIKTFDKITSLLSTGDVIFSLISGKATIVSKQHQGFLYTQNYVKLIPKNQID
FT                   ANYLVYLLNENAVVKKQLSRGLQGSQVLKYTTNQLKSLRLPKLPHLSEQRLMGEIYLKQ
FT                   QKLAYLKQRIANLEKLLVLHQLQKRVQHD"
FT   gene            597234..598535
FT                   /gene="eno"
FT                   /locus_tag="HS_0561"
FT   CDS_pept        597234..598535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="HS_0561"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24838"
FT                   /db_xref="GOA:Q0I1Z1"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1Z1"
FT                   /protein_id="ABI24838.1"
FT                   /translation="MAKIVKVIGREIIDSRGNPTVEAEVHLEGGFVGLAAAPSGASTGS
FT                   REALELRDGDKARFLGKGVLKAVSAVNNEIATALVGKEASNQAEIDQIMIELDGTENKS
FT                   KFGANAILAVSLANAKAAAASKGMPLYAWIAELNGTPGVYSMPLPMMNIINGGEHADNN
FT                   VDIQEFMIQPVGAKTLKEALRIGAEVFHNLAKVLKGKGLSTAVGDEGGFAPNLESNAAA
FT                   LACIKEAVEKAGYVLGKDVTLAMDCASSEFYNKENGMYEMKGEGKSFTSQEFTHYLEGL
FT                   CKEYPIVSIEDGQDESDWDGFAYQTKVLGDKVQLVGDDLFVTNTKILKEGIEKGIANSI
FT                   LIKFNQIGSLTETLAAIKMAKDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMS
FT                   RSDRIAKYNQLIRIEEALGEKAPFLGLKAVKGQA"
FT   gene            598843..599679
FT                   /gene="menB"
FT                   /locus_tag="HS_0562"
FT   CDS_pept        598843..599679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menB"
FT                   /locus_tag="HS_0562"
FT                   /product="1,4-Dihydroxy-2-naphthoate synthase"
FT                   /EC_number="4.1.3.36"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24839"
FT                   /db_xref="GOA:Q0I1Z0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1Z0"
FT                   /protein_id="ABI24839.1"
FT                   /translation="MLYVPVEWQDFSSGYTDILYHKSTDGIAKITINRPEVRNAFRPKT
FT                   VKEMIQAFSDARFDEKIGVIILTGQGEKAFCSGGDQKVRGDYGGYKDESGVHHLNVLDF
FT                   QRDIRSCPKPVVAMVAGYAIGGGHVLHMLCDLTIAAENAIFGQTGPKVGSFDGGWGASY
FT                   MARIVGQKKAREIWFLCRQYNAQEALEMGLVNTVVPYADLEKETVRWCREMLRNSPIAL
FT                   RCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGRNAFNEKRAPDFSKFKRNP"
FT   gene            599893..600891
FT                   /gene="menC"
FT                   /locus_tag="HS_0563"
FT   CDS_pept        599893..600891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menC"
FT                   /locus_tag="HS_0563"
FT                   /product="O-succinylbenzoate synthase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24840"
FT                   /db_xref="GOA:Q0I1Y9"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1Y9"
FT                   /protein_id="ABI24840.1"
FT                   /translation="MTNRTFHLYQYAIPVDSQLILRNRFLKKREGLFVQIKCGEHEGWG
FT                   EIAPLPEFSQETLEQAKEQTVQWLKKWEQARSANQKFSLQGLYPSVAFGLSCALAEMEG
FT                   ELAQEGNYQVAPLCYGDPDELYDVLNQIPGEKVAKIKVGMYEANRDGMIADMLLEAIPD
FT                   LYLRLDANRSWTLSKAQLFAKYVKPEHRKRIQFLEEPCKTQDDSRQFAQDTGIALAWDE
FT                   SIREQGFKLEKEPHLAAIVIKPTLIGSLQDCVKLIEKAHQLGLKAVISSSIESSLGLTQ
FT                   LARIAKQYTPNVTPGLDTLSLMDYQILRSWQGSDLPLLDLSSEFIKKIEIE"
FT   gene            complement(600940..601236)
FT                   /gene="fis"
FT                   /locus_tag="HS_0564"
FT   CDS_pept        complement(600940..601236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fis"
FT                   /locus_tag="HS_0564"
FT                   /product="DNA-binding protein Fis"
FT                   /note="transcriptional activator; factor for inversion
FT                   stimulation"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24841"
FT                   /db_xref="GOA:Q0I1Y8"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1Y8"
FT                   /protein_id="ABI24841.1"
FT                   /translation="MLEQRNPAEALTVSVLNSQSQVTNKPLRDSVKQALRNYLSQLDGQ
FT                   DVNDLYELVLAEVEHPMLDMIMQYTRGNQTRAATMLGINRGTLRKKLKKYGMG"
FT   gene            complement(601230..602213)
FT                   /gene="dusB"
FT                   /locus_tag="HS_0565"
FT   CDS_pept        complement(601230..602213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dusB"
FT                   /locus_tag="HS_0565"
FT                   /product="tRNA-U20-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24842"
FT                   /db_xref="GOA:Q0I1Y7"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1Y7"
FT                   /protein_id="ABI24842.1"
FT                   /translation="MQIGSYQLKSNVLLAPMAGITDQPFRRLCSFYGAGLTCSEMMSAN
FT                   PQVWHTEKSRLRLAHHQDAGINAVQIAGSDPIEMAQAAQVNVEYGAQIIDINMGCPAKK
FT                   VNRKLAGSALLQYPDLVKKILYSVVRAVNVPVTLKIRTGWNQEHRNCIDIAKIAEQAGI
FT                   QALSIHGRTRECLFNGNAEYDSIKKVKEQISIPVIANGDITTAKQAQEVLNYTGTDGIM
FT                   IGRGALGKPWLFQSIVSLIETGITIPEPSLDEKCSVILQHIRDLHQFYGEDKGYRIARK
FT                   HVSWYLEGIQPNSDFRQTFNAITNAKAQLIALEDFFNFILLDKETC"
FT   gene            complement(602400..603290)
FT                   /gene="prmA"
FT                   /locus_tag="HS_0566"
FT   CDS_pept        complement(602400..603290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="HS_0566"
FT                   /product="[LSU ribosomal protein L11P]-lysine
FT                   N-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24843"
FT                   /db_xref="GOA:Q0I1Y6"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1Y6"
FT                   /protein_id="ABI24843.1"
FT                   /translation="MAWVQLRLNSTNEKAEKISEYLEEIGAVSVTFMDSQDTPIFEPLP
FT                   GETRLWGNTDVIALFDAETNMQQIVRLLQQKNHLDENTAYKIEQIEDKDWEREWMDNFH
FT                   PMKFGKRLWICPSWREIPDENAINVMLDPGLAFGTGTHPTTALCLEWLDSLDLTGKTVI
FT                   DFGCGSGILAIAALKLGAKSAVGIDIDPQAILASYNNAEQNGVAERLQLFLSEEKPTDL
FT                   QADVVIANILAGPLKELYPIISNLVKPQGDLGLSGILSTQADSVCEAYQGKFTLDPITE
FT                   REEWCRITGKLNSFV"
FT   gene            complement(603291..604733)
FT                   /gene="panF"
FT                   /locus_tag="HS_0567"
FT   CDS_pept        complement(603291..604733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panF"
FT                   /locus_tag="HS_0567"
FT                   /product="sodium/pantothenate symporter (pantothenate
FT                   permease)"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24844"
FT                   /db_xref="GOA:Q0I1Y5"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011849"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1Y5"
FT                   /protein_id="ABI24844.1"
FT                   /translation="MNINIILPLVLYLLFVFGIAYYSYRQRSQGNFLSEYYIGNRSMSG
FT                   FVLAMTTAATYVGAGSFIGGPGAAYKFGLGWVLLAMIQVPVVLFTLGVLGKKLAMLARK
FT                   NQSLTVNDILFSRYKNPYIILLASLSLLFSFFIMMSVQFIGIGRLLETTLHIDYHISVL
FT                   IFATTVGIYTFIGGFRAVVLTDTIQGLIMVLGTFLLLGGVIYAGGGISQLIDHLAKIDP
FT                   HLITPYGTDDRPLDFTFMASFWVLVCFGLLGLPHTVVRAIAYKNSKALHSGIIIGTIVI
FT                   AVLMLGIHLAGALGRAVIPTLDVSDKIIPTLMIQVLPPVVAGIFLAAPMAAIMSSVDST
FT                   LIQMSSTLIKDLYLRFYPAQIHNETGIKRLSILTTLFLTLLVTIATLNPPDMLIWLNLF
FT                   ALGGLETTFLWVMLFGLYWKKANAYGAISSMLVGLISYILLTALDIKLFNFHAIIPALL
FT                   FGLIAFLLGNQVGNKLIKNEEK"
FT   gene            complement(604730..604966)
FT                   /locus_tag="HS_0567a"
FT   CDS_pept        complement(604730..604966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0567a"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0567a"
FT                   /db_xref="EnsemblGenomes-Tr:ABI26071"
FT                   /db_xref="GOA:Q0I1Y4"
FT                   /db_xref="InterPro:IPR010398"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1Y4"
FT                   /protein_id="ABI26071.1"
FT                   /translation="MKVHYKQSAKESRYALFLTVLYLIGWCIFAYLPDDARGPLGFPLW
FT                   FELSCIYFPIVFIIIVYLCIKFFFKNLSLGEEK"
FT   gene            complement(605038..606384)
FT                   /gene="accC"
FT                   /locus_tag="HS_0568"
FT   CDS_pept        complement(605038..606384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="HS_0568"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /EC_number="6.3.4.14"
FT                   /note="bifunctional"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24845"
FT                   /db_xref="GOA:Q0I1Y3"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1Y3"
FT                   /protein_id="ABI24845.1"
FT                   /translation="MLEKVVIANRGEIALRILRACKELGIKTVAVHSTADRELKHVLLA
FT                   DETVCIGPAPSAKSYLNIPAIIAAAEVTGTDAIHPGYGFLSENADFAEQVERSGFIFIG
FT                   PTADVIRLMGDKVSAINAMKKAGVPCVPGSDGPLGADINKNKEIAKRIGYPIIIKASGG
FT                   GGGRGMRVVRDEKSLEESIAMTKAEAKAAFNNDMVYMEKYLENPRHIEIQVLADTHGNA
FT                   IYLAERDCSMQRRHQKVVEEAPAPGISEETRRDIGTRCANACIEIGYRGAGTFEFLYEN
FT                   GEFYFIEMNTRIQVEHPVTEMITGVDLVKEQLRIAAGFPLSIKQEDIKVKGHAIECRIN
FT                   AEDPKTFLPSPGKVTHLHSPGGFGIRWDSHVYGGYTVPPHYDSMIAKLITYGDTREVAI
FT                   RRMQNALSETIINGIKTNIPLHNLILSDENFQKGGTNIHYLEKKLGMRD"
FT   gene            complement(606445..606906)
FT                   /gene="accB"
FT                   /locus_tag="HS_0569"
FT   CDS_pept        complement(606445..606906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="HS_0569"
FT                   /product="biotin carboxyl carrier protein"
FT                   /note="negative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24846"
FT                   /db_xref="GOA:Q0I1Y2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1Y2"
FT                   /protein_id="ABI24846.1"
FT                   /translation="MDVRKIKKLIELVEESGIMELEISEGEETIRINRGTPVSNPIQYN
FT                   VPVTAPTPVVAPPTVSEATGTPVTQVNEEPSGHIIRSPMVGTFYRSPSPEAKAFIEIGQ
FT                   HVKVGDTLCIVEAMKMMNKIEADKAGIIKAILVNDGEPVEFDESLIVIE"
FT   gene            complement(607095..607547)
FT                   /gene="aroQ"
FT                   /locus_tag="HS_0570"
FT   CDS_pept        complement(607095..607547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="HS_0570"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24847"
FT                   /db_xref="GOA:Q0I1Y1"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1Y1"
FT                   /protein_id="ABI24847.1"
FT                   /translation="MSRYAKILLLNGPNLNMLGKREPTHYGNLSLEDIEQRMQELAQQH
FT                   QLELSCFQANSEEKLIDKIHQSFHLIDFIIINPAAYTHTSVALRDALLSVSIPFVEVHL
FT                   SNIHRREPFRHHSYLSDIAEGVICGLGAQGYEFALQYASNYLKKIK"
FT   gene            607825..608745
FT                   /locus_tag="HS_0571"
FT   CDS_pept        607825..608745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0571"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24848"
FT                   /db_xref="GOA:Q0I1Y0"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1Y0"
FT                   /protein_id="ABI24848.1"
FT                   /translation="MELFDGLPIATIIFILLIVFILYSTLKTVPQGYHWTIERFGRYIR
FT                   TLTPGLNFVVPFVDRVGRRINMMEQVLDIPSQEVISKDNANVSIDAVCFVQVIDARCAA
FT                   YEVNHLEQAIINLTMTNIRTVLGSMELDEMLSQRDNINSRLLAIVDEATNPWGIKVTRI
FT                   EIRDVRPPQELIAAMNAQMKAERNKRADILEAEGVRQAEILRAEGEKQSRILKAEGERQ
FT                   EAFLQAEARERAAEAEAKATQMVSDAISSGDTKAINYFIAQKYTEALKEIGSANNSKIV
FT                   LMPLEAGNLIGSVAGIAELLKGNKQ"
FT   gene            608792..609235
FT                   /locus_tag="HS_0572"
FT   CDS_pept        608792..609235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0572"
FT                   /product="possible regulator of membrane protease activity"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24849"
FT                   /db_xref="GOA:Q0I1X9"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1X9"
FT                   /protein_id="ABI24849.1"
FT                   /translation="MEWFDAWTFWHWLILGFLLLIAEIIVPGVFLLWWGLAAIIVSMIT
FT                   IIIDLSLTIQCVIYGILAIVLSVAWWKYQHTKDEKDQANSSLNRRDHAMLGCRGKVEVI
FT                   AENGIGRGVFGDTTWRIQGKGLQQGDIIEVQAVNGITLIVQKK"
FT   gene            609245..609865
FT                   /locus_tag="HS_0573"
FT   CDS_pept        609245..609865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0573"
FT                   /product="NAD(P)H2 dehydrogenase, quinone family"
FT                   /EC_number="1.6.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24850"
FT                   /db_xref="GOA:Q0I1X8"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1X8"
FT                   /protein_id="ABI24850.1"
FT                   /translation="MKHLIIFTHPNNQTSFNQAILEQTVKTGQKLGVETRVRDLYALDF
FT                   NPILSWEELQAAQQKITPAEIRYEQELIDQSDLITLIYPLWWMGFPAILKGYLDRILSH
FT                   GVAYKTENGVSEGLLHGKKIQQFITMGNNLQKYQERGFAQSLQNCLVDGLFNYCGVTDI
FT                   DHSFFGDIHILDEQAKQHILQEVREKTVKNLTALLALQKEGIA"
FT   gene            609877..610425
FT                   /locus_tag="HS_0574"
FT   CDS_pept        609877..610425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible oxidoreductase component"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24851"
FT                   /db_xref="InterPro:IPR026269"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1X7"
FT                   /protein_id="ABI24851.1"
FT                   /translation="MNNFSLISRLFGNLFYRQPTDPIMTDVFSWLQQKGLEQVWCLETD
FT                   KQSKEALDSLQIPMDLNALEIEYQRLFMTDTPLISMKISDYGINPDEFSSFRQERGCPV
FT                   VESADHFALVFLTASWIEDNLNSIQAQRELFEIFLLPCASQFFNQVEKHANLPFYRALV
FT                   LLSREILSAMADELEESEK"
FT   gene            complement(610451..611389)
FT                   /gene="htrB"
FT                   /locus_tag="HS_0575"
FT   CDS_pept        complement(610451..611389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrB"
FT                   /locus_tag="HS_0575"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24852"
FT                   /db_xref="GOA:Q0I1X6"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011920"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1X6"
FT                   /protein_id="ABI24852.1"
FT                   /translation="MAKTSIPQFNIEFLKPKYWLFWLGFLFFRLILLLPYPILLKIGNG
FT                   LGSLFSHLKIGQRRTKIARQNLQLCFPHYSEQEINDILQSNLKATGMAIIETGMAWFWS
FT                   DKRIKKWSKIEGLEYLKENQQDGIILVGIHFLTLELGARIIGLSHPGIGIYRPHDNPLM
FT                   DWLQYRGRARSNKGLLDRKDLRAMIKAIRHGEMIWYAPDHDYGRKNAVFVPFFAVPEAA
FT                   TTTGSYYLIKSSPKSKVIPFTPLRNKDNSGYTLNISAPVDFSDILHDETAIATRMNKIV
FT                   EKEILQDVTQYMWLHRRFKTRPDEHQQSLYE"
FT   gene            611515..612942
FT                   /gene="rfaE"
FT                   /locus_tag="HS_0576"
FT   CDS_pept        611515..612942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaE"
FT                   /locus_tag="HS_0576"
FT                   /product="D-alpha,beta-D-heptose 7-phosphate 1-kinase /
FT                   D-beta-D-heptose 1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.1.-"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24853"
FT                   /db_xref="GOA:Q0I1X5"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1X5"
FT                   /protein_id="ABI24853.1"
FT                   /translation="MQYSAQFNRAKVLVLGDVMLDRYWFGATNRISPEAPVPVVRVQEN
FT                   EERAGGAANVAMNIASLNVPVRLLGLTGKDEAARALMQLLEKQSIHCDFTQLDSHPTIT
FT                   KLRILSRHQQLLRLDFEEDFNNITSADLLRKLESAVQNYGALILSDYGKGTLNDVQKMI
FT                   QIARKVNIPVLIDPKGTDFARYRSATLLTPNMSEFEAVVGKCHSEEEIAEKGLQLIKDL
FT                   DLSALLVTRSEKGMTLLRPNNAPFHLPTEAKEVFDVTGAGDTVISVLATALADGRSYEE
FT                   ACYLANVAAGIVVGKLGTSTVSTVELENAIHGRTTAGFGIMEESQLKAAVELAKARGEK
FT                   IVMTNGCFDILHPGHVSYLENARKLGDRLIVAVNTDNSVKRLKGETRPINDLATRMAVL
FT                   AGLSSVDWLVAFDEDTPQRLIAEILPDLLVKGGDYKPEEIVGSKEVWLNGGEVKVLNFE
FT                   NGCSTTNVIKKIQQLKE"
FT   gene            612952..613296
FT                   /locus_tag="HS_0577"
FT   CDS_pept        612952..613296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24854"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1X4"
FT                   /protein_id="ABI24854.1"
FT                   /translation="MITVYGIKNCDTVKKALKWLADNNIEYQLHDFRVDGLQQYWLEQA
FT                   EQQFGWENLVNKRSTTWRNLDEEIKQNLTKQTALKTLLAQPTLVKRPIILQDGKALIGF
FT                   SVEDYERVLK"
FT   gene            613409..614542
FT                   /gene="dapE"
FT                   /locus_tag="HS_0578"
FT   CDS_pept        613409..614542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="HS_0578"
FT                   /product="succinyldiaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24855"
FT                   /db_xref="GOA:Q0I1X3"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I1X3"
FT                   /protein_id="ABI24855.1"
FT                   /translation="MKNNIITLTQSLIQRPSISPDDQGCQQLIAERLQAVGFKLEWLPF
FT                   GDTLNLWATHGEGKCIAFAGHTDVVPIGNESQWTYLPFEARIVENMLYGRGAADMKGAL
FT                   AAMVIAAETFVKHLPNHQGKIALLITSDEEAAATNGTVKVVETLIKRNEKIDYCVVGEP
FT                   SSATQFGDIIKNGRRGSITGNLYIQGVQGHVAYPHLADNPVHNALKFLDELTHYQWDKG
FT                   NEFFPPTSLQIANIHAGTGSNNVIPGELYVQFNLRYCTEVTDEIIKTKVTEMLEKHKLT
FT                   YRIDWNLSGKPFLTPQGKLVNATLEAVEKFTQIRPHLDTGGGTSDARFIATMGAEVVEF
FT                   GPLNQTIHKVNECVNIDDLAKCGEIYYHILEKLFNEQ"
FT   gene            614496..615212
FT                   /locus_tag="HS_0579"
FT   CDS_pept        614496..615212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0579"
FT                   /product="D-alanyl-D-alanine carboxypeptidase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24856"
FT                   /db_xref="GOA:Q0I1X2"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I1X2"
FT                   /protein_id="ABI24856.1"
FT                   /translation="MRFIIIFWKNCLMNNRLSKILTGKSREHLISLPNTLSANHFLQME
FT                   VVAAFLQLQQAAKQAGFNLQPVSSFRDFERQRSIWNTKFYGERKVHDDQGNPLDLTALD
FT                   DWQKVQAILRWSAMPGASRHHWGTEIDIFDPDLLPKGQSLQLEPWEYQTGGYFQRLTNW
FT                   LLVNAQQFGFYFPFFELKDKKVGNELWHLSYFPIADIYQQQFCPEFLSQAWFEENVAGS
FT                   EILLKHLDEIFRDFLI"
FT   gene            615265..615885
FT                   /gene="nudF"
FT                   /locus_tag="HS_0580"
FT   CDS_pept        615265..615885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudF"
FT                   /locus_tag="HS_0580"
FT                   /product="ADP-ribose diphosphatase"
FT                   /EC_number="3.6.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24857"
FT                   /db_xref="GOA:Q0I353"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I353"
FT                   /protein_id="ABI24857.1"
FT                   /translation="MEVQQFTQQDIEILHEETLYKGFFQLKRIQFKHKLFAGGVSGVVT
FT                   RELLYKGAASAVIAYDPYLDKVILVEQVRIGAYDPKLTTSPWLFELIAGMVEEGEKPEE
FT                   VALRESQEEAGVQVDNLQHVLSVWDSPGGVIERIHLFAGKVDSTKAKGIHGLAEENEDI
FT                   QVHVISREIAYQWVCEGKIDNGIAVMGLQWLQLNYKTLQQQWL"
FT   gene            616024..616854
FT                   /gene="icc"
FT                   /locus_tag="HS_0581"
FT   CDS_pept        616024..616854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icc"
FT                   /locus_tag="HS_0581"
FT                   /product="3',5'-cyclic-nucleotide phosphodiesterase"
FT                   /EC_number="3.1.4.17"
FT                   /note="Icc protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24858"
FT                   /db_xref="GOA:Q0I352"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I352"
FT                   /protein_id="ABI24858.1"
FT                   /translation="MISTYQYPTSEKVVRLIQITDPHLFKEKNGELLGINTYDSFNQVL
FT                   SEVLQSKFDYELVLATGDLVQDSSEEGYQYFAESVKLLNKKVFWIPGNHDFQPKMFDVL
FT                   SQYQEYIYPTKHVLVGKNWQILMLDSQVSGVPHGYLGQYQLDWLSAKLRDYPKRHALVV
FT                   LHHHIVSTNSAWLDQHNLRNSLDLMQVLLPFRKVRGILYGHIHQAMDTKWQGYKIMATP
FT                   STCIQFKPDSNHFSLDTSQPGWREIELYDDGRIETRVKRIQQTSFLPNMLSEGY"
FT   gene            complement(616932..619298)
FT                   /gene="hpuB"
FT                   /locus_tag="HS_0582"
FT   CDS_pept        complement(616932..619298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpuB"
FT                   /locus_tag="HS_0582"
FT                   /product="transferrin binding protein A"
FT                   /note="heme uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24859"
FT                   /db_xref="GOA:Q0I351"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I351"
FT                   /protein_id="ABI24859.1"
FT                   /translation="MFFNKNRQQTLLRFSAVTLPLFSFNAIAQFNDSATLDQIVVETQQ
FT                   VSAKTSSTNSQQISRGLVWNEQDLVRWQTGVTVTEGGRGGANGYTMRGVESDRVAMSVD
FT                   GISAVESYMPRFYYIKGFYNGNRNSTEIENLSSVEFNKGANSLTQGSGALGGSVSMRTK
FT                   NVHDFVDSNKTVGFYAKTAYSSRNTEYRQVIGGGFKQGNAEGLLQYTYRHAHENKNYYS
FT                   GKLKDVAYCGILPSGDQRDIFPQLCGRSRVLPDNVDYHSRSWLAKLGYHFTPQHFVQVF
FT                   FENLEQSRKILEKSFYASNRQEAGDITPYQRFGLSYNYTPTESWLNKFSVQLAQQKVSQ
FT                   QANSNQYGVSPQDYNIITDKRLYKTEQKHHQLDVSFIANEIAGKFAHHQLSGGLGYHWG
FT                   KLENRNQEYGAYSRIKQREFTIQQPVARQAWYAYVQDLISINQKWGANAGIRFDHYRYK
FT                   PTTSALKYESPNQKVEVLPKKQFSAVNFSLGLNYSITDSTLLSYEFSTGFKAPKIEEMY
FT                   FDLKGEGSNHHLPNINLKPEKAQNHELSLTTEGDNYQLNLSVFYTKYRDFIDADTKTEV
FT                   IDNGYKKHVYSLSKVIYQQINIDKAYVTGLDFHARANGKIIGLSKSWYAILKASYAKGR
FT                   KNNGTAMLPIQPFSTTLGLGYQAENDKWNVLFSGRYVSAKKAKDAIDIPVAYSLKLKAD
FT                   RGTGKVSGFEQPKPYRFLSSSYVVFDLTAQYRLNSHFALNAGIFNLFNRKYTTWDTLRQ
FT                   IKYNGALGDVYNNGKGLERFTAAGRNFALSLEMKF"
FT   gene            619605..620651
FT                   /locus_tag="HS_0583"
FT   CDS_pept        619605..620651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0583"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24860"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I266"
FT                   /protein_id="ABI24860.1"
FT                   /translation="MFNRALAWQNEQYEQDNNQKFSYSKLTSLLPQWKKELIWLKECHS
FT                   QVLQQSLKDLESAFKNFFQQRADFPKFKKKGIKESFRFPQGCKIQPQNDRLYLPKIGWV
FT                   RYRNSREIVGEVKNVTVSQKCGRFFVSIQTEFEHEIPMHKGGEIGIDMGIARFATLSNG
FT                   EFFEPINAFKTYKGKLAKLQKQLKNKVKFSKNWQKLKEKIGKLHHKIANCRKDFLHKIS
FT                   TQISKNHAMIYVEDLQVANMSKSAKGTVEAHGKNVKQKSGLNRSIRDQSWFEFRRQLDY
FT                   KTQWLGGFLVAVPAQNTSRTCPCCGHIAKENRETQAHFECVECGYTENADVVGAMNVLT
FT                   RGQAIVQA"
FT   gene            complement(620843..621916)
FT                   /gene="xylH"
FT                   /locus_tag="HS_0584"
FT   CDS_pept        complement(620843..621916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylH"
FT                   /locus_tag="HS_0584"
FT                   /product="xylose ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24861"
FT                   /db_xref="GOA:Q0I349"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I349"
FT                   /protein_id="ABI24861.1"
FT                   /translation="MVIMFFFSIATEGAYLSARNISNLLRQTAITGILAIGMVFVIISA
FT                   EIDLSVGSLMGLLGGFAAISNVWWGWPLPLTILVTLLLGLLIGAWSGWWVAYQKVPSFI
FT                   VTLAGMLAFRGILIGLTNGTTVSPISNDMTIIGQGYLSDTIGIILGSIIIFCFIAWGSY
FT                   QRKARQNLNLPVAKMPKETVKYGMIAILILGAIYLLNDYRGMPIPVLILCGLAIIGTFI
FT                   SKKTAFGRHIYAIGGNIDAARLSGIAVEKVKLTIFALNGLLVAIAGLILSSRLGAGAPS
FT                   AGQNAELDAIAACVIGGASLAGGIGSIFGVVIGAFIIALLDNGMSMLDVPTFWQYIVKG
FT                   GILLLAVWIDTISKKKV"
FT   gene            complement(621974..623488)
FT                   /gene="xylG"
FT                   /locus_tag="HS_0585"
FT   CDS_pept        complement(621974..623488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylG"
FT                   /locus_tag="HS_0585"
FT                   /product="xylose ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24862"
FT                   /db_xref="GOA:Q0I348"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013455"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I348"
FT                   /protein_id="ABI24862.1"
FT                   /translation="MTKLLEMKNITKKFGDVVALNNISISLETGEILSLCGENGSGKST
FT                   LMKVLCGIYPSGDYEGEIYFSGEKLTAKNIKDTEEKGISIIHQELTLVKNMSVLENMFL
FT                   GNEITQAGITNDNKMYLRCKTLLEQVQLDIDPNTKVSALGLGQQQLVEIAKALNKQVRL
FT                   LILDEPTASLTEKETDILLNLIKGLQAHNIACIYISHKLNEVKAISDKICVIRDGEHIG
FT                   TQLAQGISEDDIITMMVGREITSLYPHEPHDIGKEILRVENLTAWHPTNTHIKRVDNAN
FT                   FILRKGEILGVAGLVGSGRTEMAQCIFGSYVGKYQGNIFLNNQKVKINKCAEAIANHIV
FT                   MVPEDRKKHGIIPIMSVGKNITLSSLSQFCFGKKVINEPLEETIINQSIAKLKVKTSSP
FT                   ELAIGRLSGGNQQKAILAKCLLLHPNILILDEPTRGIDVGAKYEIYKLINQLAQEGMSI
FT                   IVISSELPEVLGISDRVLVMHQGKVKADLINHHLTQEQVMEAALKE"
FT   gene            complement(623548..624549)
FT                   /gene="xylF"
FT                   /locus_tag="HS_0586"
FT   CDS_pept        complement(623548..624549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylF"
FT                   /locus_tag="HS_0586"
FT                   /product="xylose-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24863"
FT                   /db_xref="GOA:Q0I347"
FT                   /db_xref="InterPro:IPR013456"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I347"
FT                   /protein_id="ABI24863.1"
FT                   /translation="MKLKSKLLAVATATLMVFSHSVLANDLKIGMSIDDLRLERWQKDR
FT                   DIFVKKAEALGAKVFVQSANGDATAQISQIENMLNKDIDVLVIIPFNGEVLSNVIAEAK
FT                   KEGVKVLAYDRLINNADIDFYVSFDNEKVGELQAQSIIEKKPKGNYFLMGGSPVDNNAK
FT                   LFRKGQMKVLQPHIDSGEINVVGDQWVDSWLAEKALQIMENALTANKNNIDAVVASNDA
FT                   TAGGAIQALSAQGLSGKVAISGQDADLAAIKRILDGSQTMTVYKPITNLADKAAEISVA
FT                   LGKGGKVESNSQLNNGLKNVPAFLLEPVVVTKENIDDTVIKDGFHTKEAVYK"
FT   gene            624797..626122
FT                   /gene="xylA"
FT                   /locus_tag="HS_0587"
FT   CDS_pept        624797..626122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylA"
FT                   /locus_tag="HS_0587"
FT                   /product="D-xylose isomerase"
FT                   /EC_number="5.3.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24864"
FT                   /db_xref="GOA:Q0I346"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013452"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I346"
FT                   /protein_id="ABI24864.1"
FT                   /translation="MAMSNYFDKIAKVNYEGANSTNPFAFKHYNPNEVILGKTVEEHLR
FT                   LAVCYWHTFCWTGNDMFGAGSLDRSWQKTGDLLVGAKQKAEIAFEFFQKLGVPYYSFHD
FT                   VDIAPESNNFKEYLHNFNTIVDILEKKQSETGVKLLWGTANCFTNPRYMSGASTNPNPE
FT                   VFAWAAAQVFTAMNATQRLGGENYVLWGGREGYETLLNTDLKREREQIGRFMQLVVEHK
FT                   YKIGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLENEIKVNIEANHATLAGHTF
FT                   QHEIATATSLGIFGSIDANRGDPQLGWDTDQFPNSVEENTLAMYEILKAGGFTTGGFNF
FT                   DAKIRRQSTDPYDLFHAHIGAMDVLALSLKRAAKMIEDQTLQKVVDNRYAGWDQELGQK
FT                   ILNGKASLEDLAKIVETQGLAPKPVSGQQEYLENLVNSYLYR"
FT   gene            626191..627651
FT                   /gene="xylB"
FT                   /locus_tag="HS_0588"
FT   CDS_pept        626191..627651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylB"
FT                   /locus_tag="HS_0588"
FT                   /product="xylulokinase (xylulose kinase)"
FT                   /EC_number="2.7.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24865"
FT                   /db_xref="GOA:Q0I345"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I345"
FT                   /protein_id="ABI24865.1"
FT                   /translation="MYIGIDLGTSGVKVVLLDENQKIIAITQKSLPISRPQPLWSEQNP
FT                   QDWWNATHEAMLELADKQNLSHVKAIGLTGQMHGATLLDKADNILSPAILWNDGRSFAE
FT                   CEELEKLVSNSREITGNLMMPGFTAPKLCWLKKHQPDIAKKVSKVLLPKDYLRFLMTGE
FT                   YASDMSDASGTMWLDIAKRSWNEALLNACGLDLNNMPKLFEGNQITGYLRKEIAQQWKI
FT                   NAVPVVAGGGDNAAGAIGIGLYQAEQAMLSLGTSGVYFVVSDTFRANPQKAVHSFCHAL
FT                   PDRWHLMSVILSAASAVDWAAKSLGFKDVPTLFQRVEASQTESNVIFLPYLSGERTPHN
FT                   DPYAKGVFWGLSHSDNQVTMAKAVIEGVSFAMAESIDVLHETGVTANNIALIGGGAKSG
FT                   YWRQLLADISGKTFEYRTGGDVGPALGAAKLAQIALNPEQDIANFCRPLPLEKIYQPNS
FT                   ARYAEYQAKREKFAELYQRVKGLSLFSL"
FT   gene            complement(627781..628941)
FT                   /locus_tag="HS_0589"
FT   CDS_pept        complement(627781..628941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0589"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24866"
FT                   /db_xref="GOA:Q0I344"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I344"
FT                   /protein_id="ABI24866.1"
FT                   /translation="MKIFYLSLTAVVVLTAHSAMAQNTSPNMKYAKEAIYIGKSITEVP
FT                   NNIPNAKAVAVGDKTKVGESAVAVGYEADAHLEGATAVGRGTKTQAYAVAMGYQANAGV
FT                   QAVSIGKDSKATGVQSVALGDQAKATGKLSSAFGQNAQAAGHYSNAFGWHSNARNELAT
FT                   AIGYKANATGKRSIVLGPDSTASGEGSLSFGSGVKTTGNNSFSVGRNITNNSTKTVAIG
FT                   NNIQHTKDNSVFLGDSSAYTAPSETSGGIGKVDGNYAGVDAKGVVSVGSKGNERRIQNV
FT                   AAGLLSHQSTDAVNGSQLHATNQRLEEVNKDAKAGIAAAMAFKDVPFVPGKWSYAAGAA
FT                   HYSSESAVSLNLGRTSNDGKWAVSGGMSSDSRGRLGFRVGVSGVFN"
FT   gene            complement(629239..630033)
FT                   /gene="sapF"
FT                   /locus_tag="HS_0590"
FT   CDS_pept        complement(629239..630033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sapF"
FT                   /locus_tag="HS_0590"
FT                   /product="peptide ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24867"
FT                   /db_xref="GOA:Q0I343"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I343"
FT                   /protein_id="ABI24867.1"
FT                   /translation="MNLLEVSGLSKFFNDNIGIFSTSQFKAVENISFVLARKKTLAIIG
FT                   KNGSGKSTVAKMIVGIIKPTSGELLFKGNPLEYGDYQYRSQHIRMVFQDPYSAFNPRLN
FT                   VGQILDAPLRLTTNLNENERNLKIAETLRLVGLYPEHANVKINTMSIGQKQRVAIARAL
FT                   ILGPEIIITDDALGSLDATVKTQLINLMLDIQEKLSISYIYVGQHLGIIKHIADHVLVM
FT                   DEGQMIEYGDTKTIFTQPQSDITKRLVESHFGQVLDENAWSV"
FT   gene            complement(630049..631095)
FT                   /gene="sapD"
FT                   /locus_tag="HS_0591"
FT   CDS_pept        complement(630049..631095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sapD"
FT                   /locus_tag="HS_0591"
FT                   /product="peptide ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24868"
FT                   /db_xref="GOA:Q0I342"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I342"
FT                   /protein_id="ABI24868.1"
FT                   /translation="MALLDIRNLCIEIETPKGRVKIIDNVNLTLNEGEICGLVGESGSG
FT                   KSLIAKVICNAIKDSWIITADRFRFDDVELLKLNPKKRRKLVGKEISMIYQEPLASLDP
FT                   SRKIGQQLIQSIPSWTFKGRWWQWFGWKKRRAIELLHRVGVKDHKDIMQSYPHEVTEGE
FT                   GQKIMIALAIANQPRLLIADEPTNSLESMTKVQIFRLLASMNQNQGTSILLVSNDINSI
FT                   SAWCDSFSVLYCGQNAESGSKENILENPHHPYTRALLHSIPDFKQPLVHKSRLSTLKGA
FT                   VPLLEGMPIGCRLGPRCPFAQKECIRKPTAQRIKQHEFFCHFPINLKESQRREKEMETG
FT                   PLVVNTTK"
FT   gene            complement(631107..631994)
FT                   /gene="sapC"
FT                   /locus_tag="HS_0592"
FT   CDS_pept        complement(631107..631994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sapC"
FT                   /locus_tag="HS_0592"
FT                   /product="peptide ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24869"
FT                   /db_xref="GOA:Q0I341"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I341"
FT                   /protein_id="ABI24869.1"
FT                   /translation="MLDKEPEEFRETQGLKHIWKFFYQDKLALTGFYLFLLLIITALFS
FT                   QFIAPYSDTAQFVGFELLPPSWANSGKIAYFFGTDDIGRDIFSRLIRGTTYTFGAALIV
FT                   VLFTSILGGILGIWAGLSQGLKARVLGHFFDIFLSIPILLIAIIIATLMQPSLINAMLA
FT                   ITLALLPYFIHEIYQAVQQELKKEYILMLRLDGASNWQLVKETILPNIIIRYIHETSRA
FT                   FIIAIIDISALSFISLGAQRPTPEWGTMIKDYIELIYLAPWATILPGVAIIITIVIVLI
FT                   LTNGLCKAIEKYYG"
FT   gene            complement(631984..632949)
FT                   /gene="sapB"
FT                   /locus_tag="HS_0593"
FT   CDS_pept        complement(631984..632949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sapB"
FT                   /locus_tag="HS_0593"
FT                   /product="peptide ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24870"
FT                   /db_xref="GOA:Q0I340"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I340"
FT                   /protein_id="ABI24870.1"
FT                   /translation="MLFSFFRHCILVISTLFILSLISYSILLKDPLNQVLATPHFFSGY
FT                   FFYLQNLLQGDFGITYHGGESLKELIFAVLPPTLELCVSAMLLALIFGIPLGLLSALYA
FT                   DHLCGKAIRSFYITGIAIPVFWLAPILLYFSAIQNWEISAIGQYNLLYEIKPITGFPII
FT                   DVWFTDQPYRIKMIQNVLQHLVLPTLVLAILPTMDIIRIVQQRADFLFTQSYVKIAETR
FT                   GWSKRKILQIYILRNTIPIMIPQMSRLFTLVMAQCMLIESTFGWFGIGHWLIDAVRQQD
FT                   YNSISIGIIVVGFCIIAVNLFTEFLSFILDPFNKKNWYAR"
FT   gene            complement(632977..634665)
FT                   /gene="sapA"
FT                   /locus_tag="HS_0594"
FT   CDS_pept        complement(632977..634665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sapA"
FT                   /locus_tag="HS_0594"
FT                   /product="peptide ABC transporter, periplasmic-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24871"
FT                   /db_xref="GOA:Q0I339"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I339"
FT                   /protein_id="ABI24871.1"
FT                   /translation="MLAKKIFILCTLFYGLLFSLPSFSAPKIPKILTDNGLIYCTNASS
FT                   FSFNPQTADAGTSMNIVTEQIYNKLFEIKNHSATLEPVLAKSYSISPDGKIITINLRKG
FT                   VKFHHTDWFTPSRDFNAEDVVFSLNRILGQNIALPELDQNTLHYKNPQYKVYHEQRKKV
FT                   HFPYFDSIKLNEKIQEVKAINPYQVQIILFKPDASVLSHLASQYAIIFSQEYALQLNAD
FT                   DNLVQLDNLPVGTGPYQVKDYFRNQYVRLVHNPNYWQKNVNLENVIIDLSTNRSGRLIK
FT                   FFNNECHIASYPELSQLGLLRHNDEKYYIKSIEGMNLSYIAFNFQKTLMQDLEIRRHIA
FT                   HAINRQRIINLIYHNTASVANNIIPSISWGAVVNTTDFAYDYNVKKAKEYFAGKNINLD
FT                   MWVINEEQVYNPSPIKMAELIKADLIKVGVNVNIRNVTRTYLMKQLQEQTEDYDIILTG
FT                   WLAGNLDPDSFMRPILSCGTQNEITNFSNWCHAPFEHALDQALAASNLRERAKYYNIAQ
FT                   EIILSEIPILPIANVKRVLLANAKVQGIELTPFGNINFSKLSFKK"
FT   gene            634732..636141
FT                   /locus_tag="HS_0595"
FT   CDS_pept        634732..636141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0595"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24872"
FT                   /db_xref="InterPro:IPR007413"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I338"
FT                   /protein_id="ABI24872.1"
FT                   /translation="MFNFIHKELDELINRGMDRTLRIAVTGLSRSGKTAFITSFINQLL
FT                   HINSIDNKHLPLFLPAQNNRLLGVKRVEQRDLSVPRFDYEQNMKALKREPASWFKSTES
FT                   VSETRLAIRYIRKDGLMRHLKEKGTLYVEIFDYPGEWLLDLPLLDLDFQQWSLQQQELF
FT                   IEQRQELAQNWLNKIRTLDLSEPANEEMLAQLAQDYTEFLFACKKQGFHLTQPGRFVLP
FT                   GELKGAPVLQFFPLVHLTEQEWKRLKERSKSDSYFAMLSKRYHYYQQKIVKGFYQEYFS
FT                   TFDRQVILADCLTPLNHGHQAFQDMQNALQQLFKNFHYGKRTLFNRLFSPKIDKLMFIA
FT                   TKADHITLEQFPNLVSLMRQLVQEGGRYVEYEGIDTEYTAISAIRSTQQVQVTQNGQKI
FT                   KALQGIRSIDKKKIVVYPGSVPSKLPHADFWQKYHFAFDQFEPLTVENGEPIAHLRMDA
FT                   VLQFLLADKLD"
FT   gene            636151..637224
FT                   /locus_tag="HS_0596"
FT   CDS_pept        636151..637224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0596"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24873"
FT                   /db_xref="GOA:Q0I337"
FT                   /db_xref="InterPro:IPR006507"
FT                   /db_xref="InterPro:IPR021147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I337"
FT                   /protein_id="ABI24873.1"
FT                   /translation="MPKKVFQQEDVEQKITENFEPKQEFEQDELDIEMDCSQFETTMDR
FT                   QNTDIPFQHMVRPKVTMWQKLLMATICLFSCGILAQSVQWLVDSWRDNQWIAFVFAMVS
FT                   LFLVLLGLGAIIKEWRRLVQLKKRLILQEKSREIRSKSAVNLTEVSSEGKELCLKIASL
FT                   MGIDDKSPQLIAWQEQVHEAYTEQEILRLFSQNVLIPFDRVAKKLISKNAVESALIVAV
FT                   SPLAIVDMFFIAWRNIRLINQLAKLYGIELGYVSRLRLLRMVFVNMAFAGAADVIQDLG
FT                   LEWLSQDITAKLSARVAQGIGVGILTARLGIKAMEFCRPIAVAPEEKLRLSHIQTELLG
FT                   TLKTTLFSANKVKEKVR"
FT   gene            complement(637331..637594)
FT                   /gene="grxA"
FT                   /locus_tag="HS_0597"
FT   CDS_pept        complement(637331..637594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxA"
FT                   /locus_tag="HS_0597"
FT                   /product="glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24874"
FT                   /db_xref="GOA:Q0I336"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011902"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I336"
FT                   /protein_id="ABI24874.1"
FT                   /translation="MYVVIFGRSGCPYCVRAKNLAEKLKNTLEDFDYRYIDIVAEGISK
FT                   ADLSLSVGKPVETVPQIFIDEKPIGGCTDFEALMKAQFNVVA"
FT   gene            complement(637715..639961)
FT                   /gene="parC"
FT                   /locus_tag="HS_0598"
FT   CDS_pept        complement(637715..639961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parC"
FT                   /locus_tag="HS_0598"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24875"
FT                   /db_xref="GOA:Q0I335"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I335"
FT                   /protein_id="ABI24875.1"
FT                   /translation="MKTEINYEGIEQMPLRQFTEKAYLNYSMYVIMDRALPFIGDGLKP
FT                   VQRRIIYAMSELGLNASAKYKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRYPL
FT                   VDGQGNWGAPDDPKSFAAMRYTESRLSKISEILLSELGQGTVNYQANFDGTLEEPQYLP
FT                   ARLPHILLNGTTGIAVGMATDIPPHNLNEVANATIMLLDNPNADLDQLMTALQGPDFPT
FT                   EAEIISPKEEIRKIYEQGRGSIKMRAVWKKENGEIIITALPHQSSPSKIVAQIAEQMQN
FT                   KKLPMVEDIRDEADHENPIRLVIVPRSNRVDTDALMAHLFATTDLEKSYRVNMNMIGLD
FT                   NKPAVKNLVQILTEWLTFRRQTVTRRLQYRLDKVLARLHILDGLLIAFLNIDEIIEIIR
FT                   NEDKPKEILIARFNLTDEQAEAILNLRLRHLAKLEEQELQAEKNNLAKERNSLEQILNS
FT                   EIRLNNLIKKEIQQDAKTFASPRLSPLVERAEAKAISETDMTPSEPITIILSEMGWVRC
FT                   AKGHDINARALSYKTGDNYLTHACGKSNQPVVFIDSTGRSYTLDPLSLPSARSQGEPLT
FT                   GKLTLPSGATIEHLLIENENQSLLMASDAGYGFICKFEDLVSRNKAGKAVISLPENANV
FT                   LPPLVLQNSTALLVALTSMNRMLVFPVADLPELSKGKGNKIIHIPAANAKERSELLVKL
FT                   FLISEKTSLVFHAGKRKVTLKPEDIQKFRAERGRKGSPLPRGLHNGVTIELIDS"
FT   gene            complement(640056..641948)
FT                   /gene="parE"
FT                   /locus_tag="HS_0599"
FT   CDS_pept        complement(640056..641948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="HS_0599"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24876"
FT                   /db_xref="GOA:Q0I334"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I334"
FT                   /protein_id="ABI24876.1"
FT                   /translation="MTNYSAQEITVLKDLEPVQLRPGMYTDTSRPNHLGQEVIDNSVDE
FT                   ALAGHATKIEVILYKDQSLEVIDNGRGMPVDIHPTEKVSGVEVILTKLHAGGKFSNKHY
FT                   EFAGGLHGVGISVVNALSERVDIQVKRNGEIYKIAFENGVKVEELEIIGTCGKRTTGTS
FT                   VHFKPNPKYFDSANFSVSRLRHLLRAKAVLCSGLEIKFIDKINNTEDTWLYQDGLSDYL
FT                   MENVNGYNLLPQTPFVGDFTTNKEAASWALLWLPEGGELLNESYVNLIPTIQGGTHVNG
FT                   LRQGLLDAMREFCEFRNLLPKNVKLTADDIWDRCAYVLSVKMHDAQFAGQTKERLSSRQ
FT                   SAVFVGGVVKDSFSLWLNQNIQDAEELAKMVISSAERRLRAAKKVVRKKLVSGPALPGK
FT                   LADCSEQDLSKTELFLVEGDSAGGSAKQARNREHQAILPLRGKILNTWEVSPDQVLRSQ
FT                   EVHDIAIALGIDPDNEDLSQLRYGKVCILADADSDGLHIATLLCALFLRHFPKLVQQGH
FT                   VYVAMPPLYRIDLGNEVFYALDENEKESILARLKNKRGKLNVQRFKGLGEMNPNQLRET
FT                   TMDPNTRRLVQLTYKPHEEDVSTLELMDMLLAKKRSEDRKIWLQNNGDQVDVNA"
FT   gene            complement(642004..643290)
FT                   /gene="ampG"
FT                   /locus_tag="HS_0600"
FT   CDS_pept        complement(642004..643290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampG"
FT                   /locus_tag="HS_0600"
FT                   /product="AmpG protein"
FT                   /note="beta-lactamase synthesis signal transducer"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24877"
FT                   /db_xref="GOA:Q0I333"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I333"
FT                   /protein_id="ABI24877.1"
FT                   /translation="MEKSHSILQQIFSRNMLICVFTGFSSGLPFYIIISLLPLWLRKEH
FT                   VDLETLGYFTATTLPFTWKFLWSPLLDRFIPPFLGRRRGWLLISQVLLLISLALFGFLQ
FT                   PSSPFNLQLIAGIAVLVSFFSASQDIVLDAYRREILSDRELGLGNSIHVNAYRIAGLVP
FT                   GSLSLILADYLPWKTVFLITALFMLPGIFMTLFLSKEPQIQLKNDRTLKENVIEPFKEF
FT                   FTRKGTSSALGILAFIFLYKIGDSMATALISPFYLDMGYNMTQIGIVVKNSSLWPMLIA
FT                   SIIGGVIMLKIGINRALWLFGVVQIVTILGFAWLAKLGPFQEIDNFALISLSLVVAAEY
FT                   IGIGLGTSAFVAFMARETNPLYTATQLALFTSFAALPRVTFNTQAGVLINYLGYYDYFW
FT                   FCFWLAIPGMLCLFWVAPWNSKEDTQQSR"
FT   gene            643495..644784
FT                   /locus_tag="HS_0601"
FT   CDS_pept        643495..644784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0601"
FT                   /product="conserved permease, xanthine/uracil family"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24878"
FT                   /db_xref="GOA:Q0I332"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I332"
FT                   /protein_id="ABI24878.1"
FT                   /translation="MTKRGSNVRQEIIAGLTTFLAMVYSVIVVPNMLSAAGFPAESVFI
FT                   ATCLVAGLGSILIGLWANAPMAIGCAISLTAFTAFSLVLGQGVSIPVALGAVFLMGIVF
FT                   TLISATGIRSWILRNLPSSIAHGAGIGIGLFLLLIATTNVGIIVANQNGLLVKFGDFTS
FT                   FSVLMSLVGLAVIIGLEKMQVKGGILWVMIAITIAGLIWDQNVQFKGEIFRLPTFGEQS
FT                   LFLELDIMGALQPAILPVVFALVMTAVFDATGTIRAVAGQANLLDKDGQIINGGKALTA
FT                   DSVSSLLSGALGTAPAAVYIESAAGTAAGGKTGMTAIVVGILFLLMLFFQPLASLVPNY
FT                   ATAPALMYVGLLMLSNVSKLDFSDFVGAMSGLVCGVFIVLTANIVTGIMLGFATLVIGR
FT                   LVCGDWKKLNVGTVIIAIVLVAFYIGGWAI"
FT   gene            complement(644891..646105)
FT                   /locus_tag="HS_0602"
FT   CDS_pept        complement(644891..646105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0602"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24879"
FT                   /db_xref="GOA:Q0I331"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I331"
FT                   /protein_id="ABI24879.1"
FT                   /translation="MKIFYLSLTAVVVLTAHSAMAQAQQSSNGNIKIEKGGVYIGEGAK
FT                   AEGTYKDGTKSVAVGKNAKVAESGVAVGFEANAAHEGATAVGKTAKAQSYAVAMGYQAN
FT                   AGVQAVSIGNKSNAQGNFAVALGNEANAKGQSSFAIGRHSVAGNWANAFGADAKATGEI
FT                   STALGWNANASGERAQAIGPQAKASGKRALSFGSGTNTTAENGVSIGSQTNNYAMGAVS
FT                   MGHNNSIQASSKNAVVIGNNIHNTTNNSVFLGDSSAYVEKGETTGGIGKVDGNYAGVEA
FT                   KGVVSVGSKGNERRIQNVAAGLLSHQSTDAVNGSQLHATNQRLEEVNKDAKAGIAAAMA
FT                   FKDVPFVPGKWSYAAGAAHYSSESAVSLNLGRTSNDGKWAVSGGMSSDSRGRLGFRVGV
FT                   SGVFN"
FT   gene            complement(646388..646467)
FT                   /locus_tag="HS_tAsp02"
FT   tRNA            complement(646388..646467)
FT                   /locus_tag="HS_tAsp02"
FT                   /product="tRNA-Asp"
FT   gene            complement(646493..646572)
FT                   /locus_tag="HS_tAsp03"
FT   tRNA            complement(646493..646572)
FT                   /locus_tag="HS_tAsp03"
FT                   /product="tRNA-Asp"
FT   gene            complement(646670..647428)
FT                   /gene="dnaQ"
FT                   /locus_tag="HS_0603"
FT   CDS_pept        complement(646670..647428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="HS_0603"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24880"
FT                   /db_xref="GOA:Q0I330"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I330"
FT                   /protein_id="ABI24880.1"
FT                   /translation="MTLEITQNRQIILDTETTGMNEFGAHYEGHCIIEIGAVEMINRRY
FT                   TGRKLHLYIKPDRLVDPEAIKVHGITDEMLADKPDFSAIAQEFIDFIKGAELIIHNAPF
FT                   DIGFMDYEFKKHNFNINTADICLITDTLQMARQMYPGKRNSLDALCDRLNIDNSKRTLH
FT                   GALLDAEILGDVYLAMTGGQTSLFGDEEHTPIITLEENIHQHTTNTHNFKLLLPTEEEK
FT                   LAHQDYLKLLNQKSKENCLWFKRNTKETMH"
FT   gene            647499..647963
FT                   /gene="rnhA"
FT                   /locus_tag="HS_0604"
FT   CDS_pept        647499..647963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="HS_0604"
FT                   /product="RNase HI"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24881"
FT                   /db_xref="GOA:Q0I329"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I329"
FT                   /protein_id="ABI24881.1"
FT                   /translation="MLKKIEIFTDGSCLGNPGAGGIGILLRYKQHEKKLYQGFFQTTNN
FT                   RMELRAVIVALNSLKEPCSVILYSDSQYMKNGITKWIFNWKKNNWKTSSGNAVKNQDLW
FT                   CSLDQAIQKHQIEWRWVKGHNGHRENEICDQLAKQGAENPTLEDVGYRAE"
FT   gene            complement(648022..649227)
FT                   /gene="pmi"
FT                   /locus_tag="HS_0605"
FT   CDS_pept        complement(648022..649227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmi"
FT                   /locus_tag="HS_0605"
FT                   /product="mannose-6-phosphate isomerase, type 1"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24882"
FT                   /db_xref="GOA:Q0I328"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="InterPro:IPR018050"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I328"
FT                   /protein_id="ABI24882.1"
FT                   /translation="MNTIYQLQGRLQHYIWGGQNYLPELLNIEKQHNQYYAEWWLGAHS
FT                   SAPSLLNMSEKSVLLTDFLLQNPQVLGKATLTNFGQELPYLLKILDVAKPLSIQLHPTK
FT                   KQAEIGFAQENLAGIALKDPKRTYKDRNHKPEMMIALSDFWLLHGFKQKTNILETLKAR
FT                   PSLTALAQQLENQDLHSFYATIMQADQTQLSAWLSPIITENQVAYRQGKLKLNNPDYWV
FT                   LYTIEAMEIPTDKLDAGLICFYLFNIVHLNIGEGIYQDAGIPHAYLRGQNIELMAGSDN
FT                   VIRGGLTPKHVDIGELLKIVDCSEITPQIIPKTPQDQDIFTYTTPAKDFAMTNVRYSVQ
FT                   QKHRLTSSNAEILLVMQGALKITANHTALELKQGESAFICANVTYQIEGLKEGYAVIAK
FT                   LP"
FT   gene            complement(649224..649703)
FT                   /locus_tag="HS_0606"
FT   CDS_pept        complement(649224..649703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0606"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24883"
FT                   /db_xref="GOA:Q0I327"
FT                   /db_xref="InterPro:IPR009328"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I327"
FT                   /protein_id="ABI24883.1"
FT                   /translation="MVNAFLIVGICCFFLYAFYDQFLMDYLKGTTKLKVRLKKRAKIDA
FT                   LIFIVLIAIILYQNSGQINAITLYFLAISILLSLYIAFIRFPVLLLKEQGFFFENIYID
FT                   YAKIRQINLFENNTLIIELKNKKHLMISPENLQDIEKIVHFFGGYKSLSNKRTAK"
FT   gene            complement(649761..650597)
FT                   /gene="manZ"
FT                   /locus_tag="HS_0607"
FT   CDS_pept        complement(649761..650597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manZ"
FT                   /locus_tag="HS_0607"
FT                   /product="PTS system D-mannose-specific IID component, Man
FT                   family"
FT                   /EC_number="2.7.1.69"
FT                   /note="TC 4.A.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24884"
FT                   /db_xref="GOA:Q0I326"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I326"
FT                   /protein_id="ABI24884.1"
FT                   /translation="MTTEMKKVTQSDLNAVVLRSNIFQGSWNFERMQSLGFAYSMVPVI
FT                   KRLYPDPNSQERKDAIKRHLEFFNTQPFVAAPVLGVTIAMEEERANGKEIDDAAINGIK
FT                   VGLMGPLAGVGDPIYWGTARPVFAALGAGLAINGSILGPILFFVLFNLVRLATRYYGVT
FT                   YGYKKGLDVVQDMSGGLLQKLTEGASILGLFIMGALVQKWTSINVPLVVSVIEKQDGTI
FT                   ETTTVQNILDSLMPGLLPLLFTFACMWLLRNRINALWIITGIFIIGILGAATGILA"
FT   gene            complement(650612..651412)
FT                   /gene="manY"
FT                   /locus_tag="HS_0608"
FT   CDS_pept        complement(650612..651412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manY"
FT                   /locus_tag="HS_0608"
FT                   /product="PTS system D-mannose-specific IIC component, Man
FT                   family"
FT                   /EC_number="2.7.1.69"
FT                   /note="TC 4.A.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24885"
FT                   /db_xref="GOA:Q0I325"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I325"
FT                   /protein_id="ABI24885.1"
FT                   /translation="MEISTLQVVLVFIVACISGMGSILDEFQTHRPLIACTLIGLVLGD
FT                   IKTGIIVGGSLELLALGWMNIGAALAPDAALASVVSTILVIVGGQDISTGIAIAIPLAA
FT                   AGQVLTYVVRALTVGFQHAADKSIEDGNLTRLDWIHRSALLLQAMRIAIPALVVALTAG
FT                   TDVVQDMLNAIPAVVTNGLKIAGGIIAVVGYAMVINMMRAGHLMPFFYAGFVIAAFTDF
FT                   NLVALGVLGAIMAALYIQLHPKYNQSKVVQVVANNNNDLDNRLD"
FT   gene            complement(651424..652395)
FT                   /gene="manX"
FT                   /locus_tag="HS_0609"
FT   CDS_pept        complement(651424..652395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manX"
FT                   /locus_tag="HS_0609"
FT                   /product="PTS system D-mannose-specific IIB component, Man
FT                   family / PTS system D-mannose-specific IIA component, Man
FT                   family"
FT                   /EC_number="2.7.1.69"
FT                   /note="TC 4.A.6.1.1; TC 4.A.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24886"
FT                   /db_xref="GOA:Q0I324"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR013789"
FT                   /db_xref="InterPro:IPR018455"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I324"
FT                   /protein_id="ABI24886.1"
FT                   /translation="MSIAIIIATHGVAAEQLLKTTEMLIGEQENVATIDFVSGENAETI
FT                   MTKYQEKLSTTLAHCDEVLFLVDTWGGSPFNAANRVIGDNTNMDIVTGVNVPMLVETFM
FT                   ARDDNPSLQELVSIALETGRAGVRALKYEEKSAETTALSQPVPEQPQIAVKQQEGNLIV
FT                   GLARIDDRLIHGQVATRWTKESRVTRIVVVNDDVAKDQVRSTMLKSVAPPGVTAHVVNI
FT                   EKMIRVYNNPEYANERMMLLFTNPTDVLRLLEAGVDMKSINVGGMAYKDGKKMITSAVA
FT                   VDDKDIAAFKAIDAMGIELDVRKVSNDSRQYMMDLLKKNNLI"
FT   gene            complement(652616..652969)
FT                   /locus_tag="HS_0610"
FT   CDS_pept        complement(652616..652969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24887"
FT                   /db_xref="InterPro:IPR007458"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I323"
FT                   /protein_id="ABI24887.1"
FT                   /translation="MENINKQSFQEVLEYVRMYRLKNKLLRDIDDNNRKIRDNQKRVLL
FT                   LDNLNQYIRNDMSIADVRAIIESMRDDYETRVDDYTIRNAELSKQRREINNKIKEQKKA
FT                   HAELLKTQKKQSC"
FT   gene            653162..654238
FT                   /gene="serC"
FT                   /locus_tag="HS_0611"
FT   CDS_pept        653162..654238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serC"
FT                   /locus_tag="HS_0611"
FT                   /product="phosphoserine aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24888"
FT                   /db_xref="GOA:Q0I322"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I322"
FT                   /protein_id="ABI24888.1"
FT                   /translation="MQVFNFSAGPAMMPKVVLEQAQQELLNWLDQGTSVMEVSHRGKYF
FT                   MEMITQAEKDFRQLYNIPENYKVLFLQGGARGQFAAIPMNLANKKGKTLYLTSGHWSAT
FT                   AAKEARLFTEVDEINILLDGKLEVGELDFSHIASQYDYVHYCPNETISGVEIVDVPNVG
FT                   EAVLVADMSSNILSREIDISKFGVIYAGAQKNLGPAGITVVIVREDLIGHARKETPSIW
FT                   NYEIQSKNSSMINTPPTFAWYLCSLVFKYLLAQGGIKEMAKLNREKAKLLYDFLDQSDF
FT                   YHNVVAPKNRSLMNVTFTTNNDELNAKFVAEATACGLQALKGHKVLGGMRASIYNAMPI
FT                   EGIKALIEFMRKFEAENN"
FT   gene            654297..655406
FT                   /gene="hisC"
FT                   /locus_tag="HS_0612"
FT   CDS_pept        654297..655406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="HS_0612"
FT                   /product="histidinol phosphate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24889"
FT                   /db_xref="GOA:Q0I321"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I321"
FT                   /protein_id="ABI24889.1"
FT                   /translation="MQYINIANEGVKSLSPYHAGKPIEELERELGISNIIKLASNENPF
FT                   GFPESAKQAIQRQLNDLTRYPDSNGFELKQVISKKFGLQPEQITLGNGSNDLLELIAHT
FT                   FASETDEIIYSQYAFIVYPLVTKAINAVAREIPAKNWGHDLDAFLQAINHKTKLIYIAN
FT                   PNNPTGNFLTEHEIDHFLAQVPEKVLVVLDEAYTEFTDEKERLNSFKLLQKYPNLIVSR
FT                   SLSKAYGLAGLRIGYAVSNPEIADLLNRVRQPFNCNVLALVSAVAVMQDDAFVEKVAEN
FT                   NRIEMVRYENFCRQQKLDYIPSKGNFITIDFKRPANEIYQALLHKGVIVRPIAGYGMPN
FT                   HLRVSIGLPKENDKFFDALVKVLGEVFVG"
FT   gene            655469..656767
FT                   /gene="aroA"
FT                   /locus_tag="HS_0613"
FT   CDS_pept        655469..656767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="HS_0613"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24890"
FT                   /db_xref="GOA:Q0I320"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I320"
FT                   /protein_id="ABI24890.1"
FT                   /translation="MEKLTLSPISRIDGEINLPGSKSLSNRALLLAALAKGTTQVTNLL
FT                   DSDDIRYMLNALKALGVNYQLSDDKTVCVVEGIGGAFQWQNGLSLFLGNAGTAMRPLAA
FT                   ALCLKGDTESEVILTGEPRMKERPIKHLVDALRQTGANIQYLENEGYPPLAIRNQGIFG
FT                   GKVQIDGSISSQFLTALLMAAPLGEGDMEIEILGELVSKPYIDITLAMMKDFGINVEHY
FT                   NYQRFLIKGKQYYISPQTYLVEGDASSASYFLAAAAIKGKVKVTGIGRNSIQGDRLFAD
FT                   VLAQMGAKVTWGEDFIQVEKSELKGIDMDMNHIPDAAMTIAITALFAQGETVIRNIYNW
FT                   RVKETDRLTAIATELRKLGAEVEEGEDFIRIQPLALDKFKHAEIATYNDHRIAMCFSLI
FT                   ALSDTSVTILDPACTAKTFPTYFSEFEKISKNQ"
FT   gene            657001..658215
FT                   /locus_tag="HS_0614"
FT   CDS_pept        657001..658215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0614"
FT                   /product="membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24891"
FT                   /db_xref="GOA:Q0I319"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I319"
FT                   /protein_id="ABI24891.1"
FT                   /translation="MSIQTHIKAKRSHVFFLKLFLGIIVLLFAVMIGLKVASKMLIGKM
FT                   IAGMPEKTTPVTAITVVPTTWTPVIETTGLVRPNQGAVLSAQAPGTVANIFIQSGQPVK
FT                   KGDVLVELDISVEQANLQASEAKLTTAKQIYKRYLNLYKTKSVSQQELDNAKANYESLV
FT                   ANINALKAAIERRKIVAPFDGITGIVKVNVGQYVNVGTPIVRVEDTSSMKVDFSIAQNE
FT                   LEKLFIGQTVTATSDARLGETFGAKITALEPAVNAATGLIDVQATFEDEDSRKLLSGMF
FT                   MRLRVALTTEKDQIVIPQVGISYHMYGESAYVLTALSEEDKKTLLDNEKFAYKDSIDRV
FT                   YRVKQTTVFTKDRQGIYAQLKGQDIKPGDQIVVGGQQAITNGSLVVVVDKETIGTQQPA
FT                   KKTNL"
FT   gene            658237..661353
FT                   /gene="acrB"
FT                   /locus_tag="HS_0615"
FT   CDS_pept        658237..661353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="HS_0615"
FT                   /product="cation/multidrug efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24892"
FT                   /db_xref="GOA:Q0I318"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I318"
FT                   /protein_id="ABI24892.1"
FT                   /translation="MKFTDIFIRRPVLAVSISLLIIILGLQAISKLSVREYPKMTTTVI
FT                   TVATVYPGADANLMQAFVTSTLEEAIAQADNIDYMSSSSAANSSIITVKMKLNTDPNGA
FT                   LADVLAKVNSVRSRLPHNIEDPVISSSTGGTGIMYISFYSDKLDSSQVTDYIERVVKPQ
FT                   LFTIEGVAKAQIFGAAQYALRIWLDPEKMAAQNLSALAVMSALSANNVQTAAGSADGYY
FT                   TVYKNKVGTTTNSVKDLENLIVYSKDDNLVRLRDIATVELNKESDSTRATANGADSVVL
FT                   AIEPTATANPLTVAENVRPLYAQIKQNLPSSMYSDLLYDRTIAINSSINEVIKTIIEAT
FT                   VIVLVVILLFIGSLRAILIPIITIPISLIGVIMILQLFDFSINLMTLLAMILAIGLVVD
FT                   DAIVVLENVDRHIKAGETPFRAAIIGTREIAIPVISMTIALIAVYSPMALMGGITGSLF
FT                   KEFALTLAGAVFISGIVALTLSPMMTSKLLNNNAKPNRLEQQIEKSLTRLTNGYVYVLN
FT                   LVMANRKCMLAFAAIIFAMLPFLFTSLSSELTPAEDKRAFIAIGSTPSNMNVDYAQEAT
FT                   KQYVDLLNKTEEVQFTMSIAGFPSSSDTLNVVTLKDYKEGGRSQSEIIEELNRKATQIP
FT                   EVSVSAFNFPEIDTGESGAPIGFVISTANNYRDLAPVAEAFLAKMRESGRFVYTNLDLK
FT                   FDTAEMQISIDKEKAGSYGVSMQQISSTLGSYLSAATVSRVDIDGRAYKVIAQVKRADR
FT                   LTPESLKNFYVSASNGKSIPLSSLISMELVTQPTSLSRFSQLNSALIQAVPMPGVSVGD
FT                   AVQWLKDAATELLPKGYNYDFRGEARQLVQEGNALVITFVLAVLIIFLVLAIQFESIRD
FT                   PLVIMVAVPLAVSGALLVLNFLSLLTDMRILRLSGVTLNIYSQVGLITLVGLITKHGIL
FT                   MCEVAKEEQLYLGKSRIDAITEAARVRLRPILMTTAAMVAGLIPLLLASGAGAASRFSI
FT                   AIVLVAGLSIGTLFTLFVLPVIYSYIASEHKPLPEFDESIKPLVTDQHH"
FT   gene            complement(661379..662137)
FT                   /locus_tag="HS_0616"
FT   CDS_pept        complement(661379..662137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0616"
FT                   /product="2-succinyl-6-hydroxy-2,
FT                   4-cyclohexadiene-1-carboxylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24893"
FT                   /db_xref="GOA:Q0I317"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022485"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I317"
FT                   /protein_id="ABI24893.1"
FT                   /translation="MMPILVFLHGLLGTKQDWQYIIEELKKNLPHFSSQSYLCLDLPFH
FT                   GEQTNYHIEDFEQSAQYLSRQITAKIADKPYILVGYSLGGRLALNYALQSKYPQSKLVA
FT                   LILEGANLGLENEQQRLERWQNDLAWAKRFSQETMSKVLNDWYQQPVFAHLSARERKQL
FT                   ISQRRHQSGQNIAKMLIATSLAKQPSFHQKVRSFSLPIYYFCGEKDEKFKKMAQENQLN
FT                   LFLIERAGHNAHLENPIAFANKIVEIINRT"
FT   gene            complement(662150..663856)
FT                   /gene="menD"
FT                   /locus_tag="HS_0617"
FT   CDS_pept        complement(662150..663856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menD"
FT                   /locus_tag="HS_0617"
FT                   /product="2-succinyl-6-hydroxy-2,
FT                   4-cyclohexadiene-1-carboxylate synthase"
FT                   /note="bifunctional; 2-oxoglutarate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24894"
FT                   /db_xref="GOA:Q0I316"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I316"
FT                   /protein_id="ABI24894.1"
FT                   /translation="MSASVFNRCWSKVILETLSRQGVSHFCIAPGSRSTPLTLEAIRLQ
FT                   ENGRGTCHAHFDERSLGFFALGIAKASKKPVAVIVTSGTATANLYPAIIEARQTDVPLI
FT                   ILTADRPPELLECGANQAILQQNMFAQYPIASINLPRPSQNYSAQWLISVLDQACFRQK
FT                   QGGVIHINVPFAEPLYNANNDEIDLHPWLSNIQSWLTQNKNWIQHQEQHTEVITHKYWD
FT                   QWRTKKGIIIVGRLPSEQAMGIAEWADNMGWIMITDIQSHVKPTLPYADIWLANQTVRK
FT                   KLLQAEIVIQFGSGFIGKRINQFLAEFKGEYWIIENNQKAVDPYHHAHTRFNAKPHHWL
FT                   RAHPPMRKKPWLLEPLALAKFCADFIKQRVGSNLNEASLAHNIELLLPKSNSVLFLGNS
FT                   LFVRLADALSQPSANYPIYTNRGASGIDGLLATAAGIAVGSEQTLVAMIGDTSTLYDLN
FT                   SFALFKQLNQPAIIFVINNNGGAIFDMLPVDIAVKEKYYRMSHYLEFSHIAAMFDLKYA
FT                   RPYTWADLATVLKQAYSRRETTVIEIKVNPNDGSNIYKDLIDKIGHALIGV"
FT   gene            complement(663862..665145)
FT                   /gene="menF"
FT                   /locus_tag="HS_0618"
FT   CDS_pept        complement(663862..665145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menF"
FT                   /locus_tag="HS_0618"
FT                   /product="isochorismate synthase"
FT                   /EC_number="5.4.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24895"
FT                   /db_xref="GOA:Q0I315"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR034681"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I315"
FT                   /protein_id="ABI24895.1"
FT                   /translation="MDNLHEIKAEFIRLINQYQFDPKNDFSVLRLDLNEELNLLGWLKA
FT                   QHHYPQFYLNFRDTNKKILGLGEICRFTQVKSAQTFVQQFNLPLIGGCQFNGEPLFILP
FT                   RLSFIQEQKLVIQLIIDNKKPWEQEKYELLNIIHSLEKQVQLNPIHQSIQLITTKANQT
FT                   EWCLWVEKALHEIKQKNLTKVVLANETDFKTDSPLNAKDFLAESEKYNTGCYHFLFAQN
FT                   NTQAFIGSTPERLYVRKQNRLITEALAGTAFITNDEHINQQQAQWLLQDPKNIYENSLV
FT                   VEGICQHLIPYVEEITVSELEIKQLRQVQHLKREISARLKAGNTDAVCLNAIHPTAAIA
FT                   GLPQKEAKVFLQNTETFDRTWYAGALGIMTETESEFCVTIRSSFIEQDYIRIFAGAGIV
FT                   EGSIPLLEWQEIERKALGLISLLQKETE"
FT   gene            665297..666511
FT                   /locus_tag="HS_0619"
FT   CDS_pept        665297..666511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0619"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24896"
FT                   /db_xref="GOA:Q0I314"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I314"
FT                   /protein_id="ABI24896.1"
FT                   /translation="MRVFPKSDKLEHVCYDIRGPVHQEALRLEEEGKKILKLNIGNPAP
FT                   FGFEAPDEILVDILRNLPAAQGYCDSKGLYSARKAIVQYYQSKNILSATVNDVYIGNGV
FT                   SELITMSLQALLNDGDEVLIPMPDYPLWTAAATLAGGKAVHYLCDEQADWFPDVADIKS
FT                   KVTSRTKAIVIINPNNPTGAVYSKELLLDIVEVARQNGLMIFADEIYDKILYDNAVHHH
FT                   IAALAPDLLTVTFNGLSKSYRVAGFRQGWMILNGPKHQAKGYIEGLDMLASMRLCANHP
FT                   MQHAIQTALGGYQSINEFILPGGRLLEQRNKAYELINQIPGLSCTKPMGALYMFPKIDT
FT                   KKFNIYDDEKMVLDLLRQEKVLLVHGRGFNWQQPDHFRIVTLPYVNQIEDALGRLARFL
FT                   EYYRQ"
FT   gene            666625..666861
FT                   /locus_tag="HS_0619a"
FT                   /note="possible transposase fragment"
FT   gene            complement(667230..667616)
FT                   /locus_tag="HS_0620"
FT   CDS_pept        complement(667230..667616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0620"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24897"
FT                   /db_xref="GOA:Q0I313"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I313"
FT                   /protein_id="ABI24897.1"
FT                   /translation="MHLRLIMEIHDKIRVMREINQWSQEDMAEKLDMSPTGYAKIEHGK
FT                   TNLTIEKLKQIAQIFNIDVVELIASQDKSFFFSIGDNTNNHNYIVPNQALAMENEKLRL
FT                   LLEAKENEIGALKEIITLLKSQAK"
FT   gene            667778..668578
FT                   /locus_tag="HS_0621"
FT   CDS_pept        667778..668578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0621"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24898"
FT                   /db_xref="InterPro:IPR001677"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I312"
FT                   /protein_id="ABI24898.1"
FT                   /translation="MKLSFSKTLLSMAILVGLTACGSGGGSGSTAPRTLSSSDAGAAYI
FT                   AKTNNHGEITSVTHSIIKNKNDISFGENYISINGEKFPMPADAIQEAEHQFYQGLNAIK
FT                   NATDLDIEDISGVGIYIVYDKGAAFYLGNPTKDMPISGSATYLGGAMLFENKEFLAPLK
FT                   EGKTKLIADFSNKKLDGSLVFSDISPINISANIDQNNFTGRASSNSLSPGHVEGKFYGK
FT                   NAASISGIVKSDDLQGNKGWIAIFSGADKKHFTPQGLRDLGIQE"
FT   gene            668613..669866
FT                   /locus_tag="HS_0622"
FT   CDS_pept        668613..669866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0622"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24899"
FT                   /db_xref="InterPro:IPR007655"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I311"
FT                   /protein_id="ABI24899.1"
FT                   /translation="MKKLIFILFVSCYIPVVTANFQQERNYSIRLSRNDTKLTESLLVS
FT                   MLKSQQFHAAEKMLAIYQNIDNPSPQLINYTKIYLAQQYYRNKQYKRALSLFLELKKQA
FT                   NLTDKEKVIIEQYLSILEEQESWQFSFSANYLRNKNVNNASSERQIEDTGFSKNDDMLP
FT                   QSATGLAYYFSAERNWNLVDSHYLHFSNELFGKYYWDNKDFDESNNRTYIGYIYQNAKL
FT                   KFASKAFYERQWFARHRYNWANGLRTELEYSLAPKWKISTAIELSQPHYFKQREKNGTS
FT                   KLISFTLIWQPNHLSYLYWGIDFIREKTQLKQYSNDTKGLRLGWSRIWTGNFITQINSS
FT                   ISWRNYKDKASLGGILPLDKIRKDKIYNANLTVWKSDWNWSGFTPKLQFKYKKQKSNIA
FT                   SVFSYTEKNVQLVIEKTF"
FT   gene            complement(669927..670646)
FT                   /gene="fadR"
FT                   /locus_tag="HS_0623"
FT   CDS_pept        complement(669927..670646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadR"
FT                   /locus_tag="HS_0623"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24900"
FT                   /db_xref="GOA:Q0I310"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR014178"
FT                   /db_xref="InterPro:IPR028374"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I310"
FT                   /protein_id="ABI24900.1"
FT                   /translation="MDILKAQSPAALAEEYIVKSIWNNHFPAGSDLPAERELADKIGVT
FT                   RTTLREVLQRLNRDGWLNIQHGKPTKVNNIWETAGPNILKTLIQLSPTLKPTVIANVVS
FT                   LRTRMGEQFIPEAIKINPQQTFEFFQSLDELDDDEKSYAEFDYNLYHRFSFISDKPVYT
FT                   LILNSFRTLYHQVAALFFTNPQSRQFALTFYKQLQECCRNGDYQKASLCLAESRERSSV
FT                   IWKEMLTNLPENFCEED"
FT   gene            670750..671370
FT                   /gene="dshB"
FT                   /locus_tag="HS_0624"
FT   CDS_pept        670750..671370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dshB"
FT                   /locus_tag="HS_0624"
FT                   /product="disulfide bond formation protein B"
FT                   /EC_number="1.8.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24901"
FT                   /db_xref="GOA:Q0I309"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR022920"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0I309"
FT                   /protein_id="ABI24901.1"
FT                   /translation="MFYSILLVRLYFCVLSFYEINLMTLRIIGMLIFFKNLSMKRSTWI
FT                   LLFISALVLESTALYFQHGMGLNPCVMCIYERVAILGILFSGLIGCIAPKWLVLRILAL
FT                   LIGLGSAVKGLLLAIKHLDYQINVYPWNQCAMVPDFPQTLPLDKWFPNIFMPSGSCSDI
FT                   TWSFLGFSMVQWIIVIFACYFLFFIILSISQFKKVRKNRMLFR"
FT   gene            672127..673131
FT                   /gene="terC"
FT                   /locus_tag="HS_0625"
FT   CDS_pept        672127..673131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terC"
FT                   /locus_tag="HS_0625"
FT                   /product="membrane protein"
FT                   /note="possible tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24902"
FT                   /db_xref="GOA:Q0I308"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I308"
FT                   /protein_id="ABI24902.1"
FT                   /translation="MYYFGFPLEVVIIFFSVLFISIYLDLFSHRNVKEISFKDASLWSI
FT                   FWIGLALAFYGYIWVRFDKEFADLYLAGYVLEKSLSVDNLMVFMAIFASFGISSHLQHR
FT                   ILYWGIIGALVFRGIFVAIGNGLFLLTPWIGFAFAAFVLWSAFKMWKESGSDDEEEIED
FT                   YSNHWSVRWTGKLYPVYTKLFGERFFVKASELNKEQLASVTRQGLKFATPAFLCLVAIE
FT                   TSDVAFAFDSVPAVIAVTQEPLLVYAAMIFAILGLRSLYFILAALTKYLVHLEKAVIAL
FT                   LFFIGIKMGLQSWNHTIGDTGLHLSANASLFIVLGVLAIGVIASFLFPGKEKK"
FT   gene            673133..673495
FT                   /locus_tag="HS_0626"
FT   CDS_pept        673133..673495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24903"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I307"
FT                   /protein_id="ABI24903.1"
FT                   /translation="MKKSMLLLSAFFSVSAFAQHYYKAPPTSSTTGYVPVISDELMKLC
FT                   VDRYNQAEWLSEEINNTYVDQYSQASVNNYNAKVHQYRQLENWFNQNCAGKQSRSACEA
FT                   ARELNRQNGIEHQSCY"
FT   gene            673507..674157
FT                   /locus_tag="HS_0627"
FT   CDS_pept        673507..674157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24904"
FT                   /db_xref="GOA:Q0I306"
FT                   /db_xref="InterPro:IPR025565"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I306"
FT                   /protein_id="ABI24904.1"
FT                   /translation="MQLNNKIRTKVLLSLLILNGVFRFLDVIYINQLFKGIESGYEWFK
FT                   LLEFYEATSRTSVVLLGIIFGCWIYKAHKNLEILGRKDLRFSHASTVWWFFIPVFQFWK
FT                   PYQVMKEILLKTTENLKDTKVKKVKYILCVYWLITNLIIIYGYFVCVMLLYGYLSGYLI
FT                   PIFLLFAYLNLYTWIIMNVFSLIGMFCMFYYIYHINHWQQKSKKNVSLQKNIV"
FT   gene            674167..674805
FT                   /locus_tag="HS_0628"
FT   CDS_pept        674167..674805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0628"
FT                   /product="conserved hypothetical protein, with von
FT                   Willebrand factor (vWF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24905"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011392"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I305"
FT                   /protein_id="ABI24905.1"
FT                   /translation="MRRLPVYLLVDTSGSMMGEPIESVRSGLQTLVSALRQDPYALETA
FT                   YLSVITFDSSARQVTPLTDLMSFQLPSIEASGLTAMGEALGLLADCVNREVNKGSAEVK
FT                   GDWKPVVFLLTDGIPTDDLQSGIFALKNVKTGTFVACAAGAGADTEELKKITETVVSLD
FT                   TADANSIKAFFKWVSSSISVSSQKVDLNKKEPNGLDELPPPPAEINVVL"
FT   gene            674853..675530
FT                   /locus_tag="HS_0629"
FT   CDS_pept        674853..675530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0629"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24906"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011392"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I304"
FT                   /protein_id="ABI24906.1"
FT                   /translation="MLGKYSKTIEKAKMTRRLLTYICIDTSGSMRGEPIEAVNVGLQAL
FT                   LSSLRQNPYALESIHLSITTFDNQVQKILPLTPLEQVQMPTVTCPDSGATFMGTALEQI
FT                   AIDAKNDRIENSATKKGDWRPILILLTDGKPSDILAFNNAIPQIKALNFGRIVACAAGP
FT                   KADPDYLKKLTDDVVSLDTMDASSFSQFFQWVTQTLNQSSQSVGSPNSEQLPPPPATIN
FT                   VVL"
FT   gene            675539..676570
FT                   /locus_tag="HS_0630"
FT   CDS_pept        675539..676570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0630"
FT                   /product="conserved hypothetical protein, with von
FT                   Willebrand factor (vWF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24907"
FT                   /db_xref="GOA:Q0I303"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR028274"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I303"
FT                   /protein_id="ABI24907.1"
FT                   /translation="MRRLPIFLVVDVSESMAGDSHRQMQEAINRLVQRLRCDPYALESV
FT                   YISVIAFAGAAGVIAPLTELMSFYAPRLPMGSGTSLGAALNLTMDEIQRNVVRSSGDQK
FT                   GDFKPLVYILSDGVATDDPTSAIQRWQQEFKSRTKLIAVGLGNFADLSALNQIAELTFR
FT                   IDDQDLEEAYLTLTRSIEDSILSQSRSLGVAPLTIDENQSGVSLIKNEQQAVGIDENYA
FT                   ILTGLCRKEKLPYLMKYERQDGLPAEMRLFRYVGTYPAEKDFEDWSDHRPNESKVKASE
FT                   LWGGGGCPHCGSAFGLAVCAFCDQIFCIDGEGKAICPKCEMVNEFVAGKGESVDFEINR
FT                   SRG"
FT   gene            676573..678123
FT                   /locus_tag="HS_0631"
FT   CDS_pept        676573..678123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24908"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I302"
FT                   /protein_id="ABI24908.1"
FT                   /translation="MSSITLHFDKLKQRFAHLNPDVLDSFLQQHRKLTEVFSEALENFL
FT                   LAKHIEAQGESVFVKNPTETTAIVKPSEQLPPLTNARQKEAYCYKAEHLGNIVNAVFSE
FT                   PCGLAWDKEKQAISGIPDIGGKEIVVTFHFDNGIQKTANLYINADPRSLWNNIPSRDLV
FT                   KEYWKADSASALEKTPYGTLIAARQRGRSHAHKGTCCDDDFTFGFHQPTGIHFMAVADG
FT                   AGSAEYSRLGSKLAVEKAKETFFELLNDVSKQYYNFPKLEANSSNLKDLTTSILGQTVY
FT                   SAFLAQQKAINEKITEKSLSCTLLLTFVVPLQSGKWFTAAYWVGDGAVAVFNPQNKDVY
FT                   LLGESDGGQYSGETQFLSKAEFVDEQWKQRIQMTLSECPPVLFAMTDGVSDPKFKNDAA
FT                   LMQSESWSALWAELQAPLNHAEPEKALELWLDFWSVGEHDDRTLAMFIPAFSEEIAEKG
FT                   SENTACYTEPNSNETLTANDLTLQKVSDVEEVQAVENEPENTKLPTVTLPESLEVQNG"
FT   gene            678116..679612
FT                   /locus_tag="HS_0632"
FT   CDS_pept        678116..679612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HS_0632"
FT                   /product="serine/threonine kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24909"
FT                   /db_xref="GOA:Q0I301"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I301"
FT                   /protein_id="ABI24909.1"
FT                   /translation="MAKVVTLTATNGETIQFVEEVKAQGGMKDVMFSPNRDYVVAFLRD
FT                   PADNETKERLEMITGQYRKRIFNQEGGEYLKKLYCWPTAVVEYNGKLGVVSPFYRDCFF
FT                   FQYGSRNSDMLGIQGKEKDGKWFASANNRNKFLAPEELGDWMLHLKVCLMLARAVRRMH
FT                   MAGLSHSDLGYKNCLIDPTTGQACLIDIDGLVVPGKHPPTVVGTPDFIAPEVVATSHLD
FT                   VKDPNRKLPSRTTDLHALAVLIYMYLLYRHPLRGDKVFDPNDPQRDEELGMGKQALFVE
FT                   HPTDRSNRIKTENIRPSEHPWKDTEKMPYTLTGTYLSDLFKRAFIDGLHNPQARPTADE
FT                   WEQALVKTVDLLQPCSNASCEQKWYAFDNSKHPKCPFCGTAHHGKLPVLNLYSGTPDGK
FT                   FRPDNHRIMVYSNQSLFKWHADNRVFPNEKLRSEDAKRVGYFVQHNGNWWLVNEALPEI
FT                   YDVKAKQAIPIGGKVKLDDGGQILLQKGIGGRLLMVQMAG"
FT   gene            679642..680220
FT                   /gene="terD"
FT                   /locus_tag="HS_0633"
FT   CDS_pept        679642..680220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terD"
FT                   /locus_tag="HS_0633"
FT                   /product="stress response protein"
FT                   /note="tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24910"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I300"
FT                   /protein_id="ABI24910.1"
FT                   /translation="MAVSLSKGQNVSLSKTDPHLNKVLIGLGWDARSTDGADFDLDASV
FT                   FMTGENGKVISDNHFVFYNNLRSPCGSVEHTGDNLTGDGDGDDESIIVDLTAVPANIKS
FT                   IFITVTIHDAEARRQNFGQVSDAFIRLVNHERDEEVVRFDLSEDYSTETAMVFGEVYRY
FT                   NSEWKFRAIGQGYSGGLYALCQQYGVNVG"
FT   gene            680223..680969
FT                   /gene="terE"
FT                   /locus_tag="HS_0634"
FT   CDS_pept        680223..680969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terE"
FT                   /locus_tag="HS_0634"
FT                   /product="stress response protein"
FT                   /note="tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24911"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2Z9"
FT                   /protein_id="ABI24911.1"
FT                   /translation="MSTSFVKKIVQMQCQAENFIQEIRNKTLPELKQRADNFVQEVKQE
FT                   YQSAKQQRRITGMGISLEKGQNLSLTKNAPTLKHLQVGLGWDTRSTDGQAFDLDASAFM
FT                   VGENGKVPSDAYFIFYNQTRSQCGSVEHMGDNLTGDGDGDDEVINVALDKVGQDIRSIF
FT                   ITVTIHEAEARKQNFGQVHNAFIRIVNKDTNEEIVRFDLSEDYSIETSMIFGEIYRHNG
FT                   EWKFRAIGEGYKDGLYALCKQYGVNI"
FT   gene            680979..681560
FT                   /gene="terZ"
FT                   /locus_tag="HS_0635"
FT   CDS_pept        680979..681560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terZ"
FT                   /locus_tag="HS_0635"
FT                   /product="stress response protein"
FT                   /note="tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24912"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2Z8"
FT                   /protein_id="ABI24912.1"
FT                   /translation="MAISLQKGQKISLEKEAGRSLSKVVMGLGWDAAKKKGLFGIFGGG
FT                   SQDIDLDASCFVFDDQNQLIDLVYFGQLRSRDGFIQHTGDNRTGDGDGDDEQIIVHLDR
FT                   LPSNVKSLVFTVSSYLGQSFKDIENAFCRITDHIGKEIARYDLSAQGNHTAQVMAKVYR
FT                   HNGDWKMHAIGENCQGATPDKIVSVIYQFL"
FT   gene            complement(682438..683502)
FT                   /gene="lob2d"
FT                   /locus_tag="HS_0636"
FT   CDS_pept        complement(682438..683502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lob2d"
FT                   /locus_tag="HS_0636"
FT                   /product="lipopolysaccharide biosynthesis protein,
FT                   glycosyltransferase, family 8"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24913"
FT                   /db_xref="GOA:Q0I2Z7"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2Z7"
FT                   /protein_id="ABI24913.1"
FT                   /translation="MNILFACDDNYAKYLAVTMLSIIHARDKNNECYTIHFYLLDMGIS
FT                   TVAKDYCLELANKNNCHLDIVPISISDFEKFPRTIEYISLSTYARLNLANYLKKFNLTK
FT                   IIYLDIDILVNHSLLPLWNTDLGNKAIGACYDAFIESQEKSKRMSSQSVSQSVSQSVSQ
FT                   SVSQSVSQSVSQSVSQSVSQSVSQSDYKTKLHLPNTHFYFNAGVLLINVVEWEKCHVFE
FT                   KSLQWIEYCKRNNIEFLYQDQDILNAIFANNVKYLDLRYNFTANALNRLKRVSKKELNQ
FT                   YEEATMPLAIIHYVGPKKSWHEKCSMLKANLFCHLFQQLENPPKEWKIENVPFIRKLKR
FT                   FAKDLRHKIIYKIY"
FT   gene            complement(683518..683634)
FT                   /gene="lob2C"
FT                   /locus_tag="HS_0636a"
FT                   /note="glucosyltransferase; involved in LOS biosynthesis,
FT                   N-terminal"
FT   gene            complement(683679..684155)
FT                   /gene="lob2A"
FT                   /locus_tag="HS_0637"
FT   CDS_pept        complement(683679..684155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lob2A"
FT                   /locus_tag="HS_0637"
FT                   /product="lipooligosaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24914"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2Z6"
FT                   /protein_id="ABI24914.1"
FT                   /translation="MFNYVISLKSAVDRRQHIEKEFSQQHIPYTFFDAFQLNEENKHIL
FT                   QHYVPSLNKTDLTTGEKGCFMSLTVENTFPIDEIIFNQILNHKKYKIYQLNPAILIQEL
FT                   TLHKEKSILQSDLETERKKVRDSKKIKRNFCEKVKYKISRYKNKKREKIIRKEK"
FT   gene            684277..685170
FT                   /gene="lob1"
FT                   /locus_tag="HS_0638"
FT   CDS_pept        684277..685170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lob1"
FT                   /locus_tag="HS_0638"
FT                   /product="Lob1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:HS_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABI24915"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:Q0I2Z5"
FT                   /protein_id="ABI24915.1"
FT                   /translation="MPINQSINQSINQSINQSINQSINQSINQSINQSINQSINQSINQ
FT                   SINQSAIFVINLEKATERKHFISHQFTALQEQHPDIVINYQFFTGVNGNTQPNHPLFAK
FT                   YNQKKRYYRKGNEITLGQLGCYASHYLLWEKCVQLQQPIIVLEDDAILQPNFLAVYQFC
FT                   FSAENQFEFFWLTHSNSSKIKTKLIHTLPDSTKLEQHYFGYSNTTGYYLTPQAAQKFLD
FT                   FSQEWIYNVDIFMDRFYENHVALLGVNPPCVKPDFSKQSQITMNKNNRTFWVKLRREYF
FT                   ALLERIKRFVYWTFYC"
FT   gene            complement(685341..686390)
FT                   /gene="afuC"
FT                   /locus_tag="HS_0639"
FT   CDS_pept        complement(685341..686390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="afuC"
FT                   /locus_tag="HS_063