(data stored in ACNUC7421 zone)

EMBL: CP000441

ID   CP000441; SV 1; circular; genomic DNA; STD; PRO; 2646969 BP.
XX
AC   CP000441; AAJL01000000-AAJL01000039;
XX
PR   Project:PRJNA13490;
XX
DT   22-SEP-2006 (Rel. 89, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 9)
XX
DE   Burkholderia ambifaria AMMD chromosome 2, complete sequence.
XX
KW   .
XX
OS   Burkholderia ambifaria AMMD
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-2646969
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Bruce D., Chain P.,
RA   Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Parke J., Coenye T., Konstantinidis K.,
RA   Ramette A., Tiedje J., Richardson P.;
RT   "Complete sequence of Chromosome 2 of Burkholderia cepacia AMMD";
RL   Unpublished.
XX
RN   [2]
RP   1-2646969
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Bruce D., Chain P.,
RA   Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Parke J., Coenye T., Konstantinidis K.,
RA   Ramette A., Tiedje J., Richardson P.;
RT   ;
RL   Submitted (22-AUG-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; d4d013192f16115d714cf9e412792790.
DR   BioSample; SAMN02598309.
DR   EnsemblGenomes-Gn; Bamb_R0077.
DR   EnsemblGenomes-Gn; Bamb_R0078.
DR   EnsemblGenomes-Gn; Bamb_R0079.
DR   EnsemblGenomes-Gn; Bamb_R0080.
DR   EnsemblGenomes-Gn; Bamb_R0081.
DR   EnsemblGenomes-Gn; Bamb_R0082.
DR   EnsemblGenomes-Gn; Bamb_R0083.
DR   EnsemblGenomes-Gn; Bamb_R0084.
DR   EnsemblGenomes-Gn; Bamb_R0085.
DR   EnsemblGenomes-Gn; EBG00001103290.
DR   EnsemblGenomes-Gn; EBG00001103291.
DR   EnsemblGenomes-Gn; EBG00001103292.
DR   EnsemblGenomes-Gn; EBG00001103293.
DR   EnsemblGenomes-Gn; EBG00001103294.
DR   EnsemblGenomes-Gn; EBG00001103295.
DR   EnsemblGenomes-Gn; EBG00001103296.
DR   EnsemblGenomes-Gn; EBG00001103297.
DR   EnsemblGenomes-Gn; EBG00001103298.
DR   EnsemblGenomes-Gn; EBG00001103299.
DR   EnsemblGenomes-Gn; EBG00001103300.
DR   EnsemblGenomes-Gn; EBG00001103301.
DR   EnsemblGenomes-Gn; EBG00001103302.
DR   EnsemblGenomes-Gn; EBG00001103303.
DR   EnsemblGenomes-Tr; Bamb_R0077-1.
DR   EnsemblGenomes-Tr; Bamb_R0078-1.
DR   EnsemblGenomes-Tr; Bamb_R0079-1.
DR   EnsemblGenomes-Tr; Bamb_R0080-1.
DR   EnsemblGenomes-Tr; Bamb_R0081-1.
DR   EnsemblGenomes-Tr; Bamb_R0082-1.
DR   EnsemblGenomes-Tr; Bamb_R0083-1.
DR   EnsemblGenomes-Tr; Bamb_R0084-1.
DR   EnsemblGenomes-Tr; Bamb_R0085-1.
DR   EnsemblGenomes-Tr; EBT00001693480.
DR   EnsemblGenomes-Tr; EBT00001693481.
DR   EnsemblGenomes-Tr; EBT00001693482.
DR   EnsemblGenomes-Tr; EBT00001693483.
DR   EnsemblGenomes-Tr; EBT00001693484.
DR   EnsemblGenomes-Tr; EBT00001693485.
DR   EnsemblGenomes-Tr; EBT00001693486.
DR   EnsemblGenomes-Tr; EBT00001693487.
DR   EnsemblGenomes-Tr; EBT00001693488.
DR   EnsemblGenomes-Tr; EBT00001693489.
DR   EnsemblGenomes-Tr; EBT00001693490.
DR   EnsemblGenomes-Tr; EBT00001693491.
DR   EnsemblGenomes-Tr; EBT00001693492.
DR   EnsemblGenomes-Tr; EBT00001693493.
DR   EuropePMC; PMC2168197; 17905875.
DR   EuropePMC; PMC2168593; 17933898.
DR   EuropePMC; PMC2612433; 18931103.
DR   EuropePMC; PMC2813009; 20008172.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP000441.
DR   SILVA-SSU; CP000441.
DR   StrainInfo; 355609; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000046
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC        Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2646969
FT                   /organism="Burkholderia ambifaria AMMD"
FT                   /chromosome="2"
FT                   /strain="AMMD"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:339670"
FT   gene            complement(13..1356)
FT                   /locus_tag="Bamb_3219"
FT   CDS_pept        complement(13..1356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3219"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: bur:Bcep18194_B2245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3219"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88775"
FT                   /db_xref="GOA:Q0BAP8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAP8"
FT                   /protein_id="ABI88775.1"
FT                   /translation="MLQIFALIGALFLVALNGFFVAAEFGLVKLRATRVKTLARKHGLR
FT                   GRILAVVHGRLDAYLSACQLGITLASLGLGWVGEPAFAELIGPLLDLIGVESERIVHLI
FT                   SLVFAFSLISFLHIVVGELAPKSMAIRQSEKVGLWVALPLYAFYWAMYPAIWVLNSSAN
FT                   AVLRLAGLSADHGGDAHYSTDELKLILRGRRSAAGNTAQPARGTYTNDEWNTLAHSLDF
FT                   SSMTVSDLMRPAHEMIGLRRDLPLPDNMEIVARHRFSRYPLFENTSREQVSGLIHLKDL
FT                   LLARHAGAALEDLSDYVRPVQYVKPDTPALELFRRFRKGAPHFALVGNKGEKPIGFLTL
FT                   DNLLGALVGQIHDEFRQGDADWTRLDDGTLMGKGSLPVVSLEQALGIDIDEGRAESVGG
FT                   LVIQALSDLPTEGQRVSFDRFDVVVKKMNGPRIVLVRVYPKTAKEADE"
FT   sig_peptide     complement(1285..1356)
FT                   /locus_tag="Bamb_3219"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.958) with cleavage site probability 0.918 at
FT                   residue 24"
FT   gene            complement(1434..2213)
FT                   /locus_tag="Bamb_3220"
FT   CDS_pept        complement(1434..2213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3220"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: histidine kinase A domain protein domain
FT                   protein; KEGG: bur:Bcep18194_B2244 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3220"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88776"
FT                   /db_xref="GOA:Q0BAP7"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAP7"
FT                   /protein_id="ABI88776.1"
FT                   /translation="MTSIPVDPAADLLRERAAHYAAEAALFLRDQALSTASHDLRSPLN
FT                   AMHSWAYVLERQLASADPSLQRALAGIRTGIDQQVALIDDVLDAPRAETRTLAIAAQPF
FT                   ALRPLLDDTLALVRFALADARQVSIDATLPDGEPSLRADRERLAQALWTMLTTAVEASA
FT                   AGNRVTFACTRDGAQCVAHVTCGVSAAALADPALPHAFDAFARREMLRSRDAKRVAWVL
FT                   ALCQRVALAHGGTFTHAAFADGAVVTLSLAVPCEAAG"
FT   gene            complement(2281..3204)
FT                   /locus_tag="Bamb_3221"
FT   CDS_pept        complement(2281..3204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3221"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: bur:Bcep18194_B2243 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3221"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88777"
FT                   /db_xref="GOA:Q0BAP6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAP6"
FT                   /protein_id="ABI88777.1"
FT                   /translation="MKPEARKHLRANLLMLGAAAIWGSAFVAQRLSLDVIGPFLFTGLR
FT                   FLLGGLVLIPLLTFNTASRAQLAAIRREPALLVPGLALGALLAVSISLQQFGLQYTRIA
FT                   NAGFISSLYVVIVPLIGVFVRHRIGAGTWFGALLAAIGLYFLSIDEHFSVLYGDWFQLA
FT                   GAVIIAAHVMAVGHFAKRHDPLVLAFLQFVTCGALCLAAGLVIEPVSVAMLRSALPTLL
FT                   YGGLLSVGVGYTLQVVAQRDAAPAHAAVIFSMEGVFAAIAGWAALGETLTLRALVGCAL
FT                   MLAGLLACQLLPNGDARKKDEDALPA"
FT   sig_peptide     complement(3121..3204)
FT                   /locus_tag="Bamb_3221"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.981) with cleavage site probability 0.946 at
FT                   residue 28"
FT   gene            complement(3244..4143)
FT                   /locus_tag="Bamb_3222"
FT   CDS_pept        complement(3244..4143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3222"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B2242
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3222"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88778"
FT                   /db_xref="GOA:Q0BAP5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAP5"
FT                   /protein_id="ABI88778.1"
FT                   /translation="MNSHLLIFHSFTSEMKVLDLDAVRAFVLVADLASFTRAADALGTT
FT                   QSAVSLKLKRLEAHLGKPLLARTPRVVKLTADGENFLPAARALLDAHDHALGAISAGVH
FT                   RLSLGVSEHVAVPDLPAVLTSLHRQDPGLSLEMHLGTSSNLLAQYDERRLDAAIVRHEP
FT                   GEDPPRDDGTLLFTEPLAWLAAPDWAPRAGEPLPLAVLAGPCGVRAAALRALEHAGRPW
FT                   RERFTGGGVAAVAAAAAAGLAVCPLARRVAPRTLVDVGAKFGLPPLPHSQVVLYSRVRD
FT                   TRAAAALRRFADSLAISA"
FT   gene            4212..4595
FT                   /locus_tag="Bamb_3223"
FT   CDS_pept        4212..4595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3223"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   bur:Bcep18194_B2241 4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3223"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88779"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR037479"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAP4"
FT                   /protein_id="ABI88779.1"
FT                   /translation="MPFTRIAVREGKPAAYRAALVDGVHRALMHTFNVPEDDIFMVVTE
FT                   HSAENFVFGRHYFDIERSDDLVMIQITANNTRTLEQKRALYRTITENLARQPGVRQQDV
FT                   FISLVEVLKEDWSFGNGIAQYAV"
FT   gene            4722..6353
FT                   /locus_tag="Bamb_3224"
FT   CDS_pept        4722..6353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3224"
FT                   /product="CHAD domain containing protein"
FT                   /note="PFAM: CHAD domain containing protein; KEGG:
FT                   bur:Bcep18194_B2240 conserved hypothetical protein, CHAD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3224"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88780"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAP3"
FT                   /protein_id="ABI88780.1"
FT                   /translation="MSRVLEIVLWLSLDAWQVKSGSRARGEPRDFGAELVRAWRICPQV
FT                   RMRRGHERVTIEPCQVEEAEPSPGECWWTWIESNAQGRRVVASRTKAFAPGVMARERFD
FT                   AEHAGIAVATPLSAPAPPADAQSAQATGEAMTPGPVDEAAVAASSGPAPLRLVAERRRG
FT                   RWADDSGVVVEMTLDDLTLHGGADLPRRHVELRLAAPDWETVPARTAALRALFAAAREL
FT                   SGAWPAFVQLTSVIDRACAGEPGVTGPVKAKLVDLTGIRTQRTALFALSGDIAAQWLGN
FT                   EGGVLDRDDPEFVHQMRVALRRLRTLMRFFPRFADDQWQETFGVDLRWLASLLGTVRDW
FT                   DVFSTESLPALIAADGGSADWNGTLDAARAQATAARIELRQALHSARYARLTLGWLEWL
FT                   STLALPPAASDDDAPSLRRHATKRVRRLFGHLYASPSLTSLDTAARHQVRIDTKRLRYA
FT                   LEFFASLASRRTRNETVKTLARVQSVLGEANDTMVAQHHLEQLAAPAYQLGFVRGYGAA
FT                   LEQRAARDAEALLASLRPPRLDGKPR"
FT   gene            6402..7241
FT                   /locus_tag="Bamb_3225"
FT   CDS_pept        6402..7241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3225"
FT                   /product="transcriptional regulator, ModE family"
FT                   /note="TIGRFAM: molybdate transport repressor, ModE;
FT                   Molybdenum-pterin binding; PFAM: regulatory protein, LysR;
FT                   TOBE domain protein; KEGG: bur:Bcep18194_B2239
FT                   transcriptional regulator, ModE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3225"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88781"
FT                   /db_xref="GOA:Q0BAP2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR003725"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR016462"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAP2"
FT                   /protein_id="ABI88781.1"
FT                   /translation="MSDAPPPSSAAGPLGLGGELWLRAGPQTLGGATRIALLAAIGDTG
FT                   SITRAAKAVGLSYKAAWDAIDTMNNLAGEPLVTRSTGGKGGGGTTLTPRATSLITAFRT
FT                   IEREHRRFIDAASAAVSGFDVDWALIGRIGMKTSARNQLFGKVETIVRGTVNDEVTLVL
FT                   PGGQVIVAVLTHESADALGLEPGADACALVKASWVVLAVADEAEATLKVSARNQLHGTV
FT                   ETVAAGAVNSEVTLALDGGGTLTAVITNDSVGALQLDVGRRAIALFKASSVILAVTG"
FT   gene            complement(7365..8108)
FT                   /locus_tag="Bamb_3226"
FT   CDS_pept        complement(7365..8108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3226"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_B2238 ABC molybdate transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3226"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88782"
FT                   /db_xref="GOA:Q0BAP1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAP1"
FT                   /protein_id="ABI88782.1"
FT                   /translation="MSVAVDIRKTYASAERRFTLDVSFAATTQRVVLFGPSGAGKSMTL
FT                   QAIAGLLSPDEGTITLNGEPLFDSARGIDVPTRARRVAYLFQDYALFPHLNVRQNIAFG
FT                   LTPGLRNPRAKTTPPEVAYWLQAFELDALAGQFPSQLSGGQKQRVALARALVAQPHVLL
FT                   LDEPFAAIDGAMRQRMRHELAELQARLDIPMVLISHDPDDVAAFGDQVVQLSEGRVLAA
FT                   TPHAEWPTRVVGAHDGRGPGGHAGA"
FT   gene            complement(8203..8883)
FT                   /locus_tag="Bamb_3227"
FT   CDS_pept        complement(8203..8883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3227"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: molybdate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B2237
FT                   molybdate ABC transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3227"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88783"
FT                   /db_xref="GOA:Q0BAP0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAP0"
FT                   /protein_id="ABI88783.1"
FT                   /translation="MMQDAWVPLLLSLKVAGWATALDVVLGVAAAFALARWRSPMRDVV
FT                   DSLLTLPLVLPPTVLGYYLLVLLGRRGVFGAWLDKLGIELVFTWQGAVIASMVVAFPLI
FT                   LKSARTAFESVDPHLERAARTLGLGEAAVFFRVTLPLATRGILAGALLAFARALGEFGA
FT                   TLMIAGNLPGRTQTLSVAIYAAVQAGDDSTANFLVLVTSITCVLVLLATGWLVPSRAGR
FT                   SQPT"
FT   gene            complement(8891..9688)
FT                   /locus_tag="Bamb_3228"
FT   CDS_pept        complement(8891..9688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3228"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein, family 1; KEGG: bur:Bcep18194_B2236
FT                   molybdenum ABC transporter, periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3228"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88784"
FT                   /db_xref="GOA:Q0BAN9"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAN9"
FT                   /protein_id="ABI88784.1"
FT                   /translation="MRSTVRPLRRTLLRLLPLATLAAGIAFSAPACAADELVVSAAASL
FT                   TNAFKAVGDAYHKQHPETKVLFNFGASDVLMQQIAKGAPADVFASADQKAMDRAVTEKV
FT                   IVPGTRRDFAANSLVLIVPADSHAAAPTSLNDLTVPGVRRIAYGDPASVPVGRYTESAL
FT                   RAAGVWDAVSAKGVLAANVRQSLDYVARGEVDAGFVFGTDAAIMPGRVKIALTVPTQTA
FT                   ITYPIAVVKDSRHVAQAQSFIDFVASPQGQAVLSTFGFKPAGK"
FT   sig_peptide     complement(9587..9688)
FT                   /locus_tag="Bamb_3228"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.991 at
FT                   residue 34"
FT   gene            complement(9825..10523)
FT                   /locus_tag="Bamb_3229"
FT   CDS_pept        complement(9825..10523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3229"
FT                   /product="phosphoesterase, PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related; KEGG:
FT                   bur:Bcep18194_B2235 phosphoesterase, PA-phosphatase
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3229"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88785"
FT                   /db_xref="GOA:Q0BAN8"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAN8"
FT                   /protein_id="ABI88785.1"
FT                   /translation="MFDLPSHLWITITAFGGAGLTLPLAITIAVWLALGYSWQRAAAWL
FT                   GVLAAAIGVVALTKIAFLGWGIGIRAWDFTGFSGHAMLSTSVYPVAMFLALIRTRAPVR
FT                   IAGIALGLAAGIAVGVSRVALAAHSPSESITGCIIGAIAALVFIAGSWQAVPHRWSVPA
FT                   VVASLALVTIALHGITVPSHQWVTKVALELSGHERPFVRARWKANPNYRPASQPSSLHR
FT                   TGLSLPSLHA"
FT   gene            10771..11880
FT                   /locus_tag="Bamb_3230"
FT   CDS_pept        10771..11880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3230"
FT                   /product="esterase, PHB depolymerase family"
FT                   /note="TIGRFAM: esterase, PHB depolymerase family; KEGG:
FT                   bur:Bcep18194_B2234 esterase, PHB depolymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3230"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88786"
FT                   /db_xref="GOA:Q0BAN7"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAN7"
FT                   /protein_id="ABI88786.1"
FT                   /translation="MTKSLTKVWLGGVKRMLSPAAKRGARDAQRIARDTLEAAASSAAT
FT                   DLSPPRESRVRPRAAAWAAGEWTRGEHPMAPALGRLVQQLAYGLYVPPGRRRGAMPLVV
FT                   MLHGCQQSVDEFAQGTRMNLLADKHGFAVLYPEQSQRAHAHGCWHWYEDTDRAGRGEAD
FT                   TVASLIDALVDEHGFDASRVYVAGLSAGAGLAALLALHHPDHFAAVALHSGPALGEANS
FT                   GISAMDVMRRGLRENPAAVLDALIDASAYPGMPALIVQGDADHVVAPKNADQLTVQFMR
FT                   LNGLADSRGALRGGDRVETREAGAHITDVRRDGEPVVRLCHVKGLDHAWAGGDEAVPFH
FT                   AAVGPDASAMIWSFFEQNRRTVATERRTV"
FT   gene            11962..12138
FT                   /locus_tag="Bamb_3231"
FT   CDS_pept        11962..12138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3231"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2233 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3231"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88787"
FT                   /db_xref="InterPro:IPR021946"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAN6"
FT                   /protein_id="ABI88787.1"
FT                   /translation="MYLLSHLFLMLTKNAEKAAKERADAYLSEATDIYDLEFRMRKIDR
FT                   EAAMNRPFSFGSR"
FT   gene            complement(12247..12666)
FT                   /locus_tag="Bamb_3232"
FT   CDS_pept        complement(12247..12666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3232"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: bur:Bcep18194_B2232
FT                   OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3232"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88788"
FT                   /db_xref="GOA:Q0BAN5"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAN5"
FT                   /protein_id="ABI88788.1"
FT                   /translation="MNILYKTSATSTGGRDGRAVSADNKLEVKLAAPRELGGTGAEGTN
FT                   PEQLFAAGYSACFLSAMKFVAGQNKQTLPADTQVTAEVGIGPNDAGGFGLDIELRVSLP
FT                   GLDKADAQALVDKAHHVCPYSNATRNNVPVRLTVV"
FT   gene            complement(12820..13272)
FT                   /locus_tag="Bamb_3233"
FT   CDS_pept        complement(12820..13272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3233"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; Penicillinase
FT                   repressor; KEGG: bur:Bcep18194_B2231 transcriptional
FT                   regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3233"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88789"
FT                   /db_xref="GOA:Q0BAN4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAN4"
FT                   /protein_id="ABI88789.1"
FT                   /translation="MDRLPPLPQTLDDQLCFALYSTSHAMTKAYKPLLDKLSLTYPQYL
FT                   AMLVLWERDDIAVKDIAARLDLDPATVTPLLKRLEALGYVERVRSATDERVVNVRVTAE
FT                   GRALKVKARSVPGDLFCAMQQTPEFLVRLRADLQQLRDALAAANEG"
FT   gene            complement(13451..14260)
FT                   /locus_tag="Bamb_3234"
FT   CDS_pept        complement(13451..14260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3234"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3234"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88790"
FT                   /db_xref="GOA:Q0BAN3"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAN3"
FT                   /protein_id="ABI88790.1"
FT                   /translation="MQLIEVPAKAGYVWFRQGIWLFRRNPLAFITLFFTYLLAITLVSM
FT                   VPVIGAALPLLFIPGIAVGFMAACRDTVAGKPVMPTILIDGFRSYGSATTQRLLVLGLV
FT                   YVALMVAVFAASSIVDGGGLLHMMLGATNDTSPTPEALAAQGTVGALLLATLLYAPVAM
FT                   LFWFAPVLTAWHDIPPAKALFFSVVSCWRNRGAFVVYGLLWFGVALGSSFGLSLLLQAL
FT                   GAGAYVLTIMMPVTIIIVTMMYCSFYATYRGCFGVQEPGAPTPTTGR"
FT   gene            complement(14251..15249)
FT                   /locus_tag="Bamb_3235"
FT   CDS_pept        complement(14251..15249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3235"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="KEGG: bur:Bcep18194_B2229 homoserine kinase ThrB;
FT                   TIGRFAM: homoserine kinase; PFAM: aminoglycoside
FT                   phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3235"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88791"
FT                   /db_xref="GOA:Q0BAN2"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0BAN2"
FT                   /protein_id="ABI88791.1"
FT                   /translation="MAVFTAVSDSDLAQWMRHYELGDVLAFRGIPSGIENSNFFLTTTR
FT                   GEYVLTIFEKLTAEQLPFYLDLMRHLASHGVPVPDPIPRDDGALFGLLHGKPAAIVTKL
FT                   DGAAELAPGIEHCIEVGQMLARLHLAGRDYARYQPNLRSLPWWRENVPAIVPFVSDAQR
FT                   TLLEGELAHQAAFFASDDYAALPSGPCHCDLFRDNVLFAHAAPGTGHDVRLGGFFDFYF
FT                   AGCDKWLFDVAVTVNDWCVDLATGVLDVARADALLRAYQTVRPFTAPERRHWSDMLRAG
FT                   AYRFWVSRLYDFYLPRAAEMLKPHDPGHFERILRERIANTPALPETHTACN"
FT   gene            complement(15357..15764)
FT                   /locus_tag="Bamb_3236"
FT   CDS_pept        complement(15357..15764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3236"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3236"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88792"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAN1"
FT                   /protein_id="ABI88792.1"
FT                   /translation="MKPLILVAAAAAFAGMFAAVGTAYAAGSTPDADAQARAEANEAAG
FT                   LPDLRKINRPGAEVTSKVDFADIRRTPSFHEKSRNGTEVTEYRDRGKPVEINVKSNFGT
FT                   RYQMSSTPDTSPKPHDAGVPITRLPSVNLRY"
FT   sig_peptide     complement(15687..15764)
FT                   /locus_tag="Bamb_3236"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.995 at
FT                   residue 26"
FT   gene            15905..17431
FT                   /locus_tag="Bamb_3237"
FT   CDS_pept        15905..17431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3237"
FT                   /product="AMP nucleosidase"
FT                   /EC_number="3.2.2.4"
FT                   /note="KEGG: bur:Bcep18194_B2227 AMP nucleosidase; TIGRFAM:
FT                   AMP nucleosidase; PFAM: purine and other phosphorylases,
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3237"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88793"
FT                   /db_xref="GOA:Q0BAN0"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011271"
FT                   /db_xref="InterPro:IPR018953"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="InterPro:IPR037109"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAN0"
FT                   /protein_id="ABI88793.1"
FT                   /translation="MKNDLSRRHRMLMPESPPVEAFDDSVAAVARLSAIYDTNTGFLRD
FT                   AFARYRRHEPITEHVRACYPFVRIRTEVNTHVDSRRSYGFVAGPGVFETTVTRPDLFAN
FT                   YYREQLRLLAKNHHVKIEIGVSSQPIPVHFAFPEGIHLEGELDRDRLLAMRDIFDTPDL
FT                   SYLDDRIVNGTFEPQHGEPHPLALFTAARVDFSLHRLRHYTATSPTHFQNYVLYTNYQF
FT                   YIDEFVRLGRTMMTESDDPEVREYRSQYSAFVEPGDVVTYNANLGSEPVEGVAPPRLPQ
FT                   MPAYHLKRADGSGITMVNIGVGPSNAKTITDHIAVLRPHAWVMLGHCAGLRNTQRLGDY
FT                   VLAHGYVREDHVLDADLPLWVPIPALAEVQLALERGVAEVTRLEGAELKRVMRTGTVAS
FT                   VDNRNWELRDHREPVQRLSQSRAIALDMESATIAANGFRFRVPYGTLLCVSDKPLHGEL
FT                   KLPGMADTFYRGQVDQHLQIGVKAMEILRTNGLDKLHSRKLRSFAEVAFQ"
FT   gene            18272..18754
FT                   /locus_tag="Bamb_3238"
FT   CDS_pept        18272..18754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3238"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cvi:CV4137 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3238"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88794"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAM9"
FT                   /protein_id="ABI88794.1"
FT                   /translation="MSDVVIEFTSDTSRCIGVPTDSTTTGLVGENAPAQLRYLTDPLVQ
FT                   IVWDFKPALGCFVLDFSEVPGEPKLALDFKDGRVAAETPLVLRKYTGAISQRWSLTMRP
FT                   GYITSIANPNLVIDDHYDSTQANNVIWAFPFNKTQAQQWTLRRVLESVAAKVPRYA"
FT   gene            complement(18811..19905)
FT                   /locus_tag="Bamb_3239"
FT   CDS_pept        complement(18811..19905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3239"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: bur:Bcep18194_B2226
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3239"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88795"
FT                   /db_xref="GOA:Q0BAM8"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAM8"
FT                   /protein_id="ABI88795.1"
FT                   /translation="MEYVRLGMSGLKVSKLCLGCMTYGDPSWRPWVMNEEAARPFIRAA
FT                   LDAGVTFFDTADIYSAGESERILGRALRDFATRDDVVIATKAFFPTGDGPNARGLSRKH
FT                   LLASIDASLQRLGTDYVDLYVIHRFDPDTPIEETLDTLDAIVKSGKVRYLAASSMHAWQ
FT                   FMIMLAFQQHHGLARFVSMQSQYSLICRDDEREMLPLCTDAGIGYTPWSPLGRGLLAGS
FT                   RGADTTRASTDQQMVSWYDGRDTVAATVEAVRQAAQARGVPPASRLPGHCGDPASPRRS
FT                   SACRSRITWPMRSPRSTCAKPRCSRRRSTGRSNRCGGDQGHGDRVEPEVRRRMLRVDGG
FT                   VKPRSNDSAMPSNSLIYKGTLGSP"
FT   gene            19968..20335
FT                   /pseudo
FT                   /locus_tag="Bamb_3240"
FT   gene            complement(20508..20786)
FT                   /locus_tag="Bamb_3241"
FT   CDS_pept        complement(20508..20786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3241"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88796"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAM7"
FT                   /protein_id="ABI88796.1"
FT                   /translation="MQRSLIALAFAGLGLSLSGLAHAVNVDVNIGTPAPVVVAPAPVVI
FT                   VGWHGDRYWDGRRYWERREWEDHQRHRGHEGRGGYHCPPGHAKKGEC"
FT   sig_peptide     complement(20715..20786)
FT                   /locus_tag="Bamb_3241"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.988 at
FT                   residue 24"
FT   gene            complement(21187..21945)
FT                   /locus_tag="Bamb_3242"
FT   CDS_pept        complement(21187..21945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3242"
FT                   /product="conserved hypothetical protein 730"
FT                   /note="PFAM: conserved hypothetical protein 730; KEGG:
FT                   bur:Bcep18194_B2219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3242"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88797"
FT                   /db_xref="GOA:Q0BAM6"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAM6"
FT                   /protein_id="ABI88797.1"
FT                   /translation="MNKRKVIPSLRSLADQERATAKKARASWQMFTIMAEFIEATEYLS
FT                   EIRPAVSIYGSARLKPDTPHYKLAVQIARKLSDAGFAVISGGGPGIMEAANKGAHAGKA
FT                   PSVGLNIELPHEQAGNHFQDISLRFRHFFTRKVTFVKNSDAVIVMPGGFGTLDELSEVL
FT                   TLIQTKKSRLVPIILVGSAFWQGLLQWFRDQLIPMGLINPEDMNLMQVIDDPDQVLDAV
FT                   LAFYEDSGEEEGSDGDGQPPRPEEDRMFYL"
FT   gene            21947..24700
FT                   /locus_tag="Bamb_3243"
FT   CDS_pept        21947..24700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3243"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: bur:Bcep18194_B2218 DNA polymerase I; TIGRFAM:
FT                   DNA polymerase I; PFAM: DNA-directed DNA polymerase; 5'-3'
FT                   exonuclease; 3'-5' exonuclease; SMART: Helix-hairpin-helix
FT                   domain protein, class 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3243"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88798"
FT                   /db_xref="GOA:Q0BAM5"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAM5"
FT                   /protein_id="ABI88798.1"
FT                   /translation="MPEERNLEGKTLLLVDGSSYLYRAYHAMPDLRGPGGEPTGALYGI
FT                   INMLRRMRKEVSAEYSACVFDAKGKTFRDDLYADYKANRPSMPPDLALQVEPIHGAVRA
FT                   LGWPLLMVEGVEADDVIGTLAREAERHGMNVIVSTGDKDLAQLVSDRVTLVNTMTNETL
FT                   DRDGVIAKFGVPPERIIDYLALIGDTVDNVPGVEKCGPKTAVKWLSQYDSLDGVIEHAG
FT                   EIKGVVGDNLRRALDFLPLGRTLVTVETACDLAPHLESIEASLKTDGEARHLLRDIFAR
FT                   YGFKTWLREVESAPAEGGGADAPEGDPAPVIAADIVREYDTIQTWAQFDAWFAKIDAAA
FT                   LTAFDTETTALDPMTARLVGLSFSIEPGKAAYLPVAHRGPDLPEQLPIDDVLARLRPWL
FT                   ESADRKKVGQHLKYDAQVLANYGIALNGIEHDTLLESYVLESHRTHDMDSLALRHLGVK
FT                   TIKYEDVAGKGAKQIGFDEVALEQAAAYAAEDADITLQLHQALYPQVAREAGLERVYRD
FT                   IEMPVSLVLRKMERTGVLIDDALLQAQSTEIATRLIELEGQAYELAGGEFNLGSPKQIG
FT                   QIFFEKLQLPVVKKTPSGAPSTDEEVLQKLAEDYPLPKLLLEHRGLSKLKSTYTDKLPR
FT                   MVNPATGRVHTNYAQAVAVTGRLASNDPNLQNIPVRTAEGRRIREAFIASPGHRIVSAD
FT                   YSQIELRIMAHISGDASLLRAFAQGEDIHRATAAEVFGVTPLEVNSDQRRIAKVINFGL
FT                   IYGMSAFGLASNLGITRDAAKLYIDRYFTRYPGVAQYMEDTRTAAKDKGYVETVFGRRL
FT                   WLPEINGGNGPRRQAAERAAINAPMQGTAADLIKLSMIAVDDWLTRDQLASRMIMQVHD
FT                   ELVLEVPDDELSLVREKLPEMMCGVAKLKVPLVAEVGAGANWEEAH"
FT   gene            24980..26314
FT                   /locus_tag="Bamb_3244"
FT   CDS_pept        24980..26314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3244"
FT                   /product="NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bur:Bcep18194_B2217 NADH
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3244"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88799"
FT                   /db_xref="GOA:Q0BAM4"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAM4"
FT                   /protein_id="ABI88799.1"
FT                   /translation="MHRIIIVGGGAGGLELATRLGDRYGARANRPARALVTLVDRNPTH
FT                   IWKPLLHEVAAGSMDPFTQELEYAAQARWHGFEFQQGELTALDRTAKRITLSPVNDSDG
FT                   EELLPARDLEYDTLVIAIGSTTHFFGVQGAAQNAIALDTVGEAERFRKRLIAACMRAEH
FT                   QAPAQPAPGAAAEPRIQVVIVGGGATGVELSAELRNTAQVLSVYGLHKLDPRHDVGIVL
FT                   IESGPRILPALQERVSTATAELLEKLGVRLMLAERVTEVAPGVVHTASGKAVRADLTVW
FT                   AAGIKAPSVLSNLDGLQVNKLGQLDVRRTLQTFTDDNIFALGDCAACAWPGNERNVPPR
FT                   AQAAHQQASFLLKAIGCRLDGRPLPEFTYRDFGSLVSLGHFSAVGNLMGGLIGGNMLIE
FT                   GLFARFMYMSLYRLHIAALHGYPRMMLDTVAHWLRRTTLPRVKLH"
FT   gene            26721..27596
FT                   /locus_tag="Bamb_3245"
FT   CDS_pept        26721..27596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3245"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="KEGG: bur:Bcep18194_B2216 dienelactone hydrolase;
FT                   TIGRFAM: Twin-arginine translocation pathway signal; PFAM:
FT                   dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3245"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88800"
FT                   /db_xref="GOA:Q0BAM3"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAM3"
FT                   /protein_id="ABI88800.1"
FT                   /translation="MLKPEVDSLVPHVPFSRRKFMQAALGGTFAAAVLPVSAQTITTDS
FT                   AGLDVDTIEIRSGDASIPAYRAQPVDKTNLPVVIVIHEIFGVHEHIADVCRRFAKLGYL
FT                   AIAPDLFARQGNASKYPTIQALVEHIVSKVPDRQVTEDLDATVAWAGKNGGDLSRLGVT
FT                   GFCWGGRQAWLYAEHNPHVRAAVAWYGFVEGKTDEMTPFNPVDHAALLKVPVLGLYGEK
FT                   DTNITQASLADMRKAIQTSDSKLARQSEIVVYPDAGHAFFADYRPSYVKGDAEDGWKRT
FT                   IEWFHKYGVM"
FT   sig_peptide     26721..26837
FT                   /locus_tag="Bamb_3245"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.958) with cleavage site probability 0.915 at
FT                   residue 39"
FT   gene            complement(27648..28517)
FT                   /locus_tag="Bamb_3246"
FT   CDS_pept        complement(27648..28517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3246"
FT                   /product="3-mercaptopyruvate sulfurtransferase"
FT                   /EC_number="2.8.1.2"
FT                   /note="PFAM: Rhodanese domain protein; KEGG:
FT                   bur:Bcep18194_B2215 3-mercaptopyruvate sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3246"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88801"
FT                   /db_xref="GOA:Q0BAM2"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAM2"
FT                   /protein_id="ABI88801.1"
FT                   /translation="MPHTHYTTLISAANLAERLAAAPGSVAVFDCRFDLADPVAGEAAY
FT                   AAGHIPGAQYLHLDRDLSGRKTGTNGRHPLPTRDAFATLMASRGVKQGQQVVAYDAHGG
FT                   AYAARLWWLLRWLGHDSIAVLDGGLQAWEAAGQPLTTDVPHPPAGDFRAAAPLESTVDA
FT                   AAVLANVTSAQRVVIDARAPDRYRGENETIDRVGGHIPGARNRFFKDNLNADGRFKTGH
FT                   ELRETFTTLLAGTEPNSVILQCGSGVTACHNALALEVAGLHGASLYPGSWSEWSADPSR
FT                   PIATGPTP"
FT   gene            complement(28635..29741)
FT                   /locus_tag="Bamb_3247"
FT   CDS_pept        complement(28635..29741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3247"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   bur:Bcep18194_B2214 Rieske (2Fe-2S) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3247"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88802"
FT                   /db_xref="GOA:Q0BAM1"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAM1"
FT                   /protein_id="ABI88802.1"
FT                   /translation="MSNLSDALQLKSAHSQLPVTAYFDEALLEREIETLFKKGPRYVGH
FT                   ELMVPEAGDYFALPSEQEGRVLVRNQTNQIELLSNVCRHRQAIMLNGRGHAQNIVCPLH
FT                   RWTYDLEGQLLGAPHFPDKPCLNLGKSPLQKWQGLLFEAEGRNVARDLANLGTKHHFDF
FT                   SEYQFDHVEVHECDYNWKTFIEVYLEDYHVAPFHPGLGSFVSCDDLKWEFGDWYSVQTV
FT                   GVHNALAKPGSATYQKWHEQVLKFRNGVPPEFGAIWMVYYPGLMIEWYPHVLVVSWLIP
FT                   RGPQKTTNIVEFYYPEEIALFEREFVEAERAAYMETAVEDDEIAMRMDAGRRALMARGE
FT                   SQVGPYQSPMEDGMQHFHEFLRRHLGDL"
FT   gene            30012..30305
FT                   /locus_tag="Bamb_3248"
FT   CDS_pept        30012..30305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3248"
FT                   /product="Exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="TIGRFAM: exodeoxyribonuclease VII, small subunit;
FT                   PFAM: Exonuclease VII, small subunit; KEGG:
FT                   bur:Bcep18194_B2213 exonuclease VII, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3248"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88803"
FT                   /db_xref="GOA:Q0BAM0"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0BAM0"
FT                   /protein_id="ABI88803.1"
FT                   /translation="MAKTASPGATPPDNGTEPLPDNYEMALAELETLVARMEGGALSLE
FT                   DSLAAYRRGANLVAFCQQQLEKVEQQVRVLDGATLKPLSSGTAATDGEDDDL"
FT   gene            30302..31186
FT                   /locus_tag="Bamb_3249"
FT   CDS_pept        30302..31186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3249"
FT                   /product="farnesyl-diphosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG:
FT                   bur:Bcep18194_B2212 polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3249"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88804"
FT                   /db_xref="GOA:Q0BAL9"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAL9"
FT                   /protein_id="ABI88804.1"
FT                   /translation="MTFEQWMRSVLDRVEDALGHYLPAENVVPTQLHEAMRYAVLGGGK
FT                   RVRPLLCHAAGELTGATEAARNAAAAALEMIHVYSLVHDDMPCMDDDALRRGKPTVHVQ
FT                   YDEPTALLVGDALQSQAFVALTDADALSPVQQAALVRELALASGSIGMAGGQAIDLASV
FT                   GLKLTREQLEKMHRMKTGALLRAAVRMGALAGETPSAETLAALDVYAAAVGLAFQVVDD
FT                   ILDVTTDSATLGKTAGKDAANDKPTYVSILGLDASRELAAQLRAEAHDALKPFGARAQR
FT                   LAELADLVVNRVS"
FT   gene            31232..33172
FT                   /locus_tag="Bamb_3250"
FT   CDS_pept        31232..33172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3250"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="TIGRFAM: deoxyxylulose-5-phosphate synthase; PFAM:
FT                   Transketolase, central region; Transketolase domain
FT                   protein; KEGG: bur:Bcep18194_B2211
FT                   1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3250"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88805"
FT                   /db_xref="GOA:Q0BAL8"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0BAL8"
FT                   /protein_id="ABI88805.1"
FT                   /translation="MRARLISYNGTTMYDLLKTIDDPADLRRLDRRQLQPLADELRAFV
FT                   LDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRIVWDVGHQTYPHKILTGRRDQMHSL
FT                   RQYDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDRFSIAVIGDGAMTA
FT                   GMAFEAMNNAGVSEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERV
FT                   LSVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIRELRG
FT                   PQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSPTPAKKTYTQVFGEWLCDEA
FT                   ERDSRVVGITPAMREGSGMVEFEKRFKDRYYDVGIAEQHAVTFAGGLATEGLKPVVAIY
FT                   STFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFMRCIPNMTIMAA
FT                   SDENECRQMLHTALQQPNPTAVRYPRGAGTGVATVKEFTEIPLGKGEVRRRTSQPEGKR
FT                   VAILAFGTMVAPSLAAGEELDATVANMRFVKPIDAALVRELAETHDYLVTVEEGCVMGG
FT                   AGSACVEALMESGVIRPVIQLGLPDQFIDHGDPAKLLAQCGLDGAGIAKSIRERFLSPA
FT                   ADVADQAKRVA"
FT   gene            33327..34136
FT                   /locus_tag="Bamb_3251"
FT   CDS_pept        33327..34136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3251"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="PFAM: protein of unknown function DUF198; KEGG:
FT                   bur:Bcep18194_B2210 protein of unknown function DUF198"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3251"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88806"
FT                   /db_xref="GOA:Q0BAL7"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0BAL7"
FT                   /protein_id="ABI88806.1"
FT                   /translation="MNQMNPAFVMPDVQSTVDTRQIPIQRVGVKAVRHPLTVRTESGDV
FT                   QPTVGVWNLDVHLPADQKGTHMSRFVALLEDSREPLTVERFRAMLASMLVRLEAEAGRI
FT                   EVTFPYFVNKTAPVSGVQSLLDYEVTLAGESRNGETRLFLKVLVPVTSLCPCSKKISQY
FT                   GAHNQRSHVTIDAELAADLPVEALIRIAEEEASCELWGLLKRPDEKFVTERAYENPKFV
FT                   EDLVRDVAQRLDADERVVAYVLEAENFESIHNHSAYALIERDKRHAA"
FT   gene            complement(34237..35277)
FT                   /locus_tag="Bamb_3252"
FT   CDS_pept        complement(34237..35277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3252"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: bur:Bcep18194_B2209 O-sialoglycoprotein
FT                   endopeptidase; TIGRFAM: putative metalloendopeptidase,
FT                   glycoprotease family; PFAM: peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3252"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88807"
FT                   /db_xref="GOA:Q0BAL6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0BAL6"
FT                   /protein_id="ABI88807.1"
FT                   /translation="MLVLGIESSCDETGLALYDTQRGLLAHALHSQIAMHREYGGVVPE
FT                   LASRDHIRRALPLLEEVMAQSGTHRDDIDAIAFTQGPGLAGALLVGASIANALALAWNK
FT                   PTVGIHHLEGHLLSPLLVDEPPPFPFIALLVSGGHTQLMRVTDVGVYETLGETLDDAAG
FT                   EAFDKTAKLIGLGYPGGPEVSKLAETGTPGAVVLPRPMLHSGDLDFSFSGLKTAVLTQM
FT                   KKFEAAKLDGEALERAKADLARGFVDAAVDVLVAKSLAALKQTKLKRLVVAGGVGANRQ
FT                   LRAALSAAAAKRGFDVHYPDLALCTDNGAMIALAGALRLGRWPEQANADYAFTVKPRWD
FT                   LASLAR"
FT   gene            35409..36626
FT                   /locus_tag="Bamb_3253"
FT   CDS_pept        35409..36626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3253"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: HI0933 family protein; FAD dependent
FT                   oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG:
FT                   bur:Bcep18194_B2208 HI0933-like flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3253"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88808"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAL5"
FT                   /protein_id="ABI88808.1"
FT                   /translation="METYDIAVIGAGAAGMMSAAVAGQLGRRVVLIDHAPRLAEKIRIS
FT                   GGGRCNFTNLYAGPDNYLSSNPHFARSALARYTPRDFLGLLKRHHVTWHEKHKGQLFCD
FT                   HGSDAIIDMLKHECDAGGIAWRRPVVVDAVRHAADGFTLDTQQAGPIRARALIVATGGL
FT                   SIPKIGATDFGYRVAKQFGHKLIDTRPALVPLTFAQHDWEPFAALSGVSLEVRVSTGDK
FT                   KRGGEFVEDLLLTHRGLSGPGILQISSYWQSGDPIRIDLLPQRDAVADLLDAKRTSKRQ
FT                   IGSLLADWVPSRLAHVWLDTHRVAADARLADLPDKTLRQIGDALSGWTLTPNGTEGYKK
FT                   AEVTKGGVDTRELSSATMMSARVPGLFFIGEAVDVTGWLGGYNFQWAWASGTAAGQAAA
FT                   EFARGL"
FT   sig_peptide     35409..35477
FT                   /locus_tag="Bamb_3253"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.995) with cleavage site probability 0.971 at
FT                   residue 23"
FT   gene            36732..36944
FT                   /locus_tag="Bamb_3254"
FT   CDS_pept        36732..36944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3254"
FT                   /product="SSU ribosomal protein S21P"
FT                   /note="PFAM: ribosomal protein S21; KEGG:
FT                   bur:Bcep18194_B2207 ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3254"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88809"
FT                   /db_xref="GOA:Q0BAL4"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAL4"
FT                   /protein_id="ABI88809.1"
FT                   /translation="MTIIRVKENEPFEVAMRRFKRTIEKNGLLTELRAREFFEKPTAER
FT                   KRKKAAAVKRHYKRIRSQTLPKKLY"
FT   gene            37131..37577
FT                   /locus_tag="Bamb_3255"
FT   CDS_pept        37131..37577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3255"
FT                   /product="GatB/Yqey domain protein"
FT                   /note="PFAM: GatB/Yqey domain protein; KEGG:
FT                   bur:Bcep18194_B2206 conserved hypothetical protein,
FT                   GatB/YqeY family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3255"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88810"
FT                   /db_xref="GOA:Q0BAL3"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAL3"
FT                   /protein_id="ABI88810.1"
FT                   /translation="MSLKEQISEDMKAAMRAKESERLATVRLLLAAIKQREIDDQVTLD
FT                   DAGITAVIDKMIKQRKDSISQFQAAGRDDLVAKEQAELTVLGAYMPAQLSDAEVAAEVQ
FT                   AAVAATGAAGPQDMGKVMGVLKGKLAGRADMTAVSAQVKAALSK"
FT   gene            37642..39510
FT                   /locus_tag="Bamb_3256"
FT   CDS_pept        37642..39510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3256"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="KEGG: bur:Bcep18194_B2205 DNA primase; TIGRFAM: DNA
FT                   primase; PFAM: zinc finger, CHC2-family protein; TOPRIM
FT                   domain protein; DNA primase DnaG, DnaB-binding; DNA primase
FT                   catalytic core, N-terminal domain; SMART: Toprim sub domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3256"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88811"
FT                   /db_xref="GOA:Q0BAL2"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAL2"
FT                   /protein_id="ABI88811.1"
FT                   /translation="MIPHSFLQDLLNRVDIVDVVGRYVQLKKGGANFMGLCPFHNEKSP
FT                   SFTVSPTKQFYHCFGCGAHGTAIGFLMEHAGLTFPEAVQELAQSVGLTVPHEPSMRGGG
FT                   GGGGDYPAPVSKSVATALSDVMSVACDYYRKQLRGATVAIQYLKNRGLTGEIAARFGLG
FT                   YAPDGWQNLETAFPDYRDESLVESGLVIVSEKTDAQGVARRYDRFRERIMFPIRNVKGQ
FT                   VIGFGGRVLGSGEPKYLNSPETPLFNKGSELYGLFEARLAIRERKYVLVVEGYMDVVAL
FT                   AQLGFPNAVATLGTACTPIHVQKLLRQTDTVIFSFDGDSAGRRAARRALEACLPHAADN
FT                   RTIRFLFLPSEHDPDSYVREFGAEAFSEQVERAMPLSQFLLNEAIAGKALDQPEGRAKA
FT                   LFDAKPLLQALPANALRAQIMHMFADRLDIPFEEVAALSDVDARIAAPARHAPPRSERR
FT                   RVTDSEKRALRTLVMHPRIASQLDDEQLATLRALPRIGELFAEVVEHARALGDGAEFRL
FT                   LSDVLRTSSNGATYEEIFREILDYDENVRDLLLQNPEDETVPERQREQERIAGEELQAA
FT                   VLKMRYDACCDRLDRLARQSTFTPEELAELTELNQQRTDMKRRLGL"
FT   gene            39599..42016
FT                   /locus_tag="Bamb_3257"
FT   CDS_pept        39599..42016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3257"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; PFAM:
FT                   sigma-70 1.1 domain protein; sigma-70 region 3 domain
FT                   protein; sigma-70 region 2 domain protein; sigma-70 region
FT                   4 domain protein; sigma-70, non-essential domain protein;
FT                   sigma-70 region 1.2; KEGG: bur:Bcep18194_B2204 sigma 70
FT                   (RpoD)"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3257"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88812"
FT                   /db_xref="GOA:Q0BAL1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAL1"
FT                   /protein_id="ABI88812.1"
FT                   /translation="MAKTTGGKKATGKGSTEPTTKVTAAKSASSARTTSSATSAPGGKK
FT                   TAAGTAQAAPASAARTRAAARPDSGPAKPAAKRASAKSARDTTAAADETAVRTTHAPTV
FT                   QPAVVQQPRVDIAGTANSMTKKLNEVSVDDDANQSDEQPAPAAAPGKSKVRDRRAKEKA
FT                   LLKEAFATSTPGTAEELEERRVKLRALIKLGKERGFLTYAEINDHLPDNFTETEALEGI
FT                   IGTFNDMGVAVYEQAPDAETLLLNDNAPAASSDDEVEEEAEVALSTVDSEFGRTTDPVR
FT                   MYMREMGTVELLTREGEIEIAKRIEDGLRHMVMAISACPTTIADILAMAERVANEEIRV
FT                   DELVDGLLDPNASDSADTDGFSAKEAEAIENEDEEAEEEEEEEEEEEDDGAAQASANAA
FT                   QLEALKRASLEKFSQISEWFDKMRRAFEKEGYKSKAYLKAQETIQTELMTIRFTARTVE
FT                   RLCDTLRAQVDEVRQVERQILHIVVDKCGMPRSEFIARFPGSETDLDWAEKITAEGHSY
FT                   SAVLARNIPAIREQQQRLLDLQARVVLPLKDLKETNRQMAAGELKARQAKREMTEANLR
FT                   LVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIA
FT                   DQARTIRIPVHMIETINKMNRISRQILQETGLEPDPATLAEKMEMPEDKIRKIMKIAKE
FT                   PISMETPIGDDDDSHLGDFIEDNNTVAPADAALHASMRDVVKDVLDSLTPREAKVLRMR
FT                   FGIEMSTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSDKLKSFLEGN"
FT   gene            42155..42233
FT                   /locus_tag="Bamb_R0077"
FT                   /note="tRNA-Met1"
FT   tRNA            42155..42233
FT                   /locus_tag="Bamb_R0077"
FT                   /product="tRNA-Met"
FT   gene            complement(42358..43149)
FT                   /locus_tag="Bamb_3258"
FT   CDS_pept        complement(42358..43149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3258"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   xfa:XF1766 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3258"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88813"
FT                   /db_xref="GOA:Q0BAL0"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAL0"
FT                   /protein_id="ABI88813.1"
FT                   /translation="MSNTTAGKSIIQLNGAIALIMSLGLLVAGCHAAPTTTQESQQVTS
FT                   TSIASETLSTRQQAIVPIAAFAAKGDLARLNGALNQGLDAGLAVTDVREVLVQLYAYAG
FT                   FPRSLNALGELMKVLEARRQRGVEDAPGHAPSRPIPTGDALLSAGTAIQTRLAGGAVKG
FT                   PLFDFAPAIDEYLKTHLFGDIFERDNLDWQSREIATVAMLAAMPGVEPQLQAHMRISMN
FT                   VGLTESQLRQLGQVLADRVDADSATRAHEALDKQVAAKHER"
FT   sig_peptide     complement(43051..43149)
FT                   /locus_tag="Bamb_3258"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.998 at
FT                   residue 33"
FT   gene            complement(43127..43630)
FT                   /locus_tag="Bamb_3259"
FT   CDS_pept        complement(43127..43630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3259"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: bja:bll4598 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3259"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88814"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAK9"
FT                   /protein_id="ABI88814.1"
FT                   /translation="MKVSSLLKAILCVAACHVAATDAAEPQTAPASAAAQQVMHAGSQP
FT                   SIAGPAAYFTGKVRIDPVWAANGDINASGGLVTFEPGARSAWHTHPKGQYFVVVSGVGY
FT                   TQEWGKPIRELRPGDVVWCPPGVKHWHGAAPANAMTHLAVTGTVDGKNVEWMEKVTDEQ
FT                   YNGR"
FT   sig_peptide     complement(43559..43630)
FT                   /locus_tag="Bamb_3259"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.994) with cleavage site probability 0.816 at
FT                   residue 24"
FT   gene            complement(43648..44415)
FT                   /locus_tag="Bamb_3260"
FT   CDS_pept        complement(43648..44415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3260"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   pca:Pcar_1081 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3260"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88815"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAK8"
FT                   /protein_id="ABI88815.1"
FT                   /translation="MTITYDFSGQVALVTGAASGMGLAAARAFANAGASVALADIRADV
FT                   LDAATQELAAAGHRVIGVAGDISDEAYVKSLVEQTVKTFGRLDAAFNNAGIQSPAVETA
FT                   DVSSEVFDRINAINLRGVWLCMKYELIQMRSQGNGAIVNNSSLGGLVGVPGRAAYHATK
FT                   HGLLGLTKSAGLEYASQGIRINAICPGIVETPMVADMLKGEAAVMNEMMKDVPIGRLGT
FT                   AQEIADAVLWLCSPGSSFVVGVALPVDGGYTAR"
FT   sig_peptide     complement(44323..44415)
FT                   /locus_tag="Bamb_3260"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.985) with cleavage site probability 0.707 at
FT                   residue 31"
FT   gene            complement(45193..45942)
FT                   /locus_tag="Bamb_3261"
FT   CDS_pept        complement(45193..45942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3261"
FT                   /product="Creatininase"
FT                   /note="PFAM: Creatininase; KEGG: reu:Reut_B5123
FT                   creatininase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3261"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88816"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAK7"
FT                   /protein_id="ABI88816.1"
FT                   /translation="MLLHLSTWSEIEQFLTRSRTIVVPIGSNEQHGPTGLLGTDWLCPE
FT                   IIAREAEKSADILVGPTFNIGMAQHHLGFPGTISLRPSTFIAAIGDWTRSLVAHGFEKI
FT                   LFLNGHGGNVSSIDAAFSELYAEASFARRRAGFALKLCNWWDLEGVGELAREQFPTGHG
FT                   AHATPSEIAITQWAFPDSIKSADYAPPIANTGPIRDALDFRARFPDGRIGSDPGLATRE
FT                   KGRALVELAAQSLARELEAFGREPMPA"
FT   gene            complement(45955..47241)
FT                   /locus_tag="Bamb_3262"
FT   CDS_pept        complement(45955..47241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3262"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   reu:Reut_B5122 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3262"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88817"
FT                   /db_xref="GOA:Q0BAK6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAK6"
FT                   /protein_id="ABI88817.1"
FT                   /translation="MLAIPSESAVGDTSNLYSKINWRLLPFLLSCYLFAYLDRVNIGFA
FT                   KLQMQSDLGFSDAAYGVGAGIFFIGYVLFEIPSNLMLPRIGARKTFSRILVLWGITSAC
FT                   MLFVRNVPMFYAMRFVLGIFEAGFAPGMIYYLSCWYGPQRMARAIAVVFLAGPLGGIVG
FT                   GPVSAWLITALSGAGGLAGWQWMFLVEGLPCILLGVLALFFVPNRPADAAWLTEGEKRL
FT                   LANEIGSAAGHNHSFLAVARDVRVYVLAFAYFCIIAAIYAISFWLPTLIKAQGVSDTVQ
FT                   LGWYSALPYIAAAFGMYYMGRRSDRAGERRFHSAVPATIGGMLLAASTLVDGNLAASLV
FT                   LLTLGTCALWMTYTVFWAMPSEYIKGPGAAGGIALINTIGLSGGFWGPAIIGWAKTATG
FT                   NLHLGMLILATLPIIAALIILANKLPAKP"
FT   gene            47412..48335
FT                   /locus_tag="Bamb_3263"
FT   CDS_pept        47412..48335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3263"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: reu:Reut_B5121 regulatory protein,
FT                   LysR:LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3263"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88818"
FT                   /db_xref="GOA:Q0BAK5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAK5"
FT                   /protein_id="ABI88818.1"
FT                   /translation="MREINQQRLRYFRAVLEQGTIRGAAESLNTSPSVITRQIRLLEDE
FT                   LGATLFERQARGVRPTEAAAHLLEFWRGYRSHQERLEDQLHALKGLKQGQVQLVLSEGY
FT                   VDALVNEVLAPFCAQYPLLDIGMEILGVDQVLEAVAESRAHLGLAFNPPPHPRIEYLAS
FT                   SSQAVGLLVRSDHPLALRGGPASVEDMLSWPLAMMPASFGVGHAAKMLEFAENITIRPK
FT                   LVTNSLTALKQFVAYENYMTLIGGEFAAYREIAAGTLTVVPIDHPLFKGTQARLLAKAG
FT                   RPLPAAALKLLEHILRDMPMFAQGGE"
FT   gene            48569..49561
FT                   /locus_tag="Bamb_3264"
FT   CDS_pept        48569..49561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3264"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   cef:CE1569 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3264"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88819"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAK4"
FT                   /protein_id="ABI88819.1"
FT                   /translation="MSESDRSTAAGRTCCAPRRANSCEGVAASSSEPDRLAHLAPANAR
FT                   LPAENIIEFDGGPSWVGTDAPVIKADGEGPRRKVHLKPFGIERYAVTNDRFTEFVAATG
FT                   YRTDAERFGWSYVFDAFLEPDCVAEAPANVPWWRSVPGAYWAAPEGPLSSLDGRGMHPV
FT                   IHISWNDAAAFARWCGGRLPTEAEWEHAARGGADARRFPWGDEEPVEDALCCNIWQGRF
FT                   PDRYSGGDRAFGTVRVDAFAANPAGLYNCSGNVWEWCVDPFHVRSLSSAGKARDRQAVS
FT                   EREYTLKGGSYLCHRSYCYRYRIAARTGRPTDTSAGHTGFRVAYDLTRK"
FT   gene            complement(49604..50224)
FT                   /locus_tag="Bamb_3265"
FT   CDS_pept        complement(49604..50224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3265"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bma:BMAA1492
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3265"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88820"
FT                   /db_xref="GOA:Q0BAK3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013573"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAK3"
FT                   /protein_id="ABI88820.1"
FT                   /translation="MQIVRQAQQERSEQTRAEILAIALEQFSTRGFDAVSVRDIADVAG
FT                   VNHAMIRYYFGSKDNLWRESVTFLFDRFMEEAKPPGSDVGRISLDVVKEYIRNYVRYCA
FT                   KYPEHARLMMQEANRDSERLKWMAQTFIRPRHNLTIPLIEHVSAQTKGLEKIDPITLLY
FT                   MITAIAQIPYLLTAEIKYAHGINALREKAVEAHCEAVLAFVFR"
FT   gene            50440..52635
FT                   /locus_tag="Bamb_3266"
FT   CDS_pept        50440..52635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3266"
FT                   /product="Beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="PFAM: glycoside hydrolase, family 3 domain protein;
FT                   KEGG: mpa:MAP3625 beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3266"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88821"
FT                   /db_xref="GOA:Q0BAK2"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAK2"
FT                   /protein_id="ABI88821.1"
FT                   /translation="MKRVLMTPVDRDAGIEFSNPVLQSSLSSPMAALADPDERAREVEA
FT                   RMTDDERFSMLYSLMVRIFGTNARESRVPAHVPDIAGYVHGVPRLGIPPLLLADTSLGV
FT                   RATHDVNETATALPAGLALGATFDPMLATAAGTLIGKEMRERGFNVALGCGINLVREVR
FT                   NGRNFEYLSEDPLLSGKLGAGMVSGTQAEGVIALVKHVSLNASETNKFFLDAIIDPAAH
FT                   RESDLLAFQIAIETGRPGALMGAYNLVNGEYACGNKQIIQDTIKDAMGFEGWVMSDWRA
FT                   VNSWDYSLKGLDQHSGAQLDECEWFNEPLRRAFDEGRIPRTRIGEMVQRMLRSYFAVGI
FT                   DRPSAAEPVDAAAHNDVALEIARKGIVLLQNRDAMLPLAPTVRRIALIGGFAQVGVLSG
FT                   SGSSQVRPRGGYAAEIPFRSHPLLGATSMCFFGPSPLAQLRARLPGATIDFDSGAHIAD
FT                   AVALAEKAEVVIVNAIRHEGERFDCPDMTLPYGQDALIEAVARVNPNVVVVLQTGNPIA
FT                   MPWRDKVRSVVPAWFPGQAGAQAIAEVLTGEVNPSGRLPVTFPVSVDQTPHPRLPGADV
FT                   ELGTPIQVRYHEGAEVGYRWFAQQGDMPMFAFGHGMSYTDFAYSDFSVSGGDTVTASFT
FT                   VTNTGPRDGDDVPQLYLTHAAEATRMRLLGFEHVWLSAGGSVRVNMVADPRLLGCFDAT
FT                   SGRWRIAEGDYRIVLARSAAHHVVDATVRLEHREFGR"
FT   gene            52783..54030
FT                   /locus_tag="Bamb_3267"
FT   CDS_pept        52783..54030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3267"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ccr:CC2315 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3267"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88822"
FT                   /db_xref="GOA:Q0BAK1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAK1"
FT                   /protein_id="ABI88822.1"
FT                   /translation="MDELVLAAPGRRSRGHLGITLTLAFIGVWLALIPYPMMILPMLAE
FT                   RIAPLDKANVLAQAIGVGAIVGSIAQPIFGLLSDHTRARWGMRKPWIFGGAVAGMGAMA
FT                   ILATAGSPAQLALGWALMALSFNATLSGLNAILPDQVPPARLGFFSSIVGFTPPIGILL
FT                   GVWIVRQLAPDLVSVAMLQGAIAFTAITCFVVFANDRRLEEGHVKRLQWKRLAACFWTN
FT                   PIKHPDFAIAWLSRALVLFGVSCLQHYLMFYLRDRIGLSQQETPHAMFMCLLVATAAMT
FT                   VSALLFGRLSDRLQRRKVFVFVAGVGMAFGLLALLACTTLAQLLGVIVWIGLAQGAYLA
FT                   VDLALVTEVLPDPDTAAKDMGVFHLANVLPQFVLSLLVTWLTLPGGAIRYDTLFVTASC
FT                   ATALGALVIIFIKAVR"
FT   gene            54062..55549
FT                   /locus_tag="Bamb_3268"
FT   CDS_pept        54062..55549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3268"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: aor:AO090023000342
FT                   arylsulfatase A and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3268"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88823"
FT                   /db_xref="GOA:Q0BAK0"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAK0"
FT                   /protein_id="ABI88823.1"
FT                   /translation="MTKQPNFVVIVADQLRADCVHAVHPSTQVRTPNLDRLAADGVAFA
FT                   QAFGQHSVCSPSRVSFLSGHYPHVGGHRTLGHLLGPHEPNFLRVFKESGYHVAMAGGRG
FT                   DSFAAGATELSMHEHGFLPEETRRSAGEFLRSKTQGDPSDPMVRAFYRGQRTQDQANVE
FT                   YDEVVVKTAEHWLKSPPREPWVLYVPLFAPHPPFEAEEPWFSMYDRETVPERVAGSGRM
FT                   PAYVDALTKAHGWDRMTDAQWRELRAVYYGMVSRLDHHVGRIVDAARQATEPEWLITTF
FT                   FSDHGEYLGDFGLAEKWPSGVHECLLRNPLIVSGVSAPGVAGTVSDALVEMIDVFPTLL
FT                   DLAGLEATHAHYGRSFVQCLRETGAPHREKVFSEGGFLVREADHFENAGFPYDIKGTQQ
FT                   REHPESVGKVAVVRTLEWTYVWRLYEGPELYRRTNDPNETTNLAGMPEYAEIEADLLAS
FT                   LLRWQVETADVLPAGKGARFPVVDLPRPGEWREQQER"
FT   gene            55728..56750
FT                   /locus_tag="Bamb_3269"
FT   CDS_pept        55728..56750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3269"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG:
FT                   bur:Bcep18194_B3027 outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3269"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88824"
FT                   /db_xref="GOA:Q0BAJ9"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAJ9"
FT                   /protein_id="ABI88824.1"
FT                   /translation="MSGYTYAQSSVTLFGTVGGGVRWTDGVQGGHQIGFDSNSISGNSF
FT                   GIRGVEDLGAGWRAIFMLQSGFITGTGGTKASSTFFSQRAYVGLEGGFGRLMLGRQLNA
FT                   AEDIGVQLDPIEANGPSLATVPGIVWGGNFFTLDARFNNTIKYVGRSGGFTLRASYSPG
FT                   GVAGNTRAGTNFAVGTSYQFRTLLLAAAYQKTYNASASQHAETAMGGATWQLGPTRMYL
FT                   SYSALKVSAATAAGAERRDHVPSIGLVYRVTPTLQFTGATYYDIATNLKNVAGADGRKM
FT                   TTYAMVEYFLSKRSELYVEFDRNGFSGAYKKDPTNVSALNLRPDGRAVTGVSIGMITQF
FT                   "
FT   gene            56763..57182
FT                   /locus_tag="Bamb_3270"
FT   CDS_pept        56763..57182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3270"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; KEGG:
FT                   bur:Bcep18194_B3026 transport-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3270"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88825"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAJ8"
FT                   /protein_id="ABI88825.1"
FT                   /translation="MQGRARTRSTIGASIRRGGCMHVRVMVCRAAVATALTVLAASAAA
FT                   QERQAEPALSSMPAAAPTKAQKAADRQLRKRVARALGRAKRLDASRLLIFVRGDVVTLS
FT                   GDVADSEQSALAIATAQRVPGVGEVRNQLRIRTRN"
FT   sig_peptide     56763..56900
FT                   /locus_tag="Bamb_3270"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.967) with cleavage site probability 0.758 at
FT                   residue 46"
FT   gene            57216..58838
FT                   /locus_tag="Bamb_3271"
FT   CDS_pept        57216..58838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3271"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: sty:STY0919 probable
FT                   sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3271"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88826"
FT                   /db_xref="GOA:Q0BAJ7"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAJ7"
FT                   /protein_id="ABI88826.1"
FT                   /translation="MKAILVMYDSLNRHMLPPYGNEWVKAPNFQRLAERSATFDNCYIG
FT                   SMACIPARRELHTGRYNFLHRSWGPLEPFDDSMPNMLRREGIHTHLASDHPHYWEDGGA
FT                   TYHTRYSSWEFFRGQEGDPWKGQIRQPPIPARLKGALNEKAARQDFVNRQYYPTEDLHP
FT                   QTLTFDAGEAFIRENHDADSWLLQIETFDPHEPFTSYPKYRDLYPRTNTDAHFDWPPYG
FT                   PVSGNETDDDIRHARSEYAALVSMCDHSLGRILDLMDELNLWQDTMLIVCTDHGYMLGE
FT                   HGWWAKTAQPWFDELAHTPLFIWDPRSRRAGVRRQSLVQMIDIAPTLLDFFGVQATPRM
FT                   QGVALAKTVDEDLPVREAALFGMHGEHVNVTDGRYVYMRSGPDPDRNVPVYEYTLMPTH
FT                   MREMFSVDELQDIELAPPFPFSQGVSMMKIASRPIGYSYRAGTLLFDLQTDPGQAQPLY
FT                   DAAVEQRMATLARDLMRASDAPAEQYERLGLPAAGPIDHDQLLARAHADRSEALRLHLA
FT                   TRAQAMRAEVEGRRVRAEASPDH"
FT   gene            complement(59028..60632)
FT                   /locus_tag="Bamb_3272"
FT   CDS_pept        complement(59028..60632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3272"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin; KEGG: bur:Bcep18194_B2199 pseudomonalisin"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3272"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88827"
FT                   /db_xref="GOA:Q0BAJ6"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAJ6"
FT                   /protein_id="ABI88827.1"
FT                   /translation="MAPGESVDIVLGLNLRNEAQLDQYLRDLHTPGSPHYKQFLTPAQF
FT                   AAQYAPTDQQVASVVEHLRKAGFVNVVVAPNRLLVSASGTAATIKSAFRTTLKRFTHNG
FT                   RSVYANTDAAQVPNAIGGIVGAVLGLQNVELMHTGAGSKPQGNTSNLTIPAGASAVPHN
FT                   PTEFSSLYGGDGTPTASQTTVGIISEGDLSQTVSDLNTFAANNGLGTISSSVVHTGPSG
FT                   SSYTDTSGTVEWNLDSQSIVGTAGGSVKQVLFYVAPSMTLTAITAAYNKAVSDNVAKVI
FT                   NVSLGVCESSAYSTGSQATDDTIFKQAVAQGQTFSVSAGDHGAYECASGKPSRSTYTVS
FT                   EPATSPYVIAVGGTTLFTNTSTNAYNSEIVWNDPSWQSGTVWSTGGGYSKYEAAPSWQS
FT                   SSVTGSTKRALPDVGFDADLRTGAILVVNGQTSDTLWGSGYLNNEGGTSLAAPIFTGIW
FT                   ARLQSANNNALGFPASSIYKYFPSNAAVLHDVTSGNNGSGTYGYNAKAGWDATTGFGSV
FT                   NISKLNTFIQSTSDFAR"
FT   gene            complement(60697..61320)
FT                   /locus_tag="Bamb_3273"
FT   CDS_pept        complement(60697..61320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2198 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3273"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88828"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAJ5"
FT                   /protein_id="ABI88828.1"
FT                   /translation="MIPSDASNLTHCKPRNRFRSTHFASAAPKFSPPTASHPSAHATSR
FT                   CNSLGSCRPAAGRRTEPNEQNTEAVALAIPPASSLLARPTRNAAQRHHYLAFKHFAPGG
FT                   HHLSGSGERPRRVRAIRASAADIGGTRSEPPSTVVVHAVRCSTGGVIQNESGCRQETKA
FT                   HPHRQARVRRRGSRFVRHDGRPCRTGRRLDGNAHQGIPAARPAG"
FT   gene            complement(61569..63056)
FT                   /locus_tag="Bamb_3274"
FT   CDS_pept        complement(61569..63056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3274"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bur:Bcep18194_B2193 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3274"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88829"
FT                   /db_xref="GOA:Q0BAJ4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAJ4"
FT                   /protein_id="ABI88829.1"
FT                   /translation="MKPFSLPRRPALTLCAAACLLAGCTVGPDYRGAPAAPDAPTFVRA
FT                   PATGVDSTAPAPSAWWHALGDRQLDDLIAAALAHNPDLQAAQARLRASRAQLSQQRAAQ
FT                   LPKSSATVAAIRAREPDVSALGSMLPSGNSNQSGGSSPSLGGSGPLQLYSAGFDATWEI
FT                   DLFGGTRRAVEAASAQAEAVDADLADTQVSIAAEVATAYVDLRDQQQRLALSQRTAELQ
FT                   QQMLELTQQRRARGVAADVDIERLTTQVENTRASLIPLDAQVTESLDRLAILTGRAPGA
FT                   LDAALSASGTPLPTLPGSVPVGDPAALLKQRPDIRAAERRLASSNAQVGEHIADYFPKV
FT                   TLLGDLGFSATDPGHLFRKQNFTWIGAPYLQWNILDFGRTRGAIRAAEASRDEAEANYQ
FT                   KAVLGALQDANTALQRYGHQREHVIALAKVQTSATHSATLMDQRYRAGVASTIDLLDTQ
FT                   REALAAQQNVIAGKAELVKDYVSLQKSLGLGWQTNAG"
FT   sig_peptide     complement(62976..63056)
FT                   /locus_tag="Bamb_3274"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.953) with cleavage site probability 0.362 at
FT                   residue 27"
FT   gene            complement(63070..64656)
FT                   /locus_tag="Bamb_3275"
FT   CDS_pept        complement(63070..64656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3275"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B2192 drug resistance transporter EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3275"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88830"
FT                   /db_xref="GOA:Q0BAJ3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAJ3"
FT                   /protein_id="ABI88830.1"
FT                   /translation="MADTAATPPAPPHEGRASVTDWIAVAAGALGALMATLDISITNSA
FT                   LPQIQGEIGATGTEGTWISTGYLMSEIVMIPLAAWLTRVFGLRNFLLTNAALFIAFSMM
FT                   CGWSNSLAMMIAGRIGQGFTGGALIPTAQTIIRTRLPLSQLPVGMTLFGLIVLLGPLFG
FT                   PVLGGWLAENVSWSWCFFLNLPVCLLLMALLVFGLPSDRPQWNTFFNADWLGIAGLAIG
FT                   LSSLTVVLEEGQRERWFESQMIVTLSCVSLAGMILIALSQRFAQRPIMRLSLMRNPRYA
FT                   SVIVIVSAVGAGLYGVSYLLPQFLAIVAGYNAEQAGAIMLLSGLPAFLVMPILPRLLGK
FT                   VDFRVLVISGLLLFCLSCMLDIGLTAQSVGHDFVWSQLIRGVAQMLAMMPLNQASMAAV
FT                   AREDSGDAAGLYNMARNLGGSIGLAIIGTVIDRRTTFHAAALRESVSANSLIGQERLSA
FT                   YAANWFANTGDLAYSHLRALGQLAQQIQIQAIVMTYSETFYLLGLALLACVPLALLLKT
FT                   PRGPQPMSSGH"
FT   gene            complement(64649..65767)
FT                   /locus_tag="Bamb_3276"
FT   CDS_pept        complement(64649..65767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3276"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   bur:Bcep18194_B2191 secretion protein, HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3276"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88831"
FT                   /db_xref="GOA:Q0BAJ2"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAJ2"
FT                   /protein_id="ABI88831.1"
FT                   /translation="MSTSHPPSLKENRQGTASPRNVGSRRRRILTAVAVVAAIGGAVAL
FT                   GRWWTVGRFIESTDDAYLQADNMTAAPKVAGYVTDVYVRDNQVVKAGDPLVRLDVRQYQ
FT                   VALAQSTATVDARRADIARAEADISQQRANLEQAEAQAKVSQINARHSSDEYARYAPLA
FT                   ATGAETHERVADLKSTRDQAAATLAANTASIAAARTQIASFTAQLQQARAQLEAAQASA
FT                   AQARLDLDNTIVRSTLDGRVGDRTVRVGQYVQPGTRLLTVVPVNAIYLVANFKETQIGR
FT                   MRIGQPVELHVDALPDDTLSGTVDSFAPGTGAQFALLPPENATGNFTKIVQRVPVRIRL
FT                   AANARAPRMLVPGLSVTVDVDTRPDGNEKRHG"
FT   sig_peptide     complement(65633..65767)
FT                   /locus_tag="Bamb_3276"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.824) with cleavage site probability 0.543 at
FT                   residue 45"
FT   gene            65860..66687
FT                   /locus_tag="Bamb_3277"
FT   CDS_pept        65860..66687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3277"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG:
FT                   bur:Bcep18194_B2190 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3277"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88832"
FT                   /db_xref="GOA:Q0BAJ1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015292"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAJ1"
FT                   /protein_id="ABI88832.1"
FT                   /translation="MNEAKKLRRTSTGGYARGDETRRRIIDAAIELFGEHGFAGASTRD
FT                   IAAKAGVNAPALQYYFENKEGVYRACVEAIAEIGWSVLGPAVEHARAALDAEADVDALI
FT                   DAFIVILRTLADRIFTVPKTLGQRMFFAREQVGQEPAGATDILMKRVRKPLNDVSAELV
FT                   GRISGRPADDPVTRLRTMSLFGQLTVFHLVQRSALQLLDWDGFDGEGGALLMGTIADQT
FT                   RVLLEHWHAQRGAIVDEAPVALRRGAGVKRAAKPAASTAAAKRVPRAKKPAAR"
FT   gene            complement(66701..69295)
FT                   /locus_tag="Bamb_3278"
FT   CDS_pept        complement(66701..69295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3278"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   bur:Bcep18194_B2189 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3278"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88833"
FT                   /db_xref="GOA:Q0BAJ0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAJ0"
FT                   /protein_id="ABI88833.1"
FT                   /translation="MPESNIHRRNYSAARAIMLTSVHRPDRRATLRRAPARLLMRHFLL
FT                   GWLLAAVVSAAHAAAPAHAAASAASGAVPALTPQQAQQALSVLQNPREREQVETTLRAI
FT                   AAVGVLSTPALPASGAVPASAASAAATPAALTTNGLASLVVRQGSRWAAQIGGALRESL
FT                   SSLLDVGSVGNWWHERLVRPDARADLTRAIGIILAVLVPAFVIEWFARRLLRRALAALS
FT                   ARRAESSRVAEDEPAGPAEPAGSEPPGPDDHTPPASTIDAAARADGTGRPDTSSQGRGH
FT                   ARRNTTLLRRMPRALISLALRVVPLLVFVGVASLTMSLLDDAGTPTEIALESLIDIYVI
FT                   CRLVTIVSRLFFQPDAPQLRLLHISDAWAAFAQRSIARIAIVLGACTSAVELAGSFGLS
FT                   DAGHVALLKAVALVGHLMISALILRCRQPVAARIRAAGDERPAFAVISNALADAWAPVS
FT                   VFVVMALWFVWALDVHNGYRVLITLGGRSIAVMVGMRIVSIVVFGALARLFQRRDDDRT
FT                   LVHLHAYRYYPLMRQIVSAVIAVVTVVLLLQTWGVPIFHAFGTGTIGHRLASALITIAI
FT                   AAVVALLVWEAANIAIERRLQLWTREGNLVRAARLRTLLPMLRSLLFILIALVVVLTGL
FT                   SEIGVNIGPLLAGASIFGVALGFGSQKLVQDFITGIFLLMENAMQVGDWVTLAGVSGTV
FT                   EYLSIRTVRLRGGDGSLYTIPFSSVTTVNNTNRGLGNAAVKVSIAYGQDIDLAIATLKE
FT                   IGAALRDDPNYKDGILSDFSYWGIDQVDGAMIALAGQIQCKDSARWGVQREFNRRIAVM
FT                   FRERGIRIANPQRSLVAYDEGSRPVGPEYDGDAADMPAADTHPAPPPERKPN"
FT   sig_peptide     complement(69101..69295)
FT                   /locus_tag="Bamb_3278"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.998) with cleavage site probability 0.562 at
FT                   residue 65"
FT   gene            complement(69333..70298)
FT                   /locus_tag="Bamb_3279"
FT   CDS_pept        complement(69333..70298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3279"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG:
FT                   bur:Bcep18194_B2188 flavin-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3279"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88834"
FT                   /db_xref="GOA:Q0BAI9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR020020"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAI9"
FT                   /protein_id="ABI88834.1"
FT                   /translation="MDMPLPAFDRADVAHRVFSAERLSIGLTLPLLRSGHTVADFNEQL
FT                   ELAALADSLGFRALWIRDVPLNSADYPDPVGHLDPWVLLGALAARTRRIVLASGAIVLP
FT                   LRHPLHVAKGALSVATLSGGRFILGLGSGDRPPEYAAFGVDAQTRRDRYRRHWDIVAAA
FT                   LAVPSRVVPDETPPDAPEFTLLPRGDDAVPMLAVGSGGQSVDWIARNAIGWMTYHRDPD
FT                   TQRARHSMWRAAVERLAQPAFRAFGVSMRLDLDANRDAPAIALSLGYATGRNALIGILR
FT                   DMRAAGTHHVTLNPGSDRPVREVIEEIAEYVLPVFHDEPG"
FT   gene            complement(70347..70652)
FT                   /locus_tag="Bamb_3280"
FT   CDS_pept        complement(70347..70652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3280"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88835"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAI8"
FT                   /protein_id="ABI88835.1"
FT                   /translation="MTPMQIARQWQCVNVSKVKRRETARESDGEVAGVGTHAPAVRSRP
FT                   HDADGLLTIARRWPRSSRGGWSPAPDPASRHVAERLGLAPQGTTLQIDASRTSRTR"
FT   gene            complement(70649..71062)
FT                   /locus_tag="Bamb_3281"
FT   CDS_pept        complement(70649..71062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3281"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88836"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAI7"
FT                   /protein_id="ABI88836.1"
FT                   /translation="MRPRFARRHDDPEVMVAICMHRRFIPDDRPAIVGLARHACTSSFR
FT                   TNPVGSDGMEGRALTSPQSTATRSHGQVGDSCLQHGALRFGLFSFCCPRLLYVRPTEAI
FT                   ARPLLHPRSRSRQIQICKERTMLHCARLRGPMK"
FT   gene            71189..71395
FT                   /locus_tag="Bamb_3282"
FT   CDS_pept        71189..71395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2183 NAD-dependent deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3282"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88837"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAI6"
FT                   /protein_id="ABI88837.1"
FT                   /translation="MCCQLIHYPDGSIVEAPVTMWSMGVFFCAPVSRADRRPDRAAFCI
FT                   MCWRAGRPCGARSAAAPEHAPPT"
FT   gene            71392..72288
FT                   /locus_tag="Bamb_3283"
FT   CDS_pept        71392..72288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3283"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: bur:Bcep18194_B2183 NAD-dependent deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3283"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88838"
FT                   /db_xref="GOA:Q0BAI5"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAI5"
FT                   /protein_id="ABI88838.1"
FT                   /translation="MNDTTLHDPSSASVDPAALDALHTFVERHPRLLVLTGAGISTDSG
FT                   IPGYRDHNGQWMRSPPIQLHEFLGSDTARRRYWARSMIGWPVVGRAQPNRSHVALARLG
FT                   GAGRIERLVTQNVDGLHQRAGSGDVIELHGGINHVTCLDCGAHHARATIQTVLETDNPE
FT                   LLGAQAEPAADGDAHLEWAALDTFRIPACPACGGLLKPAVVFFGENVPRERVALASQAL
FT                   DAADALLVVGSSLMVYSGYRFCVWAQARNKLVAALNLGRTRADPMLTLKVEARCAPALD
FT                   ALNARLGVCGGAPEHAS"
FT   gene            72285..72926
FT                   /locus_tag="Bamb_3284"
FT   CDS_pept        72285..72926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3284"
FT                   /product="protein of unknown function DUF938"
FT                   /note="PFAM: protein of unknown function DUF938;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   bur:Bcep18194_B2182 protein of unknown function DUF938"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3284"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88839"
FT                   /db_xref="InterPro:IPR010342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAI4"
FT                   /protein_id="ABI88839.1"
FT                   /translation="MTGPTSSPDPSARLSAPAAERNRGPILDVLRRVLPASGSVLEIAS
FT                   GTGQHAVHFAQALPGLRWQPSDPDAHARRSIAAWVAHAGLANLAEPLAFDVRDASWPAA
FT                   ALDAIVCINMIHISPWACTDALFDGASRALRPGGVLFLYGPYRREGRHTAPSNAAFDQQ
FT                   LRSRDPSWGVRDLEAVVALGLDRGLDCTEVIEMPANNLSVVFRRLPHAEQ"
FT   gene            73024..74436
FT                   /locus_tag="Bamb_3285"
FT   CDS_pept        73024..74436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3285"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /note="KEGG: bur:Bcep18194_B2181 6-phosphogluconate
FT                   dehydrogenase; TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   domain protein; 6-phosphogluconate dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3285"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88840"
FT                   /db_xref="GOA:Q0BAI3"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAI3"
FT                   /protein_id="ABI88840.1"
FT                   /translation="MGKQAIGVIGLAVMGRNLALNIESRGHAVSVYNRSRAKTDELIAE
FT                   FPGRNLVPTYTLEEFVASLETPRRILMMVKAGEATDATIASLKPLLEKGDVLIDGGNTH
FT                   FTDTIRRNQELAQSGLHFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILKQIAAKA
FT                   PSDGEPCVAYMGPDGAGHYVKMVHNGIEYGDMQLIAESYAVLKDVAGLTNDELGAVYTE
FT                   WNQGELDSYLIEITSKIFGKKDDATGKHLVDVILDRAAQKGTGKWTSQNALDLGVPLPL
FT                   ITESVFARVLSSLKTERVAASKILSGPAAAPFDGDRAAFIEAVRRALYLSKVISYAQGF
FT                   AQLRTASEEYGWSLDLGTIAKIFRAGCIIRARFLQKITDAYAKDPALANLLLDPYFKDI
FT                   AANYQASLRDVVVAAVKAGVPVPAFASAVAYFDSYRSERLPANLVQAQRDFFGAHTFER
FT                   TDKPGSFHANWS"
FT   gene            74635..74979
FT                   /locus_tag="Bamb_3286"
FT   CDS_pept        74635..74979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3286"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3286"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88841"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAI2"
FT                   /protein_id="ABI88841.1"
FT                   /translation="MKSLIATFAAAAVLAVPAVSFAQQNAPVTRAQVKAELAELQQAGY
FT                   KLGSDRTDYPAGIQAAEARLSPQQNVAAADTSGYGAQSAAQQESGAPAAAKTGWQVKRV
FT                   SDGAPVYKGR"
FT   sig_peptide     74635..74703
FT                   /locus_tag="Bamb_3286"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.991 at
FT                   residue 23"
FT   gene            complement(75091..75411)
FT                   /locus_tag="Bamb_3287"
FT   CDS_pept        complement(75091..75411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3287"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3287"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88842"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAI1"
FT                   /protein_id="ABI88842.1"
FT                   /translation="MNNATFLSVQLNAEDFAGSSGLVELLNRHLVFATDVAEAADALVQ
FT                   LASVAHLSGATRHSVELPVLAIERLREALDTLSGYDEAWLQALEPAEALFRDIGRGPRP
FT                   LH"
FT   gene            75826..76557
FT                   /locus_tag="Bamb_3288"
FT   CDS_pept        75826..76557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3288"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: Peptidoglycan-binding LysM; peptidase M23B;
FT                   KEGG: bur:Bcep18194_B2178 peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3288"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88843"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAI0"
FT                   /protein_id="ABI88843.1"
FT                   /translation="MRETIPIHEALARWLPQAALIVAAAALTGCTMTPWTDSWQPVRPS
FT                   TPMSAATPGVIAGYYRVNPGDTLAGIAAAYGQRVQDLASWNRMSPNDAVSPGQVLRVAP
FT                   PPAATSLGQPSTAAQPGSLAWPATGSVAAPFSAGRTRGITIAASGPDHSVRAAANGRVV
FT                   YAGSGVKAYGPLVILKHDNGLITAYGHNGRLLVNEGDAVRVGQPIAEMGTDASGRSTFE
FT                   FEVRQNGKVVDPMNFLPRNGG"
FT   gene            complement(76606..77316)
FT                   /locus_tag="Bamb_3289"
FT   CDS_pept        complement(76606..77316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3289"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3289"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88844"
FT                   /db_xref="GOA:Q0BAH9"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAH9"
FT                   /protein_id="ABI88844.1"
FT                   /translation="MENPHRARRWLWHDEAFVRRCAGIMSKAFFVAAYRLIAALLAVST
FT                   TLHSVADYWAMPTFHLGNYLSYFTQLSSLYAAVMLIAGLSRVTRPGSARYESMRGAAVL
FT                   YMLITAIVYELLLARLDALLHVTPALNNWVLHRIVPLVVLCDWLYVEPRSPIPWRSALA
FT                   WLAFPIVYLGYTLVRGSVENWYPYPFVDPRPHGYLPVAIQCSLIALGATGLAVGIRWLG
FT                   NHARQSDATELKEG"
FT   gene            77476..78012
FT                   /locus_tag="Bamb_3290"
FT   CDS_pept        77476..78012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3290"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: bur:Bcep18194_B2176
FT                   cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3290"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88845"
FT                   /db_xref="GOA:Q0BAH8"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAH8"
FT                   /protein_id="ABI88845.1"
FT                   /translation="MRNILAKQTRYSSPAIFFHWIIFLLVVLAYLAIEIRGPKGSDSRA
FT                   FWMNVHLLAGTSVLVLSVLRVLWRVVSRVPEPIVQAPLLKWLSKLAHFALYLFIIAQPL
FT                   LGIMMINMGGKPVSLDWIGVSFTLFGPDKALRPTIKEVHELLGNAFYFVIGLHALAALY
FT                   HHFVRRDDVLRRMAP"
FT   gene            78169..78537
FT                   /locus_tag="Bamb_3291"
FT   CDS_pept        78169..78537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3291"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88846"
FT                   /db_xref="InterPro:IPR021333"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAH7"
FT                   /protein_id="ABI88846.1"
FT                   /translation="MLHRHRHLTAWLGVFAIWLAIAAPLVSQWRLARVATPDAIVCGSE
FT                   HGAHRAPDAGHAHDPARHLDACGYCGFFAHTPAIGGAAAVLFAFVPTQVVSAVAPHGVA
FT                   PRAAPYPRAYPRAPPERA"
FT   sig_peptide     78169..78237
FT                   /locus_tag="Bamb_3291"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.964) with cleavage site probability 0.609 at
FT                   residue 23"
FT   gene            78621..80750
FT                   /locus_tag="Bamb_3292"
FT   CDS_pept        78621..80750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3292"
FT                   /product="TonB-dependent copper receptor"
FT                   /note="TIGRFAM: TonB-dependent copper receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor, plug;
FT                   KEGG: bur:Bcep18194_B2174 TonB-dependent copper receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3292"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88847"
FT                   /db_xref="GOA:Q0BAH6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010100"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAH6"
FT                   /protein_id="ABI88847.1"
FT                   /translation="MTIPSLRAPRASRHCRARCVPRMLKLTIPALAVGAMSAAAAAEAA
FT                   RAAGAPTDDAAVLLPPVEVVASPLTTPLVIVTDPKTPRQPLPASDGADYLKTIPGFTSI
FT                   RSGGTNGDPVLRGMFGSRLNILANGMPTLGACPNRMDAPTSYIAPESYDKVTVVKGPQT
FT                   VLYGPGASAGTVLFERVTPRFERPGMRFDGSVVGGSFGRNDQNVDVTAGTPDVYGRVSA
FT                   NHAHAQDYQDGNGNTVPSQWDKWNADAALGWTPDDHTRVELTAGTGDGYARYAGRGMDG
FT                   AHFRRETFGLSFDKRHLGDVLERIEARVYYNEADHVMDNTTLRQPDPTSSMPMRMASEV
FT                   RRRTLGARAAATFRFGDDFKLVTGVDAQSNRLDARSAMGRQNYGDQPWDAQATMWNAGA
FT                   FGELTWYASDAARVIGGARVDYASARDKRATTSGMMASKPNPTFDDDRARVLPSGFVRY
FT                   ERDLASLPVTWYAGVGHAERYPDYWELFSAKRGPAGSVNAFSAVQPEKTTQLDIGAQYK
FT                   SERVDAWVSAYAGYVQDYILFNYAAGMMGPTTQATNVNAQIFGGEAGVSWRPVAPLRVE
FT                   TSLAYAWGRNATSGDPLPQMPPLEARVGLEYTRGAWSAGGLWRIVAPQHRYALNEGNVV
FT                   GKDFGPSAGFGVLSLHAQYNVSKKVQISVGVDNVLDKAYAEHLNLAGNAGFGYPANAPV
FT                   MEPGRTAWVRVSAKL"
FT   sig_peptide     78621..78746
FT                   /locus_tag="Bamb_3292"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.464 at
FT                   residue 42"
FT   gene            80980..82074
FT                   /locus_tag="Bamb_3293"
FT   CDS_pept        80980..82074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3293"
FT                   /product="Triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /note="PFAM: alpha/beta hydrolase fold; Protein of unknown
FT                   function DUF676, hydrolase domain protein; PGAP1 family
FT                   protein; KEGG: bur:Bcep18194_B2173 triacylglycerol lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3293"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88848"
FT                   /db_xref="GOA:Q0BAH5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAH5"
FT                   /protein_id="ABI88848.1"
FT                   /translation="MARSMRSRVVAGAVACAMSVAPFAGTAAMMTLATTHAAMAATAPS
FT                   DDYATTRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQHGATVYVANLSGFQNDDGPNG
FT                   RGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEF
FT                   ADFVQGVLAYDPTGLSSSVIAAFVNVFGILTSSSHNTNQDALAALKTLTTAQAATYNQN
FT                   YPSAGLGAPGSCQTGAPTESVGGNTHLLYSWAGTAIQPTISALGVTGAADTSTIPLVDP
FT                   ANALDLSTLALLGTGTVMINRASGQNDGLVSKCSALYGKVLSTNYKWNHVDEINQLLGV
FT                   RGAYAEDPVAVIRTHANRLKLAGV"
FT   sig_peptide     80980..81102
FT                   /locus_tag="Bamb_3293"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.929 at
FT                   residue 41"
FT   gene            82078..83112
FT                   /locus_tag="Bamb_3294"
FT   CDS_pept        82078..83112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3294"
FT                   /product="lipase chaperone"
FT                   /note="PFAM: lipase chaperone; KEGG: bur:Bcep18194_B2172
FT                   lipase chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3294"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88849"
FT                   /db_xref="GOA:Q0BAH4"
FT                   /db_xref="InterPro:IPR004961"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0BAH4"
FT                   /protein_id="ABI88849.1"
FT                   /translation="MTAREGRAPRVRRVAVYGAVGLAAIAGVAIWSGAASHRGADTARL
FT                   SADAAARDGASAAPPPPARPASAGMPSPLAGSSAPRLPLDAAGHLAKSRAVRDFFDYCL
FT                   SARSDLSATALDALVVREIAAQLDGTMAQPEALDVWHRYRAYLDALAKLPDAGAVDKSD
FT                   LGALQLALDQRVSIAYRTLGDWSQPFFGAEQWRQRYDLARLKIAQDRTLTEAQKAERLA
FT                   ALAQQMPGDERAARQKADRQQAAIDQIAQLQKSGATPDAMRAQLTQTLGPDAAARVAQM
FT                   QQDDASWQSRYADYAAQRAQIEAAGLSPQDRDAQIAALRQRMFTKPGEAVRAASLDRGA
FT                   AAAR"
FT   gene            complement(83152..84675)
FT                   /locus_tag="Bamb_3295"
FT   CDS_pept        complement(83152..84675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3295"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II; KEGG: bur:Bcep18194_B2171
FT                   transcriptional regulator, GntR family with
FT                   aminotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3295"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88850"
FT                   /db_xref="GOA:Q0BAH3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAH3"
FT                   /protein_id="ABI88850.1"
FT                   /translation="MDTVIVADWLSGRIDRSSPEPMYRQLLQLMQQAILTGELGPGTKL
FT                   PSSRTLAADLSIARNTVLHVYDQLTAEGYVLTTTGSGTYVADTRPDAAVIHAPGAAPPP
FT                   SAADEAPLPDAHGGLSMRGRQLIEHAGVSRRQWGAFMPGVPDVSEFPSRTWSRLQARLW
FT                   KEANPELLTYAPGGGYRPLRRALADYLRVARSVKCSPDQVIITTGIHQSIDLAVRLLSD
FT                   IGDRAWVEEPCYWGVRSVLQATGLTLTPVPVDQEGIDPSAADMQQPPRLVLVTPSHQYP
FT                   LGMVMSLARRRMLLEYARRHRCWIIEDDYDSEFRYGSRPLASLQGLDDGGRVIYVGSLG
FT                   KMLFPGLRMGYMVVPEHLVDTFRTGLSELYREGQLMQQAVLAEFIMDGHLTSHVRRMRT
FT                   LYGERRQLLIDAIHARFGDALPVMGDEAGLHLVLGLPDACDDRAVTQSAFDAGVIVRPL
FT                   TSYYSRLDTARRGLLLGYACVAHEGIGPAFDTLAATIEQHLPRHFTRAS"
FT   gene            84784..85878
FT                   /locus_tag="Bamb_3296"
FT   CDS_pept        84784..85878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3296"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: bur:Bcep18194_B2170 spermidine/putrescine ABC
FT                   transporter ATPase subunit; TIGRFAM: spermidine/putrescine
FT                   ABC transporter ATPase subunit; PFAM: ABC transporter
FT                   related; TOBE domain protein; Transport-associated OB
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3296"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88851"
FT                   /db_xref="GOA:Q0BAH2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAH2"
FT                   /protein_id="ABI88851.1"
FT                   /translation="MKSDDVIVSFRGVRKTYDGETLVVKSLDLDIHRGEFLTLLGPSGS
FT                   GKTTCLMMLAGFEFPTGGEIWLDGELLNTVPPHKRNIGMVFQNYALFPHLTVEQNVAYP
FT                   LTVRKLSAAERAERVAHALKMVQMERFAKRYPAQLSGGQQQRIALARALVFEPKLVLMD
FT                   EPLGALDKQLREHMQYELKALHEKLGVTFVYVTHDQGEALTMSDRVAVFDKGIVQQLDT
FT                   VDCLYESPCNEFVANFIGDSNRLRGTIARVDGDFCEFRLDDGTQLVGRRIGDAAEGAPA
FT                   VACIRPERMSLAANGHANGAANRVTGEARSLIYFGDHVRMRCALPGQEECFVKVPLGTD
FT                   ALHAFAPGAPVALAFAPEHLRVFA"
FT   gene            85956..87002
FT                   /locus_tag="Bamb_3297"
FT   CDS_pept        85956..87002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3297"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: bur:Bcep18194_B2169 ABC spermidine/putrescine
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3297"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88852"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAH1"
FT                   /protein_id="ABI88852.1"
FT                   /translation="MNGASSTARRTALALALAVVGASATAAELTVVNFGGANGDAQKAA
FT                   FNQPFEKATGNKVTAVEYNGEQAKVKAMVEAKHVNWDVVEVESGDLNRGCDEGLYEKLD
FT                   WSKIAKKSDLIPEAPQVCGVGFFVWSTALSYNADKLKSAPTGWADFWNVKKFPGKRGMR
FT                   KGARYNLEFALMADGVATKDVYKVLGTKAGQDRAFKKLDELKPYIQWWEAGAQPPQFLV
FT                   AGDVVMSTAYNGRIDAAQKEGKNLKVVWNGSIYDLDYWAIPKGSPNKALAEKYIAYTLT
FT                   PKPQQAYAQHIAYGPTNVAAIKSLDAKTLANLPNSPANGKNAVLEDIGFWTDHSDELEQ
FT                   RFSAWATK"
FT   sig_peptide     85956..86036
FT                   /locus_tag="Bamb_3297"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.987 at
FT                   residue 27"
FT   gene            87105..88367
FT                   /locus_tag="Bamb_3298"
FT   CDS_pept        87105..88367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3298"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B2168 ABC
FT                   spermidine/putrescine transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3298"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88853"
FT                   /db_xref="GOA:Q0BAH0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAH0"
FT                   /protein_id="ABI88853.1"
FT                   /translation="MTIAPSSPSTAALKRELKAAEARKRTMALLLVAPLAIFLLLIFVV
FT                   PIGTLLTRAVQNPEIATALPKTVAALSGWDRKAPPADAAYVALAADMTKVADSEAMGAL
FT                   ARRLNTEIPGYRSLVAKTARAMPLKGDNDAVAALTPAQTRAKLLDLDARWGDAAYWQAI
FT                   AKNGSQVSPFYLLAALDHKQDGFGRIVQADPDQSIYLSIFGRTFVIGVAVTLFALLLGY
FT                   PLAYWISTLSDRRANLVMILVLIPFWTSVLVRVAAWIVLLQSEGLINTALIGSGLISHP
FT                   LALLFNRVGVYISMTHILLPFMILPLYSVMKSIPPTYQRAAVSLGSHPFAAFWRVYVPQ
FT                   TYPGVGAGALLVFILAIGYYITPALLGGPNDQMVSYYVAYFTNVTINWGMACALGGLLL
FT                   AATLVLYAVYGRFTRSNVSLG"
FT   gene            88405..89241
FT                   /locus_tag="Bamb_3299"
FT   CDS_pept        88405..89241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3299"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B2167 ABC
FT                   spermidine/putrescine transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3299"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88854"
FT                   /db_xref="GOA:Q0BAG9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAG9"
FT                   /protein_id="ABI88854.1"
FT                   /translation="MKLARPLFAPHMSFVERAWYVALRVLVVLTLLYLILPVLAIVPLS
FT                   FSSSTFLVYPIPGFSTRWYENLIASDEWRMAAKNSFIVAPSATVVATVLGTLAAIGLTK
FT                   ADFRGKGLLMAVLLSPMIVPVVVVGVGMYLFFAPLGLANTYTGLIAAHAALGVPFVVTT
FT                   VAATLQGFNQNLVRASLSLGANPVTTFFRVTLPVIAPGVMSGALFAFATSFDEVVVTLF
FT                   LAGADQTTLPRQMFTGIRENISPTIAALATILIIFSTSLLLVLEWLRGRNARRAVS"
FT   gene            89371..90864
FT                   /locus_tag="Bamb_3300"
FT   CDS_pept        89371..90864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3300"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B2166 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3300"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88855"
FT                   /db_xref="GOA:Q0BAG8"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAG8"
FT                   /protein_id="ABI88855.1"
FT                   /translation="MNRFHRMACAAAPLNSATPRVARQPSLILSEFASSAGAREPAVNW
FT                   RAMSAVLLAVALATLDTAIANTALPAIAADLHASPAASVWIINAYQLAMVATLLPFASL
FT                   GDIVGHKRVYVAGLAVFTLASLGCSLASTLPQLTAARIVQGFGASAIMSVNVALIRNLF
FT                   PAHRLGRGVGFNALVVGVSFAVGPTIASLILSVAAWPWLFAVNVPLGVLALAVAIPSLP
FT                   QSARGKHVFDPLAALFNVITFASLIFALGEFAQRGPLSVVLAAAAVALTFGWLLIRRQA
FT                   GHPAPMLPVDLFRRPVFTLSALTAVCAFAAQGLAFVSLPFYFETVLHRSAVETGFLMTP
FT                   WSAVVALAAPIAGRLSDRYPPGLLGAIGLALLSAGMVALAALPAAPNVFDIGWRMMLCG
FT                   AGFGFFQSPNLKALMSSAPPERSGGASGIIATARLIGQATGAALVALSFGVAGRHGPTL
FT                   ALMLGAGFAGAASVASGLRLFAPSHRVGAPVPVKERATE"
FT   sig_peptide     89371..89439
FT                   /locus_tag="Bamb_3300"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.970) with cleavage site probability 0.948 at
FT                   residue 23"
FT   gene            complement(90937..92676)
FT                   /locus_tag="Bamb_3301"
FT   CDS_pept        complement(90937..92676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3301"
FT                   /product="sedolisin, Serine peptidase, MEROPS family S53"
FT                   /EC_number="3.4.21.101"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin; KEGG: bur:Bcep18194_B2163 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3301"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88856"
FT                   /db_xref="GOA:Q0BAG7"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAG7"
FT                   /protein_id="ABI88856.1"
FT                   /translation="MKRNTWFALPLPSPRHLACAVPLVFAAAAAHAATDWVDTHTKAFL
FT                   TGPQLMARSAAPSLELAAGETTDIVVSLKLRNAAQLKQLAHDVNRPGNAHYRQYLTHEQ
FT                   FLAGYAPTEAQVKSVVDYLRKSGFVNIDVAPNRLLVSAHGTAGTVKTAFNTSLVHFEYA
FT                   GRSGFANASTAQVPHALGDVVGSVLGLQNVARARPMLRIGNVAKPQALAAGTATGHYPK
FT                   EFPGLYNATGVPTAAGVTVGIITIGGVSQTLQDLRQFTSSNGYGTVTTQTVKTNGTGTS
FT                   GSYSDDQDGQGEWDLDSQSIVGSAGGQVGKLVFYMADLNAAGNTGLTQAFNRAVSDNTA
FT                   KVINVSLGWCETDANADGTLDAEEQIFTTAAAQGQTFSVSSGDEGVYECNNRGYPDGGN
FT                   YTVSWPAASPHVLAIGGTTLYTTSAGAFSNETVWNEGLDGNGKLWATGGGVSSILPAPS
FT                   WQSGSNRQLPDVSFDAAQGTGAYIYNYGQLQQIGGTSLAAPIFTGFWARLLAANGTGLG
FT                   FPAGNFYADIPSNPSLVRYDVVSGNNGYQGYGYSAGSGRDLTTGFGSLNIANLNKLIQT
FT                   GGF"
FT   sig_peptide     complement(92578..92676)
FT                   /locus_tag="Bamb_3301"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.999 at
FT                   residue 33"
FT   gene            93377..93700
FT                   /locus_tag="Bamb_3302"
FT   CDS_pept        93377..93700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3302"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG:
FT                   bur:Bcep18194_B2161 transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3302"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88857"
FT                   /db_xref="GOA:Q0BAG6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAG6"
FT                   /protein_id="ABI88857.1"
FT                   /translation="MQNTHDTLFRTLADPTRRALFERLCEEGELTVAALTAHAGVSQPA
FT                   VSKHLGVLKQAGLVSDRHAGRQTHYSAQPQALTPLIDWTSQMAGFWQNRFDALEDLLNR
FT                   MDQ"
FT   gene            93697..94128
FT                   /locus_tag="Bamb_3303"
FT   CDS_pept        93697..94128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3303"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: bur:Bcep18194_B2160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3303"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88858"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAG5"
FT                   /protein_id="ABI88858.1"
FT                   /translation="MNQPTSETRTVVVERELPHSPEKIWRALTQPHLIEAWLMKSDFEP
FT                   VAGRTFSFHADWGSVDCTLLTIEPERVLSYTWAAYGLESVVTWTLTPTPGGTLLRMEQA
FT                   GFRADQEQAYRGAQQGWVRFFDSLEQVVARADEDEEGRA"
FT   gene            94125..94565
FT                   /locus_tag="Bamb_3304"
FT   CDS_pept        94125..94565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3304"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3304"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88859"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAG4"
FT                   /protein_id="ABI88859.1"
FT                   /translation="MSASDPGLPPSARIDALIAGIADWRGKTFAEVRETILAVDDGIVE
FT                   EWKWMGSPVWACDGMIAVANAHKGKVKLTFMHGAHLPDPDGLFNGGLDGNARRSIDWFE
FT                   GDKLDKRGLKRLVRAAIDYNRAHLKKNARTGAGAKARADKAA"
FT   gene            complement(94709..97426)
FT                   /locus_tag="Bamb_3305"
FT   CDS_pept        complement(94709..97426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3305"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /note="TIGRFAM: aconitate hydratase 1; PFAM: aconitate
FT                   hydratase domain protein; KEGG: bur:Bcep18194_B2158
FT                   aconitate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3305"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88860"
FT                   /db_xref="GOA:Q0BAG3"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAG3"
FT                   /protein_id="ABI88860.1"
FT                   /translation="MAHNLHKTLQEFDSGSGKGKFYSLPQLGKELKTKIERLPVSIRIV
FT                   LESVLRNYDGKKITEEHIEQLANWKPTAKRVDEIPFVVSRVVLQDFTGVPLLADIAAMR
FT                   GVAERSGKNPKKIEPLVPVDLVVDHSVQIDYFRQKDALDLNMKLEFQRNNERYQFMKWG
FT                   MQAFDTFKVVPPGVGIVHQVNLEYLARGVHKKANGGDTVYYPDTLVGTDSHTTMINGIG
FT                   VVGWGVGGIEAEAGMLGQPVYFLTPDVVGVELKGKLREGVTATDLVLTITEMLRKEKVV
FT                   GKFVEFFGEGTKSLSLPDRATIGNMAPEYGATMGFFPVDEKTIDYFEGTGRTKAEIAAF
FT                   ENYFKAQNLFGIPQAGDIDYTKTVTLDLATVAPSLAGPKRPQDRIEIGNVKSTFTDLFS
FT                   KPVAENGFAKKADELNTQYTTSNGVDVKNGDVLIAAITSCTNTSNPSVLLAAGLLAKKA
FT                   VEAGLTVDPKIKTSLAPGSRIVTEYLTKTGLLPYLSKLGFEVAAYGCTTCIGNAGDLTP
FT                   ELNEAITKNDIVAAAVLSGNRNFEARIHPNIRANFLASPPLVVAYAIAGNITRDLMTEP
FT                   VGKGKDGYDIYLGDIWPTSEEIHALLKFALDPKKFEDNYSKLTKKGDLWSKIEGETGQV
FT                   YDWPKSTYIAEPPFFGNDFSMEPADSIPTVKGARALGIFGDSVTTDHISPAGSIKEDSP
FT                   AGKWLKENGVQKADFNSYGSRRGNHDVMMRGTFANVRIKNLMIPVKADGSRVEGGLTIH
FT                   QPSGDQLSIYDAAMRYVDADTPTVVFAGEEYGTGSSRDWAAKGTQLLGVKAVIARSFER
FT                   IHRSNLVGMGVLPLQFKGADSVQSLGITGEETYDIEGLGDDFKPQQDVTLVIHRKNGET
FT                   QRVPVLLRIDTPIEVDYYKHGGILPFVLRSLLAA"
FT   gene            complement(97479..98930)
FT                   /locus_tag="Bamb_3306"
FT   CDS_pept        complement(97479..98930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3306"
FT                   /product="2-methylcitrate dehydratase"
FT                   /EC_number="4.2.1.79"
FT                   /note="KEGG: bur:Bcep18194_B2157 2-methylcitrate
FT                   dehydratase; TIGRFAM: 2-methylcitrate dehydratase; PFAM:
FT                   MmgE/PrpD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3306"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88861"
FT                   /db_xref="GOA:Q0BAG2"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR012705"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAG2"
FT                   /protein_id="ABI88861.1"
FT                   /translation="MSAPVSNVRPAPDTVLVDIVDYVLNTGIDSALALETARHCLIDTL
FT                   GCGLEALSYPACTKLLGPVVPGTIVPNGAKVPGTSFQLDPVQAAFDIGAMIRWLDFNDT
FT                   WLAAEWGHPSDNLGGILATADWLSRTAVAAGRQPLAMRDVLVAMIQAHEIQGCLALENS
FT                   FNAVGLDHVLLVKVASTAVVGRLLGLTRDELINAVSNAFVDGQALRTYRHAPNTGSRKS
FT                   WAAGDATSRAVRLALIAKTGEMGYPSALTAKTWGFYDVLFDGQPFRFQRPYGTYVMENV
FT                   LFKIAFPAEFHAQTAAEAALQLHAQLAAAGRTTDDISRITIRTHAAALRIIDKQGPLAN
FT                   PADRDHCIQYMVAVPLLFGRLTAADYEDAVAADPRIDALRAKTVCVEDPQFTKDYHDPA
FT                   RRSIANALTIEFADGSKLAEVAIEYPLGHRRRRAEGIPLLVEKFRTNLARRFPARQQQA
FT                   ILDVSLDQATLEAMPVDEYVDLYVI"
FT   gene            complement(98962..99471)
FT                   /locus_tag="Bamb_3307"
FT   CDS_pept        complement(98962..99471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3307"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3307"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88862"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAG1"
FT                   /protein_id="ABI88862.1"
FT                   /translation="MKKLLIATAIGALSATMLVSAPSAFAQGTATTAKKTAKRPAPAKR
FT                   IIPRSKKAQARAAAKVDTVPEGAVKWSCKEGLSFDLAGDMKRDQLVTVHWAKRNYKLPR
FT                   EATTTGADTFYDPAAGLKLVVIPTKAMLFSDANGGERLADECVTPEMTQGTAAPTQSNE
FT                   LKPATN"
FT   sig_peptide     complement(99391..99471)
FT                   /locus_tag="Bamb_3307"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.997 at
FT                   residue 27"
FT   gene            complement(99695..100699)
FT                   /locus_tag="Bamb_3308"
FT   CDS_pept        complement(99695..100699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3308"
FT                   /product="HpcH/HpaI aldolase"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: bur:Bcep18194_B2155
FT                   citrate lyase beta subunit-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3308"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88863"
FT                   /db_xref="GOA:Q0BAG0"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040186"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAG0"
FT                   /protein_id="ABI88863.1"
FT                   /translation="MSALTPAQVLYDGASPPAILPCCDHYAGSEKLMRKSLALQAELGP
FT                   VFDITLDCEDGAAVGQEAAHAQLVAELLGSAENRFGRVGVRIHDFSHPHWRDDVRIVLR
FT                   AARAPAYVTLPKIASAADAAEMVAFIEGTRRELGLAQPIPVDVLVETHGALAQAAALAA
FT                   LPLVGTLSFGLMDFVSAHHGAIPDAAMRSPGQFDHPLVRRAKLEIAAACHAHGKTPSHN
FT                   VTTEVRDMAIVAGDALRARDEFAFTRMWSIHPAQIRPIVDAFAPRTDEVALAAEILLAA
FT                   QAADWGPTRHGDTLHDRASYRYYWSVLRRARATGQPVPAEAAPLFGPAAGDAR"
FT   gene            complement(100886..101872)
FT                   /locus_tag="Bamb_3309"
FT   CDS_pept        complement(100886..101872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3309"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /note="KEGG: mdh; malate dehydrogenase; TIGRFAM: malate
FT                   dehydrogenase; PFAM: Lactate/malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3309"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88864"
FT                   /db_xref="GOA:Q0BAF9"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010945"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0BAF9"
FT                   /protein_id="ABI88864.1"
FT                   /translation="MAKPAKRVAVTGAAGQIAYSLLFRIANGDLLGKDQPVILQLLDLP
FT                   QAQAAVKGVVMELDDCAFPLLAGVVITDDPKVAFKDADVALLVGARPRSKGMERKDLLS
FT                   ANAEIFTVQGAALNEVASRDVKVLVVGNPANTNAYIAMKSAPDLPKKNFTAMLRLDHNR
FT                   ALSQLAAKSGKPVASIEKLAVWGNHSPTMYPDFRFATAEGESLLKLINDDVWNRDTFIP
FT                   TVGKRGAAIIEARGLSSAASAANAAIDHVRDWVLGTNGKWVTMGIPSDGSYGIPEDIIY
FT                   GVPVVCENGEYKRVEGLEIDAFSREKMDGTLAELLEERDGVAHLLKN"
FT   gene            102161..102985
FT                   /locus_tag="Bamb_3310"
FT   CDS_pept        102161..102985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3310"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   bur:Bcep18194_B2153 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3310"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88865"
FT                   /db_xref="GOA:Q0BAF8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAF8"
FT                   /protein_id="ABI88865.1"
FT                   /translation="MRAMTSNQANNANPTGAGGPGQPGAGDSAPAPAASPSPTFSPLYQ
FT                   QIKSLITQSLESGEWKPGEIIPSEVELAARYKVSQGTVRKAIDELAAENLVVRRQGKGT
FT                   FVATHNEDRAQFRFLRLLADDGAEHPHVSRLLECRRLRAPAEIARQLDLKPADPVVQVR
FT                   RLLEFDSEVTVLDEIWLPGTMFRGLTFERLSEYKGPLYAMFETEFGTRMIRATEKIRAV
FT                   AAEPAVADLLHVPAGFPLLSVERVSYTYGDRPVEVRRGWYVTTGYYYQNDLS"
FT   gene            103155..103571
FT                   /locus_tag="Bamb_3311"
FT   CDS_pept        103155..103571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3311"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /EC_number="1.3.5.1"
FT                   /note="PFAM: succinate dehydrogenase, cytochrome b subunit;
FT                   KEGG: bur:Bcep18194_B2152 succinate dehydrogenase,
FT                   cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3311"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88866"
FT                   /db_xref="GOA:Q0BAF7"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAF7"
FT                   /protein_id="ABI88866.1"
FT                   /translation="MTDAVRKPRPEYRNIGIGDITLKYRMPLAAILSILHRVSGALLFL
FT                   FLPFVLFLFDQSLTSELSFEVFKAFLSNIVVKLIVLALSWAFLHHFCAGIRHLLMDVNH
FT                   DAVSKEGGKRTAVVVFVVSIALTIAMALKLFGAF"
FT   gene            103576..103944
FT                   /locus_tag="Bamb_3312"
FT   CDS_pept        103576..103944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3312"
FT                   /product="succinate dehydrogenase subunit D"
FT                   /EC_number="1.3.5.1"
FT                   /note="PFAM: succinate dehydrogenase, cytochrome b subunit;
FT                   KEGG: bur:Bcep18194_B2151 succinate dehydrogenase,
FT                   cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3312"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88867"
FT                   /db_xref="GOA:Q0BAF6"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAF6"
FT                   /protein_id="ABI88867.1"
FT                   /translation="MAANNRIGSKRLVVGAHYGLRDWLAQRVTATIMAVYTVILLALFF
FT                   GAHDFSYEGWASIFSAQWMKLATFVTLLSLFYHAWVGVRDIWMDYVKPVGVRLLLQSLT
FT                   IVWLLACAGYAAQILWRV"
FT   gene            103948..105723
FT                   /locus_tag="Bamb_3313"
FT   CDS_pept        103948..105723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3313"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: bur:Bcep18194_B2150 succinate
FT                   dehydrogenase/fumarate reductase, flavoprotein subunit;
FT                   TIGRFAM: succinate dehydrogenase, flavoprotein subunit;
FT                   succinate dehydrogenase or fumarate reductase, flavoprotein
FT                   subunit; PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3313"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88868"
FT                   /db_xref="GOA:Q0BAF5"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAF5"
FT                   /protein_id="ABI88868.1"
FT                   /translation="MAAIKTSLPRRKFDVVIVGAGGSGLRAALQLSRAGLSVGVLSKVF
FT                   PTRSHTVAAQGGIGASLGNMSEDNWHFHFYDTIKGSDWLGDQDAIEFMCREAPNVVYEL
FT                   EHFGMPFDRNADGTIYQRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVEAKT
FT                   QFFVEWMALDLIRDADGDVLGVTALEMETGDVYIMEGKTTLFATGGAGRIFAASTNAFI
FT                   NTGDGLGMAARSGIALQDMEFWQFHPTGVAGAGVLITEGVRGEGGILRNANGERFMERY
FT                   APTLKDLAPRDFVSRSMDQEIKEGRGVGPNKDHVLLDLSHIGAETIMKRLPSIREIALK
FT                   FANVDAIKEPIPVVPTIHYQMGGIPTNIHGQVVGTSRDHKEPVNGFYAVGECSCVSVHG
FT                   ANRLGTNSLLDLVVFGRAAGNHIVEHVKNQKEHKPLPADAGEFSLARLNKLDKSSSGEY
FT                   TQDVANDIRATMQKHAGVFRTSALLKEGVEQMAGLAARVESIHLKDKSKVFNTARVEAL
FT                   ELENLIEVARATMVSAEARKESRGAHAHSDYEHRDDDNWLRHTLWYSEGDRLDYKPVQM
FT                   KPLTVESVPPKPRTF"
FT   gene            105745..106446
FT                   /locus_tag="Bamb_3314"
FT   CDS_pept        105745..106446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3314"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; KEGG: bur:Bcep18194_B2149
FT                   succinate dehydrogenase/fumarate reductase iron-sulfur
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3314"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88869"
FT                   /db_xref="GOA:Q0BAF4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAF4"
FT                   /protein_id="ABI88869.1"
FT                   /translation="MAKRIFEVYRYDPDKDAAPRMQTYELEIQHERMLLDALVKLKAVD
FT                   ETLSFRRSCREGVCGSDAMNINGKNGLACLTNLNDLPQKIVLRPLPGLPVVRDLIVDMT
FT                   HFFNQYHSIKPYLINDAPPPEKERLQSPEERDELDGVYECILCASCSTSCPSFWWNPDK
FT                   FVGPAGLLQAYRFIADSRDTATGERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIG
FT                   KIKELMVRRAV"
FT   gene            106453..106725
FT                   /locus_tag="Bamb_3315"
FT   CDS_pept        106453..106725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3315"
FT                   /product="protein of unknown function DUF339"
FT                   /note="PFAM: protein of unknown function DUF339; KEGG:
FT                   bur:Bcep18194_B2148 protein of unknown function DUF339"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3315"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88870"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAF3"
FT                   /protein_id="ABI88870.1"
FT                   /translation="MSDDSHQSDPHRRARLRWRARRGLLENDIIFERFFSRYEHDLTDA
FT                   DVGALSRLLDLSDNDLMDLLLARKEPEGDLDSPEIHRLLEMLRNV"
FT   gene            106792..108093
FT                   /locus_tag="Bamb_3316"
FT   CDS_pept        106792..108093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3316"
FT                   /product="citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /note="KEGG: bur:Bcep18194_B2147 citrate synthase; TIGRFAM:
FT                   citrate synthase I; PFAM: Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3316"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88871"
FT                   /db_xref="GOA:Q0BAF2"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAF2"
FT                   /protein_id="ABI88871.1"
FT                   /translation="MTPSDVKATLSFSDNSPSVEMPIYKGTMGPDVIDIRKLYGQTGKF
FT                   TYDPGFMSTAACNSAITYIDGDKGELLYRGYPIDNLAQNADFLETCYLLLKGELPNAAQ
FT                   KKEFVDTVTKHTMVHEQMHFFFRGFRRDAHPMAVLVAAVGALSAFYHDSLDINDPRHRE
FT                   VSAIRMIAKLPTLVAMAYKFSIGQPFVYPKNELSYSANFMHMMFSNPCEEYKVNDVLVR
FT                   ALDRILILHADHEQNASTSTVRLAGSSGANPFACIAAGIACLWGPAHGGANEAALNMLE
FT                   QIGSPDNIPEFIKQVKDKNSGVKLMGFGHRVYKNYDPRAKLMRETCYEVLNELGLHDDP
FT                   LFKLAMQLEKIALEDEYFVSRKLYPNVDFYSGIVQRALGIPTSMFTCIFAMARTVGWIA
FT                   QWNEMIADPEQKIGRPRQLFIGDAPREAKPINAR"
FT   gene            complement(108183..109166)
FT                   /locus_tag="Bamb_3317"
FT   CDS_pept        complement(108183..109166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3317"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bur:Bcep18194_B2146 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3317"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88872"
FT                   /db_xref="GOA:Q0BAF1"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAF1"
FT                   /protein_id="ABI88872.1"
FT                   /translation="MKPQYEHVAFAPGCSIRVYHRQLARIPFEWHRHPEYELTLTLNSR
FT                   GRRFVGDHVARYTDDDLVLVPPNLPHTWSSNARIDRDAPEVALVVWFDGDWARRVADCC
FT                   PEYAPLRSLLRRAAPGLAFDAATARAMRERLPRLLDPSPRVRLAAALDTLADLAEAGGE
FT                   PLATAQAYERADAATPSADSAAPEAERLDRVLDAIDRHFHEPLRIDALAAVAHMSERTL
FT                   QRLFVRHLGESVGRYVQRLRLAHACRHLVGTDWPIATVAARCGIPNAANFNRQFLAARG
FT                   MTPGAYRQFFAQHGHAPDADAPPLDTRPPSLERGTGPAHGQRRPRK"
FT   gene            109238..109627
FT                   /locus_tag="Bamb_3318"
FT   CDS_pept        109238..109627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3318"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bur:Bcep18194_B2145
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3318"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88873"
FT                   /db_xref="GOA:Q0BAF0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAF0"
FT                   /protein_id="ABI88873.1"
FT                   /translation="MFSHVCVGVRDTARAYDFYAPLFAELGLRLKFSEPDGWSGWMPAD
FT                   ADRPLFFFGRPLDGRAPEPGNGHTIAFDAQTRAQVDRCHALALQHGGTCEGPPGLRPHY
FT                   HRDYYGAYFRDPDGNKLCVVCHRPE"
FT   gene            109739..110992
FT                   /locus_tag="Bamb_3319"
FT   CDS_pept        109739..110992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3319"
FT                   /product="protein of unknown function DUF1479"
FT                   /note="PFAM: protein of unknown function DUF1479; KEGG:
FT                   bur:Bcep18194_B2144 protein of unknown function DUF1479"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3319"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88874"
FT                   /db_xref="InterPro:IPR010856"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAE9"
FT                   /protein_id="ABI88874.1"
FT                   /translation="MHLTIDDLPAAIRAAKRALRADLPGYAATFRELEGDIARQVDAIR
FT                   RAHAHGHDVIPVLRFADIANGTVDPQTIAAIRTHGAAVIRGVFDAAQARDWNDEIGAYL
FT                   DANRFAERLHARAEDRYFGNLASGKPQIYGVYWSKPQVAARQSPALTQARVFMNRLWRH
FT                   ADGQRTHFDPDRVPAYADRIRRRPPGSTSLGLSPHVDGGSVERWLGANFRQVYRHVLGG
FT                   QWRDYDPFDAAFRPDVEEIPSPAVCSMFRTFQGWTALTPQGPGDGTLQLIPVANAMAYV
FT                   VLRALQDDVADDNLCGARPGRALSILPEWHALLLDALVPIPHMEPGDAVFWHGDVVHAV
FT                   EDAHRGSGDSNVMYIAAAPGCAKNDAYLQRQRLAFLRGDSPPDFPADHFEVEFDGRGGE
FT                   GDLTALGRAQMGFGPLAA"
FT   gene            111217..111987
FT                   /locus_tag="Bamb_3320"
FT   CDS_pept        111217..111987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3320"
FT                   /product="Dimethylargininase"
FT                   /EC_number="3.5.3.18"
FT                   /note="PFAM: amidinotransferase; KEGG: bur:Bcep18194_B2143
FT                   dimethylargininase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3320"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88875"
FT                   /db_xref="GOA:Q0BAE8"
FT                   /db_xref="InterPro:IPR033199"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAE8"
FT                   /protein_id="ABI88875.1"
FT                   /translation="MEESMQFTQAIVRRPAPSCGAGLTTATLGAPDYDKTLTQFHAYCD
FT                   ALRGLGVELTELPPLDAFPDAHFVEDVAVVTPEFAVITRPGAPARRGETVHIEAALGAH
FT                   RDLLPMQAGRLDGGDVMLVGKRFYIGLTGRTDAEGIAAFEALVSRFGYSVVAVPVAAGL
FT                   HLKSVVNALGDDTLLVTEALAAHPAFADYRRIAISAADEYAGNTLRVNGTLITPAGYPR
FT                   VHDAIGSLGLPLHVIDTSEFRKMDGGLTCLSLRF"
FT   gene            112089..112553
FT                   /locus_tag="Bamb_3321"
FT   CDS_pept        112089..112553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3321"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   bur:Bcep18194_B2142 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3321"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88876"
FT                   /db_xref="GOA:Q0BAE7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAE7"
FT                   /protein_id="ABI88876.1"
FT                   /translation="MTDKKMQLDKIDLRILDILRTDGRISYRKLSELVNLTPRPCQARV
FT                   ERLEALGVIEGYRAVIKALRATKPIVVIAQIVLADHGRSQAPFEEEMRTNPAVLDCWLV
FT                   SGTFDFLVRLACEDLDEYRRIANVWLESPRFRIEKIVTTAELQAIKRSIV"
FT   gene            112694..114229
FT                   /locus_tag="Bamb_3322"
FT   CDS_pept        112694..114229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3322"
FT                   /product="lysine:proton symporter, AAT family"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bur:Bcep18194_B2141 amino acid transporter; TC 2.A.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3322"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88877"
FT                   /db_xref="GOA:Q0BAE6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAE6"
FT                   /protein_id="ABI88877.1"
FT                   /translation="MDALQAAAQTAAPSGTALKRRLQGRHIAMIAIGGSIGTGLFVASG
FT                   ASVAQAGPGGAIAAYVAIGLMVYFVVTGLGEMAALMPVSGSFAIYGEKYVDEGFGVALG
FT                   WTYWYSWAVTIAIELVAAQIVMRYWFPAIPGVWWGAGFLVLIFLLNTLSVRGFGESEYW
FT                   FSLIKVVTVIAFIAAGLLIAAGLLGNGQPVGWRNFRTGDAPFVGGVHAMMSVALIAGFS
FT                   FLGTELVGITAGESENPRKTIPRAVKQIFWRIMLFYVFAIFVIGLLVPYTDPNLLKSDV
FT                   TDIGVSPFTLVFSHAGFPLAAGAMNLVILTAVLSAGNSGTYAATRMLYNLAAEGRAPAM
FT                   FATLSPGGVPRNALYATMAVGGLCFLTSLTSNQSIYLWLLNTVGITGFIAWLGIAVCHY
FT                   RFRKGFVKQGYRLEQLPYRAKWFPFGPLFAICIVISLGQDYQAFFAARINWMEVLSIYV
FT                   WIPLFVAIWWAYRRVRKSRLVRYEEMDIGPWLTRSVEAVDAAVTQHGQHGQSR"
FT   gene            complement(114431..115156)
FT                   /locus_tag="Bamb_3323"
FT   CDS_pept        complement(114431..115156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3323"
FT                   /product="Glutathione S-transferase, C-terminal domain
FT                   protein"
FT                   /note="PFAM: Glutathione S-transferase, C-terminal domain;
FT                   KEGG: bur:Bcep18194_B2137 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3323"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88878"
FT                   /db_xref="GOA:Q0BAE5"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAE5"
FT                   /protein_id="ABI88878.1"
FT                   /translation="MRYELYYWPEIQGRGEYVRLALEAAEADYVDVARESGRGMGVSAM
FT                   MRMMDSTKDECVPFAPPFLKAGDVVVGQVANILLFLGARLGLAPDDEAGRLWVHQLQLT
FT                   VADFVTEIHDTHHPIGSGLYYEDQKAEAAERAADFLEHRLPKYLGYFDRVLAQNPHKGG
FT                   YLAGSALSYADLSIFQLIEGLRYAFPKAMKRAERKVEGLVGLHDRVAQHPPIVRYLESK
FT                   RRIPFNDMGIFRHYPELDK"
FT   gene            complement(115284..115616)
FT                   /locus_tag="Bamb_3324"
FT   CDS_pept        complement(115284..115616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3324"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: bur:Bcep18194_B2136 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3324"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88879"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAE4"
FT                   /protein_id="ABI88879.1"
FT                   /translation="MKLGINDSLARLDAEGTLFTTLFRHGTLDIELYRPRGEDLQTPHT
FT                   RDEVYVIAAGTSRFVLDGRECGVAAGDVLFVPAFAAHRFAGFSDDFSTWVFFHGPEGGE
FT                   SGERST"
FT   gene            complement(115836..116882)
FT                   /locus_tag="Bamb_3325"
FT   CDS_pept        complement(115836..116882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3325"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa43920 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3325"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88880"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAE3"
FT                   /protein_id="ABI88880.1"
FT                   /translation="MKYRGVVYDVGLRFTADNPYSVDRFDPELVSYDINAIATALHANA
FT                   IRIEGEEIERLVTASRIAHAAGLSIFFNPWKMNVPIAELPAYFAQAARAAEQLRGEGAD
FT                   IVFVAGCEMSLFNEGILEGSTVMERVKGVIGLGAAAKSGDGELLRAKATLLNDTLDKIV
FT                   AVVRGAFNGRVTYSAGMWEMVDWRAFDIVGIDHYRSNESAKEYVGALDRYRLDKPLVVM
FT                   EVGCCAYEGAGKLGAGGFMRLQGTNPDGTGIFMDGIIPTRSEQEQAAYVEEQLELLNEA
FT                   GIDGVFIYVFSFPSYRYREGARDLDMMSFSLVKTYPDDQSESGQMPPWEPKEAFHRIAR
FT                   IYKKLAAG"
FT   gene            complement(117318..118172)
FT                   /locus_tag="Bamb_3326"
FT   CDS_pept        complement(117318..118172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3326"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: cgb:cg3390 sugar phosphate isomerase/epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3326"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88881"
FT                   /db_xref="GOA:Q0BAE2"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAE2"
FT                   /protein_id="ABI88881.1"
FT                   /translation="MSKSKVELVAAYFTLSGDVYPFGPTEISPFSFKDRVEAAAKAGWD
FT                   GIGLIHSDIYATADKIGFPEMRRILEANGIKHVEFEFLVDWYQTGERRRASDSMRYYYL
FT                   KAAEELRARIVKVGPGIGEETAIVPLMVEEFGKLAEDAEKRGTQVMLEIMPFSNVRTIE
FT                   TGKAIVEGANKANAGLLLDIWHLSRGNINFDEIATIKPEFIKGIELDDADRYAIEPLWM
FT                   DTCHKRRLPGEGVLDVKGFIKAVQATGFDGPWGVEILSEVERKLPLDEMAKRAYQATIR
FT                   QFD"
FT   gene            118514..119479
FT                   /locus_tag="Bamb_3327"
FT   CDS_pept        118514..119479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3327"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: sma:SAV5318 putative
FT                   D-ribose ABC transporter permease protein; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3327"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88882"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAE1"
FT                   /protein_id="ABI88882.1"
FT                   /translation="MNLRKSILSCLALGTISGALSTGADAANQPHVALLMPTQSVEYWA
FT                   LYIKGFQKEAAADGLKVDVKVTNYDANEQATQVEQTLAQKPDVIVLVPVDSSAMVPSIR
FT                   KIDQARIPLVISNSMPDQKYSRYWKVFTGPNDISNGEAAAKAMIQGFKEKGYGDKGKVI
FT                   VINGPMGTPPQVQRYQGFVDGLKKNAPGIEVVGAQPADWDAVKAEAAASALFTQFKDVK
FT                   GVYTENDSQLRGVVTAAQRLGLEPSKLVIVGHGCDAGGVEAISAGKAYATVEQSPFDDG
FT                   AYAAKAALELATGKTPRAVQYLPNPIATKATTNVCYSQKK"
FT   sig_peptide     118514..118594
FT                   /locus_tag="Bamb_3327"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.963 at
FT                   residue 27"
FT   gene            119611..120690
FT                   /locus_tag="Bamb_3328"
FT   CDS_pept        119611..120690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3328"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase,
FT                   C-terminal domain; KEGG: sme:SMc01163 putative
FT                   oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3328"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88883"
FT                   /db_xref="GOA:Q0BAE0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAE0"
FT                   /protein_id="ABI88883.1"
FT                   /translation="MGKAHALAYRAVANVFPRSLKPRLVAVADVSEAGARQAAEQFGFE
FT                   RATSDWRSLLDDPSVQVVSITTPCSMHREMALAAIAAGKHVHCEKPIAPSAPDAHEMMK
FT                   AAEAANVVTQVGYNYIKNPILKLAQAMIASGELGEITSFRGIHAEDYMADPEIPYGWRV
FT                   DPQNGAGALAEIGNHIVGMARFLLGPITLVNAQLETVNKTRPVAAGSAERREVKVDDIA
FT                   RLMVTFDRGCSGSIEANWTATGRNMQLEFEVYGTNGALLFSQERFNELQYFKAGDDPRT
FT                   TGFARIEAGPVHPPYEHFTVAGGHQLGFNDLKTIEMAEFLAAIEHRSPTFPDFREAWEI
FT                   QRVVDAAIRSSTEGRRIRL"
FT   gene            121149..122732
FT                   /locus_tag="Bamb_3329"
FT   CDS_pept        121149..122732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3329"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: jan:Jann_3088 ABC transporter related; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3329"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88884"
FT                   /db_xref="GOA:Q0BAD9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAD9"
FT                   /protein_id="ABI88884.1"
FT                   /translation="MLQDEKNGADMHAAQSLLCARNLTKRYGGVKALTGVSLELAPGEI
FT                   HALCGENGAGKSTFIKILGGLVQPDEGEIIVDGYPLKLGHRTDPKLISIVHQELAIVPT
FT                   LSVLDNILLGGADQSEIYRRGQYRDAVREHLDSVGLSHIKLEAPASRLSLAECQLVEIA
FT                   RGMSRQAKVLLLDEPTATLSDAEIVRVFEVARRLRDQGTAMIFVSHRLDEVFALTDRIT
FT                   VFRNGQHVLTQRTTDMTTAEVVKAMIGRELVHSKVKPPERRANVTPRLSIDNLSVTDKV
FT                   KDLSVSVAPGEILAVVGQLGSGAEVLVEALAGLRGDISGSVKLDGQTVKLDSVRNSLRA
FT                   GIGYVAEDRADKGVFLDAPIAVNITSSVMAKFSRAGVMRRAGEQEEARRLASMFAIDPK
FT                   RLPHEVSTLSGGNQQKVSLAKAVALSPRLLLLNEPTRGVDIGARSEIYGTLRRMADDGL
FT                   SIVFYSTDLEEILELADSVLTVFRGRMVRHKPRFEIDGDTLLHDIVAGDGSTSHGHVSF
FT                   RNHSVEVGNA"
FT   gene            122725..123735
FT                   /locus_tag="Bamb_3330"
FT   CDS_pept        122725..123735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3330"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="PFAM: inner-membrane translocator; KEGG: sha:SH0178
FT                   ribose ABC transporter permease; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3330"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88885"
FT                   /db_xref="GOA:Q0BAD8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAD8"
FT                   /protein_id="ABI88885.1"
FT                   /translation="MHKTALEPTVQVPSTALRRWAAALLGTTSIHAASIRIATLLLIVV
FT                   AAVVVPHFTEFGNVQSLMYSVAAVGVGAIGMALITLSGNLFMLSMGATAAVSTVMFAAL
FT                   IHLGLGATLLLVVLSGLLMGAIQGGIIAMGKANPIITTIATSSIIIGAGVIFTGGLTVI
FT                   GRGDATWLGQGKLFGWLPTQIVVLAVFGAIASFILQKSRIGREIRLIGMRAEVARIAGL
FT                   RLMAATLVCYGFAGAAAALAGSLIASSSAQGNLTYGVDLDFNAIAAVLVGGISIRGGRG
FT                   HISDAVTGAIFLAVISNILLVSGVSYEYQLVAKGIVVLAAVVFGALLARLGPGRK"
FT   gene            123750..124724
FT                   /locus_tag="Bamb_3331"
FT   CDS_pept        123750..124724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3331"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   psb:Psyr_2373 inner-membrane translocator; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3331"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88886"
FT                   /db_xref="GOA:Q0BAD7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAD7"
FT                   /protein_id="ABI88886.1"
FT                   /translation="MEQSQRLLNLAIRLILLVGMPVIFGLSVDHYFSQANLYAIFQAFA
FT                   FLGIVALGLSVTMVAGEFDLSVAATATVAGLITVKFGGDSAWLGVLSAVIFGVVVGIAN
FT                   AVLLPWLGVSSLVTTVGSMMFLTGVGFWLAGGRVLSYGNLDVSDFLDQNVLGIFSLRSL
FT                   ITVLCFIVVALFLRYTTLGRDIYASGGHRKAAIQSGARVGKALTVGFIISGGLASLGGS
FT                   MLSLSLATASATMGSNILLQAASAAIVGGVALGGGIGSPLGVAMGVLILTVLNNGLGLL
FT                   NATSTQILLVNGLLLLIVVLLDGRLGSVLAAPLGRLARRKAAA"
FT   gene            complement(124976..125899)
FT                   /locus_tag="Bamb_3332"
FT   CDS_pept        complement(124976..125899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3332"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_A4487
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3332"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88887"
FT                   /db_xref="GOA:Q0BAD6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAD6"
FT                   /protein_id="ABI88887.1"
FT                   /translation="MDRWTQLQLFVLTADLGSLSKAAEQLDMSNAAASRTLSSLEERLG
FT                   ARLIERTTRRMWLTDAGREYHRRCTAVIAELAEADAIASEEVVNPRGVLRVTSSVSFAM
FT                   MHLAPALPEFLKRYPNLTVQITATNQYQNFIESGIDIAIRTKEHEGDSCITIRRLAETR
FT                   RVLAASPAYLATHGRPQKPEDLAQHNMLVYNLAVDPYLLHLRRGKEERNIAIASALDSN
FT                   EGQVIVAAGRAGLGIVVQPLYIIHDDIVSGRLVPVLEDWQLPRLTINLAYQSRRYQPAK
FT                   IRVFTDFLIERVKNLNLEERWMTFAA"
FT   gene            126199..127080
FT                   /locus_tag="Bamb_3333"
FT   CDS_pept        126199..127080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3333"
FT                   /product="hydroxyquinol 1,2-dioxygenase"
FT                   /EC_number="1.13.11.1"
FT                   /note="PFAM: intradiol ring-cleavage dioxygenase; Catechol
FT                   dioxygenase, N-terminal domain protein; KEGG:
FT                   bur:Bcep18194_A4486 intradiol ring-cleavage dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3333"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88888"
FT                   /db_xref="GOA:Q0BAD5"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR039390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAD5"
FT                   /protein_id="ABI88888.1"
FT                   /translation="MRNINEDTITQAVIASFSDCKDARLRTVMTSLVQHLHAFARDVHL
FT                   TEDEWFKAIRFLTEVGDITDDKRQEFILLSDTLGLSMLVMSQNNRKPSNCTEATVFGPF
FT                   YVEGAPFYNNGDDISNGAKGAPCYVSGQVRGAGGEVIPDAQIDVWQSDEDGFYDVQNLD
FT                   EAGNAIHRARGRLKGDAEGFFNFRSILAEAYPIPHDGPVGRMLAAVGRHPWRPAHLHFM
FT                   IEAPGYETLITHVFRDGDKYLDSDVVFGVRSTLIAEWKRHEPGVAPDGREIDVPWYSLE
FT                   YDFVLNPSEAHA"
FT   gene            127077..127427
FT                   /locus_tag="Bamb_3334"
FT   CDS_pept        127077..127427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3334"
FT                   /product="Stress responsive alpha-beta barrel domain
FT                   protein"
FT                   /note="PFAM: Stress responsive alpha-beta barrel domain
FT                   protein; KEGG: bja:bll2683 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3334"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88889"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAD4"
FT                   /protein_id="ABI88889.1"
FT                   /translation="MIRHIVMWRVRGDTPAERETASNLVKTKFEALRGRIPGMLHLEVG
FT                   LDYSRVDYACDVVLVTEFDSRGALEAYACHPEHLRVRNEPGDLRIARFQVDYQAGADLG
FT                   SDHTAEPLDAKA"
FT   gene            127414..128490
FT                   /locus_tag="Bamb_3335"
FT   CDS_pept        127414..128490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3335"
FT                   /product="maleylacetate reductase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   bur:Bcep18194_A4484 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3335"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88890"
FT                   /db_xref="GOA:Q0BAD3"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR034786"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAD3"
FT                   /protein_id="ABI88890.1"
FT                   /translation="MQKREFVYQARAGRVVFGPGSLQHLEREVLQLNSERALILCSPEQ
FT                   KETGEAVAARLGKRAAGVFDRAVMHVPLELAKEARALARELHADCAIAVGGGSTIGLGK
FT                   AIALESDLPILAVPTTYAGSEMTPIYGITDAGLKKTGTDLRVLPKTVIYDADLTMSLPV
FT                   ALSVTSGINAIAHAAEALYSRDANPVTSLMAEEGIAALARALPEIVEDSQNVDARSDAL
FT                   YGAWLCGTVLGSVGMALHHKLCHTLGGSFNLPHAQTHTVVLPHALAYNREAAPEAMRCI
FT                   ARALGSDDAALGVFQLAKRCGAPLALKDIGMSAGDVSKAADIASANPYWNPRPIEREAL
FT                   LALLQDAFDGVAPRAATA"
FT   gene            128535..128819
FT                   /locus_tag="Bamb_3336"
FT   CDS_pept        128535..128819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3336"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: bja:bsl2673 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3336"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88891"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAD2"
FT                   /protein_id="ABI88891.1"
FT                   /translation="MHFTVYCLDHPDMVERRLENYDAHKAYLQTAPVNTLISGPLAKPD
FT                   GQTMIGSFFLYEADDIGEIKAFIEADPFNKAGIWATVDIRPFIKRVDNR"
FT   gene            128973..129776
FT                   /locus_tag="Bamb_3337"
FT   CDS_pept        128973..129776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3337"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   tma:TM1724 3-oxoacyl-(acyl carrier protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3337"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88892"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAD1"
FT                   /protein_id="ABI88892.1"
FT                   /translation="METGLEGRIVLITGAAQGIGRATALGFAREGARLCLVDIDADALE
FT                   EAQSELRSLGTSVTIAKADLSTIGGVKGGIDTVLKSYNGEVDILVNNVGAGKVRAFEEL
FT                   SDEEWDFTLSLNFMSYVRTCRYLLPVLRTREKPVIINNASDLARQPEPVPIDYSASKAA
FT                   VLALTKGLARAEAPKIRVNAVAPGPVWTPFWTKQGGFADTMGRFHGMAPKEAVEHELSL
FT                   RQLPLNRLGQPDEVANVIVFLASNLASFVTSSVWGVDGGSIRSLI"
FT   gene            130208..131200
FT                   /locus_tag="Bamb_3338"
FT   CDS_pept        130208..131200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3338"
FT                   /product="myo-inositol 2-dehydrogenase"
FT                   /EC_number="1.1.1.18"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase,
FT                   C-terminal domain; KEGG: bmb:BruAb2_0519 IdhA, myo-inositol
FT                   2-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3338"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88893"
FT                   /db_xref="GOA:Q0BAD0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR030827"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAD0"
FT                   /protein_id="ABI88893.1"
FT                   /translation="MLRIAVLGAGRIGRIHASNVASDRRVKLVVVADPNKEAAQALATD
FT                   LECDVSVDCKAVVDREDVDAVVVGTPTDTHIDLTLQAVRLGKPVLCEKPIDLDIDRALA
FT                   AVEEIERLQGRVMLAFNRRFDPDAMRLKQAIEDGEVGDVRQVIITSRDPGLAPREYLWH
FT                   SGGIFRDMTIHDFDTARWLLGEDPVEVMAIGNRLVDPTLDELPDYDSVMVLLRTASGKQ
FT                   CHINGSRQAVYGFDQRVEVFGSKGMVLNENHRPSTLRRWTRDSTEAREPLLNFFLERHA
FT                   DSYKVELDRFLTALETGAPMPATPRDGIRALRIANCALEAAYTGCAVKI"
FT   gene            131309..132217
FT                   /locus_tag="Bamb_3339"
FT   CDS_pept        131309..132217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3339"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: psb:Psyr_2945 regulatory protein,
FT                   LysR:LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3339"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88894"
FT                   /db_xref="GOA:Q0BAC9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAC9"
FT                   /protein_id="ABI88894.1"
FT                   /translation="MAQVDTFSGVVIFVTAAKSRSFTDAAEQLGLTKSAVGKAIAKLED
FT                   RLGAQLFHRTTRSISLTADGEAYFAACTSALDEIATAETAIGPGNQRPVGRLRIDMPAA
FT                   FGRRILVPILLDIGRKHPDLQFTMTFSDHLIDPIEEGVDLVIRFGELQSSAGLIARRLT
FT                   RQRMLIAASPDYLSRRGTPGNLEALEHHSCVVGYRRGLPLSWRVKINGQAQRISPPGTH
FT                   QISDGDSIVQAALAGMGLCQMPMSLLRPYLDSGALLPVLEDVSSELIDVHAVWPKVAHL
FT                   RPKVRHVVDTLVEIAEQGGLD"
FT   gene            132441..133850
FT                   /locus_tag="Bamb_3340"
FT   CDS_pept        132441..133850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3340"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, large
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   bur:Bcep18194_B2133 3-isopropylmalate dehydratase large
FT                   subunit region"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3340"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88895"
FT                   /db_xref="GOA:Q0BAC8"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0BAC8"
FT                   /protein_id="ABI88895.1"
FT                   /translation="MAQTLYDKLWNTHVVHTEDDGTALLYIDRQLLHEVTSPQAFEGLN
FT                   VAHRPVWRISANLAVSDHNVPTTDRSHGIADPVSKLQVDTLDANCDAFGITQFKMNDVR
FT                   QGIVHIIGPEQGATLPGMTIVCGDSHTSTHGAFGALAHGIGTSEVEHVLATQTLLQKKS
FT                   KNMLVKVEGALPRGCTAKDIVLAIIGRIGTAGGTGYAIEFGGSTIRALTMEGRMTVCNM
FT                   AIEAGARAGMVAVDDTTIDYLKGRPFVPTGAEWDQAVEYWREFKSDEGAQFDRVVELNA
FT                   AEIVPQVTWGTSPEMVTSIDGRVPDPEREKDPVKRDAMERALAYMALEPNTPMESIKVD
FT                   KIFIGSCTNARIEDIRAAAYVVKKLNRRIASNVRLAMVVPGSGLVKAQAEREGLDKVFT
FT                   DAGFEWREPGCSMCLAMNADRLDPGERCASTSNRNFEGRQGAGGRTHLVSPAMAAAAAI
FT                   EGHFVDIRQLG"
FT   gene            133854..134000
FT                   /locus_tag="Bamb_3341"
FT   CDS_pept        133854..134000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3341"
FT                   /product="Entericidin EcnAB"
FT                   /note="PFAM: Entericidin EcnAB; KEGG: entericidin-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3341"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88896"
FT                   /db_xref="GOA:Q0BAC7"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAC7"
FT                   /protein_id="ABI88896.1"
FT                   /translation="MTASKLIARLVAALALAGLGFGLAGCNTVRGFGQDVNAAGNALQR
FT                   AAD"
FT   sig_peptide     133854..133949
FT                   /locus_tag="Bamb_3341"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.995) with cleavage site probability 0.593 at
FT                   residue 32"
FT   gene            134066..134716
FT                   /locus_tag="Bamb_3342"
FT   CDS_pept        134066..134716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3342"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: leuD; 3-isopropylmalate dehydratase, small
FT                   subunit; TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3342"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88897"
FT                   /db_xref="GOA:Q0BAC6"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0BAC6"
FT                   /protein_id="ABI88897.1"
FT                   /translation="MEKFTVHTGVVAPLDRENVDTDAIIPKQFLKSIKRTGFGPNAFDE
FT                   WRYLDHGEPGQDNSKRPLNPDFVLNQPRYQGASVLLARKNFGCGSSREHAPWALQQYGF
FT                   RAIIAPSFADIFFNNCYKNGLLPIVLTEQQVDHLFNDTYAFNGYQLTVDLDAQVVRTGD
FT                   GREYPFEIAAFRKYCLLNGFDDIGLTLRHADKIRQFEAERLAKQPWLNNKLVG"
FT   gene            134792..135859
FT                   /locus_tag="Bamb_3343"
FT   CDS_pept        134792..135859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3343"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="KEGG: bte:BTH_II0674 3-isopropylmalate
FT                   dehydrogenase; TIGRFAM: 3-isopropylmalate dehydrogenase;
FT                   PFAM: isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3343"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88898"
FT                   /db_xref="GOA:Q0BAC5"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAC5"
FT                   /protein_id="ABI88898.1"
FT                   /translation="MKIAVLPGDGIGPEIVNEAVKVLNALDEQFELEQAPVGGAGYEAS
FT                   GHPLPDATLKLAKEADAILFGAVGDWKYDSLERALRPEQAILGLRKHLELFANFRPAIC
FT                   YPQLVDASPLKPELVAGLDILIVRELNGDIYFGQPRGVRAAPDGPFAGAREGFDTMRYS
FT                   EPEVRRIAHVAFQAAQKRAKKLLSVDKSNVLETSQFWRDVMIDVSKEYADVELSHMYVD
FT                   NAAMQLAKAPKQFDVIVTGNMFGDILSDEASMLTGSIGMLPSASLDKNNKGLYEPSHGS
FT                   APDIAGKGIANPLATILSAAMMLRYSLNRAEQADRIERAVKTVLEQGYRTGDVATPGCK
FT                   QVGTAAMGDAVVAAL"
FT   gene            136181..137302
FT                   /locus_tag="Bamb_3344"
FT   CDS_pept        136181..137302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3344"
FT                   /product="aspartate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="KEGG: bur:Bcep18194_B2130 aspartate-semialdehyde
FT                   dehydrogenase; TIGRFAM: aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase, NAD -
FT                   binding; Semialdehyde dehydrogenase, dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3344"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88899"
FT                   /db_xref="GOA:Q0BAC4"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR011534"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAC4"
FT                   /protein_id="ABI88899.1"
FT                   /translation="MNVGLVGWRGMVGSVLMQRMQEEGDFDLIEPVFFSTSNTGGKAPS
FT                   FAKNETTLKDATNVDELKKCDVIITCQGGDYTNDVFPKLRAAGWNGYWIDAASSLRMKD
FT                   DAVIILDPVNLDVIKDALVKGTKNFVGGNCTVSLMLMALGGLFRENLVDWMTAMTYQAA
FT                   SGAGAQNMRELLSQMGALHGAVQEQLADPASAILDIDRRVLATMNSDAMPTSHFGVPLA
FT                   GSLIPWIDKDLGNGMSKEEWKGGAETNKILGKPAMGEPGSIPVDGLCVRIGAMRCHSQA
FT                   LTIKLKKDVPLDEINGILASANDWVKVVPNEREASMRDLSPAKITGTLTVPVGRLRKLA
FT                   MGGEYLSAFTVGDQLLWGAAEPLRRMLRILLDK"
FT   gene            137569..139653
FT                   /locus_tag="Bamb_3345"
FT   CDS_pept        137569..139653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3345"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88900"
FT                   /db_xref="InterPro:IPR020011"
FT                   /db_xref="InterPro:IPR038440"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAC3"
FT                   /protein_id="ABI88900.1"
FT                   /translation="MSRISLFPRQSRLSRAVRGALAILALGTAVSAWAADTGELAASAA
FT                   GGPAPLNVTVQPGQSLNDLAKAATQSHDPAVLARAGRALFDANPQAFMKRDPSRLKVGA
FT                   TLTVPALDATGAALVPAGASSASGASAVSAPASAVVAASGTAAAAVAQHGASAPHPGSA
FT                   VQSAPAASAAHAAPVSGASVAVAAGASAPIGASAAHGASTVEPIQPAAPAAGASGPHVW
FT                   SGAIQSAPSSASDAAAQVTPGGAAQGMHEPSAAAPVAGASQPRPSSLQQLLALKNRVLM
FT                   ELQKHGIGKPADTNNVAPARAPAPAPAAPRPAANDAGASAAAPASAASEASGVVASAVQ
FT                   PASAPVQPAVPVTTAAPARGAAKIDWRPTAMAGGAVLVLAAWFAWRKRRKARPADAIAP
FT                   ESGGAAAVDAGASSSPVEPLPPILPETPLARDAAADVNLIAATAAAAGAADTHEAEVAS
FT                   PPETAKPHDDQPEVPPAHTELERDAAPASHDVKPVAETAADEPLQTPAAPSTNDAQHAA
FT                   LMQNAISALNSLDMPLPPRQADEPAAREGRAESESEQIATNGQSASHPPVGASDLSPEH
FT                   PAEQDDEFDWDPDAATPAPHAGGASAPSSLPPLGGAQFGALKLDFDLDLPSAPGAALPA
FT                   LTPEELARIARNKLDLASEYVELGDLSGARTLLQEVIDANDAATRDDARALLAKLADEA
FT                   "
FT   sig_peptide     137569..137673
FT                   /locus_tag="Bamb_3345"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 1.000 at
FT                   residue 35"
FT   gene            139653..140465
FT                   /locus_tag="Bamb_3346"
FT   CDS_pept        139653..140465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3346"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /note="KEGG: bur:Bcep18194_B2127 pseudouridylate synthase;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: tRNA
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3346"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88901"
FT                   /db_xref="GOA:Q0BAC2"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0BAC2"
FT                   /protein_id="ABI88901.1"
FT                   /translation="MRIALGVQYDGAAFCGWQAQPHGKTVQDALERALGEFACVPLHTT
FT                   VAGRTDTGVHGLGQVVHFDTDLDRTDFSWVRGTNAFLPSTVSVQWAKPMPETFHARFAA
FT                   FERTYYYVLYVHPVRSPMLAGRAGWIHTPLDDDAMRAAAAHLIGEHDFSSFRSSECQSK
FT                   TPVKHLYQIDVRRSGHFIHFRFRANAFLHHMVRNLMGCLVAVGRGRYPADWLADVLAGR
FT                   DRTLAAPTFMADGLYLAHVGYPAEFAVPPAQLGSVPWSSVWADLDLPS"
FT   gene            140462..141163
FT                   /locus_tag="Bamb_3347"
FT   CDS_pept        140462..141163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3347"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="PFAM: N-(5'phosphoribosyl)anthranilate isomerase
FT                   (PRAI); KEGG: bur:Bcep18194_B2126
FT                   N-(5'-phosphoribosyl)anthranilate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3347"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88902"
FT                   /db_xref="GOA:Q0BAC1"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAC1"
FT                   /protein_id="ABI88902.1"
FT                   /translation="MTDHAVPSPTSAATGLAPRTRIKLCGLSRPEDVLHAAALGADAIG
FT                   LVFYPKSPRAVSIAQAAELARLAPPLVSVVGLFVNATEAEIDAVVREVPLTVLQFHGDE
FT                   TPEQCDALGRAARLPWLRAVRVGPSTQPSDLVESALHYSKARGLLFDTLVPDYGGSGKV
FT                   FDWSLIPAELAHRAVLSGGLSAQNVGDAIRQLRPFAVDVSSGIEVEGAKGVKDHARMAA
FT                   FVRAVREADAR"
FT   gene            141220..142413
FT                   /locus_tag="Bamb_3348"
FT   CDS_pept        141220..142413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3348"
FT                   /product="tryptophan synthase, beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit;
FT                   KEGG: bte:BTH_II0679 tryptophan synthase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3348"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88903"
FT                   /db_xref="GOA:Q0BAC0"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAC0"
FT                   /protein_id="ABI88903.1"
FT                   /translation="MYNLPDDHGHFGPYGGVFVAETLIHALDELRAAYEKFRNDPDFVA
FT                   EYERELKHFVGRPSPIYHAQRWSETLGGAQIYLKREDLNHTGAHKINNVIGQALLAKRM
FT                   GKKRVIAETGAGQHGVATATICARFGMECIVYMGAEDVRRQAANVYRMKLLGATVVPVE
FT                   SGSRTLKDALNEAMRDWVTNIESTFYIIGTVAGPHPYPAMVRDFQRVIGDECKVQMPEL
FT                   AGRQPDAVIACVGGGSNAMGIFYPYIDDTSVQLIGVEAAGDGLDTGRHAASLIAGSPGV
FT                   LHGNRTYLLQDDDGQIIETHSVSAGLDYPGVGPEHAWLKDSGRAQYVPITDEEALKAFH
FT                   DCCRIEGIIPALESSHAIAYGVKLAPTLPKDKILLVNLSGRGDKDMHTVAERSGIAL"
FT   gene            142421..143272
FT                   /locus_tag="Bamb_3349"
FT   CDS_pept        142421..143272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3349"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   bur:Bcep18194_B2124 DNA methylase N-4/N-6"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3349"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88904"
FT                   /db_xref="GOA:Q0BAB9"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAB9"
FT                   /protein_id="ABI88904.1"
FT                   /translation="MRDLIEEPGGGAASEAEAGQPAVAVPCALPSGIELHNRDFMTEAA
FT                   RLPDASIDLIVADPPYGLGKDYGNDSDKRSGDDFLAWTREWLELAIPKLKPSGSMYIFC
FT                   TWQYAPEIFSFLKTQLTMVNEIIWDRRVPSMGGTTRRFTSVHDNIGFFAVSKAYYFDLD
FT                   PVRIPYDADTKKARSRKLFEGSKWLEMGYNPKDVWSVSRLHRQHAERVDHPTQKPLEII
FT                   ERMVLASCPPGGRVLDPFMGSGTTAVACARQGRDFVGYEINESYCAIAHERVNALAAQA
FT                   CA"
FT   gene            143314..144132
FT                   /locus_tag="Bamb_3350"
FT   CDS_pept        143314..144132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3350"
FT                   /product="tryptophan synthase, alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: bur:Bcep18194_B2123 tryptophan synthase;
FT                   TIGRFAM: tryptophan synthase, alpha subunit; PFAM:
FT                   tryptophan synthase, alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3350"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88905"
FT                   /db_xref="GOA:Q0BAB8"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAB8"
FT                   /protein_id="ABI88905.1"
FT                   /translation="MSTRIQQTFAALAEQGRKGLIPFITAGDPDPAKTVEFMHALAEGG
FT                   ADVIELGVPFSDPMADGPVIQRSSERALARGVTLKSVLADVKCFRETNQTTPVVLMGYA
FT                   NPIERMGVDAFATEAQAAGVDGVLVVDYPPEEAGVFAEKMRAAQIDPIFLLAPTSTDER
FT                   IADVGKIASGYVYYVSLKGVTGAGNLDVSSIAGKIPAIKSRVPVPVGVGFGIRDAETAR
FT                   AVAEVSDAVVIGSRLVQLLESAAPEGAAAALKTFIAELRAALDGAGKTAR"
FT   gene            144199..145071
FT                   /locus_tag="Bamb_3351"
FT   CDS_pept        144199..145071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3351"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, carboxyl
FT                   transferase, beta subunit; KEGG: bur:Bcep18194_B2122
FT                   acetyl-CoA carboxylase carboxyl transferase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3351"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88906"
FT                   /db_xref="GOA:Q0BAB7"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAB7"
FT                   /protein_id="ABI88906.1"
FT                   /translation="MSWLDKLLPPKIKQTDPKSRKGIPEGLWVKCPSCEAVLYRNDVDA
FT                   NLHVCPKCDHHMRIGARERLDGLLDPEGRYEIGQEIVPVDSLKFKDSRKYPDRLKEAMD
FT                   ETGETDAMVVMGGAIHTLPVVAACFEFSFMGGSMGSVVGERFARGAQNALEQHVPFICF
FT                   TASGGARMQESLLSLMQMAKTTAMLTKLAEAKLPFISVLTDPTMGGVSASFAFLGDVVI
FT                   AEPKALIGFAGPRVIEQTVREKLPEGFQRAEFLLTTGAIDMIVDRRKMRDEIAQLLALL
FT                   QRQPADALA"
FT   gene            145172..146482
FT                   /locus_tag="Bamb_3352"
FT   CDS_pept        145172..146482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3352"
FT                   /product="FolC bifunctional protein"
FT                   /note="TIGRFAM: FolC bifunctional protein; PFAM: Mur
FT                   ligase, middle domain protein; KEGG: bur:Bcep18194_B2121
FT                   folylpolyglutamate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3352"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88907"
FT                   /db_xref="GOA:Q0BAB6"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAB6"
FT                   /protein_id="ABI88907.1"
FT                   /translation="MSTFPTLDAWLSHLERAHPVGIDMGLTRIGQVKAALQLEFACPVI
FT                   TVGGTNGKGSTCAFLEAILVHAGYKVGCHTSPHLLEFAERARVNGQQVSDADLLPHFEA
FT                   VEAARTSLPEPVSLTYFEFTTLAILHLFASRGLDVVILEVGLGGRLDAVNIIDTDCAIV
FT                   TSIDIDHTEYLGDTREKIAFEKAGIFRAGKPAICGDPAVPNTLIDHAAAIGADLWLVGR
FT                   DFRYEAQPGAERQQWSYLGRDKRYPALAYPALRGANQLINASAALAALEALRPVLPVSA
FT                   QDIRLGLANVELPGRFQVLPGKPAIVLDVAHNPHAAAVLEQNLGNMGFFPYTYAVFGAM
FT                   HDKDIDGVLRHLAGEVDHWCVTDLPLPRAASAEQLEAALRKAGVEDGPDSSVTRFASPA
FT                   EAFRDALKRASENDRIVVFGSFHTVAGVMAYRKSQQH"
FT   gene            146512..147369
FT                   /locus_tag="Bamb_3353"
FT   CDS_pept        146512..147369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3353"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG:
FT                   bur:Bcep18194_B2120 sporulation related repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3353"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88908"
FT                   /db_xref="GOA:Q0BAB5"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAB5"
FT                   /protein_id="ABI88908.1"
FT                   /translation="MGIFSFGKKDDDAPTRRGGRTGASRNVRTERTERVERRTRRTERP
FT                   ESDALLLDPTLPEKQRARRRLVGAIALVVGAVIVLPMVLDSHPKPVTDDIAIDIPNRPA
FT                   HQAVAPRDDDVADVQAGVAHDEPPASDVAVAAAPAPAPKDTAKPAAKPAATTSTTPTTT
FT                   ASVTPPKPAAKPAAPAAKPVAPKPAPAPATVANADAATDSGDASSPASPAGARFAVQLG
FT                   SFKDDTTARSWATKLKSAGVPAYVEHRKQADGSTATLLRAGPFADRAAASAAIAKVREA
FT                   GLTQ"
FT   gene            147376..147870
FT                   /locus_tag="Bamb_3354"
FT   CDS_pept        147376..147870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3354"
FT                   /product="Colicin V production protein"
FT                   /note="PFAM: Colicin V production protein; KEGG:
FT                   bur:Bcep18194_B2119 colicin V production protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3354"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88909"
FT                   /db_xref="GOA:Q0BAB4"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAB4"
FT                   /protein_id="ABI88909.1"
FT                   /translation="MLTAFDYAVLAVIALSALRGAWRGFVSEIFGLIGWIVAVVIAARY
FT                   VGLVVPYIPANWPGGALTQWVLAFALIVIGVVFVAGVANALLSRIAQATGLGGVDRSLG
FT                   MMFGLVRGCVLVVLLVAAAGLTELPKQDFWRNALLRPFAEQGVHELKQLLPDGMAQYVR
FT                   V"
FT   gene            147922..149454
FT                   /locus_tag="Bamb_3355"
FT   CDS_pept        147922..149454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3355"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase, class-II;
FT                   phosphoribosyltransferase; KEGG: bur:Bcep18194_B2118
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3355"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88910"
FT                   /db_xref="GOA:Q0BAB3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAB3"
FT                   /protein_id="ABI88910.1"
FT                   /translation="MCGIVGVISQSPVNQLIYDSLLLLQHRGQDAAGIATADGSNFHMY
FT                   KANGMVRDVFRTRNMRSLPGTFGIGQVRYPTAGSASSEAEAQPFYVNAPFGIILAHNGN
FT                   LTNWEQLKDEMFRIDRRHINTNSDSEVLLNVFAHELQLSTTGLELDPAAVFKAVAGVHR
FT                   RLEGSYAIVSLIAGYGLLAFRDPFGIRPLCLGKLETEHGTEWMVASESVAVEGIGFEFV
FT                   RDVQPGEAIFIDKAGNFHSQQCAEQPTLNPCMFEYVYLARPDSCLDGVPVYNVRLRMGD
FT                   YLAEKIKRELPNVPIDVVMPIPDSSRPAAMQVAAKLGVEYREGFFKNRYVGRTFIMPGQ
FT                   AVRKKSVRQKLNAMSIEFKDKNVLIVDDSIVRGTTSHEIVQMARDAGAKSVIFASAAPP
FT                   VKFPNVYGIDMPTRGELVAHGRTDEEVAKIIGADHLIYQDVDDLRRAVRDINPKLERFE
FT                   ASCFDGNYITGAVTPEYLDAIERARLAPASQADRDTAGDTARSQMNLQLSVE"
FT   gene            149673..150905
FT                   /locus_tag="Bamb_3356"
FT   CDS_pept        149673..150905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3356"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /EC_number="2.5.1.48"
FT                   /note="KEGG: bur:Bcep18194_B2117 O-succinylhomoserine
FT                   sulfhydrylase; TIGRFAM: O-succinylhomoserine sulfhydrylase;
FT                   PFAM: Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   enzymes; aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3356"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88911"
FT                   /db_xref="GOA:Q0BAB2"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAB2"
FT                   /protein_id="ABI88911.1"
FT                   /translation="MIRGAPFEYGKRNMDDSLNFDTLAVRAGTLRSSDFNEHSEALFLT
FT                   SSFCFKSAAEAAERFANSEDYFTYSRFTNPTVTMFQDRLAALEGGEACIATASGMAAIM
FT                   SVVMSALQAGDHLVSSRSLFGSTLGMFSQIFSKFGITTTFVDPTDLNAWQEAVRPETKM
FT                   FFLETPSNPLTELADIEAIGKIAKAANALFVVDNCFCSPVLQQPLKLGADVVMHSATKF
FT                   LDGQGRVLGGALVGSKAFIMGKVFPFVRSAGPTLSAFNAWVLLKGMETLSLRVEKQSAN
FT                   ALEIARWLDSHPAVARVFYPGLESHPQHELAKRQQKAGGAIVSFELKGDTPEQQRANAW
FT                   RVIDSTKLISITGNLGDTRTTITHPATTTHARITPEARAAADITEGLLRLAVGLEDAGD
FT                   LRRDLTRGLEG"
FT   gene            complement(151001..151969)
FT                   /locus_tag="Bamb_3357"
FT   CDS_pept        complement(151001..151969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3357"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal
FT                   domain; KEGG: bur:Bcep18194_B2116 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3357"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88912"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAB1"
FT                   /protein_id="ABI88912.1"
FT                   /translation="MTRTEAGRPSRRAFVTGLTGFTGRYMAQRLEAAGYDVWGTVAPGA
FT                   ARPDDPAFANCTLLPVDLLDANAMRAAAADARPDAVVHLAARAHVAQDEPSQTYAVNIV
FT                   GTRNLLAALAGLDHRPSAVLLASSANVYGNSTAGVLDEATPPAPANDYAVSKLAMEYAA
FT                   KLWADQLPIVIARPFNYTGVGQDDAYLLPKLVSHYARNAPRISLGNLDVSRDFSDVRDV
FT                   TAAYLKLLDAAPAGETFNVCSERAYSLKEVLAMLSRIAGYVIDVTIDPRFVRHNEVKRL
FT                   SGSRDKLRRAVGELPVTPLDDTLRWMMEAMRDVPGQPAQAG"
FT   gene            complement(151956..153002)
FT                   /locus_tag="Bamb_3358"
FT   CDS_pept        complement(151956..153002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3358"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; KEGG:
FT                   bur:Bcep18194_B2115 GDP-mannose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3358"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88913"
FT                   /db_xref="GOA:Q0BAB0"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAB0"
FT                   /protein_id="ABI88913.1"
FT                   /translation="MSQNRKKAIITGITGQDGAYLTKLLLDKGYEVTGTYRRTSSVNFW
FT                   RIAELGVDTHPNLSLVEHDLTDAGSSLRLLERTQPDELYNLAAQSFVGVSFDQPATTAE
FT                   VTGIGPLNLLEAIRVVSPKTRFYQASTSEMFGKVQAIPQTETTAFYPRSPYGVAKLYAH
FT                   WMTVNYRESYDLFGCSGILFNHESPLRGREFVTRKITDTVAKIQLGKATKLELGNLDAK
FT                   RDWGFALEYVEGMWRMLQVDEPDTYVLATNRTETVRDFVRMAFAAAGYQLEWTGKGEQE
FT                   RGIDASNGNVLVEVNPKFYRPAEVDLLIGCADKAKSKLGWAPETTLEQLCQMMVEADLT
FT                   RNRHHDTY"
FT   gene            complement(153038..154102)
FT                   /locus_tag="Bamb_3359"
FT   CDS_pept        complement(153038..154102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3359"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: bur:Bcep18194_B2114
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3359"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88914"
FT                   /db_xref="GOA:Q0BAA9"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAA9"
FT                   /protein_id="ABI88914.1"
FT                   /translation="MTGISRTADLAPPQHGRIVQLDGLRAIAVGAVFLQHALKAPLWMG
FT                   VDLFFVLSGLLITGILLDRKARGQSYFSHFYARRVRRILPPYVLLLVVSTLLFGASWLP
FT                   HWPWFAFFSTNIGLSLGSIGHDSLNVLWSLAVEEQFYIFWPFVVLWCSERALLWIAAAL
FT                   IVAAPVLRAIATPWFDSFWPIYYLTPFRMDLLAAGALLAIVLRRDRRALDPFYPLAIVG
FT                   ALVSLAILGWLHLSFPRFRAANTPMSNAALYSISLLLCTSIVVIALRGRGLVQRVLTNP
FT                   LLVYVGTVSYTVYLIHLSVLYALWPLHLNRFVTAALALAITLAYATLCWYGFERRLTRG
FT                   PARNTLPAAARTTA"
FT   gene            154182..154472
FT                   /pseudo
FT                   /locus_tag="Bamb_3360"
FT   gene            154572..156788
FT                   /locus_tag="Bamb_3361"
FT   CDS_pept        154572..156788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3361"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2113 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3361"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88915"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAA8"
FT                   /protein_id="ABI88915.1"
FT                   /translation="MRRLILVGMTVCAALSVSAAPAETVLPATTSWIGNTFGYGDGSWT
FT                   QIDIRAIAVTPDGKVYTNAPWDESGAEASVYQDGKMLGFAGGTHGWGNLGGNAVAVNGK
FT                   YAYVAIGVGNERGHLQSPGIWPDKGKQWFGISRRTIGDMKQPAPFRAAPQVAPGGRADA
FT                   GRARMAASFMVMNEVAAPARSEVGEAKAEVGGLAADDKTLFATNPSHDEVDVFDAETMQ
FT                   KKGTWSAHEPGRIALAGDGTLWLLTDTISGPARLVHVRADGRKLDDAPALPEGTEAVDV
FT                   AVDVKGRVLVADNGARQQVLIFSKGGKGYAPSGTLGERGGIFAGPVPGRPGPQRFNGLT
FT                   GVGVDRAGNVYVSMNGIGPRHDTIGAGLGAVLESYTPDGKLRWQVQGLLFVDGAWIDPA
FT                   RPNSVYTGNKRFELDLSKPPGQDWKYAGFLSNRFKYPDDPVFHTDQYPGMPFARRVDGR
FT                   TFLYLTDMYADHLKIYRFDAKRDGEVAIPSGLIAGRARPVDKVPNKPPGGDWLWRDANG
FT                   NGRLDADEFTINTTGKAKAGGWGWWVDTKGDIWRTSDVRGIHRFGYGGVDKAGNPIYSY
FT                   DKVTTYPMPQPFTQLRRSIYEPQTDTLYVTGYTADAPPQPGINKEVGRVLVRFDKWSTG
FT                   SPVVRYTVALPWQLDAKPILDLIGITVEGRYIFTVEPVGKIHVYDKETGKEVGVMSPGA
FT                   EVGKASGWVDVPFGISAFRRENGEYLVFVEEDARGKVLMYRWKP"
FT   sig_peptide     154572..154631
FT                   /locus_tag="Bamb_3361"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.991 at
FT                   residue 20"
FT   gene            156830..158296
FT                   /locus_tag="Bamb_3362"
FT   CDS_pept        156830..158296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3362"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   bur:Bcep18194_B2112 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3362"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88916"
FT                   /db_xref="GOA:Q0BAA7"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAA7"
FT                   /protein_id="ABI88916.1"
FT                   /translation="MDKGILKNVSINFIGLILPTFVSLVTVPAYIHALGVERYGVVSLV
FT                   WTLIGYFGILDLGMSMAAQNHISKALASGNADESARVFWSAFWLNLGTGIVGGLLIYFG
FT                   AFVYTAYFTKVSAAMQHEVYLALPWLALAIPLANVSWVFAGAINGAERFGVFNTNQTIG
FT                   TFLFQLLPLGAAWWIAPNLQTVLAAAVVARLVAAVMLGHASIKVLGIRRIDPPQWGTAK
FT                   GLFNFGGWMLIASTTSMIADTLDRVMLGAGMGAKFVTYYTVPQNLVTRLNMLPNALVRT
FT                   LFPRLSAVGRDHADTLARQSLEFLNGVFTPVGIVAIFALAPFLTLWVGADLAAHSAPVG
FT                   RVLVISVWLVGQASVTRILIQSQVNPARAAFAGLVEMPFFVGGLWFGIHHFGLIGAAVV
FT                   VAARALVDYGVLLYLSAIRMRAILLDMLAHLAFLLASLFLAQAWSGLGESIGLCAVVLL
FT                   LNLAWSLTMTPGLRALVRDLFVRLNARKTI"
FT   gene            complement(158310..159362)
FT                   /locus_tag="Bamb_3363"
FT   CDS_pept        complement(158310..159362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3363"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase, IS891/IS1136/IS1341 family;
FT                   transposase, IS605 OrfB; KEGG: noc:Noc_1587 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3363"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88917"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAA6"
FT                   /protein_id="ABI88917.1"
FT                   /translation="MILVYRYRVKSLNGLLNKQSRAVNYVWNFCNDTQKHALKWRKKWP
FT                   TGFDLNVLTTGSSKELGIHSGTVNATCEQYAKSRNQHRRPYLRYRGRKSLGWVPLKGRD
FT                   LKREGDAFRFAGNTFRVFNSRPLPDGKIKDGTNFAQDARGNWFLNIVIEMPDVQARPIR
FT                   SGVGIDLGLKDFATLSTGEKLPNDQFGRRAAEKLAKAQRARKHKRHIAKLHAKVTNARA
FT                   DFQHKLALDLVRRFDYIAVGNVSAAKLARTRMAKSVYDAAWSSFRSKLRYKAIAHGAMF
FT                   EQVDESGSTQSCSACGSKASTTRPKGIAGLRIREWACDGCGVVHDRDINAALNILRCGR
FT                   ASPVVGIRCL"
FT   gene            159479..161947
FT                   /locus_tag="Bamb_3364"
FT   CDS_pept        159479..161947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3364"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   bur:Bcep18194_B2111 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3364"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88918"
FT                   /db_xref="GOA:Q0BAA5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAA5"
FT                   /protein_id="ABI88918.1"
FT                   /translation="MNRDLAEHAILNVATADAAVAEAGATALRRTETAAPAGARDASRP
FT                   LRVAIVHDWLVTYAGAERVLEQIVACFPDADLFSLVDFLDDRAFVRGKPVTTSFIQKLP
FT                   FARTKYRSYLPLMPLAIEQLDVSDYDLVISSSHAVAKGVLTGPDQMHISYVHSPIRYAW
FT                   DLQHQYLEQSNLTHGPKSLLARMILHYIRNWDTRTANAVDGFVANSAFIARRIRKVYHR
FT                   DAAVIFPPVDVDGFSLNEVKDDFYLTASRMVPYKKIDLIVEAFSRTPERKLVVIGDGPE
FT                   MQKIRAKAGPNVEIMGYQPFAVLHDRMRRAKAFVFAAEEDFGISVVEAQACGTPVIAYG
FT                   KGGALETVLEPRSHANPTGLFFDEQTPHAIVAAVDDFERAPQRFTPHACRANAERFSAD
FT                   TFRRRFLDYVEAALPGATAQRGSAAPMPAAHGPATLVLDQSGVLGGAELSLLEIMKHMR
FT                   ANADVLLFDDGPFRAALDEIGARVDVLDQGALAGVRKQGGVSVGALKRLAGLVRDVARR
FT                   ARRAEVIYANTQRAMVVAALAGRLARKPVVWHLRDIVSGDHFGSKQLMAIKYCARFGVT
FT                   RVIANSDASAQAFRALTGFTPQHVDVVFNGISAEPFDALDHASQAALRARFGLPEHAWL
FT                   VGSFSRLAHWKGQHLLLEAAARHPDMHVVLVGAPLFGEDEYAAQLHEIVARHGMGDRVH
FT                   FLGFQRDVAACMKAVDVVAHTSITPEPFGRVIVEGMLARRPVVAARAGGVVEIIEDEEN
FT                   GLLCEPGNAAALADALGRLKHDTALRERLVASGRATAVRRFGTETYVERVEKILADTAK
FT                   AAKAAKAKKR"
FT   gene            complement(162364..163539)
FT                   /locus_tag="Bamb_3365"
FT   CDS_pept        complement(162364..163539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3365"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: bur:Bcep18194_B2110
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3365"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88919"
FT                   /db_xref="GOA:Q0BAA4"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAA4"
FT                   /protein_id="ABI88919.1"
FT                   /translation="MQASSGSPLTAPPVADHKEHVIDAMRGFAALLVAYFHCRQVVWVG
FT                   MQSFHRAYGHALDPSVIVGYLTFPFAWGSAGVPIFFVISGYCIHRNAALKLAANPAYRL
FT                   DAPNFWARRFARIYPVLLAALLFTLAMDAVSLQIAPVSHKIRDVGLTAFLVNLFSLQGV
FT                   AGYTYGSNGALWTLSLEVQFYAIYPLLFALRRRIGMPAIVATVALVNVASAWLLERHDL
FT                   QFFTSYWLSWTIGAWIADVRAQPAHGPAAVPSRAWYLAAAVLLAAGCGAFHIGQYGAFQ
FT                   LWAAGFACFLYRALACPPRPTPLLRVLGWFGDFSYSLYLIHLPLFVCLGSVLFHSELQL
FT                   SIWPSFAFMAAAIPVAYVFYRLFERPAMMWAASLKPTRTARVVAPAPERAV"
FT   gene            163753..163896
FT                   /locus_tag="Bamb_3366"
FT   CDS_pept        163753..163896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3366"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3366"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88920"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAA3"
FT                   /protein_id="ABI88920.1"
FT                   /translation="MDMHWIASAAVLLVMAVLSAYREALQNEPIRPGLERGGVPFIEEF
FT                   DS"
FT   sig_peptide     163753..163827
FT                   /locus_tag="Bamb_3366"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.957) with cleavage site probability 0.658 at
FT                   residue 25"
FT   gene            164126..165013
FT                   /locus_tag="Bamb_3367"
FT   CDS_pept        164126..165013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3367"
FT                   /product="UDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.9"
FT                   /note="TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase; KEGG:
FT                   bur:Bcep18194_B2109 UTP--glucose-1-phosphate
FT                   uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3367"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88921"
FT                   /db_xref="GOA:Q0BAA2"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAA2"
FT                   /protein_id="ABI88921.1"
FT                   /translation="MLKVTRAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEA
FT                   INAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLELVRGIKPSHVNCFYVR
FT                   QPEALGLGHAVLCAEKLVHGEPFAVILADDLLHGEQPVLKQLVDVFDHYHSSVIGVETI
FT                   PREDSRSYGVVEGREWEEDIIKLSGIIEKPAPEDAPSNLGVVGRYVFMPTIFDHLRKLK
FT                   PGAGGELQLTDAVQSLLANEQVLAYRYFGTRFDCGSKIGYLKATVELALQHPEVSREFE
FT                   AYLRTCLPALAAVA"
FT   gene            165223..165537
FT                   /locus_tag="Bamb_3368"
FT   CDS_pept        165223..165537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3368"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88922"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAA1"
FT                   /protein_id="ABI88922.1"
FT                   /translation="MRWLPDAVAMKPALTCRLCAASGTKIARAIAVVDAGSVMSTKRHV
FT                   SAAALSSADEMRVPDGRTGPPAAPFRCPASWAPNACFPLASRADDCSAQRGDVLGRATK
FT                   "
FT   gene            complement(165501..166619)
FT                   /locus_tag="Bamb_3369"
FT   CDS_pept        complement(165501..166619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3369"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: bur:Bcep18194_B2107
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3369"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88923"
FT                   /db_xref="GOA:Q0BAA0"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BAA0"
FT                   /protein_id="ABI88923.1"
FT                   /translation="MREVRYVKGLDGLRAIAVILVFLSHKGHVLAVDVGKLGVWTFFFI
FT                   SGFLIVGELHRNRQAIECGTMGRRHALALFLAKRALRIFPVYYLLLAALAIAHALFYQR
FT                   GVNLGLPWHAAFLSNYWIGVVKDGWPGSTSHFWSLAVEQQFYLIAPLTLLAVPAARHVA
FT                   LGIAAVALCALAHLALYAFDASPVLIYAFSPWNFALIALGGVGAMALADRGPTVVRRIP
FT                   PGWLAAVGVVFFLTLPAFTALPDIVSGLVDLGLSVSLGALMLWIVTEPDHPAVALLDRA
FT                   PLVYLGTISYGFYLFHNLIPTRFGEMPALFAHVPMPGIVREALPELLQFALAVLLAHLS
FT                   WRYLERRLLDFKKPIAAMLARYFVARPSTSPR"
FT   gene            complement(166646..167107)
FT                   /locus_tag="Bamb_3370"
FT   CDS_pept        complement(166646..167107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3370"
FT                   /product="acyltransferase family protein"
FT                   /note="KEGG: acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3370"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88924"
FT                   /db_xref="GOA:Q0BA99"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA99"
FT                   /protein_id="ABI88924.1"
FT                   /translation="MSTALTAFTSTAARSAMCVASDAFVNLSFSGVGAAGAAFATAFLA
FT                   TTFFAGAAFFAATFLVAGAAAFLATFFAEVAMFLLPGVVVGYTKRATRALQRRILQAPR
FT                   RFVQYFYAFSRGFPQVLLRATDFIDARTAKNSSTYTPERELRSIFAHLY"
FT   sig_peptide     complement(167045..167107)
FT                   /locus_tag="Bamb_3370"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.966) with cleavage site probability 0.618 at
FT                   residue 21"
FT   gene            complement(167138..167425)
FT                   /locus_tag="Bamb_3371"
FT   CDS_pept        complement(167138..167425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3371"
FT                   /product="acyltransferase family protein"
FT                   /note="KEGG: acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3371"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88925"
FT                   /db_xref="GOA:Q0BA98"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA98"
FT                   /protein_id="ABI88925.1"
FT                   /translation="MRSAIKIPARFRVRGPSDIVTVADLHSAAVTRHYAAASFSFFSAR
FT                   AFTRTLAGFAGNQRSSPVNGSLPKRFFFAGTTCAVIFSRPGSVNSPAPFL"
FT   gene            167797..168192
FT                   /locus_tag="Bamb_3372"
FT   CDS_pept        167797..168192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3372"
FT                   /product="streptomycin 3''-adenylyltransferase"
FT                   /note="KEGG: bur:Bcep18194_B2105 streptomycin
FT                   3''-adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3372"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88926"
FT                   /db_xref="GOA:Q0BA97"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA97"
FT                   /protein_id="ABI88926.1"
FT                   /translation="MVDLLDVSALPGSTAHMRPLEATIVVRGDVVSWRHPARRALQLDE
FT                   WLRRDLRAGIVESPSVGRDLAILLTKIRKHDVALLGSRAAAWFEPVPAHDFVAASCPPS
FT                   CSGMPNGTGAATNTASCLRTHASSKAP"
FT   gene            complement(168645..169118)
FT                   /locus_tag="Bamb_3373"
FT   CDS_pept        complement(168645..169118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3373"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /note="PFAM: 3-demethylubiquinone-9 3-methyltransferase;
FT                   KEGG: bur:Bcep18194_B2104 3-demethylubiquinone-9
FT                   3-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3373"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88927"
FT                   /db_xref="GOA:Q0BA96"
FT                   /db_xref="InterPro:IPR009725"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA96"
FT                   /protein_id="ABI88927.1"
FT                   /translation="MTIQKITPFLWYATEAEEAAAFYTDIFPNSRVVRVTAVPGTSGTR
FT                   MVEFELFGQPFTAMSHPRTETFNHAISLMVSCADQAELDRYWSALLDNGGTADGCGWLR
FT                   DRFGVSWQIVPDALIPMMTDRDEVKAARVAAAMMQMTKFDVAALKAAYAGTAG"
FT   gene            complement(169507..170664)
FT                   /locus_tag="Bamb_3374"
FT   CDS_pept        complement(169507..170664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3374"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG:
FT                   bur:Bcep18194_B2103 outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3374"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88928"
FT                   /db_xref="GOA:Q0BA95"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA95"
FT                   /protein_id="ABI88928.1"
FT                   /translation="MKKLALSTLSLALLGAAGAAHAQSSVTLYGVIDTSIAWVHGNNGQ
FT                   ANNSWQMLSGNLQGSRWGLKGAEDLGGGLKAIFQLENGFDPGTGHLNQGSRMFGRQAFV
FT                   GLQSDQYGTLTLGRQYDPLVDLVQAVTADNYFGSVMATPGDVDNNDNSLRVSNAIKYTS
FT                   PVWGGFQVEGMYALGGVAGKTGSGQTWSVAAAYNNGPVGVAAGYFYAANPSPTTAVGRA
FT                   GWGSTTSDAIFDGPINSGYATAKSIAIAQVAGQYALGPVTFGLGYSNAQYKPDAFSGFG
FT                   STEKYNTGRAFVTYQVTPPLLLGLGYSYTRASGDTKAKYHQVGVGADYSLSKRTDIYLV
FT                   GAYQHASGTQLVDGVQQSAQASIASYGFAGKSSAELVALGIRHKF"
FT   sig_peptide     complement(170596..170664)
FT                   /locus_tag="Bamb_3374"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(171109..172041)
FT                   /locus_tag="Bamb_3375"
FT   CDS_pept        complement(171109..172041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3375"
FT                   /product="putative ribonuclease BN"
FT                   /note="TIGRFAM: putative ribonuclease BN; PFAM:
FT                   ribonuclease BN; KEGG: bur:Bcep18194_B2102 ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3375"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88929"
FT                   /db_xref="GOA:Q0BA94"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA94"
FT                   /protein_id="ABI88929.1"
FT                   /translation="MKRQITSEATRLAQQQANWALNAFKRFSSHRCSAMAASIAFFSAF
FT                   SLAPTLVMVIAVAGWFYGDEAARGQVFEQAHQLIGDDAAASIQTIVQNAHRAGERGGIA
FT                   TLISFAALAIGASATFASLNTALSVIWPNSENRWSSMLGLVRVRLISFGLVLGVAFLLI
FT                   VSLVLDTVITFIGTWLLGDSPYVAITNVLQLVVGVAVLAGAFAVLMKFLPDAHVAWHDA
FT                   VIGGIVSAILFSGGKKLFALYLARAGTASAFGAAGSFAVLLMWLYFSAAVLLLGAEFAA
FT                   ARGDAHRGARNAAGVPAPMDPTADRTRDD"
FT   sig_peptide     complement(171865..172041)
FT                   /locus_tag="Bamb_3375"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.957) with cleavage site probability 0.499 at
FT                   residue 59"
FT   gene            172181..172771
FT                   /locus_tag="Bamb_3376"
FT   CDS_pept        172181..172771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3376"
FT                   /product="formate dehydrogenase (quinone-dependent)
FT                   catalytic subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="KEGG: bur:Bcep18194_B2101 molybdopterin
FT                   oxidoreductase; TIGRFAM: Twin-arginine translocation
FT                   pathway signal; PFAM: molybdopterin oxidoreductase Fe4S4
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3376"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88930"
FT                   /db_xref="GOA:Q0BA93"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA93"
FT                   /protein_id="ABI88930.1"
FT                   /translation="MLQMSRRQFLKVTATSLAGSSLALLGFSPTEALAEVRQYKLARTV
FT                   ETRNTCPYCSVGCGILMYSLGDGAKNAQPSIIHIEGDPDHPVNRGTLCPKGASLIDFIH
FT                   SPSRLTHPEYRAPGSDKWERISWGDALDRIAKLMKADRDANFVETAEDGAKVNRWLTTG
FT                   MLAASAGSNEVGYLTHKAVRSLGMLVFDNQARV"
FT   sig_peptide     172181..172285
FT                   /locus_tag="Bamb_3376"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.807 at
FT                   residue 35"
FT   gene            172784..175252
FT                   /locus_tag="Bamb_3377"
FT   CDS_pept        172784..175252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3377"
FT                   /product="formate dehydrogenase (quinone-dependent)
FT                   catalytic subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="KEGG: bur:Bcep18194_B2100 formate dehydrogenase,
FT                   alpha subunit, anaerobic; TIGRFAM: formate dehydrogenase,
FT                   alpha subunit; PFAM: molydopterin dinucleotide-binding
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3377"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88931"
FT                   /db_xref="GOA:Q0BA92"
FT                   /db_xref="InterPro:IPR006443"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA92"
FT                   /protein_id="ABI88931.1"
FT                   /translation="MAGLAPTFGRGAMTNHWVDIKNADVILVMGGNAAEAHPCGFKWVT
FT                   EAKAHRKARLIVVDPRFTRTASVADYYAPIRTGTDIVFLGGVINYLLTNDKIQHEYVKN
FT                   YTDFSFIVREDFAFNDGIYSGYDAEKHAYPDKSSWDYERGDDGFVKVDPTLQHPRCVYN
FT                   LMKQHYARYTPDMVQQTCGTPKEKFLKVCEMLATTAVPGRAGTVLYALGWTHHSIGSQM
FT                   IRTGAMVQLLLGNIGIAGGGMNALRGHSNIQGLTDLGLMSNLLPGYMTLPMQAEQDFDG
FT                   YLKKRTQQPLRPNQLSYWKNYKAFHVSFMKSWWGDAATAENNWGYDYLPKLDKQYDLLQ
FT                   AIELMNEGKMTGYICQGFNPLAAAPSKVKTAAGLAKLKWLVIMDPLATETSEFWKHHGD
FT                   YNDVDASKIQTEVFRLPTTCFAEEDGSLVSSSRVLQWHWKGAEPPGEAKSDLEIMSGLF
FT                   LRMRKMYQKDGGKYPDPIVNLTWPYANPESPTPAELAMEFNGRALADLPDPKDPTKTLV
FT                   KKGEQLAAFAQLKDDGTTASGCWIFCGAWTQAGNQMGRRDNSDPTGIGQTLNWAWAWPA
FT                   NRRILYNRASCDVSGKPFDPTRTLIGWNGSAWKGPDVPDFKADEPPENGMGPFIMNPEG
FT                   VARFFARAGMNEGPFPEHYEPFETPLAANPLHPNNPQALNNPAARVFPGDRASFGKVSE
FT                   FPHVATTYRLTEHFHYWTKHARLNSIIQPEQFVEIGEDLAKEVGVAHGDRVKVSSKRGY
FT                   IVAVALVTKRIKPLTIEGKKVQTVGVPLHWGFKGLTKPGYLANTLTPSVGDGNSYTPEF
FT                   KSFLVKVEKA"
FT   gene            175263..176177
FT                   /locus_tag="Bamb_3378"
FT   CDS_pept        175263..176177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3378"
FT                   /product="formate dehydrogenase (quinone-dependent)
FT                   iron-sulfur subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="TIGRFAM: formate dehydrogenase, beta subunit; PFAM:
FT                   4Fe-4S ferredoxin, iron-sulfur binding domain protein;
FT                   KEGG: bur:Bcep18194_B2099 formate dehydrogenase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3378"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88932"
FT                   /db_xref="GOA:Q0BA91"
FT                   /db_xref="InterPro:IPR006470"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR015246"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR038384"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA91"
FT                   /protein_id="ABI88932.1"
FT                   /translation="MALQSLDIKRVSATTTPPPTAREPVTGSVAKLIDVSKCIGCKACQ
FT                   TACMEWNDLRDEVGTNVGVYDNPADLTEHSWTVMRFSEYENPAGDLEWLIRKDGCMHCE
FT                   DPGCLKACPSPGAIVQYNNGIVDFHEENCIGCGYCVTGCPFNVPRISKKDHRAYKCTLC
FT                   SDRVAVGQEPACVKTCPTGAIVFGTKEDMKQHAAERIEDLKERGFEHAGLYDPQGVGGT
FT                   HVMYVLHHADKPSLYHGLPDDPSISPMVRLWKGIAKPLAVAGIALTALAGFFHYIRVGP
FT                   NEVTAEDEAAARDEARRIEEDAK"
FT   gene            176174..176800
FT                   /locus_tag="Bamb_3379"
FT   CDS_pept        176174..176800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3379"
FT                   /product="formate dehydrogenase (quinone-dependent)
FT                   cytochrome b subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit; PFAM:
FT                   cytochrome B561; KEGG: bur:Bcep18194_B2098 formate
FT                   dehydrogenase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3379"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88933"
FT                   /db_xref="GOA:Q0BA90"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA90"
FT                   /protein_id="ABI88933.1"
FT                   /translation="MKHDDPNLIVRYTANERTNHWITAITFVLLALSGLALFHPSMFWL
FT                   TALFGGGQWTRILHPFIGLVMFVSFAILVVRFWHHNVLDADDRQWLRQIDDVVTNREDR
FT                   LPPVGRYNAGQKLLFFTLVACLLLLLLSGIVIWRRYFSFYFPIGVIRAAAVVHAVAAFV
FT                   LIVSIIVHIYAALWVKGSIGAMVRGTVTLGWARKHHPKWFRESVK"
FT   gene            176827..177843
FT                   /locus_tag="Bamb_3380"
FT   CDS_pept        176827..177843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3380"
FT                   /product="formate dehydrogenase accessory protein FdhE"
FT                   /note="TIGRFAM: formate dehydrogenase accessory protein
FT                   FdhE; PFAM: formate dehydrogenase accessory protein; KEGG:
FT                   bur:Bcep18194_B2097 formate dehydrogenase accessory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3380"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88934"
FT                   /db_xref="GOA:Q0BA89"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA89"
FT                   /protein_id="ABI88934.1"
FT                   /translation="MRRTVPPPAGIARSADSSALTYLEDIFVTQRILEPTEISALDHSA
FT                   IPRFRLPERATVFSARAARLRKLADLNPISGYLRLMATVADAQHATLQTLELPLPSKEA
FT                   IARAQQHSMPLVPALGGERDPRWRAVLYELLDRVEGAGLVNPQLAKLLDRLRLMSPAEL
FT                   DAQAEAILALRFAEVDPATAPFLMAALQVVWTDLASRIAPAEIPYLDQPGLCPVCGTHP
FT                   VASVVRVGGQFQGYRFLQCGLCTTEWHMVRTKCSHCDSTKGIAYHGIEGGSEAIKAESC
FT                   DECKTYRKIGYQEKDYEFEPLADDLASLTLDLLMNEAGYQRSSPNPLLWPDMSRETD"
FT   gene            177920..179356
FT                   /locus_tag="Bamb_3381"
FT   CDS_pept        177920..179356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3381"
FT                   /product="L-seryl-tRNA(Sec) selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent enzymes; L-seryl-tRNA
FT                   selenium transferase; KEGG: bur:Bcep18194_B2096
FT                   selenocysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3381"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88935"
FT                   /db_xref="GOA:Q0BA88"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA88"
FT                   /protein_id="ABI88935.1"
FT                   /translation="MSEPGLNELNAVLARVPSVERVLSSAPLQPLLADYGRTRVLNAVR
FT                   AELERWRTAAQQDPAAAEPLDEPRIAAAVARTLAARSAGAVRAVYNLTGTVLHTNLGRA
FT                   LLPDDAVRAVVDALTQPVNLEFDLATGRRGDRDDLIDDLLCELTGAQAATVVNNNAAAV
FT                   LLTLSALATKKEVVVSRGELVEIGGAFRIPDIMSRAGAKLHEVGTTNRTHLRDYAEAIG
FT                   PRTAMLMKVHCSNYAISGFTKEVTLAELAPLAREHGLPVAVDLGSGTLADLSQWGLPHE
FT                   TTVQETIAAGADLVTFSGDKLLGGPQAGLIVGDRALVAKIKKHPLKRALRVGKLTLAAL
FT                   EPVLRLYQAPEFLCERLTTLRLLTRPQRDITEAAQRVRPALQAALGSGFDVRVEPMFSQ
FT                   IGSGALPLDQLPSAGLVVRTPDGKRGGRALAQLEKRLREWPRPVIGRVADNALRLDLRC
FT                   LEAADEATFVAQCVRIEKAH"
FT   gene            179357..181282
FT                   /locus_tag="Bamb_3382"
FT   CDS_pept        179357..181282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3382"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor SelB"
FT                   /note="TIGRFAM: selenocysteine-specific translation
FT                   elongation factor; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu, domain 2 protein; KEGG:
FT                   bur:Bcep18194_B2095 translation elongation factor,
FT                   selenocysteine-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3382"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88936"
FT                   /db_xref="GOA:Q0BA87"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA87"
FT                   /protein_id="ABI88936.1"
FT                   /translation="MIVGTAGHIDHGKTTLVRALTGVDTDRLKEEKARGISIELGYAYT
FT                   PLENGDVLGLIDVPGHEKLVHTMAAGACGIDFALLVIAADDGVMPQTREHLAILQLLGV
FT                   THGAVALTKCDRVDPARVAAVRDEITAWLHGSTLDGAPLFETCATRDDDPGVAALKRFL
FT                   ADAALAWRARRDDGLFRLAVDRVFTLAGQGTVVTGTAFAGRVATGGTLAVVRTGGAARV
FT                   RSIHAQNRPVDAGRAGERCALNLAGVDKADVERGDTVADARLVATSPRLDVELTLLADA
FT                   GLTLTHWAPLHVHLGTLHRVAHVALLDGDTLAAGQKMRVQLVFDEPVFALPSDHFIVRN
FT                   PQATRTVGGGRVLDPFGPARKRRTPARRAWLDALAAWLDEGRLDALLAQAPLGIARTML
FT                   THLTGFAPDVLALPDDALAIGQRDAASNDGTVMARAHWLALQARTIDTLRAYHERVPDE
FT                   QGLDAARLRRMVAPLVGDALWRALVDALVDGGEVARSGPWLHLPSHSVSFDAREEALAR
FT                   QLLPLIHAGRFDPPWVRDLARDTGTAEEAVRSLLRKLARRGDVQQVVRDLFYHADIVRE
FT                   LAGLVADLAPTRGGGLDAATFRDATGLGRKRAIQILEFFDRVGYTRFHRDLHFLRPDSG
FT                   WASIQA"
FT   gene            181325..181416
FT                   /locus_tag="Bamb_R0078"
FT                   /note="tRNA-SeC(p)1"
FT   tRNA            181325..181416
FT                   /locus_tag="Bamb_R0078"
FT                   /product="tRNA-Sec"
FT   gene            complement(181580..182596)
FT                   /locus_tag="Bamb_3383"
FT   CDS_pept        complement(181580..182596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3383"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="TIGRFAM: dTDP-glucose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility C-terminal domain; KEGG: gvi:glr3235 dTDP-glucose
FT                   4-6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3383"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88937"
FT                   /db_xref="GOA:Q0BA86"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA86"
FT                   /protein_id="ABI88937.1"
FT                   /translation="MSYRPKHVLVTGGAGFIGANFVRHLLDSDPQVSVVTLDLLTYAGS
FT                   LDNLGDDMPGADRHRFVRGDICDRPLVESLLRDHAIDTVVHFAAESHVDRSIDGPGEFV
FT                   RTNVLGTWTLLDACRELWLNDQKLGRTDAHARRRFHHIGTDEVYGSLGPDDPPFSETTP
FT                   YAPNSPYSATKASSDHLVRAYFHTYGLPVTTTNCSNNYGPRQHGEKFIPTVIRHCVDGT
FT                   DIPVYGDGANVRDWLYVDDHCRAIDAVIRRGTVGETYNVGGWNEWRNVDIVALICVLLD
FT                   ERRPERAPHARLVRFVTDRPGHDRRYAIDAGKLARELQWRPAESFETGIVKTLDWYV"
FT   gene            complement(182593..183477)
FT                   /locus_tag="Bamb_3384"
FT   CDS_pept        complement(182593..183477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3384"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal
FT                   domain; KEGG: xac:XAC3582 dTDP-4-keto-L-rhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3384"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88938"
FT                   /db_xref="GOA:Q0BA85"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA85"
FT                   /protein_id="ABI88938.1"
FT                   /translation="MTIVVTGALGQVGRELVLRAGEQPLVGLSRAALDIADADAVRRAL
FT                   EEHRAALVINAAGWTAVDRAETEPDAAWQANRDGPAVLANACAALGIPLIHLSTDYVFD
FT                   GRMPGAYAETAAVAPLGVYGCSKLAGEEAVRERLPDRHLILRVAWVFGAHGNNFVRTML
FT                   RVGRERDVVGVVADQYGGPTHAGAIADTLLTIAARYRAGETLRWGTYHLCGTPVTTWHG
FT                   FAETIFTEARRTGLIDRVPVVRPIRTDAYPLPAPRPANSALDCSRLREHFGIESPSWLA
FT                   GLTEVLATWKRTS"
FT   gene            complement(183474..184055)
FT                   /locus_tag="Bamb_3385"
FT   CDS_pept        complement(183474..184055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3385"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="KEGG: eba:ebA2275 dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; TIGRFAM: dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; PFAM: dTDP-4-dehydrorhamnose 3,5-epimerase
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3385"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88939"
FT                   /db_xref="GOA:Q0BA84"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA84"
FT                   /protein_id="ABI88939.1"
FT                   /translation="MTRVIETPLPGVLVIEPGVFGDARGFFVESFRESWLRDAGVDATF
FT                   VQDNQSRSRRGVLRGLHYQRVNPQGKLVHAARGTVYDVAVDIRRGSPSFGRWFGAQLDD
FT                   ISHRMLWIPPGFAHGFCVLSDEADFAYKCTQYYDPDSDAGVRWDDPAIGIDWPASGAPY
FT                   QLSDKDRRQPPLAELAAGAPAMLPAYGSAR"
FT   gene            complement(184052..184948)
FT                   /locus_tag="Bamb_3386"
FT   CDS_pept        complement(184052..184948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3386"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: bpm:BURPS1710b_3162
FT                   glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3386"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88940"
FT                   /db_xref="GOA:Q0BA83"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA83"
FT                   /protein_id="ABI88940.1"
FT                   /translation="MQTAIGRKGLILAGGSGTRLHPLTHSVSKQLMPVYDKPMIYYPLS
FT                   TIMLSGIRDVLVISTPRDLDAFQQLLGDGSQWGMNFSYAAQPSPDGLAQAFVIGAPFIG
FT                   RDAATLVLGDNIYHGPALSSLLQQAAARTAGATVFGYYVRDPERYGVVSFDAHGRAIDL
FT                   EEKPREPKSHYAVTGLYFYDNDVVELAKAVRPSARGELEITDLNLAYLARGALNVEILG
FT                   RGYAWLDTGTHESLLDAANFIQVMQARQGLQIACPEEIAYRLGWIDAEQLETLAHKLAK
FT                   SGYGRYLLDLLSKEVAA"
FT   gene            complement(185048..186445)
FT                   /locus_tag="Bamb_3387"
FT   CDS_pept        complement(185048..186445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3387"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bsu:BG10420 methylenomycin A resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3387"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88941"
FT                   /db_xref="GOA:Q0BA82"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA82"
FT                   /protein_id="ABI88941.1"
FT                   /translation="MNGGSATPATGAYASAAARPVLVMVALACGFVMAMLDVTIVNVAL
FT                   KAMETSLSMSLTALVWVVDAYTLSFAALLLLGGALANRYGSKSVYVAGLVLFVGASVLC
FT                   AAAQSSAALVAARLAQGVGAALFMPSSLSLLTLAFPPGPVRTRMIGIWGALVSAAMALG
FT                   PCVGGVLVEAIGWRGIFWVNLPVGAAGLWLTYRHIARAPRHPGPLNALGHLFGALALAA
FT                   LSFTLIEGPSAGWRSPSIIAGAAATLAATVAFALRERYASSRIVSLALLANRRFVAGST
FT                   LGLAINFGILAEIFLLSLYLQNVRGASALVVGFELFPLMAMFGIGNLASAKVSALLGPR
FT                   RTLLTGLALATLGSVALVGVAAMPYPALAIAVGLANFGAGQAIPAMNLVVMQSADAADA
FT                   NLAAASLNASRQIGSLVGIAIASVILHVVDDPDRATAVGFAVIAALYALGFAIVFRAIH
FT                   AGGTEQP"
FT   gene            complement(186442..187161)
FT                   /locus_tag="Bamb_3388"
FT   CDS_pept        complement(186442..187161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3388"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: tfu:Tfu_1185 ABC-type branched-chain amino acid
FT                   transport systems ATPase component; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3388"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88942"
FT                   /db_xref="GOA:Q0BA81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA81"
FT                   /protein_id="ABI88942.1"
FT                   /translation="MIDVRELVAGYTPEVDILHRVSLTVGATDIVTILGPNGCGKSTLL
FT                   KSIAGFLLPRAGSVTIQGTDVARVPVHRKIREYGIGFVPQTDNVFASLTVRENLMLGGQ
FT                   SMSAFPREARIDELCEQYPVLRRRYRSLAGALSGGERQIVSLARALMPRPVLLLLDEPS
FT                   AGLSPKMVDEVFDAIVRMRDTEHIGVLMVEQNAIEALRIADRGIVLTMGRVALDGPAAE
FT                   LLDSAEMRRLYLGGRAA"
FT   gene            complement(187158..187943)
FT                   /locus_tag="Bamb_3389"
FT   CDS_pept        complement(187158..187943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3389"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cvi:CV1505 leucine/isoleucine/valine transport system
FT                   ATP-binding protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3389"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88943"
FT                   /db_xref="GOA:Q0BA80"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA80"
FT                   /protein_id="ABI88943.1"
FT                   /translation="MSALLDLDGVTIRYGENVVLSGVTLSVDGGEIVGLLGPNGSGKST
FT                   ALNAVTGFAPLAAGAIRFDGQRIDALSPHRIARLGIRRTFQLPSMPARMSVLELAMAAS
FT                   SARHGIGAALWRGRATRALDADTRARAAELLDELKLSGVAHLAAASISGGQKKLLGIAC
FT                   AMMTEPKLLLLDEPTAGVHPNLRGELIDALQRIRKQGVTLVVIEHDMHFIRELCDRCVV
FT                   LDRGVAIANCRPTELERDRRVLDAYLGRAHAAGRPLEAS"
FT   gene            complement(187940..188827)
FT                   /locus_tag="Bamb_3390"
FT   CDS_pept        complement(187940..188827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3390"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rru:Rru_A3415 inner-membrane translocator; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3390"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88944"
FT                   /db_xref="GOA:Q0BA79"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA79"
FT                   /protein_id="ABI88944.1"
FT                   /translation="MSSFVIHLLTIGCLYATMALGLNLQAGYAGLVNFGFIAFAGLGAY
FT                   AAGIASQLGWPLLSALALAVAAAGALALVVARLGRQLAADYWGIATLAIAEILRTTALN
FT                   ESWLTGGAQGIGGIAPLFPGLRAPWADLAFLAVTAGCLALTYATYRRLTASRFGRALKV
FT                   MREEPALAVCFGYDPLALKTRACIAGALPAAVAGALATWYIGYVGPDAMIASETFALWT
FT                   VVMVGGLGSHAGVLVGTLIVQAVYALAPFLKDWLGVGSDLTGAVRLGLVGLMLLACVIW
FT                   RPHGLVPERLEVRP"
FT   sig_peptide     complement(188747..188827)
FT                   /locus_tag="Bamb_3390"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.738) with cleavage site probability 0.553 at
FT                   residue 27"
FT   gene            complement(188820..189713)
FT                   /locus_tag="Bamb_3391"
FT   CDS_pept        complement(188820..189713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3391"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG: mlo:mll7173
FT                   ABC transporter, permease protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3391"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88945"
FT                   /db_xref="GOA:Q0BA78"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA78"
FT                   /protein_id="ABI88945.1"
FT                   /translation="MLSFIVDVLIRTADLMLVSVGLSTLYSLIRFPNIAHVQYAMLGAF
FT                   ATLWLERAGLPFALATAVSCVLIGTVATLLNLFVFARLLRSGSAVAMIGSLAISMLAVA
FT                   LVLGIAGSRPQQYAQDVHPPMVIAGVALSVPQLGSIACGAGALALFAALLYRTGLGRAM
FT                   RALASNRALALATGIDATRVTNVITFASGVLAALGGTMLGATESVHVNLGYGLLIPVFS
FT                   AAILGGLGNPLGAAAGALLIALAETVALNVDFGTLVDRPMQFFPVEYVGAVSFAILLVA
FT                   LIFRPYGIFDREVRRV"
FT   gene            complement(189749..190849)
FT                   /locus_tag="Bamb_3392"
FT   CDS_pept        complement(189749..190849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3392"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   cyb:CYB_0772 hydrophobic amino acid ABC transporter (HAAT)
FT                   family, periplasmic amino acid-binding protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3392"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88946"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA77"
FT                   /protein_id="ABI88946.1"
FT                   /translation="MKASQWSVGIWIALGAVASGATQADVSVGAVLPLTGASASIGEDQ
FT                   RRGIELAVAQINAKGGVLGQKLAVRIEDSGGSANTALDAARKLATVEHVPVVLGEFSSS
FT                   VTIPVGQFLVRQGDVHINIGSSSQQVRKIGAGSFSVIGLDDLSARFAAQDVYARKLRRI
FT                   ALIAPNNGYGQGIAGEFRKRFEALGGTVVSTVLYTEGQSTYRRELEQASRAQPDAYVYS
FT                   AYGQEAATLNRQAFEMRLNQHPWYGIYLTMCTSDTPAQIAQGQIGLEVAALGAGAKAYA
FT                   SAYQAAYNEAPRSAFGSYAYDATLLSAAAIGRAQSIDPAKIRTALAALGKSYTGVTGAI
FT                   AFDADGQREVQPYEKVVYRQSVVAQQ"
FT   sig_peptide     complement(190775..190849)
FT                   /locus_tag="Bamb_3392"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.960 at
FT                   residue 25"
FT   gene            191168..191518
FT                   /locus_tag="Bamb_3393"
FT   CDS_pept        191168..191518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3393"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: sme:SMc00791
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3393"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88947"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA76"
FT                   /protein_id="ABI88947.1"
FT                   /translation="MLEIKRYGVGERMSQLVVAGGLAFVSGQVADDTSLDVAGQTRQIL
FT                   DKIDQLLDSAGLDKRRIVSASIWLADYRSFAEMNSVWDAWVPQGEAPARACVESKLAFP
FT                   QYTVEIAAIAAS"
FT   gene            191596..192840
FT                   /locus_tag="Bamb_3394"
FT   CDS_pept        191596..192840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3394"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   mlo:mlr5698 D-amino acid dehydrogenase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3394"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88948"
FT                   /db_xref="GOA:Q0BA75"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA75"
FT                   /protein_id="ABI88948.1"
FT                   /translation="MKTIVLGGGIVGVTTAYFLAKAGDEVTVIERRGGVALETSFANAG
FT                   LIAPGHSYTWASPRAPKILFKSLFADGQALRLKWTPDWRMWAWCGLFLQNCTAERSRRN
FT                   TSIKVRLCRYSQQRLQQATHDELLEYDRTSGGLLYLYRDPASFDRGVANMRILTDNGLP
FT                   LDILDARATVEREPALRHAAGGIAGAIHCPTDESGDAHLFTRALAERCRALGVEFRFDT
FT                   SIDGVRASADAIDYVETSHGRVTGDRYVLALGSYSPIVARALGYRLPIYPVKGYSVTLP
FT                   IHDTHEPPALGGVEENQLVAWARFGDRLRLTATAEFSGYDTTHSPGDFAHMLATAQALF
FT                   PNGADYSTPSYWAGLRPMTPEGTPIIGASRHRNLFFNTGHGHMGWTMSCGTAQIVADLI
FT                   HGKRPDIDITGMTLQ"
FT   sig_peptide     191596..191664
FT                   /locus_tag="Bamb_3394"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.761) with cleavage site probability 0.748 at
FT                   residue 23"
FT   gene            192837..193652
FT                   /locus_tag="Bamb_3395"
FT   CDS_pept        192837..193652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3395"
FT                   /product="Asp/Glu racemase"
FT                   /note="PFAM: Asp/Glu racemase; KEGG: sil:SPO2437
FT                   Asp/Glu/hydantoin racemase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3395"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88949"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA74"
FT                   /protein_id="ABI88949.1"
FT                   /translation="MSELLSSSQALGPGVGAGAVRDAYARFDFSLDAGIARRAAIGLVV
FT                   LATDHTIEYEWRRLLAIDGVAFYESRIANSAEITAETLAQMDGGICAAVELIRPGERLD
FT                   VVAFGCTSASMVLGEERVFERIREARPGVACTTPITAARVALAALGARGVALLTPYERA
FT                   INDAMATYLRARGVDIVRVGSFEHRDDNEVARIERASIEHAVLTLAADPAVDAVFVSCT
FT                   SLRIVDALAEIEARAGKPVLSSNHALAWHALRLAGIDDPVPGFGSLLMR"
FT   gene            193742..194443
FT                   /locus_tag="Bamb_3396"
FT   CDS_pept        193742..194443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3396"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: bja:bll6810 transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3396"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88950"
FT                   /db_xref="GOA:Q0BA73"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA73"
FT                   /protein_id="ABI88950.1"
FT                   /translation="MSTSVMAGRETAAPMRTGLTVNEIYEQLKQMAVLYKIRPGERFNE
FT                   LELAERFNVSRTPIREALNRLVAENLLVFVPNRGFFIRQLEGKDVFDLFELRRSIESTA
FT                   VTLACERASDNDIKALRRFWKQVMKNAARMPSSELVVKDEQFHLELAALSGNAEIGRVL
FT                   QGINARIHYVRWVDVDQRRNEAFTEHLEILDALAERDAARCAALTDTHIRWRMEEITRV
FT                   VQASVVKLYAK"
FT   gene            194598..195482
FT                   /locus_tag="Bamb_3397"
FT   CDS_pept        194598..195482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3397"
FT                   /product="rhamnosyltransferase"
FT                   /note="KEGG: bur:Bcep18194_B0560 rhamnosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3397"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88951"
FT                   /db_xref="GOA:Q0BA72"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA72"
FT                   /protein_id="ABI88951.1"
FT                   /translation="MTHGTLVTLYKPSAAQIAHLLTLPAKSPVVVAVDNSPVADRALYA
FT                   RLAEGGVDVIANHNRGGIAGAFNAGVEFLIGRGCDVFFIFDQDSHVPDDYFDRMLSGCA
FT                   RVGDSRFLVGPRIFNRNFQRDLPLFTVRRWSAQITPIHGGAHGLLSCSVIISSGTAISL
FT                   DAYRALGRFREDFFIDHVDAEYCMRAQAHGVPVRVNADVSLPHELGSPSAQQHWPRVEI
FT                   FDQSALRHYYAARNCILVARDYWRRYPAMLLINLITLKHVAFVLLHARNKRVKLKAIYC
FT                   GVTDGLRGRYGRV"
FT   gene            195561..196496
FT                   /locus_tag="Bamb_3398"
FT   CDS_pept        195561..196496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3398"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   bja:bll7953 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3398"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88952"
FT                   /db_xref="GOA:Q0BA71"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA71"
FT                   /protein_id="ABI88952.1"
FT                   /translation="MSLPTPIHRRYTGAFSVAPTIFTESGEIDMPGQKRCIDFIIDAGA
FT                   DGLCILANYSEQFSLTDEERERLIAAILEHVAGRVPVIVTTTHFNPTICAARSRAAQAA
FT                   GAAMVMVMPPYHGATIRCGEAAIEQFYAELSDAIAIPIMYQDAPMSGTQVSAAFLARIA
FT                   HTIPNLRYFKIEVPQSASKLRELIALGGDAIEGPFDGEEAITLLADLDAGATGSILGGG
FT                   YPDGLRPILAAYLAGRRDEAVAGYERWLPLINYENRQAGLLAAKALMKEGGVIASDAPR
FT                   RPLAPLHPATRAGLIEIARRLDALVLRWAR"
FT   gene            196602..197780
FT                   /locus_tag="Bamb_3399"
FT   CDS_pept        196602..197780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3399"
FT                   /product="Mandelate racemase/muconate lactonizing enzyme,
FT                   N-terminal domain protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   enzyme, N-terminal domain protein; Mandelate
FT                   racemase/muconate lactonizing enzyme, C-terminal domain
FT                   protein; KEGG: sec:SC2294 paral putative galactonate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3399"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88953"
FT                   /db_xref="GOA:Q0BA70"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR023444"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0BA70"
FT                   /protein_id="ABI88953.1"
FT                   /translation="MSMPTIRAVRALTVRGGGADYHDQDAGHWIDDHIATPMSRYPEYR
FT                   QSRQSFGINVLGTLVIEIEASDGTVGFAVTTGGEIGAFIVERHLARFIEGQRVTDIEKM
FT                   WDQMFYATLYYGRKGVVLNAISGVDLALWDLLGKVRQEPVHQLLGGKVRDELEFYATGA
FT                   RPDLAKEMGFIGGKLPLHHGPAEGDAGLRRNLDALADMRSRVGDDFWLMLDCWMSLDVP
FT                   YATRLAHGAHALGLKWIEECLPPDDYWGYAKLRRDVPRGMLVTTGEHEATRWGFRMLLE
FT                   MECCDIIQPDVGWCGGLTELMRISALADARGVLVIPHGSSVYSYHFVATRHNSPFAEFL
FT                   MMAPQADRVVPMFDPLLLDEPVPVGGRMKVPDTAGFGVRLNPDVRMQRPYEH"
FT   gene            197799..198587
FT                   /locus_tag="Bamb_3400"
FT   CDS_pept        197799..198587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3400"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   cne:CNB05760 glucose 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3400"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88954"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA69"
FT                   /protein_id="ABI88954.1"
FT                   /translation="MTKLLEDRIVVVTGGSRGIGRAIALASARHGADIVINYWTNPLLP
FT                   AQADHEIDALVDAIRATGRDALAVSGDIAQPDTAHALVAAAVERFGRIDVLASNAGICP
FT                   FHGFLDLPPDLLQRTMEVNLHGTFYMTQAAARQMAAQGHGGAIVATSSISALVGGGMQT
FT                   HYTPTKAGVHALMQSCAVALAPHRIRCNSVLPGTIRTEINDSDLAAPGKTEYFERRIPL
FT                   GRLGEPDDVADCVVFLASDMARYVNGAALLVDGGMYVNLQ"
FT   gene            198599..198919
FT                   /locus_tag="Bamb_3401"
FT   CDS_pept        198599..198919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3401"
FT                   /product="L-rhamnose 1-epimerase"
FT                   /note="TIGRFAM: L-rhamnose 1-epimerase; PFAM: protein of
FT                   unknown function DUF718; KEGG: ret:RHE_PE00285 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3401"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88955"
FT                   /db_xref="GOA:Q0BA68"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0BA68"
FT                   /protein_id="ABI88955.1"
FT                   /translation="MVMETIAFRMRLHPGKRDEYRRRHDAIWPELADALRAAGISDYWI
FT                   FLDEDTHHLFAVLKRPIGHRIAQLAETDVMRRWWAYMADLMATGPDGRPVEKSLEPMFH
FT                   LE"
FT   gene            199038..199934
FT                   /locus_tag="Bamb_3402"
FT   CDS_pept        199038..199934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3402"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: sil:SPO2544
FT                   amidohydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3402"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88956"
FT                   /db_xref="GOA:Q0BA67"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA67"
FT                   /protein_id="ABI88956.1"
FT                   /translation="MQIVDPHVHFWDADMLSYSWLDRAQPAFSGAVADLPRRYGPAELR
FT                   ADAGADIDVLKVVHVEAIHDAWTTPSEVEWLQALADAPASGGMPDGIVAGVDLFAPDAR
FT                   IRLAGAAAHRNVRGIRQVLNRHPDPWYNYVDVDYLAEPRWRENFGMLDEFRLSFDLQLY
FT                   PAQVGAALAVIDAHPDTPVIVNHTGMFVDRTSVHGWREWRDGLRGLARRANVTMKLSGL
FT                   AMFDHRWTVESFRPYVLEAIDVFGATRCMFASNFPVDRLHADYGALWRAYAAIVAGAGE
FT                   DERDALFAGTAMRVYRL"
FT   gene            complement(199998..200159)
FT                   /locus_tag="Bamb_3403"
FT   CDS_pept        complement(199998..200159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3403"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: bps:BPSL0094 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3403"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88957"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA66"
FT                   /protein_id="ABI88957.1"
FT                   /translation="MKKGVIALLAAASVVGALGGCVAYVPGPPVVVAPQGGPGNGFCPP
FT                   GQAKKGNC"
FT   sig_peptide     complement(200088..200159)
FT                   /locus_tag="Bamb_3403"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.875 at
FT                   residue 24"
FT   gene            complement(200225..201382)
FT                   /locus_tag="Bamb_3404"
FT   CDS_pept        complement(200225..201382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_I0078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3404"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88958"
FT                   /db_xref="InterPro:IPR025491"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA65"
FT                   /protein_id="ABI88958.1"
FT                   /translation="MNNHFWKAALCAAMVPFALAGCGGGDDGGAQTGTLHVAMTDAPSC
FT                   GFDHVYVTVSQVRVNANTNASDNDAGWSTITLATPRKIDLLSLTNGVLADIGQTALPAG
FT                   QYQQIRLVLAPNQGNSLANSVVPTGGTEQALATPSATQSGYKIIQPFTVQANTLVDLVL
FT                   DFNACKSIVQRGNGTYALKPVVTAIPTVVSGAISGYVAPAEAGATVYAEQGGKVVRGTV
FT                   ADSTGKFVLSPLIQSSTQGNYDVVIVQNNFASGIVRTVPVVVNTTTAVSASNAPITLPA
FT                   STMSSVSGTVTASADALVRALQTVDARAYEITSINANMDTGAYALNVPTAAPIVGTYSG
FT                   SLPVALAASPAAAAQYTIEADAASGATQSTNVNATTSQPNINFSF"
FT   sig_peptide     complement(201305..201382)
FT                   /locus_tag="Bamb_3404"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.990) with cleavage site probability 0.394 at
FT                   residue 26"
FT   gene            201752..201964
FT                   /locus_tag="Bamb_3405"
FT   CDS_pept        201752..201964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3405"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88959"
FT                   /db_xref="GOA:Q0BA64"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA64"
FT                   /protein_id="ABI88959.1"
FT                   /translation="MKNTIEKTTGPVWGVAAGVLLAAAGLSLGIFPKSLNSAGTANDFV
FT                   ASGVAMLGIFLVVYSTHELRRKRLH"
FT   sig_peptide     201752..201865
FT                   /locus_tag="Bamb_3405"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.931) with cleavage site probability 0.459 at
FT                   residue 38"
FT   gene            complement(202016..202318)
FT                   /locus_tag="Bamb_3406"
FT   CDS_pept        complement(202016..202318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3406"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88960"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA63"
FT                   /protein_id="ABI88960.1"
FT                   /translation="MNSAYTYRGYTIDVRCEFRLDEPRDHAPPPDTLRFGFVAVVQVRT
FT                   AGRAPRLLAPVRLADDGGRLFDNTLNALRAGRAAGEIIVDDLLVDCGPADGRARS"
FT   gene            complement(202405..202827)
FT                   /locus_tag="Bamb_3407"
FT   CDS_pept        complement(202405..202827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3407"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bur:Bcep18194_B2090
FT                   NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3407"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88961"
FT                   /db_xref="GOA:Q0BA62"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA62"
FT                   /protein_id="ABI88961.1"
FT                   /translation="MPQAPLSTKPPEGSAVPIKERATIVCYRDEQVLLVARATSRWALP
FT                   GGTIKRGETPLEAAHRELQEETGITGQDLVYSMQFTGLAKVHHVFFAEVGPDQTPQASN
FT                   EIRKCKWFRIDSVDGVRASIPTKRIVELVYRHELLK"
FT   gene            complement(202925..204313)
FT                   /locus_tag="Bamb_3408"
FT   CDS_pept        complement(202925..204313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3408"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG:
FT                   bur:Bcep18194_B2088 xanthine/uracil transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3408"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88962"
FT                   /db_xref="GOA:Q0BA61"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA61"
FT                   /protein_id="ABI88962.1"
FT                   /translation="MQPASPARSAAHGAADTDPSHDLVYGPNDRPAPMVAFVAALQHLL
FT                   AIIVPIVTPGLLICQALGVSSRDTTLIVSMSLVISGIATFVQCKRFGPLGAGLLIVQGT
FT                   SFNFVGPLIAGGSVMVKQGTPVETVMAAIFGVVIAGSFVEMAVSRILPFVKRLITPLVT
FT                   GIVVLLIGLTLIKVGLISMGGGYGAMANGTFASAQNLTLSCVVLGTIILLNRVPIVWVR
FT                   STALVIALVIGYAAAAVLGRLDFTGVHQAALFQVPTPLHFGIGFSWSLFVPMLIIYLVT
FT                   SLEAIGDVTATSKISKEPVEGPVWMRRIKGGVLVNGANSLLAGVFNTFPSSVFAQNNGV
FT                   IQITGVASRHVGIWIAGMLVVLGLFPVVAGALQAVPEPVLGGAAMVMFGAVAASGINIL
FT                   SGIHLDRRALLIIAVSLALGLGVSQVPDILNSLPHALKNVLESGVATGGICALVMNWFL
FT                   PEQK"
FT   gene            complement(204509..205486)
FT                   /locus_tag="Bamb_3409"
FT   CDS_pept        complement(204509..205486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3409"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B2085
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3409"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88963"
FT                   /db_xref="GOA:Q0BA60"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA60"
FT                   /protein_id="ABI88963.1"
FT                   /translation="MEDIDLNLVTALDVLLTEGSVTGAARRLGLSTSAMSRTLTRLRTA
FT                   TGDPLLVRAGRKLVPTPHAAALRDRVHAIAVDARAVLRPATADIDMTTLSSTFTIRAAA
FT                   SFMDMLAGPVVAAIGDIAPGVRVRFVSKPDRDPGPLRDGTVDLEIGKRGDDAPELHTRE
FT                   LFHDGHVAVARAGHPLFAAARITPARYAACRHVIAAQLGDFGGPTNDTADTPAVTHTVQ
FT                   VVVPGYPDAMRVAAGTDLIALVPRSSLGNAFTPGLVDALGLRSFAIPVRLPEILISALW
FT                   HPRMHGDPVHRRLRDAVIDVCRRAYPAARAPRAPARGTKPRTAG"
FT   gene            205619..206335
FT                   /locus_tag="Bamb_3410"
FT   CDS_pept        205619..206335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3410"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bcn:Bcen_4362 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3410"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88964"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA59"
FT                   /protein_id="ABI88964.1"
FT                   /translation="MQSTVSNASTPSILLIAASRGLGLAMAEHFLNKGWHVTGTVRAGS
FT                   GRTKLHELAERFGERLEIDTLDICAPDQLAALRARLSGRRFDMLFVNAGTTNDPNETIG
FT                   EVTTDEFVRVMITNALAPMRVIEALHDLVPEGGLIGAMSSGQGSVANNVSGMREVYRGS
FT                   KAALNQFMRSFAARQAATPRAMVLMAPGWVRTELGGPDARLTIDESVPSLVNVLIGKQR
FT                   RAGLEYLDYQGRTVPW"
FT   sig_peptide     205619..205702
FT                   /locus_tag="Bamb_3410"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.690) with cleavage site probability 0.480 at
FT                   residue 28"
FT   gene            206525..206860
FT                   /locus_tag="Bamb_3411"
FT   CDS_pept        206525..206860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3411"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   bur:Bcep18194_B2078 antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3411"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88965"
FT                   /db_xref="GOA:Q0BA58"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA58"
FT                   /protein_id="ABI88965.1"
FT                   /translation="MNEPYLQVIAHFFAKPGNGDRVIELLAELAPLTRAEPQNLDYAYF
FT                   RSPVEPDHIVILERYREADGLDVHRETPHFQRIGVGAIIPLLDRRDVTCYMVQPDTGTA
FT                   TPPGGTR"
FT   gene            206857..208014
FT                   /locus_tag="Bamb_3412"
FT   CDS_pept        206857..208014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3412"
FT                   /product="Alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   bur:Bcep18194_B2077 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3412"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88966"
FT                   /db_xref="GOA:Q0BA57"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA57"
FT                   /protein_id="ABI88966.1"
FT                   /translation="MNPFQFRTVPTQIVEFGAARRLGALLRERFPTLARLCVVTDAFLH
FT                   RSGVLAPALASLAAHGWQVTVIDDVIADPPEHVVLDATARAVAADAEIVLGLGGGSSMD
FT                   VAKLIAALAPGRQALADMYGVDKVATSRLPLVQMPTTAGTGSEVTAVSIVTVGEARKMG
FT                   VVSPHLFADVAILDAELTLGLPRAATAATGIDAMVHAIEAYTSSRLKNPVSDMLAVQAL
FT                   TLLSRNLLKACDDGGDRHAREAMLVGAMFAGQAFANAPVAAVHALAYPVGGIFHVPHGL
FT                   SNALVLPHVLRFNASAAAPLYAQLAAIVAPSATGSDEARTHALIDEIDRLIVATGIPRT
FT                   LREVGIGESDLPRMASDAMLQTRLLVNNPREVTEADALTIYRHAW"
FT   gene            208187..208771
FT                   /locus_tag="Bamb_3413"
FT   CDS_pept        208187..208771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3413"
FT                   /product="protein of unknown function DUF1089"
FT                   /note="PFAM: protein of unknown function DUF1089; KEGG:
FT                   bur:Bcep18194_B2070 protein of unknown function DUF1089"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3413"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88967"
FT                   /db_xref="InterPro:IPR009467"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA56"
FT                   /protein_id="ABI88967.1"
FT                   /translation="MTQRDEAARTRCVAWQIAQTWQAGEWCRLVETRDGVDLSGAVAGA
FT                   IDGTPFRVDYAIACGADWLTRSVRVTHWLGAAPPTQLEIECDAGRWTINGADVPALAGA
FT                   TDIDLGFSPSTNTLPIRRLGLAVGASAVIHTAWLRFPAFELVRGEQRYARTAERVYRYE
FT                   SGTYAADIAVDEAGLVTDYDEWRRIGATRSP"
FT   gene            complement(208792..209784)
FT                   /locus_tag="Bamb_3414"
FT   CDS_pept        complement(208792..209784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3414"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplasmic ligand-binding protein"
FT                   /note="TIGRFAM: aliphatic sulfonates family ABC
FT                   transporter, periplsmic ligand-binding protein; SMART:
FT                   extracellular solute-binding protein, family 3; KEGG:
FT                   bur:Bcep18194_B2069 ABC transporter, substrate-binding
FT                   protein, aliphatic sulphonates"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3414"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88968"
FT                   /db_xref="GOA:Q0BA55"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA55"
FT                   /protein_id="ABI88968.1"
FT                   /translation="MNDTPHAELETAPANPRRRHWLHGAAAGLAGLALGPLAGLPARAQ
FT                   GSDKRLRIGFQKYGNFVVLKARGTLEKRLASQGVAVQWLEFPAGPQLLEGLNAGAIDVG
FT                   TVGETPPIFAQAAGVDFVYIGNEPPAPHGEAIVVLPDSPIRGVAQLRGKKVAFNKGSNV
FT                   HYLLVKALEHAGLTYADIQPVYLTPADARAAFVQRSVDAWVIWDPYLAAAERQLGARVV
FT                   ANGDGLVRNTQYYLAARKYAAAQPQVLRTLLDEVDAVDRWGRDNVPEVAAQLSPLVGLD
FT                   APTLEIALKRAGYGVQPITDATLAYQQKIADAFSTLKLIPGKVTVANAR"
FT   gene            complement(210003..210410)
FT                   /locus_tag="Bamb_3415"
FT   CDS_pept        complement(210003..210410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3415"
FT                   /product="protein of unknown function DUF427"
FT                   /note="PFAM: protein of unknown function DUF427; KEGG:
FT                   bur:Bcep18194_B2068 protein of unknown function DUF427"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3415"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88969"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA54"
FT                   /protein_id="ABI88969.1"
FT                   /translation="MSISPDTPSRPVKSPGPDHPITIEPHPSRVVVRVAGKTVADTRRA
FT                   LALREASYPAVLYIPREDADMSLLQRTDHATYCPYKGDCAYYSIPAGGERATNAVWTYE
FT                   HPNPAVESIRAHLAFYPDRVDAIEESPLGTD"
FT   gene            210851..212437
FT                   /locus_tag="Bamb_3416"
FT   CDS_pept        210851..212437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3416"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: bur:Bcep18194_B2067 ABC peptide transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3416"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88970"
FT                   /db_xref="GOA:Q0BA53"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA53"
FT                   /protein_id="ABI88970.1"
FT                   /translation="MAASLLLAGGFTHAFAAPAGKTLVYCSEGSPAGFDPGQHTTSTDF
FT                   DASTYTIYNGLVQFKRGTLDLVPSLATSWDVSSDQRVYTFHLRRGVKFQTTAWFKPTRP
FT                   FQADDVVFTFGRMLDADSPFRKAYPVSFPYFSDLGFDRNIERIEKVDDDTVRFVLKSPD
FT                   VVFVRNLAMAFASILSAEYASQLAARHREADINQLPVGTGPFQLRAYQKDAVIRYDANP
FT                   DYWKPDDVKLAHLVFAITPDPAARLQKLTAGECQVSVFPRPADLETVRRDPKLTLFSGT
FT                   GFNVGFVAYNTQHPPLDRVDVRRALDIAIDKTAIIKTVFNGDATIATNPMPPAQWSYNP
FT                   RLKDAPRDPAAAKALLAQAGFPNGFDLTLWAMPVQRPYNPNAQLMAQLIQQDWAKIGVR
FT                   AKIVSYEWGEYNRRAKRDGQHDAILYGWSGDNGDPDNWLGTLLGCDAVHGSNLAKWCNA
FT                   DFERLVGAARTNADVAKRTSLYEQAQVVFKDQVPFTPIATSIVSLPISKRVHGVTFSPL
FT                   GGHRFDGVWLE"
FT   sig_peptide     210851..210901
FT                   /locus_tag="Bamb_3416"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.946) with cleavage site probability 0.942 at
FT                   residue 17"
FT   gene            complement(212571..213527)
FT                   /locus_tag="Bamb_3417"
FT   CDS_pept        complement(212571..213527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3417"
FT                   /product="Taurine dioxygenase"
FT                   /EC_number="1.14.11.17"
FT                   /note="PFAM: Taurine catabolism dioxygenase TauD/TfdA;
FT                   KEGG: bur:Bcep18194_B2065 taurine dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3417"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88971"
FT                   /db_xref="GOA:Q0BA52"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA52"
FT                   /protein_id="ABI88971.1"
FT                   /translation="MSDVQHAAHPSSHASHAVAPHTAAAPLQLRQVAGRIGAEIAGVRL
FT                   SNTLDDATFDAIQAALLRHKVLFFRNQEHLDDAAQEAFARRFGDTVAHPTVPPADGSAQ
FT                   LLELDSAHGARANSWHTDVTFVDAYPKVSILRAVVIPPFGGDTVWANTATAYAHLPEPL
FT                   RALADTLWALHTNAYDYASTHVHADDTQLKRYREVFTSTVYETEHPVVRVHPETGERTL
FT                   VLGHFVQKIKGLSSQDSAHLLQVLHEHVTRLENTVRWRWQQGDVAIWDNRATQHYAIND
FT                   YGDARRVVRRATVHGDVPVGIDGRRSVLLKGPGVALQ"
FT   gene            214248..214427
FT                   /locus_tag="Bamb_3418"
FT   CDS_pept        214248..214427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3418"
FT                   /product="Flp/Fap pilin component"
FT                   /note="PFAM: Flp/Fap pilin component; KEGG:
FT                   bur:Bcep18194_B2060 Flp/Fap pilin component"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3418"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88972"
FT                   /db_xref="GOA:Q0BA51"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA51"
FT                   /protein_id="ABI88972.1"
FT                   /translation="MLQYVKSLLRDERGVSSLEYAVLAGIIVVALAAVGTYLSGTSGLQ
FT                   AIFTSLINKVSSLI"
FT   gene            214516..214995
FT                   /locus_tag="Bamb_3419"
FT   CDS_pept        214516..214995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3419"
FT                   /product="peptidase A24A, prepilin type IV"
FT                   /note="PFAM: peptidase A24A, prepilin type IV; KEGG:
FT                   bur:Bcep18194_B2059 peptidase A24A, prepilin type IV"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3419"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88973"
FT                   /db_xref="GOA:Q0BA50"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA50"
FT                   /protein_id="ABI88973.1"
FT                   /translation="MLYLVQLTATLVLVSIAMQDLRERRVSNRAVLAFAMLYLIAAALV
FT                   REGLAPFAGHVATAAAMLVVFGALRHAGWLGGGDVKLAAAVFLWAGPPLALPVLTIVGA
FT                   SGAACGLAMLAGLARQRRVAPAHPMATRGVPYGVALAFGGALAVWAPFPHALSLT"
FT   gene            215016..216044
FT                   /locus_tag="Bamb_3420"
FT   CDS_pept        215016..216044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3420"
FT                   /product="Flp pilus assembly CpaB"
FT                   /note="KEGG: bur:Bcep18194_B2058 Flp pilus assembly CpaB"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3420"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88974"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA49"
FT                   /protein_id="ABI88974.1"
FT                   /translation="MPKPLRMAVLIIAAGIGAFILRQLYVSASTPPPPGNTADVRVRVA
FT                   AADLPEGLLLRDNDLAWKPMARAQVPAGAFVESQPGADLKGALLRSRVEAGAPIRADNV
FT                   ISAGAPDFLAAALQPGMRAISVPVDDVSGNAGLIQPGDFVDVVLTQQIGGSATTPGTFE
FT                   AETVVRRARVLAVGSEFQRAKGPASAPDAPVRARTVTLEVAPRTAQVVLVATRLGSLSL
FT                   ALRSFATSDRRQAAGGDEQEPDTPPVWAGDVSRAAREAARAPAARTDTGTRPSQGNTVV
FT                   IYRGSSVDDGSRAGGTGTPGVPPLPAGWPGTPVAPVAPAAPVGGNATADAATQAPRTTT
FT                   VQ"
FT   sig_peptide     215016..215102
FT                   /locus_tag="Bamb_3420"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.964) with cleavage site probability 0.891 at
FT                   residue 29"
FT   gene            216099..217481
FT                   /locus_tag="Bamb_3421"
FT   CDS_pept        216099..217481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3421"
FT                   /product="type II and III secretion system protein"
FT                   /note="PFAM: type II and III secretion system protein;
FT                   KEGG: bur:Bcep18194_B2057 type II and III secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3421"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88975"
FT                   /db_xref="GOA:Q0BA48"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA48"
FT                   /protein_id="ABI88975.1"
FT                   /translation="MVRMVRWIAFWCLACIVAPGVALAQRAHAVEAGATLSIATGKGEM
FT                   LSLSEPATAMFVADPSIADIQVPSPRTVFVFGKKAGTTTLIALGANHRPILRKTVIVQV
FT                   DTVSLQAVLDSRFPQLKLSVSGAPGSLMVSGKVPSAADADAVMQSLAPYLNDKERIVNR
FT                   LTLSRPIQVNLRVRVTEVSRNVTQQLGINWSSLGAAGNFIGGLFNGRTLMDPTNRLFNL
FT                   SPTGAYSVLGGFHTGRWSIDVVLDALDQEGLITMLAEPNLTAMSGQTASFLAGGEIPIP
FT                   VAQAGNTTGAITVEFKPFGVSLDFTPTVLADNRISLKVRPEVSEVDANNSVTTGGVTVP
FT                   GLTVRRVETTVELSSGQSFAIGGLLQSQTANTVSQIPGLGRLPIIGRLFSSKNFQDNKT
FT                   EVVVIVTPYIVQPTGPGQLEQALDTVARPSSDLEFAVQRNLGLDLMSGETPRPVGAAGF
FT                   VY"
FT   sig_peptide     216099..216188
FT                   /locus_tag="Bamb_3421"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.613 at
FT                   residue 30"
FT   gene            217496..217879
FT                   /locus_tag="Bamb_3422"
FT   CDS_pept        217496..217879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3422"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3422"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88976"
FT                   /db_xref="InterPro:IPR019027"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA47"
FT                   /protein_id="ABI88976.1"
FT                   /translation="MRVRTIVFALLAPALAGCLSAPPPINLPDARAIGFDGVRAVPPDC
FT                   AALMQPSHLVDAGFGRPGVPFGCATYTNLATMLARPEDLVAPIPYGGADAQVAADAVRR
FT                   YVEDRVKQPTPGKTLTTTGSPGH"
FT   sig_peptide     217496..217558
FT                   /locus_tag="Bamb_3422"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.988) with cleavage site probability 0.946 at
FT                   residue 21"
FT   gene            217901..219124
FT                   /locus_tag="Bamb_3423"
FT   CDS_pept        217901..219124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3423"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: bur:Bcep18194_B2055 response regulator
FT                   receiver domain protein (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3423"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88977"
FT                   /db_xref="GOA:Q0BA46"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA46"
FT                   /protein_id="ABI88977.1"
FT                   /translation="MPTMNVLDRQNAKRAASAGAADLIAVVSDAGSEDVIRRVAQDLSI
FT                   TRAHVQAGNCDDAIRLLQQHERSPRQLIVDVSDSVLPVSDLMRLAEMCDPSVRVIAIGT
FT                   QNDVGLFRNLLGIGVQDYIVKPLTVELMRRALTATESIVQARTGKIVSFVGARGGVGAT
FT                   TVAVSLARCLAGEKRRRVAYADLNLHGGGANSMLGLSSNNGLIELLNMEQRPDDALFDR
FT                   MFVTKGDRLHVLSAELAYGEDAPLRDDAIAQLVDMLRDRFHYVLFDVGNRAGKLFEDAL
FT                   AASDLVYIVADRSVHAAYEAARLARFVKELPGERLLSMVLNNPLEPVKGRVAQTDFEDA
FT                   FGGVKLRELPHEPQPLAVAENLGEPIEGGKRHGFLDEIRRLANGITGESMAVAEPWYAR
FT                   FVKWRKGS"
FT   gene            219121..220539
FT                   /locus_tag="Bamb_3424"
FT   CDS_pept        219121..220539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3424"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; SMART: AAA
FT                   ATPase; KEGG: bur:Bcep18194_B2054 type II secretion system
FT                   protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3424"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88978"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA45"
FT                   /protein_id="ABI88978.1"
FT                   /translation="MTFGTRKRSTPEPAPAVAPAAPRDDAPAPAPAPIASHAPPPLRGA
FT                   AAADTQESLIRSGKFDAIRTAVFSSMNMSAALMKTRDEVRAGIEQVAAHTVERERLKIT
FT                   AGEQVLIVDAILNDMFGVGPIEPLLADDTVSDILVNGPDQVYVERAGRLELTSLKFRDN
FT                   AHVTSVAQRIAAAVGRRVDESSPMVDARLADGSRVNVVLPPIAMRGASISIRKFAKRDI
FT                   TLARMAHQGNISHGMLQVLKIACACRLNIVISGGTGSGKTTLLNALSQHIEEHERIVTI
FT                   EDAAELQLLQPHVVSLETRPENTEGLGGISQRDLVRNALRMRPDRIILGEIRGAEAFDV
FT                   LQAMNTGHDGSMTTIHANTPRDAISRLESMVMMANANLQLLSIRRQIASAVHLFVQIER
FT                   MRDGVRRVTRITEIVGMEGEVVITQDLFTFRQDSDTTRDVVKGVFEASSLRPAFAPRAA
FT                   YYGMEDALSEVFRQ"
FT   gene            220536..221513
FT                   /locus_tag="Bamb_3425"
FT   CDS_pept        220536..221513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3425"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   bur:Bcep18194_B2053 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3425"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88979"
FT                   /db_xref="GOA:Q0BA44"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA44"
FT                   /protein_id="ABI88979.1"
FT                   /translation="MRPADLFALGAFVVILVIGLMLSALLDRARQAPEQRIRERMRRLA
FT                   PSLAGREAGANATPGVALFNLPRRQGRVRAWLQRYVTRVRAVGGERGMRIVIASAIVGE
FT                   IAAIVAMKLVALPSVLHPLIYVGLPLLAMRTSYRALVERFRLRFLEAFPDAIDLIVRAV
FT                   RAGIPVTQAISTVGDSAAEPVRSTFRTMGDSLRVGVDLKDVLTQASDRLMIADFSFFTV
FT                   YLLLQRETGGSLGETLDELSSIIRTRRDIRLKTRALTAEGRITTKIISAVPFVMIGALF
FT                   LVNRSYVMLLFDTHAGHVMLTIAAVLLTIGLLTINKISKLDTAR"
FT   sig_peptide     220536..220625
FT                   /locus_tag="Bamb_3425"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.634) with cleavage site probability 0.285 at
FT                   residue 30"
FT   gene            221510..222454
FT                   /locus_tag="Bamb_3426"
FT   CDS_pept        221510..222454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3426"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   bur:Bcep18194_B2052 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3426"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88980"
FT                   /db_xref="GOA:Q0BA43"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA43"
FT                   /protein_id="ABI88980.1"
FT                   /translation="MTMSMLAARGLELLLLIACVAAALATPGGGTRRRIAARVQQAAGQ
FT                   RSLSLAAGRLQPGEVRQDLTRRLAQLGERLPVLDPMQRVKLGLQLTRAGFRERRAVSAM
FT                   IGIKLSCGVLFAGFAIVFSPYIPRLGEFFVIRAVAMVGAFVIGVIVPEYVLGAMIRRRR
FT                   RTIAACFPDALDLLVICTMAGNSLASGVRRVARELQRICPPLADELTVCADELTLSGNV
FT                   SEALAHFALRVNFSSARSLATTLTQSQRFGTPITQALRTLSRSERTEQVVALEEKAAKL
FT                   APKITVPMMLFILPTVGLIAAGPAAIRLIEVFK"
FT   sig_peptide     221510..221587
FT                   /locus_tag="Bamb_3426"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.890) with cleavage site probability 0.737 at
FT                   residue 26"
FT   gene            222451..223308
FT                   /locus_tag="Bamb_3427"
FT   CDS_pept        222451..223308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3427"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   bur:Bcep18194_B2051 TPR repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3427"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88981"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA42"
FT                   /protein_id="ABI88981.1"
FT                   /translation="MTRSVIRALAFAAVLPVLAGGCAPGIQTRAALSHKSDDPQAELRI
FT                   ADSALSGGNVELASTLYGKVLARHPDSLAAQLGLGDVNYRAGDLERARILYEQARQQAP
FT                   ADLGPQLGLARVALRQRRLDEAAQRYRDLLAAQPNLPLAAQGLGTVLDLQGRHADAQAV
FT                   YRDALNAHPDAQGLRIDLGLSLVLSNRPREGVNVLLDVAGLPDAPWQARQNLAFAYGVL
FT                   GNTDSAKKLLSADLPASAVADNLRFYQAVRAQLAARPAAAAARPLTGAALERSVVPPAA
FT                   GTTK"
FT   sig_peptide     222451..222510
FT                   /locus_tag="Bamb_3427"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.980) with cleavage site probability 0.587 at
FT                   residue 20"
FT   gene            223305..223733
FT                   /locus_tag="Bamb_3428"
FT   CDS_pept        223305..223733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3428"
FT                   /product="TadE family protein"
FT                   /note="PFAM: TadE family protein; KEGG: bur:Bcep18194_B2050
FT                   TadE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3428"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88982"
FT                   /db_xref="GOA:Q0BA41"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA41"
FT                   /protein_id="ABI88982.1"
FT                   /translation="MTRGARGARHARGVVSLEFALMLPFLLMVLIGIIDVSLLLCDKAV
FT                   ITNASREAARAGVVLRVPMLTPTQIANVALSYTQNSLVSGGTGTVPTVAVTQANGTTAG
FT                   TALTVTVTYTYSGLVLGTALSVLTGPITISASSVMLYE"
FT   gene            223726..224766
FT                   /locus_tag="Bamb_3429"
FT   CDS_pept        223726..224766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3429"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3429"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88983"
FT                   /db_xref="GOA:Q0BA40"
FT                   /db_xref="InterPro:IPR018705"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA40"
FT                   /protein_id="ABI88983.1"
FT                   /translation="MNDAADTRCTGPASERGSVALFFLMFLIPLLSFGALAIDIAWVAT
FT                   VRNQLQNAADAAALAAADAMMSPTGGPLNWSQAAPAANGVIARNSAAGAALATGTVTTG
FT                   YWNVTRNPASMQPTTITPGAYDVPAVQVTVSRAPGVNGGSIPLLLGGLLGVPGTSGSAT
FT                   AIAVLAAPGGVAAGGLFPIAIDQCVYNQYWNAATNQPLINPLTGQPYEFSITNGQTYGA
FT                   LCMGGQWTSFQSTATDTTTMGGLMVTGNPTTLNIGDTINLATGVKATLYTSVPVGATVV
FT                   LPVVTQTSSSTSVPIVAFAAFHIDVSLGGTYKYIQGHFVAGVKLTGVATGVGPYYGVYV
FT                   PPRLAL"
FT   gene            complement(224730..226004)
FT                   /locus_tag="Bamb_3430"
FT   CDS_pept        complement(224730..226004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3430"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88984"
FT                   /db_xref="GOA:Q0BA39"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA39"
FT                   /protein_id="ABI88984.1"
FT                   /translation="MDISSQSLRSAPRAVGEWLTPRRLVLYSAMMLVFYALFIAVWTTV
FT                   VRHGGAVARPGADFSVFWSASYVMLHGTPAQAYDFSSFSRLTAELFTHFRRDSFAPWLY
FT                   PPTYLLLVTPLALLPFALGYPLFVAFGVVVLGLAASRVSGLGSMAAAGRAATLALAAAP
FT                   CVFVTATLGQNAFLTASCAALAVHWAARRPMWAGLCIGLLSVKPQMALLFPFVLIAARA
FT                   WRTIAWAALATGTFVALSILVCGVESLRLFVASTGLARSIVLEHGVVFWLVSPTPFATF
FT                   RLAGVPLAAAYAAHACIAVIAIAAACVAWARSRDTRVRAAVLTVATLAANPYVWHYELA
FT                   WLAVAIACMLAIGWRDGWLRGEQTAIALLWALPIVEYLNPWLEWPQIGPAVTLFALLVL
FT                   LRRARHDVHHVHDAHNASRGGTYTP"
FT   gene            complement(226019..227095)
FT                   /locus_tag="Bamb_3431"
FT   CDS_pept        complement(226019..227095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3431"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   bur:Bcep18194_B2047 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3431"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88985"
FT                   /db_xref="GOA:Q0BA38"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA38"
FT                   /protein_id="ABI88985.1"
FT                   /translation="MSTQARKPLISLVVPFHDEEETIDAFFAETLPILESVAVVRFEIV
FT                   CINDGSRDRTLDRLLAIAAGDARVHVVDLTRRFGKEAALTAGLDEAAGAAVILIDADLQ
FT                   DPPALIPAMIERWRGGAEVVAAKRTDRLCDPYLQRAAAALYYRVHNALSEVEMPENVGD
FT                   FRLMDREVVDALRALPERRRFMKGLFAWVGFRTEIIEYTRAPRSGGRSKFSGWRRWNFA
FT                   LEGITSFSTVPLRVWTYVGITFAMLSLVYGAFIVVRTLLFGNPVHGYPSLISVVLFVGG
FT                   IQLIGIGVIGEYLGRIYHESKQRPVYLVRRRYRAERDAAAQPASKLLQFPLKRTHAARR
FT                   RTTIPAAAGLAARKASFK"
FT   gene            227369..227761
FT                   /locus_tag="Bamb_3432"
FT   CDS_pept        227369..227761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3432"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3432"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88986"
FT                   /db_xref="InterPro:IPR019701"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA37"
FT                   /protein_id="ABI88986.1"
FT                   /translation="MPKERAVQVHDLTGAPLDFWVAMAEDLGAPRVDAGGCTIIREPDG
FT                   TPVPYAPSSSWADGGPLVERVPFGAFERDGGHGAWRAVLHRAVPAAGERCTFNQSGPTL
FT                   LIAAMRTLVASTFGDDVPDLDMSKPR"
FT   gene            complement(227778..228767)
FT                   /locus_tag="Bamb_3433"
FT   CDS_pept        complement(227778..228767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3433"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, periplasmic ligand binding protein"
FT                   /note="KEGG: bur:Bcep18194_B2045 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3433"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88987"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA36"
FT                   /protein_id="ABI88987.1"
FT                   /translation="MTSPSAPARRRALLRVAALAAAPLAGAAALPARAAGPDLSNVTLV
FT                   LGDQAGGLRALAEAARVLDGVPYRFRWANFQGAAPLFEAQRAGAIDLAPAGDLPVLTAA
FT                   LGDPALRIVATRVGSPTSLGIVVQPDSPVRTVADLKGRTVVVSSARGSISQYQLYGALR
FT                   EHGLAPGDVDVRFVLPVDAFAAFEAKQIGIWATFDPYYGNVVRRGARIVRDGSGINSGL
FT                   AFLTSPVDTLDDRSKRAALSDVLARLTRAGQWALAHPADYATVYASLTRLPRDAAADIA
FT                   RRAALAQRGVTAADIDVLQRVADRAAADTILPKRVDVASIAVRNLSAA"
FT   sig_peptide     complement(228663..228767)
FT                   /locus_tag="Bamb_3433"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.991 at
FT                   residue 35"
FT   gene            complement(228908..229786)
FT                   /locus_tag="Bamb_3434"
FT   CDS_pept        complement(228908..229786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3434"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B2044
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3434"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88988"
FT                   /db_xref="GOA:Q0BA35"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA35"
FT                   /protein_id="ABI88988.1"
FT                   /translation="MNPLEFRHVRAFLSVAQHLHFARAADALDMAPPALTRQIQEAERL
FT                   LGVRLFQRSRRAVTLTAAGVAFLAEASAAFEHLQRGRELAMLAERGELGRIEIGYVSSA
FT                   VYSGALQRTVGAFRAAHPRIDLNLREVPMDDVAKQLDAGRLDLAYVRPPLPLPGALRIV
FT                   TLQRDVFVAAVPADSRYASMTAVRAADLADARFAVPEQERGTLEVARRGRFAPVIAARP
FT                   GGLLAVLACVSVNGWVAVIPDALAGCVSLPGVVYRPIAGKPITSELALAHRRFEKAPAV
FT                   RAFLRTVPARA"
FT   gene            229906..230958
FT                   /locus_tag="Bamb_3435"
FT   CDS_pept        229906..230958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3435"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase, IS891/IS1136/IS1341 family;
FT                   transposase, IS605 OrfB; KEGG: noc:Noc_1587 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3435"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88989"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA34"
FT                   /protein_id="ABI88989.1"
FT                   /translation="MILVYRYRVKSFNGLLNKQSRAVNYVWNFCNDTQKHALKWSKKWP
FT                   TGFDLNVLTTGSSKELGIHSGTINATCEQYAKSRSQHRRPYLRYRGKKSLGWVPLKGRD
FT                   LKREGDAFRFAGNTFRVFNSRPLPEGKIKDGSNFAQDARGNWFLNIVIEMPDVQARPIR
FT                   SGVGIDLGLKDFATLSTGEKLPNDRFGRRAAEKLAKAQRARKHKRHIAKLHAKVANARA
FT                   DFQHKLALDLVRRFDYIAVGNVSAVKLARTRMAKSVYDASWSSFRNKLRYKAIAHGATF
FT                   EEVDESGSTQSCSSCGSKDSTTRPKGIAGLRIREWACSDCGVEHDRDTNAALNILRCGR
FT                   ASPGVGITCL"
FT   gene            231076..232632
FT                   /locus_tag="Bamb_3436"
FT   CDS_pept        231076..232632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3436"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B2043 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3436"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88990"
FT                   /db_xref="GOA:Q0BA33"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA33"
FT                   /protein_id="ABI88990.1"
FT                   /translation="MSLPSPASRAAAPANPRLPAAATLAVASATCSLIVLDTNVVAVSL
FT                   PSIARGFHASFADIEWVVSAYMTAFAACLLPAGGLADRFGRKRMLGAGLALFSLASLGC
FT                   GLAPSAGWLIAARAVKGGGAALLLTAALAVIANRFPDGRERARAWAIWGMCMGIATAVA
FT                   PLVGGAITHWIGWRWVFLLNLPVCALLAAGARVAIDESRDPHAKRVDAAGSLLFGAALA
FT                   CAIAALIGAPSHGWLSGATLGRFAFAAALLAAFVGAERWQARPMIDLALFRQPRFVGAV
FT                   LAMFGYAACAQVMMTFLPLYLQNAFGMSAIDAGLGMLPFAVAMIGGPSLGGMLAARVSP
FT                   GGVLAGGLALIGAGNLATAALTAGGDYRLVALGMFVTGCGAGIMNGDTQKAIMACVPPN
FT                   RTGMASGISTTTRFSAIVTAVGVLGAVLAASTHAQLDRLLSAAPGVRAFVDAPFMSSLL
FT                   AGDLAQALAHVPPSSARTLAEAAPAAFASGFADALTVSGVLALAAAVVAYKLLAQPMRD
FT                   A"
FT   gene            complement(232692..233864)
FT                   /locus_tag="Bamb_3437"
FT   CDS_pept        complement(232692..233864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3437"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B2041
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3437"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88991"
FT                   /db_xref="GOA:Q0BA32"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA32"
FT                   /protein_id="ABI88991.1"
FT                   /translation="MRDAPEPHGLPVDAPDATGALDVLDARLMRILLVLLTERTVSRAA
FT                   VRLNMSQPATSAALKRLRTLLGDPLLVRSRYGMVPTEFGARLIDPLRNALRVIDFIRIQ
FT                   QPTFDARTSVRTYRIGCPDYLNVLFVPKLVALFRARAPNAQLVFHPLGDGYDDERALAD
FT                   GELDIVIDNRPARSSRFRQDDLFDDRIVCLMRATHPLARRGAMTAAEFAQAAQLCPTPS
FT                   WLEASGAIDLQLERVGLQRRIVVTLPHFELAAHALVRSDLILTTTYRLARHYAKLLPLG
FT                   AVALPAEPPDIVYRMTWNESGPCVDGVRWLRALIAEATHGWLDAEAALPDVTAVAANVG
FT                   ADARTAAPVADEPPEPARRTRRRQATHCGSSQRPHPARAARIHRIATKSH"
FT   gene            233959..235227
FT                   /locus_tag="Bamb_3438"
FT   CDS_pept        233959..235227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3438"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3438"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88992"
FT                   /db_xref="InterPro:IPR021551"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA31"
FT                   /protein_id="ABI88992.1"
FT                   /translation="MDGFQSHALSPSMFGGANRQRVHAAQARLPWALCVGFAGEYGSAP
FT                   RRWEIKYSAGRQLENEWGGTSIGAPAPGTRIARPPLPFNRHQRRCHAAIFHSLRIASRL
FT                   RRHPDRRPGGRCGLSEEERDRHRHRCEFERHGRHGAGAVHRAVGHAEQRHGRQRRRRGE
FT                   HAGRGIRAGGRERRLTRDSGRRPALPRRRAGSARAPHGARVRRPARERFARTVVVIPGP
FT                   APLVSRRRTPSGTGGAMQNAESNSTPEKQREQIAKSPVKTPAAGDMPDASTQAAEVAKR
FT                   PLTPETVAAKMPTGLPPIDVDAHAVDSGDPVRRAAGRIVTLDNANMARTDNTVDVDGKG
FT                   QEAAAGATEWHDNVIYSNASLDDAVMTPDEGLGGIESRPGGNVPLIGTRPGWRVRYVGD
FT                   VEVEVQHGVGARAEHVICFERIG"
FT   gene            complement(235291..236052)
FT                   /locus_tag="Bamb_3439"
FT   CDS_pept        complement(235291..236052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3439"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3439"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88993"
FT                   /db_xref="InterPro:IPR025510"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA30"
FT                   /protein_id="ABI88993.1"
FT                   /translation="MKSIRTIVALCSVISVLAACGGGDDVGTELGISKPQARFINAVPA
FT                   GPNLDYYLNAKVDASGIAYKGVTRYHDIDSGTQTASYDVSGTTRTIASQSFSAANGHHY
FT                   TTIALPSTSSAISVIDDPFDKKLLSDKARVRSFNASPNAQNVDVYVVPPGTDITAQSPT
FT                   LAGAAYQNAVPASGQDSVYLNGGTYQVIVTTAGSKTPILKTPPVALNNNADWLLLTIPA
FT                   GGISDVIPNDVHVLVAQGNDADTSAQELGPQ"
FT   sig_peptide     complement(235987..236052)
FT                   /locus_tag="Bamb_3439"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.993) with cleavage site probability 0.741 at
FT                   residue 22"
FT   gene            236595..236927
FT                   /locus_tag="Bamb_3440"
FT   CDS_pept        236595..236927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3440"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3440"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88994"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA29"
FT                   /protein_id="ABI88994.1"
FT                   /translation="MPIPVPFRSLRWLTIAAASCLLAACSTASDVTTTSNPNVFTVTTR
FT                   TLGVSTTWADAHEKAVSEATNYCTQRGMRASLRQEQLTAGRRVDARSELAFECHPTFET
FT                   ASNPRG"
FT   sig_peptide     236595..236681
FT                   /locus_tag="Bamb_3440"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.869 at
FT                   residue 29"
FT   gene            complement(237017..237907)
FT                   /locus_tag="Bamb_3441"
FT   CDS_pept        complement(237017..237907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3441"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="KEGG: bur:Bcep18194_B2034 3-hydroxyisobutyrate
FT                   dehydrogenase; TIGRFAM: 3-hydroxyisobutyrate dehydrogenase;
FT                   PFAM: 6-phosphogluconate dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3441"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88995"
FT                   /db_xref="GOA:Q0BA28"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011548"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA28"
FT                   /protein_id="ABI88995.1"
FT                   /translation="MEIAFIGLGNMGGPMAANLLKAGHALTVFDLDAHGVDAAVRAGAT
FT                   AAASPRDAAARASLVITMLPAAQHVRAVYLGDDGVLAGARAGATFVDCSTIDPDTVRAV
FT                   ADAAAQRDFPLADAPVSGGTGGAQAGTLTFMVGAPAALFERIRPVLLDMGKNVVHCGGT
FT                   GTGQIAKICNNLLLGISMMGVSEAMALGAALGIDPAVLAGIINTSTGRCWSSDTYNPYP
FT                   GVNDAAPAARGYAGGFAANLMLKDLGLATEAARSARQPVWMGALAQQLYQSMSQQGLGA
FT                   LDFSACVKLYEAKPA"
FT   gene            complement(237922..239448)
FT                   /locus_tag="Bamb_3442"
FT   CDS_pept        complement(237922..239448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3442"
FT                   /product="methylmalonate-semialdehyde dehydrogenase
FT                   (acylating)"
FT                   /EC_number="1.2.1.27"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: aldehyde dehydrogenase; KEGG: bur:Bcep18194_B2033
FT                   methylmalonate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3442"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88996"
FT                   /db_xref="GOA:Q0BA27"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA27"
FT                   /protein_id="ABI88996.1"
FT                   /translation="MNAAVPQTTLALPTAKLLIDGAFVDSQSAEWGDIVNPATQEVIGR
FT                   VPYATLDEVDAAIASAQRAFQTWKTTPIGARLRIMLKFQDLVRRNLERIAHTLTAEQGK
FT                   TLPDAQGDIFRGLEVVEHACSIGTLQQGEFAENVAGGVDTYTLRQPIGVCAGITPFNFP
FT                   AMIPLWMFPMAIVCGNTFVLKPSEQDPLSTMQLVELAIEAGVPQGVLNVVHGGKTVVDR
FT                   LCTHRDIKAISFVGSTRVGTHVYNLGSQHGKRVQSMMGAKNHAVVLPDAHREQAINALV
FT                   GAGFGAAGQRCMATSVVVLVGRARDWLPDLVEKAKALKVNAGAEAGTDVGPVVSKAAKA
FT                   RVLSLIDAGVKEGATLLLDGRDVKVPGYEQGNFVGPTIFSGVTTDMSIYQEEIFGPVVV
FT                   VLEADTLDDAIALVNANPMGNGVGLFTQSGAAARKFQSEIDVGQVGINIPIPVPVPYFS
FT                   FTGSRGSKLGDLGPYGKQVVQFYTQTKTVTARWFDDDATAGGVNTTIALR"
FT   gene            complement(239570..240889)
FT                   /locus_tag="Bamb_3443"
FT   CDS_pept        complement(239570..240889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3443"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bur:Bcep18194_B2032
FT                   major facilitator superfamily (MFS_1) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3443"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88997"
FT                   /db_xref="GOA:Q0BA26"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA26"
FT                   /protein_id="ABI88997.1"
FT                   /translation="MQTRSTLDEHASVATPAPARTARHYLLAGWASMAGTTIEWYDFFL
FT                   YGTAAALVFNRIFFPSLDPVVGTLAAFGTFAVGFIGRPMGGIVFGHFGDRIGRKSMLMI
FT                   TLLLMGVPSMIIGLIPSYDSIGYWAAALLIAMRFLQGMAVGGEWGGAVLMAVEHAPKGR
FT                   KGLFGSLPQTGVGLGLILSSVAMAAVAALPDADMLSWGWRVPFLASIALVGLGWFIRAK
FT                   VPESPDFEKIQRQGKAEKSPVTAALRRHPREVLTIVGARAAENTWFYMVVTFALAYATQ
FT                   QLHLPKAEMLHAITAGAALSLVTMPLCGHLSDRIGQRRMFAIGLVLMCAFAAPFFMMLG
FT                   TQQTSTAWWAIVLGLGVVFPILYAPEALLFAQQFPAEIRYSGISLSVQLAGVIGGGFAP
FT                   MIATSLLKAGGGQPHYVIAYLVGFGVFALACTALMRPARA"
FT   gene            241034..242005
FT                   /locus_tag="Bamb_3444"
FT   CDS_pept        241034..242005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3444"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B2031
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3444"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88998"
FT                   /db_xref="GOA:Q0BA25"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA25"
FT                   /protein_id="ABI88998.1"
FT                   /translation="MRHTPEPVSGNLNWDDLRFFLEVARTQRASGAAKRLGVDYTTVAR
FT                   RIRALEAAMGTLLFDKSRSGGFTLTAEGQRLVAYADAMETTVQSACDQVANTGGALSGH
FT                   VRIGSTEGFGCFFLAPQLARFRVAHPHVTVDLLPVPHFVNLPKREADLAITLERPERGP
FT                   YVVTKLCDYQLRLYATRDYLANHAPITCTDDLARHAFVSYVDDLAFSSELLYLERAVPG
FT                   ATAGLRTTSVIAQVFAALQGGALAILPCFMAATQPALVPVLPDDVVVTRCFWLTCREDL
FT                   RKLRRVTALWDYLRAAADANRALLMGESGVLRFVGERADGTP"
FT   gene            242149..242424
FT                   /locus_tag="Bamb_3445"
FT   CDS_pept        242149..242424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3445"
FT                   /db_xref="EnsemblGenomes-Tr:ABI88999"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA24"
FT                   /protein_id="ABI88999.1"
FT                   /translation="MKKKTAILIVAANADPTGLAVGQIITGSGSMGRVSMKITSVKQQT
FT                   AFADQPFVLEVATREPTWFDDANPITTISYNNERNRAEVTTCTFTS"
FT   sig_peptide     242149..242193
FT                   /locus_tag="Bamb_3445"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.740) with cleavage site probability 0.365 at
FT                   residue 15"
FT   gene            complement(242450..243250)
FT                   /locus_tag="Bamb_3446"
FT   CDS_pept        complement(242450..243250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3446"
FT                   /product="haloacid dehalogenase, type II"
FT                   /note="TIGRFAM: haloacid dehalogenase, type II;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 2
FT                   (HAD-like); PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: bur:Bcep18194_B2027 haloacid dehalogenase,
FT                   type II"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3446"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89000"
FT                   /db_xref="GOA:Q0BA23"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA23"
FT                   /protein_id="ABI89000.1"
FT                   /translation="MSIEPAPRNPAARRCALSSIDLHWITMTNPADIKALVFDVFGTIV
FT                   DWRSGVAREAAAFLARHAADLDPFEFADAWRAEYSPSMEEIRSGRRRYVRLDVLHRENL
FT                   VRTLDRYGIDGAPDDEIDALNLAWHRLDPWPDSVAALQRLKQRYVIAPLSNGNIRLMID
FT                   VAKHGGLPWDAILGAEVAHAYKPSPKVYTDAVEILGVAPAEVCLVAAHNGDLAAARQLG
FT                   LATAFVLRPAEHGPNQTTDLQADDAWDFDVRDLNELADRLGCPG"
FT   gene            complement(243334..243516)
FT                   /locus_tag="Bamb_3447"
FT   CDS_pept        complement(243334..243516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3447"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2021 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3447"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89001"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA22"
FT                   /protein_id="ABI89001.1"
FT                   /translation="MLQRMKDTLGCFDNERSHCELLVAMISRRNVLIASEVGDHSPDVM
FT                   PIRDGKVQVRIRKWH"
FT   gene            243731..245980
FT                   /locus_tag="Bamb_3448"
FT   CDS_pept        243731..245980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3448"
FT                   /product="diguanylate cyclase/phosphodiesterase with GAF
FT                   sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; GAF domain protein;
FT                   KEGG: bur:Bcep18194_B2019 diguanylate
FT                   cyclase/phosphodiesterase (GGDEF & EAL domains) with GAF
FT                   sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3448"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89002"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR012226"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA21"
FT                   /protein_id="ABI89002.1"
FT                   /translation="MNTEPQSSRYSLGLAAEVLASEQSVLRLITRNTPLPELLVEVCRR
FT                   AEALLGEGASCTILLLDADGVHVHVGAAPSLPAQYSAAIEGATIGPAAGSCGTAMYERR
FT                   MIAVEDIETDPLWADYRAFALPLGLRACWSVPFLDETGTVLGAFAVYHRAPRRPSDTET
FT                   DLLRDIGNSVGLAVHQDSIARQLVHSEEQHRLVVNSLNEGILMLSPDGVVIASNPSANR
FT                   MMRVKGELVGRRLSSVILYKLREDGTPIAPDDWPSRLAFTTATPLLDYSVGFGLADGDI
FT                   IWVRGNAVPIVKPGETRPESVLVSFHDIGPVREAQQQLRYLATRDALTGLYNRRWLSER
FT                   MRELFGTHDAAAGPARVAILFIDLVGFKKVNDTAGHDAGDALLRSVAARLAACAGGRHA
FT                   LTRVGGDEFVILVDQCDDPDELSALAREVIDTIAKPFAIANNEYWLGVSIGISVAPRDG
FT                   DDAVTLMRNADSAMYDAKQRGRNHFTFFTAQLNLRLQRRFAIEQSLRRAILSDALRLAY
FT                   QPVVDARSGRTVGAEALLRWTSPELGPMSPTEFIPVAEDTGLIVAIGQWVLETACRQAA
FT                   EWRRTIAPDLMLAVNLSPRQFHEGLVESVGRCLAQTQLDPGALELEITEGLLMNDTDTV
FT                   LPMLEALTDMNVRISVDDFGTGYSSLAYLKRFPLHNLKVDRSFVSGVPDHRDSVAITQA
FT                   VVAMAHSLGMKVTAEGVETEAQSWFLQQIGCDMQQGYLFGRPLDPADYARRLVTV"
FT   gene            complement(245985..247058)
FT                   /locus_tag="Bamb_3449"
FT   CDS_pept        complement(245985..247058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3449"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; response regulator receiver; KEGG:
FT                   bur:Bcep18194_B2018 diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3449"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89003"
FT                   /db_xref="GOA:Q0BA20"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA20"
FT                   /protein_id="ABI89003.1"
FT                   /translation="MTSDLSRPPGGLHAAFDAGPTPHADAPAMVLLVDDQTIVAEAIRR
FT                   ALVDEDGIDFHYCPRSDDALATALETRPTVILQDLVMPGTDGLTLVKAYRANPAMRDVP
FT                   IIVLSTQEEPVVKSAAFAAGANDYLVKLPDRIELVARIRYHSRSYMSLLQRDEAYRALR
FT                   QSQQQLLEANLELRRLTHSDGLTGLSNRRYLDEYLAAEWRRGARERSELSLLMIDVDNF
FT                   KLYNDTYGHVSGDSVLKQVASTIERCLGQSGDLAARFGGEEFAVVMPATSPGAARLLGE
FT                   KIRLAIEGLRLEHAHSSTGRYVTISIGGASIVPAAGVPTTSLIEAADRALYRAKHDGKN
FT                   RVEIDAPPARPPGGGVA"
FT   gene            complement(247114..248118)
FT                   /locus_tag="Bamb_3450"
FT   CDS_pept        complement(247114..248118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3450"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /note="PFAM: CheB methylesterase; response regulator
FT                   receiver; KEGG: bur:Bcep18194_B2017 chemotaxis-specific
FT                   methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3450"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89004"
FT                   /db_xref="GOA:Q0BA19"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA19"
FT                   /protein_id="ABI89004.1"
FT                   /translation="MNIGIVNDLPLAVEAMRRALARRPEHRVLWVATDGAQAVDMCAAQ
FT                   PPDVVLMDLIMPKFDGIEATRRIMRSDRPCAILIVTSCIGANAWRVFEAMGAGALDAVD
FT                   TPRLGEGAAGDTARLLLAKIDQIGRLLDAPGGVRTAGTTTRASGGPLIAIGASAGGPGA
FT                   LASILGGLPANFSAPIVIVQHVDRAFAEGMAQWLDGQTPLTVRVAREGDRPQPGVALLA
FT                   ATDDHLRITRAGTLEYTREPAATPYRPSVDVFFNSLTEHWPGRVIGVLLTGMGRDGAIG
FT                   LKALRMKGYHTIAQDEATSAVYGMPKAAATLGAARAILPLERIAGELAALARI"
FT   gene            complement(248509..248733)
FT                   /locus_tag="Bamb_3451"
FT   CDS_pept        complement(248509..248733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3451"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2014 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3451"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89005"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA18"
FT                   /protein_id="ABI89005.1"
FT                   /translation="MIDVFQTIGSREFSAHLAKDGMVTLMEQRHEVDRVTLATAYAALV
FT                   EESEQEADLLDATVEGMMRALIQGYARSH"
FT   gene            249026..249715
FT                   /locus_tag="Bamb_3452"
FT   CDS_pept        249026..249715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3452"
FT                   /product="protein of unknown function DUF969"
FT                   /note="PFAM: protein of unknown function DUF969; KEGG:
FT                   bur:Bcep18194_B2013 protein of unknown function DUF969"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3452"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89006"
FT                   /db_xref="GOA:Q0BA17"
FT                   /db_xref="InterPro:IPR010374"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA17"
FT                   /protein_id="ABI89006.1"
FT                   /translation="MLVLIGVPIVVIGFALRFNALLVVTIAGLATGLAGGMNLVDIVSA
FT                   FGKAFTDNRYMGLIWLTLPVIALLERNGLKEQAKRMISRVQAATTGRVLMLYFVLRQAT
FT                   AALGLTSLGGHAQMVRPLIAPMAEAAAVSQHGELPESVRQQIRAHASAADNVAVFFGED
FT                   IFIAIQSILLIKGFLEQNGIAIEPLHLSVWAIPTAIAALLIHCTRLALLDRRLSRSFGA
FT                   FGREGAR"
FT   gene            249712..250662
FT                   /locus_tag="Bamb_3453"
FT   CDS_pept        249712..250662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3453"
FT                   /product="protein of unknown function DUF979"
FT                   /note="PFAM: protein of unknown function DUF979; KEGG:
FT                   bur:Bcep18194_B2012 protein of unknown function DUF979"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3453"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89007"
FT                   /db_xref="GOA:Q0BA16"
FT                   /db_xref="InterPro:IPR009323"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA16"
FT                   /protein_id="ABI89007.1"
FT                   /translation="MIGLEPLYTLAGLMFAAFACFNLMDRTNPRRVFNFAFWAIYALTF
FT                   LFGALLPHFVMGCLAIALALIAGSGKLGRGKSDEAGDAAAARRDAKALRFGNRLFLPAL
FT                   LIPVVTLIGTFALKLVPFVDPKSVTLISLVLGTLVAFAVALAMLRDSPVHALKEARHTM
FT                   DAVGWAAILPQMLAALGALFAVAGVGGVVSGLVKDWVPIDSPFAVVAAYTVGMALFTMI
FT                   MGNGFAAFPVMTAGIGLPLIVHQFHGNPAILGAIGMLSGFCGTLMTPMAANFNIVPAAL
FT                   LELKDKNGVIKAQWPTAVLLLAVNTLLMYAFVFRF"
FT   gene            250673..251695
FT                   /locus_tag="Bamb_3454"
FT   CDS_pept        250673..251695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3454"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3454"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89008"
FT                   /db_xref="InterPro:IPR021365"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA15"
FT                   /protein_id="ABI89008.1"
FT                   /translation="MTDRLTPELASKFASLALAHLTREYPNKLTHALEGPHDVQGPRAL
FT                   HPIFYGSYDWHSCVHGYWLLLRVLERYPALPEAERIIAVVDAHFTDANVAGERAYLALP
FT                   HNSGFERPYGWAWLLALSAQLERLALKGVVPQAARWAKTMAPLTDLFVARFETFLPKAT
FT                   YPLRVGTHFNTAFALALTLDFARATQRDGLAALIVDTAKRWHLGDVACQAWEPSGDEFL
FT                   SPALMEAELMRRVLPAGEFDGWFARFLPDLARGEPATLFVPATVSDRSDGKIAHLDGLN
FT                   LSRAWCQRSLAGALPEGDARRAKLLDAAERHLASALAHVAGDYMGEHWLATFALLALDA
FT                   "
FT   gene            251847..252911
FT                   /locus_tag="Bamb_3455"
FT   CDS_pept        251847..252911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3455"
FT                   /product="asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /note="PFAM: L-asparaginase II; KEGG: bur:Bcep18194_B1986
FT                   L-asparaginase II"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3455"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89009"
FT                   /db_xref="GOA:Q0BA14"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA14"
FT                   /protein_id="ABI89009.1"
FT                   /translation="MDTQRAAVVTYRGNAIENTHVADVAVVDAGGKLLFRLGDPFRMTL
FT                   ARSAAKPAQALSVIETGAPERFGFDDADIALMCASHSSEEQHIARTRAMLAKVDAHESD
FT                   LRCGGHAPLSDAVYRSWIKRDYTPTGVCSNCSGKHVGMLGGARAIGAAIADYHLPEHPM
FT                   QVRVKQVVANACGLRDDEVDWAIDGCNLPTPAFPLDRLARLYASLADGADTVEARGAAT
FT                   TDRVRALARIHHAMTAHPELVAGEGRYCTVLMEAFEGQVVGKLGADACYGIGVRASART
FT                   RELGADGALGISVKIEDGNIDVLYMMVSELLERLRIGTDAQRARLAAFHRPRMLNTQGV
FT                   EIGHATFPFELQAA"
FT   gene            complement(253007..254029)
FT                   /locus_tag="Bamb_3456"
FT   CDS_pept        complement(253007..254029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3456"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B1985
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3456"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89010"
FT                   /db_xref="GOA:Q0BA13"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA13"
FT                   /protein_id="ABI89010.1"
FT                   /translation="MYYRKRFCVGRNNERRMKAMARDTGLDHLGAMRAFVRVVEMGSFS
FT                   AVAKEMHVSTSTVARKITAIEEALGVALLHRSTHSVTLTEAGHIYLERAVTLIADLDDT
FT                   LRVVAELNAQPSGPLKLTAPVAFGRRHLAPLIAPFLARYPTIQLDVRLTDNHNDLVAGG
FT                   YDLDIHEGENYLDNLVVHRLSRNDSILCATPGYLDRCGRPATPDDLLHHNCLRYVHPEG
FT                   DPRWELVRGDARHSVLPAGNLVTDHSELLLEATCAGLGIAEFEIWLVRDLLASGRLEAV
FT                   LPRYRLHNKLTGEHIYIAYLANRRSSAKLRVLKDFLADQLAHIGELSEVELMKIRDAGA
FT                   "
FT   gene            254138..255544
FT                   /locus_tag="Bamb_3457"
FT   CDS_pept        254138..255544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3457"
FT                   /product="aspartate ammonia-lyase"
FT                   /note="TIGRFAM: aspartate ammonia-lyase; PFAM: fumarate
FT                   lyase; KEGG: bur:Bcep18194_B1984 aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3457"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89011"
FT                   /db_xref="GOA:Q0BA12"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA12"
FT                   /protein_id="ABI89011.1"
FT                   /translation="MTANGFRVEADLLGKRSIPNEVYYGVHTLRAKENFDISGRTIASL
FT                   PYFVMALAAVKEAAADANCELGLLPAAYRDAITAACVEIREGRLHDQFVVDIIQGGAGT
FT                   STNMNANEVICNRALEIMGHARGQYEYLHPNEHVNLAQSTNDVYPTAIRVATCFAVEHL
FT                   LEAMARLRDAFAEKADAFSDLLKLGRTQLQDAVPMTLGQEFSTYAVMVTEDIARLQEAG
FT                   WLMREINLGATAIGTGITAHPQYAEKALAALRRITGLDLSTAPNLIEATQDCGAFVQIS
FT                   GVLKRIAVKLSKICNDLRLLSSGPRAGFGEINLPPVQAGSSIMPGKVNPVIPEVVNQVA
FT                   FEVFGNDLTVTFAAEAGQLQLNAFEPVIASALFRSFSHLTAACTTLAGRCVSGITANPE
FT                   RLRDTMERSVALATALNPYIGYKRATAVAAEAHASGKSIREVVLERALMTAAQLDEALQ
FT                   PEALIRPRAY"
FT   gene            255648..257141
FT                   /locus_tag="Bamb_3458"
FT   CDS_pept        255648..257141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3458"
FT                   /product="asparagine:proton symporter, AAT family"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bur:Bcep18194_B1983 amino acid transporter; TC 2.A.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3458"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89012"
FT                   /db_xref="GOA:Q0BA11"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA11"
FT                   /protein_id="ABI89012.1"
FT                   /translation="MKHVSERPADTAGGADPRHAERDAMFASHEAGYAKQLKPRHVQMI
FT                   AMGGAIGTGLFLGAGGRLQSAGPALAVVYLVCGVFAFLIMRALGELVMHRPTSGAFVSY
FT                   AREFMGERASFVAGWMYYLNWATTGIVDITAVAIYMKYWAAFSDVPQWVFALGALGIVS
FT                   VMNMIGVKVFGEMEFWFSIVKVGTLALFLGVGAVFLASGHPVAGQMPGLHLIADHGGIF
FT                   PHGILPAVLIVQGVVFAYASIELVGVAAGETADARKVLPKAINSVMWRIALFYVGSVVL
FT                   LTMLLPWTAYSAHESPFVTFFSKLGVPYVGTVMNVVVLTAALSSLNSGLYSTGRVLRSL
FT                   AMGGSAPRFVSRMNARGVPYGGILVTVAVNAIGVPLNYIVPAQAFEIVLNMASLGIITT
FT                   WGFIVMCQILFRRAVNRGELSPVSFRMPGAPFTSWLTLGFLVSVLVLMAFDYPGGTWTV
FT                   GMIPVVVLALVIGWKLAKRGTARQQASAAPAIADPASNV"
FT   gene            complement(257185..257928)
FT                   /locus_tag="Bamb_3459"
FT   CDS_pept        complement(257185..257928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3459"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   bur:Bcep18194_B1982 phospholipase/carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3459"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89013"
FT                   /db_xref="GOA:Q0BA10"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA10"
FT                   /protein_id="ABI89013.1"
FT                   /translation="MPSARSRLSVHSPYRTHAMTDVLPLTTDAESGLQYRLRPAAGRPA
FT                   GRLLLLHGVGGNETNLLNLADTIDPRIEIAFVRGPLTFGPNQYAWFPVRFGPNGPEIDA
FT                   ARAEASRVQLIALLRALCAPDAATDAPDLPAVIAGFSQGGIMSASVALTSPADVTAFAV
FT                   LCGRILPEIDPLIASRDALSRLHALVMHGRFDDKLPLAWANTADAKLTALGVAHDTRLY
FT                   DTGHELTAPMAGDFSRWVGARVGLN"
FT   gene            258139..258381
FT                   /locus_tag="Bamb_3460"
FT   CDS_pept        258139..258381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3460"
FT                   /product="SpoVT/AbrB domain protein"
FT                   /note="PFAM: SpoVT/AbrB domain protein; KEGG:
FT                   reu:Reut_C6177 putative virulence-associated protein
FT                   homologue"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3460"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89014"
FT                   /db_xref="GOA:Q0BA09"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA09"
FT                   /protein_id="ABI89014.1"
FT                   /translation="METAKIFKHGGSQAVRLPKDFRFDTTEVRIRRHGASVILEPVPQD
FT                   WAWLTPLIGPVDADFEAAAATEPAAQERPGLDVFE"
FT   gene            258378..258785
FT                   /locus_tag="Bamb_3461"
FT   CDS_pept        258378..258785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3461"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   reu:Reut_C6178 PilT protein, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3461"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89015"
FT                   /db_xref="GOA:Q0BA08"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA08"
FT                   /protein_id="ABI89015.1"
FT                   /translation="MKFLLDTHAVIAILKGEQAMLARLRRHQPADFGIPAIVAHELYYG
FT                   AYKSQRAAANLARVEGLQFEVVSFDAEDAQHAGEIGAQLAAVGTPIGPYDALIAGQARA
FT                   RRLVLVTHNTREFERVPELQVEDWLAAAREN"
FT   gene            259235..261625
FT                   /locus_tag="Bamb_3462"
FT   CDS_pept        259235..261625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3462"
FT                   /product="putative CheA signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; SMART: PAC repeat-containing protein; KEGG:
FT                   bur:Bcep18194_B1979 putative CheA signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3462"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89016"
FT                   /db_xref="GOA:Q0BA07"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA07"
FT                   /protein_id="ABI89016.1"
FT                   /translation="MTIRHRITLLVVLTFFALSAIGVYAVYQTRKSASEVRQVTQGIVP
FT                   SALASADLVADVKNIQIATMTLVYAPDANTAAQARDELKAKQAALRAALDAQAKSAVGQ
FT                   AQQGLVAQAKDSATNYFAAIDDTVKMKADGKPEMAQAYLFANVAQYRDELESIVDTLRV
FT                   EKNRQKDDAIRALNGMLSTTATAIAAVAGTVVVLLTALGFVLYRQIARPLIGMQTAMSE
FT                   IATSQDFTRRVPVGRMDEIGHSIVAFNGMIEKIQENAAQLKQKTADIQAMLQNMQQGIL
FT                   TVVEGGVVHAEYSAYLETIFETSDIAGRDLMALVFDASSIGADARSQVEAAVHACLGED
FT                   SMNFAFNEHLLVNEVAKRMPDGREKWLDLSWSAITDETDTVVRLMLCVRDVTEIRELTA
FT                   QAGEQQRRLEMIGEILSISQDKFHDFVHSAKGFLSENERMIRQHERADHSIVAALFRNM
FT                   HTIKGNARTYSLQHLTNIVHEAEQAYESLRRADSGPEWNRDALMDDLARVREAVDHYAT
FT                   INAVTLGRHGEPTGPGGGGYLMVERAHIRESLRMLDGADPANAGDWLAARDSVRRLLSQ
FT                   FGTQGIGDALGGVIESLPSLAAELGKPAPVVHIDSNGHRVRSEIGATLKNVFMHLLRNA
FT                   IDHGIETSDERRAAGKAPAGKIDIAVDVEDGALRFVLGDDGRGLALDRIRGIARERGWI
FT                   DAGNEAALTEEAVAELIFRPGFSTARAVTEVSGRGVGMDAVRNFLKRDGGDIALRFTDD
FT                   RVGSPYRAFETIVSLPARFAADGAAHHAEPHARAGIANVDVAE"
FT   sig_peptide     259235..259312
FT                   /locus_tag="Bamb_3462"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.932 at
FT                   residue 26"
FT   gene            261628..262368
FT                   /locus_tag="Bamb_3463"
FT   CDS_pept        261628..262368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3463"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   bur:Bcep18194_B1978 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3463"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89017"
FT                   /db_xref="GOA:Q0BA06"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA06"
FT                   /protein_id="ABI89017.1"
FT                   /translation="MQAWMIPIGAALAGGLVVAAIAAIVCRVMRARLVAAFTREADALR
FT                   DALGAADARADAAVAAQTEAAQAWTRREAELEETLARDAAGAGEQRDALQALAAERAAL
FT                   AQQATKLADEAARLRGLAGTFERWHEQMISLTTQNQDMRAKNQELSAIVAHVSIVSLNA
FT                   SIEAARAGAAGRGFSIVASEVRGLAARSQQLSNSYRDSLNRNDLVTAATFQDIQAGGKM
FT                   ITAALATLETLAGQLHARLEGAAA"
FT   sig_peptide     261628..261687
FT                   /locus_tag="Bamb_3463"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.975) with cleavage site probability 0.502 at
FT                   residue 20"
FT   gene            262365..262949
FT                   /locus_tag="Bamb_3464"
FT   CDS_pept        262365..262949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3464"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1977 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3464"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89018"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA05"
FT                   /protein_id="ABI89018.1"
FT                   /translation="MISAQARAGFERIFFDAARTRLASCGACEIRPAAGDTHDASHDPS
FT                   RMKSRMTPTVSEHVVVLTISALHFRLLLALRFRDDAPTRRHFAAAASGASAQRPLPEAF
FT                   MEVANLCCGALNQALTAPFPDLGMSTPYLLSGASIDYLPALHPDHVAAYDVTLDGDVRI
FT                   GATLCVCANAPVDFHVPEGASVDTGGELELF"
FT   gene            263027..263929
FT                   /locus_tag="Bamb_3465"
FT   CDS_pept        263027..263929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3465"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1976 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3465"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89019"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA04"
FT                   /protein_id="ABI89019.1"
FT                   /translation="MRPRSSASATHNLVGLTVRRNRLLKVLRSNIDLGAILLAEDYGGS
FT                   PAESAIVATQIDALRPELPIILRRASDASRDGLPEALARVACAAYVADDMTPLARAIGE
FT                   YLFGRDYPNALVRGISEITEARLDSLFPGMTIERDTPCIVRDQIIFGEVFSLIALESAW
FT                   CRGYMLLQTSEQPLLDMIGGTRDDGRAPDFRDVNSLLGELTNLVWGAFKNRYLGDAEAL
FT                   ARHPVQVPLVVNHKQKFISFGGDCPQLCFKYRMTDRASGRSVQLDQRFVFSLSWSREDF
FT                   RESVQDVGPMVESGELELF"
FT   gene            263965..264330
FT                   /locus_tag="Bamb_3466"
FT   CDS_pept        263965..264330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3466"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bur:Bcep18194_B1975 response regulator receiver domain
FT                   protein (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3466"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89020"
FT                   /db_xref="GOA:Q0BA03"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA03"
FT                   /protein_id="ABI89020.1"
FT                   /translation="MAKILVVDDSGTVRDEVAGFLRNHGLDVATAVDGKDGLAKLKATP
FT                   GVRLVISDVNMPNMDGLTMVEKIRGELANASVNIVMLTTESSPAMKERGKAAGVKGWIV
FT                   KPFKGDAVLDALKKLAG"
FT   gene            complement(264557..265660)
FT                   /locus_tag="Bamb_3467"
FT   CDS_pept        complement(264557..265660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3467"
FT                   /product="ImpA domain protein"
FT                   /note="PFAM: ImpA domain protein; KEGG: bur:Bcep18194_B0973
FT                   ImpA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3467"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89021"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA02"
FT                   /protein_id="ABI89021.1"
FT                   /translation="MSKKPSPRQSISGKATAKDTPHHDWLAPVSNAMPCGPDLEYDHDF
FT                   VVLFTSAAPRQDVQYGAFVGAPDPVNWSEIERDCQRLMLRTKDIRVAVLYTRSRTRLAG
FT                   AAGLADGTGLLAAWLDAFAEQVHPQPDVDGGRDAAREMRMNAIQALADPAGLLADVREI
FT                   VLSKSTLARLQVRDVERAFAHPRPADALAPESVTQQLQDVRAQQPEVMAGFDDAITHLA
FT                   AIDAWCAVHLDGYLPELSSLTRLLGRLKAPASANAIEQLEESYDPPSAASESSGRDASA
FT                   PLEPPNDGPVSATERMTAPPGSAPTDRQAALALIRTARTWFETHEPSSPIPVLLKRAEQ
FT                   FVGKPYAEVVTAIPAELLAQWEETESG"
FT   gene            complement(265657..266730)
FT                   /locus_tag="Bamb_3468"
FT   CDS_pept        complement(265657..266730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3468"
FT                   /product="protein of unknown function DUF1305"
FT                   /note="PFAM: protein of unknown function DUF1305; KEGG:
FT                   bur:Bcep18194_B0974 protein of unknown function DUF1305"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3468"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89022"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA01"
FT                   /protein_id="ABI89022.1"
FT                   /translation="MKRATLPALVRDSTLSPDLLESLQMEPWRFGFLSLLRRVGANPTV
FT                   DRVGTARRPQAEPFRLGQQPSLAFAPREIASVQEAAGRLKVRLFGLGMLGPNGPLPIHV
FT                   TEWAREREEGRRDTTTVDFLDIFHHRFLTLFYRAWASAQSTAGLDRKDDEQFSFYIASL
FT                   TGLDTAEIGRRPLPSHARLAASAHLVRESRNSDGLRATLDHYFGVPIAIEENVFHWIAI
FT                   DPIDQGRMGRPGPAATMGQAAMLGRVAPDRQHRFRIVIGPVDLDAYLRFTPQGQDLPRL
FT                   VEWVRAFVGYELEWELELRIKPESAPPAVMGGRQRMGWSGWLGRPNPDRPITGMRFEPE
FT                   RYVRHFEQHTTESDNRP"
FT   gene            complement(266730..268619)
FT                   /locus_tag="Bamb_3469"
FT   CDS_pept        complement(266730..268619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3469"
FT                   /product="protein of unknown function DUF879"
FT                   /note="PFAM: protein of unknown function DUF879; KEGG:
FT                   bur:Bcep18194_B0975 protein of unknown function DUF879"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3469"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89023"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:Q0BA00"
FT                   /protein_id="ABI89023.1"
FT                   /translation="MDPRLLDYYNQELIYMRELATEFAQAHPKIARRLGMQAGEVADPY
FT                   VERLIESFCFMAARLQLKLDAEFPRFTGRLLEVIYPNYVAPTPSIAVARLYPGQAEGNL
FT                   AAGYRIARGTSFKARVPDGEKTACQFTSGQDVTLWPLTITDARLTGIPPDIPALDRHVP
FT                   PDRQVRGALRLRLATTGDVRIADLKGLDRLPVYLAGDEQVASHLFELLHVAGVASVIAA
FT                   PGEFGVPGRSPAAVIHGAVEHEGLGTDQNLLPLTWTKFHGHNLLHEYFACPARFWFFAL
FT                   NGLAEGLSRVNGREVEIVVLLDRAPGQLANLVDASRFALFCTPVINLFKRHTDRIEISP
FT                   RETEFHLVPARLAPLDYEVFSVETVYGQVAATSDELEFRPLYQTLNNDEGNHGRYFSTR
FT                   RERRLASDSARRYGTRTPYVGTEVFLSLVDQNEAPYGEDIRFLSVDALLTNRDLATLVP
FT                   RDGVRDLAMEESAPVESIGLIRPPSPPKAPYAEREMAWRLIRQLNFNYLPLEGLDHRDG
FT                   GQGLRDLLRLYLSNDNNEHSRQVESLVGVNTRPVTRKLPGTGPMTFGRGIECAVTVDEA
FT                   GFSGVSPYLFGTILEHWLARHVSINSFTQTELHSMQRGRIARWPVRTGTRGVL"
FT   gene            complement(268652..269209)
FT                   /locus_tag="Bamb_3470"
FT   CDS_pept        complement(268652..269209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3470"
FT                   /product="protein of unknown function DUF1316"
FT                   /note="PFAM: protein of unknown function DUF1316; KEGG:
FT                   bur:Bcep18194_B0976 protein of unknown function DUF1316"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3470"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89024"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Z9"
FT                   /protein_id="ABI89024.1"
FT                   /translation="MTEHKRPLTRGNSLVARPPRRANAHLMPTLLDRLRDDAPHRLIEA
FT                   PEEYAVTRKQMRDIVQRDLAYLLNTTSIEDRIERERHPQAAASTVNFGVPPLAGTFLAS
FT                   RQWNDIERMIRQAITDFEPRLIPGSLAVSPRHGDDASGHHNVLAFEVRGLVHMDPYPLE
FT                   FMVQSSLDLETSEIQITGMRSG"
FT   gene            complement(269202..270053)
FT                   /locus_tag="Bamb_3471"
FT   CDS_pept        complement(269202..270053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3471"
FT                   /product="virulence protein, SciE type"
FT                   /note="PFAM: virulence protein, SciE type; KEGG:
FT                   bur:Bcep18194_B0977 virulence protein, SciE type"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3471"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89025"
FT                   /db_xref="InterPro:IPR009211"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Z8"
FT                   /protein_id="ABI89025.1"
FT                   /translation="MKMPFAAEEPSGHGRDDVPIAAQIERIESHIRAQPTFAAHRWALF
FT                   QWLCVTGDWARAVIQLQTWAKLEPQQTQAAQVYRDLVRAERWRQKVVAGFERPGFVLEP
FT                   APWVMELAFALRLARDGQRGHADEAREKALDAAPLIAAHTPRGGASWIADSDSRFGPVC
FT                   EVMTAGHYRWVPFADLAAWRMAPPANLIDLVWASCVLTLTDGSTVHGFMPARYPGSEAA
FT                   TDALRLGRETAWHEAGRTAVIAHGQKTWTTDRGDFGLFELAHAQFGSRVADGATTGEPV
FT                   DD"
FT   gene            complement(270050..270496)
FT                   /locus_tag="Bamb_3472"
FT   CDS_pept        complement(270050..270496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3472"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0978 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3472"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89026"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Z7"
FT                   /protein_id="ABI89026.1"
FT                   /translation="MPFPDHTDDLVETLHAQYWGALTDPHTALPGSWGEQLDSPETPVA
FT                   SVTPDSHDVRPTPANAAAFGSIEVMLSGKRSLEDAFGHLDTGFTPELEIEPVPEVLRLF
FT                   APPEFHAAEAHRASALPPTLTRREHHMLSVDSPLAAALVCKDDA"
FT   gene            271254..273947
FT                   /locus_tag="Bamb_3473"
FT   CDS_pept        271254..273947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3473"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; Clp N
FT                   terminal domain protein; ATPase associated with various
FT                   cellular activities, AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: bur:Bcep18194_B0979 AAA ATPase,
FT                   Clp"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3473"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89027"
FT                   /db_xref="GOA:Q0B9Z6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Z6"
FT                   /protein_id="ABI89027.1"
FT                   /translation="MTISRQALFGKLGVQLYRSIESATQFCKLRGNPYVELIHWLHQLL
FT                   QQPDSDLHRILRHAGIERDVLDRDFARALAVLPAGASSISDFSWHIETAIERAWVLATL
FT                   SHGDRRVRGAWLVAALVSTPELRRVLLSISPAFGKIPVDGLGDELPAWIDGSPEAADAP
FT                   YDHSDLSAATPGEASGAIPVASKRGSLDQYCADLTALARMGEIDPVIGRELEIRTMIDV
FT                   LLRRRQNNPLVTGEAGVGKTAVVEGLARAIASGNVPPKLADVRLLSLDVGALLAGASMK
FT                   GEFEARLKGLLEAAGKSPTPVILFIDEIHTLIGAGGQAGTGDAANLLKPALARGTIRTI
FT                   GATTWAEYKRHIEKDPALTRRFQVLQIAEPSEAAAIDMVRGLVQTFSRHHGVVVLDEAI
FT                   RAAVTLSHRYIPSRQLPDKAISLLDTACARVALSQHATPRELDDVRQRLAAARAEEALL
FT                   VQEARIGLDTDRALTGVRARIDTLGAEAAAVEHRWRAQAAAAQALLAAREAIGPDDGKT
FT                   PRDEVAALPKLRELEHALVALQGDAPLVFPEVDEAIVAEIVSDWTGIPVGRMVTDEVAA
FT                   VRKLPETLEARVIGQTNALRQIGERVQTARAGLTDPRKPVGVFLLAGPSGVGKTETALA
FT                   LAEALYGGEQNLITINMSEYQEAHTVSGLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLL
FT                   DEIEKAHRDVHEMFFQVFDKGYMEDGDGRYIDFRNTTILLTSNVGSELSTSLCADPSLA
FT                   PNQDGLREALTPELLKVFPAAFLGRVTVVPYRPLADSVLASIVRLYLERIVKRMADGHG
FT                   IALTYDDAVVNYIIGRCLVQETGARVLIGFIEQHVLPRLSALWLDAFASKRTLSHIVIG
FT                   VADPSCMPAQALSFDAIAFHSDEPVL"
FT   gene            273986..274528
FT                   /locus_tag="Bamb_3474"
FT   CDS_pept        273986..274528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3474"
FT                   /product="Uncharacterized conserved protein UCP028301"
FT                   /note="PFAM: Uncharacterised conserved protein UCP028301;
FT                   KEGG: bur:Bcep18194_B0980 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3474"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89028"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Z5"
FT                   /protein_id="ABI89028.1"
FT                   /translation="MSASSSSQKFIARNRAPRVQIEYDVEVYGSEKKVELPFVMGVLAD
FT                   LSGKHPVEPLPAVSDRRFLEIDIDNFDERMKAIRPRVAFAVSNTLTGDGQMMVDMTFES
FT                   MEDFSPAAIARKVEPLRQLLEARTQLANLQTYMDGKSGAEALVTQLLHDPALLKSLAAA
FT                   PKPERQADETADQDDTN"
FT   gene            274556..276049
FT                   /locus_tag="Bamb_3475"
FT   CDS_pept        274556..276049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3475"
FT                   /product="protein of unknown function DUF877"
FT                   /note="PFAM: protein of unknown function DUF877; KEGG:
FT                   bur:Bcep18194_B0981 protein of unknown function DUF877"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3475"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89029"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Z4"
FT                   /protein_id="ABI89029.1"
FT                   /translation="MAKQEVRPAVAQTATPSDFTQLLEREFRPKTDDAREAVELAVQTL
FT                   AEQALAQTATISDDAYKSIAAIIAQIDHKLSEQINLILHHADYQALESAWRGLNHLVSN
FT                   TETDEHLKIRFMDVSKAELHRTMRRYKGLAWDQSPLFKQIYEQEYGQLGGEPYGCLVAD
FT                   YYFDHTPPDVDLLGSIAKVSAAAHTPFITGAAPSVLQMESWQELANPRDLTKIFTQNLE
FT                   YTAWNSMRSTEDARYVGLAMPRFLARLPYGAKTNPVDEFDFEEDTNGSDHGRYGWANAA
FT                   YAMGVNVNRSFKQYGWCSLIRGVESGGTVENLPTHTFPTDDGGVDMKCPTEIAISDRRE
FT                   AELSKNGFIPLVHRKNTDHATFIGAQSLQKPAEYHDPDATANANLSARLPYLFACSRFA
FT                   HYLKCIVRDKIGAFKEREDMQRWLNEWIMHYVDADPTNSSQETKARRPLAAAEVVVEEV
FT                   EGNPGYYNSKFFLRPHFQLEGLTVSLRLVTKLPSIKEAA"
FT   gene            276142..276627
FT                   /locus_tag="Bamb_3476"
FT   CDS_pept        276142..276627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3476"
FT                   /product="protein of unknown function DUF796"
FT                   /note="PFAM: protein of unknown function DUF796; KEGG:
FT                   bur:Bcep18194_B0982 protein of unknown function DUF796"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3476"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89030"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Z3"
FT                   /protein_id="ABI89030.1"
FT                   /translation="MAQDIFLKIDGINGESLDEKHKDEIEVLTWEWDIQQESTMHAGSG
FT                   GGAGKATVKDLTFEHNIDRASPNLMKYALTGKHIDQATLVMRKAGGNPLEYLKLTMSDV
FT                   IVTRVKPSGSKNDAEKSRESVSLSFAKVKQEYVVQNAQGGSGGAVTASFDIKGNKEA"
FT   gene            276714..277220
FT                   /locus_tag="Bamb_3477"
FT   CDS_pept        276714..277220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0983 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3477"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89031"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Z2"
FT                   /protein_id="ABI89031.1"
FT                   /translation="MRSIPTVATLACALALSACASSGEPKPKEPIRLDMRVNARPDVNP
FT                   DDRGWAAPIVVRIYELKNDGAFNAADFFTLQTRDKTALADDVVKRDELQLRPGEHQTLV
FT                   RRPDPVTTTIGVIAAYRDLPNAVWRAVYTMPAAPDKAWYRLFTSKLKLTIDLEAKAVKI
FT                   TEAKK"
FT   sig_peptide     276714..276782
FT                   /locus_tag="Bamb_3477"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.437 at
FT                   residue 23"
FT   gene            277252..278595
FT                   /locus_tag="Bamb_3478"
FT   CDS_pept        277252..278595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3478"
FT                   /product="protein of unknown function DUF876"
FT                   /note="PFAM: protein of unknown function DUF876; KEGG:
FT                   bur:Bcep18194_B0984 protein of unknown function DUF876"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3478"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89032"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Z1"
FT                   /protein_id="ABI89032.1"
FT                   /translation="MSWYAKVAWQEGLFFRPQLFQQQDRYFEKYAHQRAAPLSPFFFGF
FT                   THFALDHEALALGKVVVKAAAGVFADGTPFDAPGNTPLPPPLTIRPEHLDQVIYLAVPV
FT                   RLPNCEETTFDETPDSLARYQVFDTELRDTNSMGLAPESVQLSNLRVRLLPEKELGDAW
FT                   IGLALTRVTTIRADGSIALDDTLVPPVSGYGASDLLTSWVTKIHDLARLRANALAQRLA
FT                   GTDDTTASAATVTDYLLLQILNRYEPLLQHLLRVPATSPADVYALLIGMAGELSTHLRT
FT                   NTRRPLDTHPPYQHTTPHVCLKPVVDDTHRLLNAVLVRSAQSIVLEDRGHGMRNAVVDP
FT                   VDMQGFAALVLAVHAAMPQDVLQQQFLAQAKAGPSDKLPSLVRSHLPGIGLQALPVPPR
FT                   QIPFNAGYIYYELTQGGLLWEEVVRHGGIALHVSGEFPSLRLELWGVR"
FT   gene            278884..281421
FT                   /locus_tag="Bamb_3479"
FT   CDS_pept        278884..281421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3479"
FT                   /product="Rhs element Vgr protein"
FT                   /note="PFAM: Rhs element Vgr protein; KEGG:
FT                   bur:Bcep18194_B0985 rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3479"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89033"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Z0"
FT                   /protein_id="ABI89033.1"
FT                   /translation="MALFDAPRTLSVSGAALPMYGDRPILTPVKLTGGETIGELFEYTL
FT                   ELKTPDALGFSQSIAANVKLDKLIGTEVTVSIQLEGKGRFIPGLVGSAGMANLGAGARE
FT                   ITGIVSHATIVREDGRSIVYALTLRPWLWHATKNCDCRIFQDMSVVEITDAVLSSYPFP
FT                   VEKRLTTPRPNKGWPKRDIQRQHFESDWAFLQRLWEEWGIYYFFEHSEGKHRLVLCDSM
FT                   GALKPLGEAYAALRYEPPTGRRLDEEHIQDFSVSHALTTGAVTSVDYDYTLPRADLKVM
FT                   REDPRDTGLAHQEHYTWGDYAQPQAGAAGLSGDHNEPRTEAEYLTLVQMEAWRCQGLRA
FT                   YGKGNLRGVVTGQSFVLSHYPQDAANREYAVIACKLTIEEIGEASGSGQRYRCEADFTV
FT                   QPTNEPFRLLRTIAKPRMNGVEYAVVTCPENQEIWTDAQGRVKLQFLWDRLGKNDERSS
FT                   CWVRVAGAWHGDQFGGVFLPRRGHEVEVAFVNGDPDLPIIVGSATNAFNMPPFDLPKNQ
FT                   ALAGYRSREIGGRRANTLAFDDTNGKIQAHLSSDEGASQLNLGYITRIAGSAGRQNERG
FT                   RGFELVTSLWGVVRSAMGMLITTEARPDTQGHAKDMGETVRRLTDARDTHERLAELAQQ
FT                   NLAQDANVDQSEVTAALRAQNDAIRGGAMSDDAPFPEFVEPHLTLASPVGIQTTTAGST
FT                   HVASGEHLALTTGEHFGIATGRSLFATVKEKLRIFVYEAGIKLIAGAGSIDIEALKDAI
FT                   NLMAKIRIRQTATRIEIWAEEELSLRGGKSFITLNHSGITNGTPGQWQSYAATHQMPGP
FT                   KSSPGDVPAAELKVCELSTVKAAAQHAAIVPLS"
FT   gene            281396..282280
FT                   /locus_tag="Bamb_3480"
FT   CDS_pept        281396..282280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3480"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_C7608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3480"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89034"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Y9"
FT                   /protein_id="ABI89034.1"
FT                   /translation="MRRSCRFREGRMQSYSLSDAMSVTTHLLADRLLIQDWADDLPWHD
FT                   VVPEWLSNEHHLLPVVLRLDDLDDTQRERVEQYLTEDSAEVASAMLICSELSAEAQARQ
FT                   LARHVVITLDDDSRALLRFADPAVFVHLLRVLPLPHLASLCDGASRWWVPFQGLWYELE
FT                   FSGRPEARWSKLDEFQSIALTNVGLVNDVLATMPEPHDIKQMWRCSQEINQWLGAAQSE
FT                   FGLVNAHDCVAFARHGCLLGRGFSNHPKLVPHLRDAVETPGLYAQATALFSEKEWNNLI
FT                   ADIERINQKQEAP"
FT   gene            282817..284832
FT                   /locus_tag="Bamb_3481"
FT   CDS_pept        282817..284832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3481"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_C7607 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3481"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89035"
FT                   /db_xref="GOA:Q0B9Y8"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Y8"
FT                   /protein_id="ABI89035.1"
FT                   /translation="MGARNASHAATLNDVASVVAEYSPKAKVETFAFSPYGFNSRASTT
FT                   DGLLRAAWSLGPQPAAMLVIDDPASVAAEIGARTIELHDSFMAVAERSRKLSVSTAILS
FT                   LQGAVADRAEMNEIVAGDELEQDGHYVPDGLGRITYVANPPKLPDTTVADLRKISSKSW
FT                   AKYALDYDEDARGKWQGEFNQEYGRFRDETLHPLAASHVQWMTSNQMRNYLECTHDDTS
FT                   AEVGLVYARILTACIQGTEQFKPCAQLYARWLNGVISDDKNIVLRGIVLNLEINKKKFS
FT                   ESLKPEVTWQAVGWDGLMLAFNNSIDGVAKQAPEVLGKLLASLGGSITQVLQSAADGPV
FT                   RHALVACGVVSGRAVVPVELTGSYKTYRTSLIRQLLQSSGIKNIGKNALQREVSLALRR
FT                   LQIRGEPMSTVVSSKFLVMIDEESIKGMPKGLSKTEQAKWLANSIRSAEEIERLNLSVW
FT                   RERINLSQRVATAGKAIPFLGNMLAGLFQWAAYQKVSKDLAGSMKGDMLESQYRLGSAV
FT                   IALGSTVADTIARAAGSLAETTLLRGRAVLLEVVGSLFGIASKAAGILAAGINAFWDGK
FT                   NAVEAIQQRNYPLAVALGVSALSGFAAAALLVAGSVIGAIFAIIVFIGSGVVATFLQDD
FT                   KIDKWLKRCYWGVLEAKDRYQNVDAEMSDLVVATGG"
FT   gene            284825..285754
FT                   /locus_tag="Bamb_3482"
FT   CDS_pept        284825..285754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3482"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpm:BURPS1710b_1774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3482"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89036"
FT                   /db_xref="GOA:Q0B9Y7"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Y7"
FT                   /protein_id="ABI89036.1"
FT                   /translation="MGEMDYTGLYAKKYRVNRKLTDEERVNQFRQKMRIDVVPFYNISV
FT                   IAMNSKYMECVDRWFVYRGSMAAVCLFGLMVPIYSFFIPLLVKVGIEFRALLIFFGVSI
FT                   PYWMLMVWLLLKEAFSWTHFPIRFNYMNRQVYVFRRNGTVLEAKWDDIFFTLGRCQRTA
FT                   GRQNWDIRGHILDKDGETVRETFALPGDTMLVDQLKHSWEFIRRYMEEGPASVYRDVYW
FT                   CHDIAERREKYRVGLRYMFFSLNGQPVGQILLSPVFLVASLGRWFAMRTSKIPVWPAEI
FT                   EAACQVDPFDPYLRDASRNPEKIPMEPM"
FT   gene            285825..286103
FT                   /locus_tag="Bamb_3483"
FT   CDS_pept        285825..286103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3483"
FT                   /product="PAAR repeat-containing protein"
FT                   /note="PFAM: PAAR repeat-containing protein; KEGG:
FT                   bur:Bcep18194_B0990 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3483"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89037"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Y6"
FT                   /protein_id="ABI89037.1"
FT                   /translation="MSLPIAVLGDGTDHGGQIITGSATHTIDGKPIARLHDLVDCPQRY
FT                   PDGRLHGVNRIIEAHPTLTVGGVRVALHGHRTECGCALVSNTVARIG"
FT   gene            286100..287398
FT                   /locus_tag="Bamb_3484"
FT   CDS_pept        286100..287398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3484"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG:
FT                   bur:Bcep18194_B0991 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3484"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89038"
FT                   /db_xref="GOA:Q0B9Y5"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR017733"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Y5"
FT                   /protein_id="ABI89038.1"
FT                   /translation="MMDRAKYLGGQKEDVSVPVDAPTFADTVDPDRNQKTYVIPPGKVE
FT                   SLRLNAILAARNPLLEASRVLLRAQADMPETFESRDAVVLLRRLLVEEVRVFDRLCEQA
FT                   NIRRDHMIGASYCLCTALDEAVAQTAWGKEGSSAIEWIQGGLATTFHGDLKGGDKVYLL
FT                   IGRLLEDPHEHRELLEVIYRILSLGFEGRYRGVTDGKRKHDGIRQRLYNVITSQREPVP
FT                   LALSPHWQSTAKGKRLSFTDFPVWITVTVLSVILLGLFGWFKYELVSRSADVQKQIADI
FT                   ARMTPPPAPPQLHLKQLLQDEIAAGTVSVDEDARHSAVTFRGDAMFKPGGASVQASMNP
FT                   LIAKIATEIAKVPGKVTIIGYTDKVPIRSRHFASNQVLSEERATQVMQMLQAAGVPANR
FT                   LEAVGKGDAHPVGDNRTAQGRAQNRRVEIDVAR"
FT   gene            287424..291521
FT                   /locus_tag="Bamb_3485"
FT   CDS_pept        287424..291521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3485"
FT                   /product="ImcF domain protein"
FT                   /note="PFAM: ImcF domain protein; protein of unknown
FT                   function DUF1215; KEGG: bur:Bcep18194_B0992 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3485"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89039"
FT                   /db_xref="GOA:Q0B9Y4"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Y4"
FT                   /protein_id="ABI89039.1"
FT                   /translation="MKKFQFLSFLASRQFLAFLALIVVALVIWFVGPLFAFGGLKPLAG
FT                   AGMRVLLIALLLAGVLLWLAGLSTSVVFVVLLCLLIWYAAPLLSLGHTAPFEPVSARLT
FT                   AIALVVAAFVLFWIVRLWQKMREDDAFMKKMLRMDRRENESPAAPRLRKIEAVVTSALA
FT                   RLKSMRTGARGLGKLFQGKRYLYELPWYITLGSQGAGKTSVLMNGGLVFPVAEQMQRAA
FT                   GPSAGDAAAVDWWLTNDAVLIDTAGYYTHHGMSTAEDVKAPAAETGKPATGVPGKGGAD
FT                   AQPAAKSAEDDTKRNEASQSKAAAVSTAGGPVVPPDQGAGERRQKVDRAEWLGFLGMLR
FT                   RHRPRAPINGALLTIDLATLAGGDEQARVAEAATLRARLAELRQELGIRFPVYVMVTKM
FT                   DRLTGFAEYFGGLTAEGRAQTWGFTLPYGKETVAKERLRARCQAELAELSQRLSGSIDT
FT                   HLQDEYDTRKRRSLAALPEEFAALLGPLLDLIDRVFLDSRYDDTQLHSTLRGVYFTSAR
FT                   QRDSEIVVERGTVVQRLLSTQDHAPVSSARAEGNQGFFLHDLLTRVVFPEAHLVSPNLR
FT                   WEYRYRLLRLIGHTLALLLFVWLAIGLRVSFGHNGDYLATIGRKVQALTARVTELYKTP
FT                   KLQAVPDTLTDARYLPTFPGLDLSDPDSAWRYGLYTPVDIATESHRTYDALEDNLLLPQ
FT                   IVHRLEDVMSGAIANKDPKAAYDALRVYLMLYDKAKFNAADVKAWVLDDWAKTDSAAAF
FT                   GGRASMIDHVQQLFSGARVVQSPVIRNDALVQQARAFLEGSNATDRLYQRAKAAMLKEA
FT                   PDEFTLLRAVGPQAGTVFTRASDAPLSRGVSGLFTFDGYRNLFDKRLPEFVQIARDDDA
FT                   WVMGRSYLGEAQKKTAEIVSNAAGADDALTDAVRREYLMEYAQQWDAFLNDIRTVSGTS
FT                   LAFNLKVLRSFAAPDSPLVRLARAAVHETTLAQPMTVTDGSLLQRAADQINQKTDKALG
FT                   IRASERVERELVDNHFAALREVVTGSVDAQSDTQPAATQADKTGLDGVTSLLNDYYTAL
FT                   TVADNALSNNSMPPASDVAAKLKMTADTMPAPFRAVLLQLAADGSREVNQGIGQLLSRQ
FT                   MQAVVGDACRLTIEGNYPFSPDSKRDVGIDDFTRVFAQGGVIDDFFVKTLAPFVDTSAK
FT                   PWRYRTLPGATEPVQGPDLEPFEHAKAIRDIFFNDPGHKQLTWKADIRIPELDPTIMSL
FT                   SLDIDGQTTLYQHGPVAPFTVTWPGPRGGVHTEITASPRIRPDTSTISTDGPWALMRLL
FT                   EKGRVMETATPGRTRVAFSFDGRQAALDVASAGSVANPLTSDVLKTFRCPSTMSAFNLP
FT                   DSGPPPGLPRGMLPASAGSASR"
FT   sig_peptide     287424..287534
FT                   /locus_tag="Bamb_3485"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.835 at
FT                   residue 37"
FT   gene            291542..292756
FT                   /locus_tag="Bamb_3486"
FT   CDS_pept        291542..292756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3486"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG:
FT                   bur:Bcep18194_B0993 outer membrane protein, OmpA/MotB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3486"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89040"
FT                   /db_xref="GOA:Q0B9Y3"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Y3"
FT                   /protein_id="ABI89040.1"
FT                   /translation="MALSTTDPRGHAGAVASPPVAARLTAAEQAINPLLEASRVLLQAL
FT                   ADTPDMLDADAITRWRRWLGQEVRLFTRISGELQLSPEHVRRASYCLCSALDEAAMQTS
FT                   WGKGETTGVEWQDNSLASVSGHDRQGGDRVFQLIDEAMRDPRENLDLIELYQNVLDLGF
FT                   RGRYRFEAGGHKRLQVIREHVHDAVMTGGLNVNRVSEPPKRTRQTVDPWVRPVAVRRSR
FT                   ARFVGGLAVALLLGAGGYAAADRWVRTKETRRALPLDALARNLEQRLRDEVAAGNVELI
FT                   RAPGSDALTLRFGGLFAPGDAAVAPWGASVVASAGREIAVLTGSATVHVAGYADSTSAR
FT                   STRQASNQALSEARARHVAQILVSAGVSAPRISVEGNGEADSLADNGTAAGRARNRRVE
FT                   VTITD"
FT   gene            complement(292778..293659)
FT                   /locus_tag="Bamb_3487"
FT   CDS_pept        complement(292778..293659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3487"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B0412
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3487"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89041"
FT                   /db_xref="GOA:Q0B9Y2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Y2"
FT                   /protein_id="ABI89041.1"
FT                   /translation="MNWDNARFFLALARTGTLRGAAAQLNVDQATVGRRIAALEDELSA
FT                   RLFLRTPALYVLTTAGEALLEPAETMERASLTIERRVMGLDEQLAGTVRIATTDSLGKR
FT                   FVIPAIARLRRRHAGIDVVCVTSTEIANLTRREADLAIRTLRPESPDLIVRRLGHLETG
FT                   IYASRHYLAERGEPVAGSAFDGHDLVMYQQPVMPTMWDALCGEPTSRGRVMFQTSSTMM
FT                   LVEAALAGLGIAELPCFRAEAEPELVRLMARRCNHFDVWLVAHADLYKTARVQAVIEAV
FT                   VEEFATAAPSTR"
FT   gene            293790..295199
FT                   /locus_tag="Bamb_3488"
FT   CDS_pept        293790..295199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3488"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cvi:CV0719 methylenomycin A resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3488"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89042"
FT                   /db_xref="GOA:Q0B9Y1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Y1"
FT                   /protein_id="ABI89042.1"
FT                   /translation="MTDCNPVSVPVSMTAASRPTAREQRFTLALVAIGMFMAVLDTTIV
FT                   NVALPAMRTNLGATVAELAWIVDAYTLSFAALILAGGALSDRFGAKHVYLAGLALFVGA
FT                   SAACGVASSVAILVAARFVQGIGAALFLPASLAVVRSTFDVPAERARAIAVWAGIASVA
FT                   VAVGPVLGGILVDDFGWRSAFLINVPTGALAFAGAAVLVRASVARHARHFDWAGQCIGA
FT                   TALGALCFAVIELPTRGPGAAEVRCALLVAGLAAVVLIVVERRARNPMVPLVWFRNRIF
FT                   VAMNVMGSLVYVGYFGLLFVLSLYLHGRFGMSARQTGLTLLPFALSLSLGNLLSGKWQG
FT                   RVHPVRLMANGLGMAALAIPALAVALTLRAPWPVVWAAMAAFGTGTALSVAPMIATVLE
FT                   QVPADAAGVASGFLNAARQAGSLLGVAIAGAATILLPNLTDALWAIAAVGCVAYATAAF
FT                   TARTAGTAKGT"
FT   gene            295318..296112
FT                   /locus_tag="Bamb_3489"
FT   CDS_pept        295318..296112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3489"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bur:Bcep18194_B1966 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3489"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89043"
FT                   /db_xref="GOA:Q0B9Y0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Y0"
FT                   /protein_id="ABI89043.1"
FT                   /translation="MEPDQETAEPILLRDAHDGVVTLRLNRPPQFNALSEAMLASLHDA
FT                   FESLAADPHVRCVVLAAQGKAFCAGHDLRQMRGKPELDYYRTLFAQCSRVMLAMRALPV
FT                   PVIARVQGIATAAGCQLVAACDLAIAADTARFAVSGINVGLFCSTPAVALSRNVTAKRA
FT                   FDMLVTGRFVDAATAAAWGLVNESVPEDALDAAVARKVAEIVAKSPAAVRYGKQMFYRQ
FT                   RELPLDEAYAYAGDVMARNMMEEDAGEGIDAFLEKRKPTWRS"
FT   gene            complement(296261..297382)
FT                   /locus_tag="Bamb_3490"
FT   CDS_pept        complement(296261..297382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3490"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: bur:Bcep18194_B1965 alanine racemase; TIGRFAM:
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3490"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89044"
FT                   /db_xref="GOA:Q0B9X9"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9X9"
FT                   /protein_id="ABI89044.1"
FT                   /translation="MPRPIVAHVRPDAVRHNLDFIRRTAAQSRVWAVIKANAYGHGIER
FT                   IYPGLAAADGIALLDLDEAVRVRELGWDKPVLLLEGIFEPADVELADRHRLTVAVHCDE
FT                   QLDLLIAAKPRQPLDIQLKMNSGMNRLGYRPYAFRAAWERAAAAPSIGKITLMMHFANA
FT                   DEGEVDWQLEQFDAATAGIPGERSASNSAAVLWHPRAHRDWVRPGTILYGASPTGAAGH
FT                   IADTPLMPAMTLTSKIIGVQTLAPDETVGYGRRFTADRPMRIGVVACGYADGYPRHAPT
FT                   GTPIAVDGMMTRVVGRVSMDMLTVDLTPCPNAGIGSSVELWGDQVKVDDVAEASGTIGY
FT                   ELMCALARRVPVVIVPPGASEVQPLLRTGSHGR"
FT   gene            297686..298057
FT                   /locus_tag="Bamb_3491"
FT   CDS_pept        297686..298057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3491"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: bur:Bcep18194_B1964 membrane protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3491"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89045"
FT                   /db_xref="GOA:Q0B9X8"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9X8"
FT                   /protein_id="ABI89045.1"
FT                   /translation="MTTSQLCLFIVALLPFPLTFLAKARKGYDNHTPREYLAKLEGWRA
FT                   RAQAAHQNAWEALALFTAALVVAWHNGANAHHVDQIAMGFVAIRVVYTLMYLLNWAALR
FT                   SLVWFGGMVCVVALFFAAP"
FT   sig_peptide     297686..297760
FT                   /locus_tag="Bamb_3491"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.871) with cleavage site probability 0.751 at
FT                   residue 25"
FT   gene            complement(298100..299047)
FT                   /locus_tag="Bamb_3492"
FT   CDS_pept        complement(298100..299047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3492"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B1963
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3492"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89046"
FT                   /db_xref="GOA:Q0B9X7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9X7"
FT                   /protein_id="ABI89046.1"
FT                   /translation="MSHLPPLSALRAFEAAVRLGGFARAAVELNVSTSAVSHQIRSLEE
FT                   SLGARLLERSTGLGGISLTPAGARLLPAVSDALARLTDACAEIRGTEQRLTVSANAPFS
FT                   SMWLARRLAEFSSRHPETPLHAVVLDDEPDFTRSSVDLAIVHVPAHRLRADDDVLMRET
FT                   VFPVCSPELYPYASGYVCRSRLLQEMHENSPEIDWRNWASEFGLPDDFETKIVRYSSFS
FT                   QVIGAALGGAGIALGRMPLIEPELRSARLVPLVPGLARDASWRFVLRRHPSTRHRLLDP
FT                   LIAFLRREAEAPPFVAKIVAPASNDSHARGAGGA"
FT   gene            299168..302707
FT                   /locus_tag="Bamb_3493"
FT   CDS_pept        299168..302707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3493"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter, transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG:
FT                   bur:Bcep18194_B1962 ABC efflux pump, fused ATPase and inner
FT                   membrane subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3493"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89047"
FT                   /db_xref="GOA:Q0B9X6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9X6"
FT                   /protein_id="ABI89047.1"
FT                   /translation="MYFDRRLWAMMAGLRWRVAAAVALGLLAMGVGILRFVFLGRVLAL
FT                   VFSGAPARTIGEAVVATSACVLLRAWLDHRRTVLAQHTAGRVQATLRARLFDRIAALGP
FT                   AWFSGERTGGVMLAVVDGVEQLQTFFGVYLPQLVIAACAPVMIFAVLAWWDVPTAAILL
FT                   VAALVTLALPQLVHRADRRAALARSAAFKAFGEEFLDAVQGLPTLKAFGQGTAFGAKLA
FT                   AKARALSDSTFWVLALGLLTRLFTDLGTGLGAAAAIAVGAWRVRHGDMSLEALLIVLMA
FT                   GSEIFRPLRDLRAVLHQGMIGQSAANAIHALLDAGSRAPAADAPRMTDLRAEIAFDGVS
FT                   FAYPGRRADAHAALSFSVREGETVAIVGPSGAGKSTIVRLLLRQHDVQGGAVRIGGHDV
FT                   RTLDADQVREMIAVVAQDATLFDGSVADNLRLGRPDASDADMIAAARAANAHDFISALP
FT                   DGYATRIGERGLMLSGGQRQRLAIARALLRDAPILLLDEALSSVDAENEALIQQALDRL
FT                   TRGRTTLVLAHRLSSVIGADRILVLDQGQVVDEGTHAALIARDGPYRRLMGPQLEAVAE
FT                   SVGVATTAGATARASSGPQVRPLNDDAGTIGWPETLQTLLRFVRPWQGKVVLTVLFGIG
FT                   RVLAFIGVGVIGAMVVGAVSAGHASPVLVVALLVIAPVAAVLHWLESWLAHDMAYRLLA
FT                   EMRIALFATLERLAPAGLLHRRSGDLVSLATQDVETVEYFYAHTLAPAFVAVLVPAAVL
FT                   VLLASVAWPLALVLLPFLLWAGLAPVLARRDVDRLGTGAREALGQLGAHVTETIQGLAE
FT                   LTAFQAIARRRAAFVAEVDAYRKQRAKLLDDLSKQSAALEIASWLGGLTVAALGALLCA
FT                   RGWFPRESLPLLVLVAVAAFMPVAEIGQVARQLADTIASTRRLRALEKEPMTVTDGTHA
FT                   MPGNPAVRFEAVSFTYPGRGVPAIDRVSFEVPPGSTVALVGASGAGKSTVASLLLRFWD
FT                   PQQGRVTLGGVDLRDLRLDDLRQHIALVAQDTYLFNDTLEANIRLAANDASDADVRRAI
FT                   DHAALGEFVARLPDGLATRVGERGVQLSGGQRQRVAIARAFLKDAPVLILDEATSHLDT
FT                   ISEQQIRAALEDLMTQRTSIIIAHRLSTVRNADLILVIEQGSVIEAGRHAELMARQGAY
FT                   ARLVSHQASGVAA"
FT   gene            303195..303392
FT                   /locus_tag="Bamb_3494"
FT   CDS_pept        303195..303392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3494"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="KEGG: bur:Bcep18194_B1959 ABC polar amino acid
FT                   transporter, ATPase subunit; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3494"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89048"
FT                   /db_xref="GOA:Q0B9X5"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9X5"
FT                   /protein_id="ABI89048.1"
FT                   /translation="MSSFPPAGWPATSLNHAERNHESAKRVGTRLLFMDQGGIAEDGHP
FT                   VDLIDRPPTPRLQEFLKHVS"
FT   gene            303413..304462
FT                   /locus_tag="Bamb_3495"
FT   CDS_pept        303413..304462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3495"
FT                   /product="peptidase C45, acyl-coenzyme
FT                   A:6-aminopenicillanic acid acyl-transferase"
FT                   /note="PFAM: peptidase C45, acyl-coenzyme
FT                   A:6-aminopenicillanic acid acyl-transferase; KEGG:
FT                   bur:Bcep18194_B1958 peptidase C45, acyl-coenzyme
FT                   A/6-aminopenicillanic acid acyl-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3495"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89049"
FT                   /db_xref="GOA:Q0B9X4"
FT                   /db_xref="InterPro:IPR005079"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9X4"
FT                   /protein_id="ABI89049.1"
FT                   /translation="MPLSLSPVIAGAPFDIGVRLGELARPVFDEYMQQSNAWQAVRRWR
FT                   GHPFVAALRQAALAAYPDLVAELDGIAAGVGWPADDIFLWNCRGELIHNAPDGCTTLAA
FT                   RDADGTRWIAHNEDGDPYLRERCLLVDVQPQGKPGFISFYYPGSLPGHTFAANRAGIAQ
FT                   AINNLRILTPAAGVPRMILARAVLDATSLDAAADVLRTHARASGFHHTLGATGDARLLS
FT                   IEASVARCSVVDVARLAGHANHLVHPGCEAEAQIVTQSSGDRQRRVDALTQRIDTIDEA
FT                   ALLRVLGDRAPEGLPIYRDDPTDPDDENTLATAVFAIRDAAIDVTIHQHGTQRFATRIV
FT                   PSAHARSAS"
FT   gene            304478..305812
FT                   /locus_tag="Bamb_3496"
FT   CDS_pept        304478..305812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3496"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   bur:Bcep18194_B1957 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3496"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89050"
FT                   /db_xref="GOA:Q0B9X3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9X3"
FT                   /protein_id="ABI89050.1"
FT                   /translation="MTTVFHRAPRATLPVAVAGDGIEIIDSTGKRYIDACGGAAVSCLG
FT                   HSNQRVIDAIKRQVQQLPYAHTSFFTTDVAEELADRLVDAAPAGLEHVYFVSGGSEAIE
FT                   AALKLARQYFVEKGELQRRHFIARRQSYHGNTLGALAIGGNAWRREPFLPLLIEAHHVS
FT                   PCYAYRDQHAGETDEAYAQRLADELEQKIVELGAENVAAFVAETVVGATAGAVPPVRTY
FT                   LKKIRAVCDKYGVLMILDEIMSGMGRTGYLFACDEDEVAPDLLTIAKGLGAGYQPIGAT
FT                   LVSDRIYRTIVDGSGFFQHGHTYLGHATACAAALEVQRVIAEEKLLDNVKARGEQLRAS
FT                   LRTHYGAHPHVGDVRGRGLFVGVELVRDRDSKAAFDPALKLHAAVKREAMQRGLMVYPM
FT                   GGTIDGVNGDHILVAPPFVCTAQQIDTIVERLSGAIDAALASAGA"
FT   gene            305838..306392
FT                   /locus_tag="Bamb_3497"
FT   CDS_pept        305838..306392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3497"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   bur:Bcep18194_B1956 putative 4-carboxymuconolactone
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3497"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89051"
FT                   /db_xref="GOA:Q0B9X2"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9X2"
FT                   /protein_id="ABI89051.1"
FT                   /translation="MTDRLPPFDPASATDEQKAVLADILSGPRGNLNGPFLGWIASPEL
FT                   AQHAQRLGAFCRYRTGLSLRLSELAILVTAARWRSQAEWHIHYPIALDAGVPAATADAI
FT                   RRGVMPAFESDDDALIHAFATELYDTQRVSDATFARAQARFGHETVVNLVALLGYYALV
FT                   AMTLNTFGMRADGQTDLPFPE"
FT   gene            306601..307500
FT                   /locus_tag="Bamb_3498"
FT   CDS_pept        306601..307500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3498"
FT                   /product="Aspartyl/Asparaginyl beta-hydroxylase"
FT                   /note="PFAM: Aspartyl/Asparaginyl beta-hydroxylase; KEGG:
FT                   putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3498"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89052"
FT                   /db_xref="GOA:Q0B9X1"
FT                   /db_xref="InterPro:IPR007803"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9X1"
FT                   /protein_id="ABI89052.1"
FT                   /translation="MRWVLLIVFIACVIHTHRRGKVRHRLFRQLSDHSTFTAPLNCFSY
FT                   AFSSVPTTPFLDPRHFPELAVLQREWRTFREEALALRDASRIKASGEYNDIGFNSFFRN
FT                   GWKRFYLKWYDAPHPSAQALCPRTVEILSRIPSIKAAMFAQLPPGGKLGLHRDPYAGSL
FT                   RYHLGLDTPNDDACRIVVDGESYAWRDGEAVMFDETYLHWAENRTAHDRVILFCDIDRP
FT                   MKYRWAQRVNDVFGQLLMRAAASPNETGDRTGGLNHAFKYLYAIRRAGKRLKAWNRTVY
FT                   YVVKWALFGGIAVAIFCL"
FT   gene            307683..308543
FT                   /locus_tag="Bamb_3499"
FT   CDS_pept        307683..308543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1955 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3499"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89053"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9X0"
FT                   /protein_id="ABI89053.1"
FT                   /translation="MRRTRKTLMIVGGLLVAAAGSGYVMLLRDDHRAIAEAGIGDAAAP
FT                   AAAVPAANGDHTAQGTIAPPAAVAVPSTHVDDAVPQRAAVPPPAAAPARTNAAPPSTAV
FT                   VPVIAGQAPPAKPTAPPPTVHVVTVEPEDSTPAKAKPAPATPQAPVQAAQPPQAARPTQ
FT                   PAQAAQPVQSTPPVQATQASRSSQPAYQPAQRAERKRDGLERHATTPSGTKSETPETAA
FT                   LVHESAKLDPSLPPPQYVATPSVDRARPSAGGNAVAAAMTEQLVRQSSSFKAPASASAA
FT                   PAAAQ"
FT   sig_peptide     307683..307763
FT                   /locus_tag="Bamb_3499"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.997) with cleavage site probability 0.416 at
FT                   residue 27"
FT   gene            complement(308658..310256)
FT                   /locus_tag="Bamb_3500"
FT   CDS_pept        complement(308658..310256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3500"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bur:Bcep18194_B1954 FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3500"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89054"
FT                   /db_xref="GOA:Q0B9W9"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9W9"
FT                   /protein_id="ABI89054.1"
FT                   /translation="MLDANLKNQLKAYLEKITRPIELVASLDDSAKSQELLALLNEIGS
FT                   LTSRVTVTERRDDAERKPSFSIGEPGKPAGIRFAGIPMGHEFTSLVLALLQTGGHPIKL
FT                   DDDVIEQIRALDGDYAFETYFSLSCQNCPEVVQALNVMSLINPRIRHVAIDGALFQNEV
FT                   EARQIMAVPTMFLNGESFGQGRSSVKEILAKLDTGASARAAKSLENKPVFDTLIVGGGP
FT                   AGAAAAIYSARKGIATGVVAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYD
FT                   VDIMDVQRADALIPGDVHQIRLANGAVLKAKTIILATGARWREINVPGEREYRNRGVAY
FT                   CPHCDGPLFKGKRVAVVGGGNSGVEAAIDLAGIVKEVTLLEYGAQLRADEVLQRKLRSL
FT                   PNVTIVTQAQTTELTGDGSKLNGLVYKDLRSGEAKRVDLEGVFVQIGLVPNTEWLKGTI
FT                   ELSKHGEIVVDARGATSVPGVFAAGDVTTVPFKQIVIAVGEGAKASLGAFDHLIRQDVT
FT                   PATADTPQAEEAIAA"
FT   gene            complement(310379..310942)
FT                   /locus_tag="Bamb_3501"
FT   CDS_pept        complement(310379..310942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3501"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   bur:Bcep18194_B1953 alkyl hydroperoxide reductase/thiol
FT                   specific antioxidant/Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3501"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89055"
FT                   /db_xref="GOA:Q0B9W8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9W8"
FT                   /protein_id="ABI89055.1"
FT                   /translation="MPIINTQIKPFKATAYHNGEFVPVTEENFKGKWSVVVFYPADFTF
FT                   VCPTELGDLADRYAEFQKLGVEIYGVSTDTHFTHKAWHDTSDTIGKIKYPMIGDPTLTL
FT                   SRNFDVLIEEEGMALRGTFVINPEGEIKLCEIHDNGIGRDAGELLRKVQAAQYIAAHPG
FT                   EVCPAKWTPGAETLTPSLDLIGKI"
FT   gene            311263..312270
FT                   /locus_tag="Bamb_3502"
FT   CDS_pept        311263..312270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3502"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="SMART: extracellular solute-binding protein, family
FT                   3; KEGG: reu:Reut_A1722 extracellular solute-binding
FT                   protein, family 3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3502"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89056"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9W7"
FT                   /protein_id="ABI89056.1"
FT                   /translation="MNLFSGRAARVLLAWCRDIFLERRCVLRHVRGAACAFIAVSCSAP
FT                   ALALDATAPATTAPKAVTAAAATPATTTAPATTVTATGLVPLPDGRLLAPEFARIVTRG
FT                   TLVVAVLGVDQPPFFWSRNGALAGVDIDLADELAKKLGVAVQFDRDARTFDDVVHLLAT
FT                   GQADVAISKLSRTLPRAQVVSFSTPYISLRRALLINRVSFAELAKGRPLPEVVRDYRGT
FT                   IGVVARSAYAEYVRNDFPAAQVRTYPSWPATLDALNAGAVTAVYRDELAIKLVMQDDPS
FT                   APIRLRVATFDDLTDALAVGVPVSAPTLLAFVNQFLAERHTRLDVKSLLDAMGH"
FT   sig_peptide     311263..311409
FT                   /locus_tag="Bamb_3502"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.877) with cleavage site probability 0.876 at
FT                   residue 49"
FT   gene            312254..313576
FT                   /locus_tag="Bamb_3503"
FT   CDS_pept        312254..313576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3503"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   reu:Reut_A1721 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3503"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89057"
FT                   /db_xref="GOA:Q0B9W6"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9W6"
FT                   /protein_id="ABI89057.1"
FT                   /translation="MRWATDMNMNETRGIKPRIERLHAFAIHPLTVFGSLALGIVAGML
FT                   WPAAAPQFDYVGEVYVGLLKMTALPFMTAAVIFSLQRLLREGSASDLVMRVIAIFGCVS
FT                   VFVVVVGAVVLVAMRPGEHLSNATLKAFGALVGSDGAASDTVMTLYGTDPAEKSSGLAD
FT                   MLIALVPGNFFAALASGDTLKALVFSLFFGFASGRVPASISAALSQTLETVYFTCQKIM
FT                   HWLAYPTPIVLFCGGAAQIGTSGFGPLEAMFRFVMAFVVVTVVLIAAAIAVIWKRSGAT
FT                   LADTLAGLRTPFAMALATRSSVACMPSMIECLADGFGFARARVELVVPLAVSLLRVGPM
FT                   VYYASATLFVAQLYERALGPGELCVVLVASVLAGFASTGTSGVVTVSLAGMVCAALHLP
FT                   FEAAFVLFAAVDPFCEILRTLLLVIGNSAVVSAICARPPRA"
FT   gene            313587..314288
FT                   /locus_tag="Bamb_3504"
FT   CDS_pept        313587..314288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3504"
FT                   /product="aspartate racemase"
FT                   /EC_number="5.1.1.13"
FT                   /note="TIGRFAM: aspartate racemase; PFAM: Asp/Glu racemase;
FT                   KEGG: reu:Reut_A1720 aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3504"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89058"
FT                   /db_xref="GOA:Q0B9W5"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9W5"
FT                   /protein_id="ABI89058.1"
FT                   /translation="MALVGVLGGMGPLATVDFMHRVIRLTRARCDQEHLPMIVANLTRT
FT                   PDRSRAILDGGADPLPALLDGVALLNRCGVDVIAIPCNSAHHWYAPLRERSAAPVLHIV
FT                   DASVAAVPAGVRRVAVLATGGTLVSGFYQAALRARGFEPVMPAVAAQRDIAACIAAVKA
FT                   GKIDASVRRLSRALATLARRDVGVAVMGCTEIPIAARALRDAPFALIDSTQELARATVA
FT                   YAAERGWGRAV"
FT   gene            complement(314373..315266)
FT                   /locus_tag="Bamb_3505"
FT   CDS_pept        complement(314373..315266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3505"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B1951
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3505"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89059"
FT                   /db_xref="GOA:Q0B9W4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9W4"
FT                   /protein_id="ABI89059.1"
FT                   /translation="MKNIEQLPHDPPLRAVRAFEAFARLGSVTAAAHELDITPSAVSHQ
FT                   LQLLEAFIQTPLTVREGRLLALTDEGRDYYRSISAAFSVLRSATRFVRDRSSLRQITIS
FT                   LIPLLGIGWFIPRLHAFLADNTDVDVTVLYAHHRNYRSDASDLSIRFGTGDWPGYRCER
FT                   LLPGAMVPMCSPSFLKRHGPFRTPADLARAPLVHDEDRSTWVNWLQGAGVRHVSHAVGP
FT                   MFEDGQLTLSAARADLGAALLRAPLVERELASGELVQLFDHALDDGRDYYLCTREDADM
FT                   PDGARRLADWLRKIAA"
FT   gene            315444..316610
FT                   /locus_tag="Bamb_3506"
FT   CDS_pept        315444..316610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3506"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bur:Bcep18194_B1950 ABC branched chain amino acid family
FT                   transporter, periplasmic ligand binding protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3506"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89060"
FT                   /db_xref="GOA:Q0B9W3"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9W3"
FT                   /protein_id="ABI89060.1"
FT                   /translation="MKIAFLPARLAFSAAALIAAVPAFAQSAPQTILIGLAAPLTGPSA
FT                   RIGKDLQNGAQLAIDDANAEHPSIGGKPVVYKLVAADDQSDPRTAVAVAQQLVDQHVIG
FT                   VVGHWNTGCSVPASRVYRDAGIAQIAPASTGHQYTQQGYATAFRIMGHDDAGGNFTGAY
FT                   AVKTLKAKRIAVIDDRTSFGAGLADQFIKGVQANGGTIVDRQYVNDKTTDFSGVLTAIK
FT                   GKRADLVFFGGLDAQAAPIARRMRQLGVNAPLLGAGGFVSQTFLSLAGKDGEGVTALEP
FT                   GLPLDRMPGGNAFDAQYRARWHAPIELHAPFAYDAAATLIAAVQKAGSTQPAKVVAAVR
FT                   AIDRPGVTGRVAFDQQGNLKDPAFTIYQVRGGKWTVVDVLGGGRPATK"
FT   sig_peptide     315444..315521
FT                   /locus_tag="Bamb_3506"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.914 at
FT                   residue 26"
FT   gene            316627..317166
FT                   /locus_tag="Bamb_3507"
FT   CDS_pept        316627..317166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3507"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1949 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3507"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89061"
FT                   /db_xref="InterPro:IPR026002"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9W2"
FT                   /protein_id="ABI89061.1"
FT                   /translation="MTDQTHAAAPAPEDTRLGILARRRIEAEIIKPIYEIMKREFGTER
FT                   AQAVIAEAVRGAAVDAGRTFAAQEPDGTSVQSFIALQVLWEKDDALDVEVRRADDAHYD
FT                   YDVHRCSYAEMYHAMGLGEIGHLLSCARDSYFIEGYDPRIALTRTSTIMQGGKRCDFRY
FT                   ALQAAPRDDAAEAGNA"
FT   gene            317159..318415
FT                   /locus_tag="Bamb_3508"
FT   CDS_pept        317159..318415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3508"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: bur:Bcep18194_B1948 N-carbamoyl-L-amino acid
FT                   amidohydrolase; TIGRFAM: amidase, hydantoinase/carbamoylase
FT                   family; PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3508"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89062"
FT                   /db_xref="GOA:Q0B9W1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9W1"
FT                   /protein_id="ABI89062.1"
FT                   /translation="MHDDFARAPRVDGTRLWASLERMAQIGATPKGGVCRLALTDLDRE
FT                   SRDLFVEWARDAGCTVRVDRMGNVFARRAGRNPDAAPVMTGSHADSQPTGGRYDGIYGV
FT                   LGGLEVVRALNDAGIETERPIDVVIWTNEEGSRFAPAMISAGVFSGVYPLEYGLSRTDG
FT                   AGKTIGEELARIGYAGTEPVGGYPVHAAYELHIEQGAILERAGKTIGVVTAGQGQRWYE
FT                   VTLTGVDAHAGTTPMEFRRDTLVGAARMIAFVDALGRRHAPHARATVGMIEARPNSRNT
FT                   VPGNCFFTVEFRHPDDAVLDELDAALRAELARVAADAGLGAQIEQIFTYPPVPFAPRCI
FT                   DAVRDAAQALGLSHMDIVSGAGHDACYVARVAPTGMIFVPCVDGLSHNEAEAITPEWST
FT                   AGADVLLRAVLQSAQEAGA"
FT   gene            complement(318426..319262)
FT                   /locus_tag="Bamb_3509"
FT   CDS_pept        complement(318426..319262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3509"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG:
FT                   bur:Bcep18194_B1946 cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3509"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89063"
FT                   /db_xref="GOA:Q0B9W0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9W0"
FT                   /protein_id="ABI89063.1"
FT                   /translation="MLKCRWFSLLLLMVCLIATRASAQGALELDTDGTPRVLTREALLA
FT                   RADATDIHVPRDIAYGRPMTFRAVPFAALLGDTPPAADGVLETRAADGFAAQLPLDLAR
FT                   RRAPAGAIAWLAIEDPAHPWPKLPGKQVSAGPFYLVWLGPDASSVRGEQWPYQIVRITV
FT                   ESSPLARWPSLAVDSALPANDPARAGQRLFVTQCLACHRLDGAGSSHAGPDLNAPMNPV
FT                   DYFQPAALRRYIRNPASVRDWPGRVMPAFPPEQLSDRELDQIVAYLAYMARRKAGK"
FT   sig_peptide     complement(319191..319262)
FT                   /locus_tag="Bamb_3509"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.905 at
FT                   residue 24"
FT   gene            complement(319615..320916)
FT                   /locus_tag="Bamb_3510"
FT   CDS_pept        complement(319615..320916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3510"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1945 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3510"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89064"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9V9"
FT                   /protein_id="ABI89064.1"
FT                   /translation="MTERQDVAHAFALRARAARRAAAWRVAAVLCGACVAVAAPTYTCA
FT                   GAPVVHTVTVQPPAAPQERGDARRFMHGIGVADAGDGRRWVFFSSSGIAPRGALRNGNW
FT                   PHDVYVGEWLPGKPGLLRVHTFISRPEAQEPVSIAQNPRGDIFVTFEDGWDTPETVSQR
FT                   YGIYRRDLKPVKPYPNDVEAGGHSGHVAAVGERFVVFYSADWIDGGGVDNLGTGNGVYV
FT                   KTYDAEGRVLNHVSVAPRRREWWPMVAGSSRRALLLWQKYIEGSTDATLEYAMFDPVTA
FT                   KLDKLGALNDAIQYYVYSSAYVPAVDRFVVVTTTADNRGVAMLIDPDGRRVATLDCLPA
FT                   SVRESGIGVDGTHAYVPTRDGRLLALALSPTGMSVSGVQRSPIPWGSTGIAGFPARGGA
FT                   MHFVSLTPSGAREADFDTARDTPLPKADAQCPTR"
FT   gene            complement(320913..322736)
FT                   /locus_tag="Bamb_3511"
FT   CDS_pept        complement(320913..322736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3511"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="2.6.1.16"
FT                   /note="TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase, class-II; sugar isomerase (SIS); KEGG:
FT                   bur:Bcep18194_B1944 glucosamine-fructose-6-phosphate
FT                   aminotransferase, isomerising"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3511"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89065"
FT                   /db_xref="GOA:Q0B9V8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9V8"
FT                   /protein_id="ABI89065.1"
FT                   /translation="MCGIVGASGLKNQVPQLVNALSRLEYRGYDSCGIAVLRDGHLCSE
FT                   RTLRRVADLQQRVLTLGLEAQTCIAHTRWATHGAPSEVNAHPIMSGDTIAVVHNGIIEN
FT                   HDALRAELRQRGYTFRGETDTEVIAHLIHSVYRDNLFDAVIRAVKRLHGAYAIAVLSAR
FT                   EPQRLVAARAGSPLVIGIGADQNYLASDCAALGDLTDRFVYLEDGDVALITPERIDVVD
FT                   SVGAEARRPLCEVKARDDDAALGPYQHFMQKEIFEQPKAIASTIDGIDAISPALFGGEA
FT                   SARALLSKARSVLLLGCGTSYYAGLTAKYWLESIAGIPAQVEIASEYRYRDTVPDPRTL
FT                   VVGISQSGETADTIGALERAREMGQDMSMAICNVATSSIARSAPLCFLTRAGIELGVAS
FT                   TKAFTTQLVALFLLTLTLAQQRGRLDAEQVAMHLKKLHELPERIAHALALETQIMGWAA
FT                   KFARTENALFLGRGIHYPIALEGALKLKEVSYIHAEGYPAGELKHGPLALVTSAMPVVT
FT                   IAPDDRLFQKLKSNMAEVRARGGRLYVLAGHQLEIEADRDTHLIRVRESGDALSPIVNV
FT                   IPLQLLAYHVGCARGADVDKPRNLAKSVTVE"
FT   gene            complement(322859..323347)
FT                   /locus_tag="Bamb_3512"
FT   CDS_pept        complement(322859..323347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3512"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1943 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3512"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89066"
FT                   /db_xref="GOA:Q0B9V7"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9V7"
FT                   /protein_id="ABI89066.1"
FT                   /translation="MKNAPIIDLSLRAPRELIAERGGIVGPVLVAWFRLMRPALVGGVW
FT                   ASICIYTYRYLLPFNEAEMPIEQIVFYVTSIALIAGTIVMWLIAGRVVHPLAYRWRVSK
FT                   MLRRSASVKVRSVAPTAFAGARRRGARRTTRILVASHDANGSISGIEWVAHAGAQPRE"
FT   gene            complement(323325..324596)
FT                   /locus_tag="Bamb_3513"
FT   CDS_pept        complement(323325..324596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3513"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   bur:Bcep18194_B1942 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3513"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89067"
FT                   /db_xref="GOA:Q0B9V6"
FT                   /db_xref="InterPro:IPR023853"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9V6"
FT                   /protein_id="ABI89067.1"
FT                   /translation="MNSHSIIQRLQDFVFYYPFFMSYLWMIGGVVHYFLLEEGRELSMR
FT                   TIASSGIPKISIVVPCFNEAANARSVIRHLNAMDYPNYDIIAVNDGSQDRTGEILNELA
FT                   VEIPRLLVIHHARNEGKAVGLTTAAAVSNAEYLLCIDGDALLAHDAIGWMLEHFLTDPG
FT                   VGAVTGNPRIRTRTSLLGRMQVGEFSSIVGLIKRTQQVYGRIFTVSGVITMFRKTALAD
FT                   VGYWSSDMLTEDIDISWKLQCRDWRVVYEPHALSWILMPETVRGLYRQRLRWAKGGIQV
FT                   LMKYAGTLARPTQMMMWPLFIEYLIGIAWAYSMSFILLLALIDVVYPLPPSWHVSVVPH
FT                   WHGMLLVATCILQLIIGSMIDRRYDEKLLMYFLDTIWYPVAFWLISMITTVVALPAVVL
FT                   RGRGKRAVWVSPDRGIQHEERADY"
FT   gene            complement(324593..326686)
FT                   /locus_tag="Bamb_3514"
FT   CDS_pept        complement(324593..326686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3514"
FT                   /product="polysaccharide deacetylase"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: polysaccharide deacetylase; KEGG: bur:Bcep18194_B1941
FT                   polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3514"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89068"
FT                   /db_xref="GOA:Q0B9V5"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR023854"
FT                   /db_xref="InterPro:IPR032772"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9V5"
FT                   /protein_id="ABI89068.1"
FT                   /translation="MQSRRTFMCGCMGAFAACSLFPGVSNAKMIDLLPPSDPADGKTFR
FT                   VICLHDVRDNLMASFTSPSAMVDPFAVDTGTLTAIFSWLQTNNYHTITVKQIEESRHGG
FT                   KPLPPRSVLLTFDDGFRSHYTKVLPLLERFKYPAVMGIVTAWIDTPPNAPIRISDKVQV
FT                   PRDYFLSWDEVKKLGQSHLVELGCHTHNLHHGAIANPQGNELPATTSHLYLQDQKRYET
FT                   DAEFEARVHNDLQTCVRQIREHTGIVARSMVWPYGAENQPVRKISTSLGMDIQFSLDAG
FT                   PNTPDVPLDRLRRILMMYDVDIGGFERSMREPASNRGDVDVPERTVQVDLDQVYDPDPA
FT                   RQEANLGKLIERIYRMQPKSVYLQAYADPKGTGVAEAVYFPNRHLPMRSDLFSRAAWQL
FT                   NTRANVQVYAWMPVLAFRPPADKQRGLEAVSAYGGAPARENGTRVFRLSPFDPEARLMI
FT                   QQIYEDLTKHASFSGILFGDDAVLDDYEDAGKHALRTYSQWGLPADIGKIRENPDLMKR
FT                   WTRQKSRYLVDLTRQLSQIVLAHQNAGDVLTARNIFAMPVLKPESEAWYAQNYDDFLAT
FT                   YDYVALMAMPYMEQAKDPESWLDQLVQAVHAKPRGLERTVFELQSYDWRARKEVPANTL
FT                   LAQMRRLRSKGAVNFGYYPDNFLNGQPQLEAMRDVMSLKSRLDQNSINALMQMQHTPGT
FT                   KTP"
FT   sig_peptide     complement(326603..326686)
FT                   /locus_tag="Bamb_3514"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            complement(326702..329566)
FT                   /locus_tag="Bamb_3515"
FT   CDS_pept        complement(326702..329566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3515"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89069"
FT                   /db_xref="GOA:Q0B9V4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023870"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9V4"
FT                   /protein_id="ABI89069.1"
FT                   /translation="MANNRKQQCTTVAPSNRRILLHAPLLLLLVASGPCFAAEGDAEPG
FT                   SAREIAKAHGARDALPPDLQPTGAPMQAAQGSGTLPPHAPTPIALASDASLQIAQASPM
FT                   PISVVVEPEAPQSGEPAPGAQPPDPPTPVAPTPDGPKQLAGASDSALPSTPVSIAQTQD
FT                   APVQLTQASDTAPPNTPAPVAQTQDAPAQLAQASDIAPPNTPAPIAQTQDTQMPPAQAT
FT                   STQPPDTPAPTAATTSEPSASTAPQPAPATTTPPNSPTQTAQASGTPMPNSPAPVTQMP
FT                   GAQPPSSQGPSSQTPGAQLPGESMQRSQGPDVETPNAEAPDLRTADVETVRKDVFGLAA
FT                   SGGAVKAIDEAKMRPDAFSAVDIAQLEELSIRQQVRGGRDKSRAMTSSDRFDGLDNALR
FT                   AADDLDQRMPATPEYTPVRTALAGDRTIALAARGDMTKAVKTFETIPPDAEISIDALAA
FT                   VGDAYLYLSEPGKANVVYQRALNQATASPTDRATRGFQYGARTRAIELREGLFWSYVDR
FT                   ARAADAKQVLDDMNKSLPPATEVRNYGPGESDYLRYYRLRAQYLIFTGRPDEGIAALEQ
FT                   LEKEVPFNGEVRAAHADAVSGQAHPRQAISMYRASLADHPDSVEMLAGLGRASLTADDY
FT                   ATAKTVDQTLDNTFPDSGAVRSFKRDYKAYRSPIFTTDLSFEHGNSALADNSFTSDSYI
FT                   YSQPFGDNWRVFSHTFFGHAQTDSGSISRTRTGIGGDYRHGPLTVLGEVTRSFGGDGRT
FT                   GGRGTIAYALNDYWTVSGGLDSNDNSLPWKAYAAHIWGRSANVSVVYRQNDRREVKLNY
FT                   GVSRYSDSNLHQEITATATQRVYTSANQLVNVSLDLGTDSNTRRDAPYFSPGRDYAAAA
FT                   TVMHQLTLWKKGDMGLQQRISVSGGAYNERGFGTSALWSARLEHAWTFKHDITLSYGIE
FT                   VSSHAYDGERERSETGFLSLNLPF"
FT   sig_peptide     complement(329453..329566)
FT                   /locus_tag="Bamb_3515"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 1.000 at
FT                   residue 38"
FT   gene            complement(329671..330441)
FT                   /locus_tag="Bamb_3516"
FT   CDS_pept        complement(329671..330441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1939 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3516"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89070"
FT                   /db_xref="GOA:Q0B9V3"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9V3"
FT                   /protein_id="ABI89070.1"
FT                   /translation="MTRAERPDDAPVRQPKPSWGPGKNAALSIVAFAAIFGAFAYVERD
FT                   VGMGNAAHTTVTRDIAGVVGTAVQKSRDAIVAVTDNASGPSASAGAASTVAQAAPGKSS
FT                   AAEAAPVMSAAAEPTVAPPMTARSHPKHTRRAHGSSTTLAANASAASAGARTTRSSEAH
FT                   RTSRSQALARTKKPTDSEPSVQPHSYTADSAHMQAASVTRAEVEGARALAKARSCAQRD
FT                   QWNCVEQNASRALAIDPKNSESRALLGQAIRNRL"
FT   gene            complement(330527..330979)
FT                   /locus_tag="Bamb_3517"
FT   CDS_pept        complement(330527..330979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1938 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3517"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89071"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9V2"
FT                   /protein_id="ABI89071.1"
FT                   /translation="MEVAMSSSSFKQHARPLVGLVVVFALCIDAVAQGQTQTQTETPAS
FT                   GAGPERYVISYICGDARIDGTAPLPPDGRPYNLGVSFVAGSTGQPLSNVQVRLRRHGRV
FT                   LLEFKATGPRCLFSVPEASYRVEGTYQGATQFAIVETGALTTQLKW"
FT   gene            complement(331649..332641)
FT                   /locus_tag="Bamb_3518"
FT   CDS_pept        complement(331649..332641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3518"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B1937
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3518"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89072"
FT                   /db_xref="GOA:Q0B9V1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9V1"
FT                   /protein_id="ABI89072.1"
FT                   /translation="MEAKWLEDFLSLADTKSFSRAARHRHLTQSAFSRRIAALETWMDA
FT                   KLVDRSINPITLTPAGQMFRGLAADILRSMYAARNLVNGYDQFAASDQVVRFAVAHTLV
FT                   FTLFPEWLKQLNGEVGHVTARVNAVNVPEGVQQLVEGECDLLLGYHHPQLPIVLDPNHF
FT                   PFVTLGVERILPVSTPDAHGRPVFELPGAPDAPLPLLAYSSGAFLGNVVEMLLLNASES
FT                   YALHRCFETHMSEALKGMVVAGHGIGWLPESCVAKELAEGSLVRAGSADWITELEIRLY
FT                   RSARKRGLAAEQLWTYIMNRPRTAADGLVAAEPGAPAVRIARRSVGGSR"
FT   gene            333287..334717
FT                   /locus_tag="Bamb_3519"
FT   CDS_pept        333287..334717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3519"
FT                   /product="protein of unknown function DUF404"
FT                   /note="PFAM: protein of unknown function DUF404; protein of
FT                   unknown function DUF407; KEGG: bur:Bcep18194_B1936
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3519"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89073"
FT                   /db_xref="InterPro:IPR016450"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9V0"
FT                   /protein_id="ABI89073.1"
FT                   /translation="MENNSMKPFDEMLQSGDMVRPPYARLKQWLDTQNPASLAQKAHDA
FT                   EGVFRRTGITFAVYGDAQAAERLIPFDIVPRIISGAEWSRLSLGIEQRVMALNAFLDDI
FT                   YHRQEIVRAGIVPKHLIAHNEAFIPEMIDFRPPGNVYTHIIGVDIVRTSENEFYVLEDN
FT                   ARTPSGVSYMLENRETMMQLFPELFQQVKVRPVETYPQMLRQSLAAVCPPGGNADNPTI
FT                   AVLTPGIHNSAYYEHSFLADQMGVHLVEGSDLQVVDGRVAMRTTEGFRQIDVLYRRVDD
FT                   AFLDPLTFRPDSVLGVAGIMDVYRAGNITIANAPGTGIADDKAIYSYMPEIVEFYTGRK
FT                   ALLENVPTWRCGEADSLKYVLDHLDELVVKEVHGSGGYGMLVGPCASKAELEAFAAKLR
FT                   ARPANYIAQPTLALSTTPILTEAGLAPRHVDLRPFVLVSDRIRITPGGLTRVALQEGSL
FT                   VVNSSQGGGTKDTWVLAD"
FT   gene            334782..335723
FT                   /locus_tag="Bamb_3520"
FT   CDS_pept        334782..335723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3520"
FT                   /product="protein of unknown function DUF403"
FT                   /note="PFAM: protein of unknown function DUF403; KEGG:
FT                   bur:Bcep18194_B1935 protein of unknown function DUF403"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3520"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89074"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9U9"
FT                   /protein_id="ABI89074.1"
FT                   /translation="MLLGRTASGLYWMYRYIERAENIARIVDAGLRMALTRTADAPAEW
FT                   SSVLVSSGADDGYRQKYDAYAADTVTDYLLRDRDNPSSVLSCIEAARSNARMVRTALTR
FT                   EAWESVNGAWLALRRALAEPVPESGLPAVLDEVKRETALILGSFYSTMLRNEIFDFAQI
FT                   GAFVERADNTARIIDVKYHLLLPSVSHVGTILDNYQWETILRCVAAHRSYRWVYDVQYK
FT                   PMNIADYLILNGRMPRSLRYCYGRVVSSLNLLAKDYGVTHPCHDTAAKILQMLSDTSVE
FT                   RIFKSGLHEFLTDFIGRNNSLGADIAQAYNFD"
FT   gene            335732..336748
FT                   /locus_tag="Bamb_3521"
FT   CDS_pept        335732..336748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3521"
FT                   /product="transglutaminase, N-terminal domain protein"
FT                   /note="PFAM: transglutaminase, N-terminal domain protein;
FT                   KEGG: bur:Bcep18194_B1934 transglutaminase-like enzyme
FT                   putative cysteine protease-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3521"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89075"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9U8"
FT                   /protein_id="ABI89075.1"
FT                   /translation="MRLAIRHISRYKFDDQATHALQRLRLRPQSGPGQTVRAWQVTIDG
FT                   VEPTLSYADGFGNRIDLVRHDPGAKNEIVVVAAGVVETQDRAGILGNSEGYAPPWIFER
FT                   ETALTKAGDTVRELAHALPIEPHSLDALHWLMTEVHDRIAYAPTLADAPVDAETALQNG
FT                   EGTSRDHAHAFIAAARVLKIPARYISGYVLADSAMQRIADAKQSVADEDEEEALALQSG
FT                   EGMEQALGASHAAQSQSQSQSQSQSQSQSQGLQQPALGAQPRAAALMQQPAGHAWAEAY
FT                   VEGLGWVGFDPFMNRCPDERYVRIAVGLDHRDAQPVTGVGARAVGVEISVVQSPELV"
FT   gene            336842..340291
FT                   /locus_tag="Bamb_3522"
FT   CDS_pept        336842..340291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3522"
FT                   /product="transglutaminase, N-terminal domain protein"
FT                   /note="PFAM: transglutaminase domain protein;
FT                   transglutaminase, N-terminal domain protein; KEGG:
FT                   bur:Bcep18194_B1933 transglutaminase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3522"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89076"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR018667"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9U7"
FT                   /protein_id="ABI89076.1"
FT                   /translation="MPIHVALHHTTRYRYDRPVNLGPQIVRLRPVPHCRTPIIAYSMTV
FT                   EPAEHFINWQQDPFSNYLARLVFPERTEHFEITIDLVAEMSVYNPFDFFLEASAEQYPF
FT                   SYDDALKTELAPYLACDPATSEAPRFRAYLDSVDRTPAGTTNFLVALNQQLQRDIGYLV
FT                   RLEPGVQTPEQTLELASGSCRDSAWLLVQLCRHLGIAARFASGYLIQLTPDVKALDGPS
FT                   GTSVDFTDLHAWCEVYLPGAGWIGFDPTSGLLAGEGHIPLACTPQPTSAAPVEGLIDEC
FT                   EVSFEHEMAVTRVYESPRVTKPYTESQWEAVRTLGTQVDGALTAGDVRLTQGGEPTFVS
FT                   VDDRDGAEWNTDALGPTKRGYATELVQRLRAEYGEGGFLHFGQGKWYPGEQLPRWALSI
FT                   FWRADRQPVWQDPSLFADEREPSALTTDDAKRFIDALAARLGLTDEFVQPGYEDVWYYL
FT                   WRERRLPVNVDPFDSRLDDELERARLRKVFDQKLDSVVGYVLPLKCADDEPGRDRAGRE
FT                   RSGLDGPRWQTGPWFFRDERMYLVPGDSPMGYRLPLDSLPWVTGADYPYLVERDPFAPR
FT                   AALPEAAAFRARHVSTADAPRYLAGAHREAPTQTVMQWRGDGTDAAGRHAPGQQDPQRR
FT                   PERFESAGWITRSALCAEVRKGILYVFMPPLAALEDYLDLLAAIELTAHAIGVKLVLEG
FT                   YPPPRDARLKLLQVTPDPGVIEVNIHPARSFDELVEQTEFLYDAAWQSRLSSEKFMVDG
FT                   RHVGTGGGNHFVLGGATPADSPFLRRPDLLASLIAYWHNHPSLSYLFSGLFIGPTSQAP
FT                   RVDEARNDQLYELDIAFAEIQRNKLLYGQDMPPWLVDRVLRNLLIDVTGNTHRSEFCID
FT                   KLYSPDSSTGRLGLLELRAFEMPPHARMSIVQQLLLRALVARFWAAPYTTPLTRWGTAL
FT                   HDRFMLPAFLKMDFDDVLAELRDAGFGFDPAWFAPHFEFRFPLFGQIAVNGMELSLRGA
FT                   LEPWHVMGEEGAPGGTVRYVDSSVERLEVRVTGLNDNRHVVTVNGRPLPLQPTGTVGEY
FT                   VAGVRYKAWAPPSALHPTIGVHAPLTFDIVDTWLQRSLGGCRYHVTHPGGRNYATFPVN
FT                   AYEAESRRLTRFVEMGHTPGRMTASAAAPSREFPFTLDLRRP"
FT   gene            340504..343110
FT                   /locus_tag="Bamb_3523"
FT   CDS_pept        340504..343110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3523"
FT                   /product="protein of unknown function DUF404"
FT                   /note="PFAM: protein of unknown function DUF403; protein of
FT                   unknown function DUF404; protein of unknown function
FT                   DUF407; KEGG: bur:Bcep18194_B1932 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3523"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89077"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9U6"
FT                   /protein_id="ABI89077.1"
FT                   /translation="MPTLFDTGAQPDAAELAAALAAPAAAGRYDELRGSAAGLTAPLLA
FT                   PAWRSFFTSIGSDGVADLDRRADALQRRMRENGLFYQLHEQRAGDGAAGPWSLDLLPLI
FT                   VTPEDWVAIERGVLQRVRLLNATMADLYGPQTILERGLLPPALVTGHPGYLRAMRGARV
FT                   PGDTWLHIVAFDLARGPDGQWRIVAQHTQGPSGLGYLLENRLIVSRLFPRGFRGLRVQR
FT                   LASAYRSLLQSMQTLSPASKNSRIVLLTPGPHSATYFEHAYLARYLGLTLVEGGDLTAR
FT                   DNHVFLKTLRGLEPVHGILRRVDDAWLDPLELRPDSMLGVPGLLQAVRAGNVLLANAPG
FT                   SGFLESPGMLGFMPRLAEALLGETLTLPAVHSWWCGEAAACNDALPQLARGIVKPSYPP
FT                   DAQDGGGFDPVIGARLTPAQLAEWRARILARPEHYTVQADLPLSQAPTWPGRDAPEGNG
FT                   GARIVPKPLLLRVFALADGAQRWRLLPGGLSRVGTRDTLFNAPMPRGGSTVDTWVMTEG
FT                   IVDSTTLLQTRLGPDDLVEHPRAIASRAAENLFWLGRYTERATSLMRLARAALERLRGE
FT                   DDVDSPAHLELIDTLCRDTGLIASDAPNAVDAPRAFQHALATSLTRGADRTSGIASCLF
FT                   GMRGAAAAIRERLSSDQWRLIDDATQLFADSADHPEAEEQIGNEALQLLERLGLLLGAI
FT                   TGAQTDNMTRDDGWRLLSIGRQIERLDFLCSVLKFAFDEGAVHRQDGFELVLELFDSTI
FT                   TFRSRFQRGFDVAPLLSLVVLDTDNPRSLGWVVQALRGRLTKVERSEGYALSELAETIP
FT                   DVPAWSLHELCETGDDGRHDKLLDALDTTVKAVWELSNRIGERYFSHVRDAGRTLW"
FT   gene            343104..344162
FT                   /locus_tag="Bamb_3524"
FT   CDS_pept        343104..344162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3524"
FT                   /product="transglutaminase, N-terminal domain protein"
FT                   /note="PFAM: transglutaminase domain protein;
FT                   transglutaminase, N-terminal domain protein; KEGG:
FT                   bur:Bcep18194_B1931 transglutaminase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3524"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89078"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9U5"
FT                   /protein_id="ABI89078.1"
FT                   /translation="MVTTKHAAKMSPAPGSGSAKDAPATTPATPATPTTVAPGRVLRVT
FT                   HDTEYRYAARVESAQHQARLQPLATPRQQVQSFALDIEPAPESVCTEIDAFGNARASFA
FT                   LNQPHDALLVRSRSTVRVSAPVWSLGARGAPPPAIANPDAEHAMAWEAVRERLQFRAGQ
FT                   PYDAASEFVFASPHVACDPELAAYAAASFTPGRPLVQAAWDLMRRVHADFAYTPNSTDI
FT                   TTTALDALRLRKGVCQDFAHVMIGALRSLGLAARYVSGYLLTQPPPGQPRLIGADASHA
FT                   WIDVYDPAWPEDGGWLQLDPTNDRAPGDDYVMLSIGRDYADVTPLRGVIRGGGADQELK
FT                   VGVTVEPLDEAS"
FT   gene            344346..344618
FT                   /locus_tag="Bamb_3525"
FT   CDS_pept        344346..344618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3525"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3525"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89079"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9U4"
FT                   /protein_id="ABI89079.1"
FT                   /translation="MIKNFDYPLGNETIALCASFGAGPAFRRVLVSRADSMETLVVLDA
FT                   RGLSGLLKVATEEPEGLLDDAIRKVGDEQLVERAISGKAIVEAAL"
FT   gene            complement(344686..345618)
FT                   /locus_tag="Bamb_3526"
FT   CDS_pept        complement(344686..345618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3526"
FT                   /product="prolyl aminopeptidase, Serine peptidase, MEROPS
FT                   family S33"
FT                   /EC_number="3.4.11.5"
FT                   /note="KEGG: bur:Bcep18194_B1929 peptidase S33, proline
FT                   iminopeptidase 1; TIGRFAM: proline iminopeptidase; PFAM:
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3526"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89080"
FT                   /db_xref="GOA:Q0B9U3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9U3"
FT                   /protein_id="ABI89080.1"
FT                   /translation="MYPPIEPYAHGHLDTGDGHHIYWERCGNPSGKPAVFLHGGPGAGC
FT                   SPDHRRLFDPERYDILLFDQRGCGRSTPHASLDNNTTWDLVADIERLREMTGAEQWLVF
FT                   GGSWGSALALAYAQTHPQRVSALVVRGIFTMRRAELLWYYQEGASWLFPDLWEEFLAPI
FT                   PEAERGDLMAAYHRRLTGDDEAAKLEAARAWSLWEGRTITLLPDPALAEHFADGRYALA
FT                   FARIENHYFVNRGFVDEGQLLRDAHRLAGIPGVIVQGRYDIATPARTAWDLAKAWPDAT
FT                   FEIVPDAGHAYNEPGILKALLAATDRFAA"
FT   gene            345867..347093
FT                   /locus_tag="Bamb_3527"
FT   CDS_pept        345867..347093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3527"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: bur:Bcep18194_B1920
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3527"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89081"
FT                   /db_xref="GOA:Q0B9U2"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9U2"
FT                   /protein_id="ABI89081.1"
FT                   /translation="MSALARNRELRAGLPSLHRANGSHPMNHRVKQLTGLRAVAVTMVV
FT                   VGHAEHVLPGGYTGWLAPLRLIADGRLGVLIFFVLSGFLITNVLRAEFARTGGIALTSF
FT                   YVRRALRIWPACYVYLVIVGILAVAGWLDVDRRQWLYAALHLWNYSAWFGLAGDNALHP
FT                   DGAWYLGHFWSLALEEQFYWFWPLLFVYGTRHRGTRWLAVLILAVPLVRTLTYFVAPAL
FT                   RGQLAMMLHTGVDPILIGCYAALNRERLEAWIGSWRGETRIVTAIVFIVLFGMPLAERR
FT                   LGGFWNATYGVTIEAALIAIVIVVLNFRSEFWCARWLRAGPVVFVGTISFSLYLWQQPF
FT                   ANPGLPVAHAFPLGIVWALLAATASYFLIEKPFLRLKDRYTAREARRVRDDALRMPAPT
FT                   DAIGPKVVE"
FT   gene            complement(347122..347967)
FT                   /locus_tag="Bamb_3528"
FT   CDS_pept        complement(347122..347967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1919 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3528"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9U1"
FT                   /protein_id="ABI89082.1"
FT                   /translation="MRNTFSLVARRLPHFIPLLALVLAPAAQATDNQPCDDAAITAVAR
FT                   WAGIASARIATRDADRLAIASACKAMPNAPQTTIAAVAFDSLPKSENPGGNNKLQVVAL
FT                   VEGGKIVAAARSIVEEDATTEVGPDSYRIDTAPYRLSPDVRAFGVVFLSSARGPSCPDA
FT                   NASEELTLWVREGDRIRPVFGTNLYGWVSVEGEACGAGAGDARAEDARMTIAVEKTSSH
FT                   GFADLSITAHVTKTQRKDGDYSETGKRTARTVVKYDGQSYGIDMFRDFWYSPAARKRFK
FT                   "
FT   sig_peptide     complement(347878..347967)
FT                   /locus_tag="Bamb_3528"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.998 at
FT                   residue 30"
FT   gene            complement(347975..348379)
FT                   /locus_tag="Bamb_3529"
FT   CDS_pept        complement(347975..348379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3529"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_C7260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3529"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89083"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9U0"
FT                   /protein_id="ABI89083.1"
FT                   /translation="MTDMRNGMTTTFDEATTAAIAAFAQLDFYTAVQAMRAEADYDHER
FT                   DQWISRYIDEHGGDADDAAYDALHAQAQATPEYAQFVDSVRREILEYFGVTDDQLDCMI
FT                   VLRDDDSDELWAEVNRQRSALGTGEVRGDL"
FT   gene            complement(349061..349951)
FT                   /locus_tag="Bamb_3530"
FT   CDS_pept        complement(349061..349951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3530"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: psb:Psyr_4923 regulatory protein,
FT                   LysR:LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3530"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89084"
FT                   /db_xref="GOA:Q0B9T9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9T9"
FT                   /protein_id="ABI89084.1"
FT                   /translation="MTCFARAVEMGSFSAAGRDLGLGQPNVSRYVAALEDHLQTRLLHR
FT                   STRKLALTPEGERYYADIRRILDAVEESESSFRNNVDPSGLLRVACPTSLAHAFVLPHV
FT                   PAFLERYPRLTLDIQISDRYVNLVDEGIELAIRIGHLEDSALRARRIGMFERVVVASKE
FT                   YLAKRGVPHTPDDLRDHDCVIYTLLSSGATWRFRDTDIPVSGRLRVNSPDAVRAAVNAG
FT                   LGVGHGPAWLFEEGLESGRLQLILSGLADPAVPVQIVYVANRLLPTRAIVFIEFIADVF
FT                   SKISAFNKNIPSLKL"
FT   gene            350096..350848
FT                   /locus_tag="Bamb_3531"
FT   CDS_pept        350096..350848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3531"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   psb:Psyr_4922 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3531"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89085"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9T8"
FT                   /protein_id="ABI89085.1"
FT                   /translation="MSRLQGKRTLITGGTSGIGLETAKQFLNEGARVVVTGVNPDSIAK
FT                   AKAELGSEVLVLRADSASVAAQRELAQAVKDHYGQLDIAFLNAGVSVWLPFEEWTEEMF
FT                   DRSFDVNVKGPYFLFQALLPVFASPASVVLNTSVSAHVGAERSSVYAATKAAFLNMSKT
FT                   LSTELLGRGIRVNAVSPGPIDTPLYDKLGIPDAYREQANKDIAATIPLGRFGTPEEVAK
FT                   AVLYLASDESSWTVGSEIVVDGGRMLNR"
FT   gene            351110..351826
FT                   /locus_tag="Bamb_3532"
FT   CDS_pept        351110..351826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3532"
FT                   /product="Glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   Glutathione S-transferase, C-terminal domain; KEGG:
FT                   rso:RSc2594 probable glutathione-S-transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3532"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89086"
FT                   /db_xref="GOA:Q0B9T7"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR005442"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9T7"
FT                   /protein_id="ABI89086.1"
FT                   /translation="MPTLTLISHPLCPFVQRAAIVLLEKQVPFQRINVDLSDKPAWFLE
FT                   ISPTGKVPVLQVQEAGGSNEVLFESVAICEYLQETHSGPSLYPDDPLERAKHRAWIEFG
FT                   SATLAEAWGYLNAKDHFTANVKATSLKDKLAQLEKVLGLGPYFDGETFGMVDAVFAPVF
FT                   RYFDVLQTDSGPSPFPDFPKVDAWRERLRVRASIIAAVSADYPALFRAHLRRQKALLME
FT                   EIYGASQPYPATSHKL"
FT   gene            complement(352074..353138)
FT                   /locus_tag="Bamb_3533"
FT   CDS_pept        complement(352074..353138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3533"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V; Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent enzymes; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   bur:Bcep18194_B1916 aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3533"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89087"
FT                   /db_xref="GOA:Q0B9T6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR012703"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9T6"
FT                   /protein_id="ABI89087.1"
FT                   /translation="MLLLNPGPVTLTERVRRSLLQPDLCHRESEFFDLQDEARARLVAA
FT                   YELDPAEWAAVLMTGSGTAAVESMIAALVPQDGKLLVIENGVYGERIAQIATQYGIAHD
FT                   VLKHEWMQAPDPAQIGAKLDAGGYSHVAVIHHETTTGRLNDLGKIADVCRARGVKMLVD
FT                   GVSSFGAEAIDFAGGVIDAVAATANKCLHGVPGAAFVIVRRSALAKAASRTYYLDLGRL
FT                   AKLQDQRNTPFTPSVHAYYALVEALREFDEAGGWRARHAHYKALADQAQAGLAARGMSL
FT                   VLPEGASSVVLRAYRLPQGVTYETLHDGLKARGFVIYAGQGGLSKELFRISTMGAIQAA
FT                   DVERLMEGFTELTR"
FT   gene            complement(353138..354319)
FT                   /locus_tag="Bamb_3534"
FT   CDS_pept        complement(353138..354319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3534"
FT                   /product="thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; KEGG: bur:Bcep18194_B1915 thiamine
FT                   pyrophosphate enzyme, putative 3-phosphonopyruvate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3534"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89088"
FT                   /db_xref="GOA:Q0B9T5"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR017684"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9T5"
FT                   /protein_id="ABI89088.1"
FT                   /translation="MIEAAQFVEAARERGFDWYAGVPCSYLTPFINYVLQDPTLHYLSA
FT                   ANEGDAVALIAGATLGGKRGIAMMQNSGLGNAVSPLTSLTWTFRLPQLLIVTWRGQPGV
FT                   SDEPQHALMGPITPAMLDTMEIPWETFPTDPEQVGPALDRAIAHMDATGRPYALVMQKG
FT                   SVAPYELKANPAATPRAHVAAQSAARAESPAAWPTRHDALQRVIAHTPVDSTVVLASTG
FT                   FCGRELYAIDDRPNQLYMVGSMGCVTPLALGLALARPDLRVVAIDGDGAALMRMGVFAT
FT                   LGTYGPSNLTHVLLDNGAHESTGGQATVSQHVSFAGVAAACGYASAVEGDTLDVLDATL
FT                   AAQSNGTQFVRVAIRTGVPDGLPRPTVTPVEVKTRLMRHIGAAQAEAHAEGAH"
FT   gene            complement(354316..356001)
FT                   /locus_tag="Bamb_3535"
FT   CDS_pept        complement(354316..356001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3535"
FT                   /product="2,3-dimethylmalate lyase"
FT                   /EC_number="4.1.3.32"
FT                   /note="TIGRFAM: phosphoenolpyruvate phosphomutase; KEGG:
FT                   bur:Bcep18194_B1914 isocitrate lyase and phosphorylmutase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3535"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89089"
FT                   /db_xref="GOA:Q0B9T4"
FT                   /db_xref="InterPro:IPR012698"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9T4"
FT                   /protein_id="ABI89089.1"
FT                   /translation="MNAREPNFSESRSARLRRMLVSNELEFLMEAHNGLSARIVREAGF
FT                   KGIWASGLAISAQFGVRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRL
FT                   VKKLEQRGIAGVCIEDKQFPKTNSFIGGERQPLAEIDEFCGKIKAGKDSQSDSDFSIVA
FT                   RVEALIAGWGMDEALRRANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPT
FT                   KYYSTPTDVFRQAGISTVIWANHLIRASASAMQAVAREIHENETLINVEDRVASVNEIF
FT                   RLQDADEYSAAERIYLSSSSRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRW
FT                   LVDGFKTHGVNDITVVGGYRADAIDTSGIKLVVNERHAQTGELASLACAAERLTGDTVI
FT                   SYGDLLFRSYIVRDLAESEAEFSVVVDSSLTETNQSVRDFALCSAADDRGLFGQKTYLQ
FT                   RVSSDVAAGTPHGRWIGLLNVRGAGVDRLKAMLATLQARPDFDTLDIPSLLNELIAAGE
FT                   KIEVQYVHGHWRGVNDLEDFRRAGDFAHGQTPLSEPSTGNGGAQ"
FT   gene            complement(355998..356765)
FT                   /locus_tag="Bamb_3536"
FT   CDS_pept        complement(355998..356765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3536"
FT                   /product="sugar nucleotidyltransferase-like protein"
FT                   /note="KEGG: bur:Bcep18194_B1913 sugar
FT                   nucleotidyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3536"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89090"
FT                   /db_xref="GOA:Q0B9T3"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9T3"
FT                   /protein_id="ABI89090.1"
FT                   /translation="MRAIILAAGLGLRLQQPPEAQYPKCLLRFDDVSLLERHLRVLDAA
FT                   GVDEIVLGLGFQSEKVEQELKRLGRTAEIVINERYDLGSVLTVHTVADAMTRGGDVLLM
FT                   DADVLYDENILHALVADSDKAVDRLLIDRDFEAGDEPVKLCLKNGVPVELRKQLAVDLD
FT                   YDTIGESVGFFRFTEGTARRLAKIVAGYVDSGRANMPHEEAVRDLLLEGGHSFDVADVT
FT                   GSPWIEIDFPNDVARATQDILPLIQRTTAGAAR"
FT   gene            complement(356802..357803)
FT                   /locus_tag="Bamb_3537"
FT   CDS_pept        complement(356802..357803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3537"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; KEGG:
FT                   bur:Bcep18194_B1912 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3537"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89091"
FT                   /db_xref="GOA:Q0B9T2"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9T2"
FT                   /protein_id="ABI89091.1"
FT                   /translation="MTRAGLILLSLGTALFIALLAWQGVGAVASTLLAAGWGLALVAAF
FT                   HVVPLVIDAFAVSVMFRRGQPAAELGNALRARWVGESVNSLLPAGQIGGPVLMVRYLAQ
FT                   RGTRMADAAAAMTVGTTMQALAQMAFALIGIAAFSLYATHDSVAHLRTPALIATGVLGA
FT                   LAVAFYAAQRRGLFGRGMRLASKLLGPRDWSSLATRADAIDNAVAGLYRDRAKVAKTFA
FT                   LSLAGWIAGTAEVWLALHFLGHPVSWLDALLLESVGQAIRGAAFAIPGSLGAQEGGYLL
FT                   LAPLVGLPPDAALALSLAKRARELALGLPGLLYLHFSERNWQRRHAPQPLAD"
FT   sig_peptide     complement(357714..357803)
FT                   /locus_tag="Bamb_3537"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.359 at
FT                   residue 30"
FT   gene            complement(357800..358609)
FT                   /locus_tag="Bamb_3538"
FT   CDS_pept        complement(357800..358609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3538"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; KEGG:
FT                   bur:Bcep18194_B1911 2OG-Fe(II) oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3538"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89092"
FT                   /db_xref="GOA:Q0B9T1"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9T1"
FT                   /protein_id="ABI89092.1"
FT                   /translation="MTSSTRDDSVLSPARPAPARAAAADPDRTVAGCVGQLDLDRLRSD
FT                   YTRQGSFLYLDAFLPPDAHAKLAAAARALQPGLNRNYLPGHKQGGSVSRHTIDEKAPYI
FT                   AELYRSKALIGFLEKITGDKLMVSPENDPHAYALYYYTKPGDHIGWHYDTSYYDGRRYT
FT                   LLIGVIDESSCRLDYELHTRNPDVPDEPGSVQIADGGIVLFDGDKLRHRITPLGQNETR
FT                   VSLTFEYVTNPGMRPWKRFISNMKDAIAYFGFRQVFKQLATRRSSGS"
FT   gene            complement(358606..359286)
FT                   /locus_tag="Bamb_3539"
FT   CDS_pept        complement(358606..359286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3539"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   bur:Bcep18194_B1910 CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3539"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89093"
FT                   /db_xref="GOA:Q0B9T0"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9T0"
FT                   /protein_id="ABI89093.1"
FT                   /translation="MDQRKTAKHPEPPLPRTWDARLARALVRPLIDTPVTPNHLTTLRL
FT                   LIGLAGAWCLAQGGFGWSNAGAFLIVLSNFVDHTDGELARISGKSSKIGHFYDLAADAL
FT                   VTVALFVSMGVGIVAQGGQMAASPVLLGALAGGAVALIFFLRMRIESVAGKAGTKQAFA
FT                   GGFETEDVLYLLPLVTLTDSVQPFLLAASIGAPLFAAWVVIDWWRIVRRGNTPQNSTEI
FT                   QASK"
FT   gene            359926..361440
FT                   /locus_tag="Bamb_3540"
FT   CDS_pept        359926..361440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3540"
FT                   /product="Acetyl-CoA hydrolase"
FT                   /EC_number="3.1.2.1"
FT                   /note="PFAM: acetyl-CoA hydrolase/transferase; KEGG:
FT                   bur:Bcep18194_B1909 acetyl-CoA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3540"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89094"
FT                   /db_xref="GOA:Q0B9S9"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9S9"
FT                   /protein_id="ABI89094.1"
FT                   /translation="MSSSRILAPALRSLVRTADEAAALIRPGMTVAMSGFTGSGYPKAV
FT                   PAALAAHIEAAHARGEDFRINVLTGASTAPELDGALARTNGISMRLPYQSDPTLRDKIN
FT                   SGEVDYQDVHLSHVAQYAWFGLYGDLDVAIVEVAGIREDGLLIPSASIGNNKTWLEQAK
FT                   HVILEVNSRQPLGLDGMHDVYYGTALPPHRKPIPLTKSDDRIGEPYLRCPADKIVAIVE
FT                   TDAPDRSNAFSAPDATSKQIALQLIDFLRHEVKRGRLPENLLPLQSGVGNITNAVLAEL
FT                   SSAGFSNLTAYTEVIQDGMLDLLDDGTLSFASATALSLSPAAVQRFADEIATFREKILL
FT                   RPQEISNHPELVRRLGCIAMNGMIEADIYGNVNSTHVMGTKIQNGIGGSGDFARNGYLS
FT                   CFMSASTAKGGAISRIVPMASHVDHTEHDVAVVVTEQGLADLRGLSPKQRARKIIATCA
FT                   HPDYRPMLEDYFERASRESFGKHTPHLLAEALSWHERYVRTGTMKA"
FT   gene            361641..362066
FT                   /locus_tag="Bamb_3541"
FT   CDS_pept        361641..362066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3541"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; KEGG:
FT                   bur:Bcep18194_B1905 transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3541"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89095"
FT                   /db_xref="GOA:Q0B9S8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9S8"
FT                   /protein_id="ABI89095.1"
FT                   /translation="MSRLDIADVARRSGLPASTLRYYEEKGLIVPNGRHGLRRQYDESV
FT                   LERLALIALGREAGFALDDILAMFGADGRPAIDRAKLDDKADELDRTIRRLGAVRDALR
FT                   HAAVCPAPSHLECPSFRKLLRVAAHRHPARRTKAEGA"
FT   gene            complement(362145..363023)
FT                   /locus_tag="Bamb_3542"
FT   CDS_pept        complement(362145..363023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3542"
FT                   /product="Helix-hairpin-helix DNA-binding protein"
FT                   /note="SMART: Helix-hairpin-helix DNA-binding, class 1;
FT                   KEGG: bur:Bcep18194_B1903 DNA polymerase IV (family
FT                   X)-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3542"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89096"
FT                   /db_xref="GOA:Q0B9S7"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9S7"
FT                   /protein_id="ABI89096.1"
FT                   /translation="MQTTISQTHEENRQIAACLREAAQLLADQGANPYRVAAYRASADT
FT                   IESLDDGIRTRFNAGGVDALGALPEVGTGVAQAIAEWLVTGRWRLLDRLRGDAERVSAF
FT                   EAVPGIGHALALRIHDQLHIDTLEELERAALSGQLDAISGVGPRRAAGIRAALDDVLSR
FT                   RRRWQGHAQDADLGTEPPVELLLYIDRLYRNKAAAGILPMLVTRRVNADVSVSPPVMHM
FT                   TKGGWHFTALCPYPARPHEAGRTADWVALYFYDALQCEHQRTVVTETFGSLVGKRIVRG
FT                   REMECRVYYAG"
FT   gene            complement(363212..364762)
FT                   /locus_tag="Bamb_3543"
FT   CDS_pept        complement(363212..364762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3543"
FT                   /product="RNA polymerase, sigma 38 subunit, RpoS"
FT                   /note="PFAM: sigma-70 1.1 domain protein; sigma-70 region 3
FT                   domain protein; sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; sigma-70 region 1.2; KEGG:
FT                   bur:Bcep18194_B1902 sigma 38 (RpoS)"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3543"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89097"
FT                   /db_xref="GOA:Q0B9S6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9S6"
FT                   /protein_id="ABI89097.1"
FT                   /translation="MTTPRPTLRADTPLDPIIQLLALAGEQGYLTHADLVDALPPESDS
FT                   PDALDVVRAALADIGIAVLDEPASPAPFAGAAPVDVDRDALDEGRALLGDLARGTSAST
FT                   DPLALYMRRIHAVPLLKREDEIVLAREIETGRHQILHALAGYPAAVDALLARHGATGGS
FT                   VAAGDEADDSRDGEGDTPAPARYDTLQAAITALRAALHAQGCRSAEYRDARNRLAALLG
FT                   SLAWVAPAVDDASRIVRALATAPANAAADSDAACFDAVARRALGAALSDGQQKVRDGTR
FT                   AMLEANLRLVLSIARKYMNRGVDLPDLVQDGCLGLMRAIEKFEYRRGFKFSTYATWWIR
FT                   QAVARAVADRSRTIRVPVHVGDQYQRVQRHALRFRQRTGRRATPAELAAESGLPEGKLR
FT                   AVLALPAEPLSLDTPLPDAETGLVDLIEDQASASPFERLADTRMRECVTSLLRSVTPAE
FT                   ADVLRRRFGLGGAEPDTYDAIAQDAGMSRERVRQIEKRALATLRTAAEAEGAESFLDA"
FT   gene            365070..365534
FT                   /locus_tag="Bamb_3544"
FT   CDS_pept        365070..365534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3544"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1901 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3544"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89098"
FT                   /db_xref="GOA:Q0B9S5"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9S5"
FT                   /protein_id="ABI89098.1"
FT                   /translation="MNPIHAARPAVIVLAILALSGCYYTSPYGYAPYYAPAPAVVSQRE
FT                   MPVTSANTGPAASSTPAVPAVPPPADDYAYAYPPAPVYAAPAYVPYPAYYPAYYPGWYG
FT                   PPVTIGFGFRGYWGGGYRGWHRPWGGGHWGGGHWGGGHWGGGHWGGGHRH"
FT   gene            365568..366419
FT                   /locus_tag="Bamb_3545"
FT   CDS_pept        365568..366419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3545"
FT                   /product="SH3, type 3 domain protein"
FT                   /note="PFAM: protein of unknown function DUF1058; SH3, type
FT                   3 domain protein; KEGG: bur:Bcep18194_B1900 uncharacterized
FT                   protein with a SH3 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3545"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89099"
FT                   /db_xref="GOA:Q0B9S4"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9S4"
FT                   /protein_id="ABI89099.1"
FT                   /translation="MSNTIIRSLCVVLFGIAAVPGIADAQSSAYTNSGAELFAGPAPDY
FT                   PVVAQLPPGTAVDVFGCLSDYSWCDVALPGVRGWIDAQQLDYPYQGNYVPLLEYGAIIG
FT                   VPVTGFAIGTYWDRYYRHRPWFHDRDRWEHRAEPRVGPGGMPPAYYGRPQPGWPAQREP
FT                   RGAPPVQHDARPSATRGGWNGPNRAPAPQVAPAPARAPAPMPAPAPMPAPAPIPGAAGV
FT                   RQPAPPPAQPAQPAPSGGAVQMMPPAHQGGGGYGGRPQGGGDGGGNHGGGGGRGRSDEF
FT                   RR"
FT   sig_peptide     365568..365645
FT                   /locus_tag="Bamb_3545"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.945 at
FT                   residue 26"
FT   gene            complement(366536..368395)
FT                   /locus_tag="Bamb_3546"
FT   CDS_pept        complement(366536..368395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3546"
FT                   /product="dihydroxyacid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: bur:Bcep18194_B1899 dihydroxy-acid
FT                   dehydratase; TIGRFAM: dihydroxy-acid dehydratase; PFAM:
FT                   dihydroxy-acid and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3546"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89100"
FT                   /db_xref="GOA:Q0B9S3"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9S3"
FT                   /protein_id="ABI89100.1"
FT                   /translation="MPTYRSKTSTAGRNMAGARSLWRATGMKDDDFSKPIIAVVNSFTQ
FT                   FVPGHVHLKDLGQLVAREIEAAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSRDIIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPVIFVSGGPMEAGKTRLANPVTKTV
FT                   ELKKLDLVDAMVIAADPAYSDADVAEVERSACPTCGSCSGMFTANSMNCLTEALGLSLP
FT                   GNGTVVATHADREQLFKRAGRRIVELTRQHYEQDDMRALPRSVGFKAFENAMTLDIAMG
FT                   GSTNTILHLLAIAQEAGIDFTMKDIDRLSRSVPQLCKVAPNTNKYHIEDVHRAGGIMAI
FT                   LGELDRAGKLHTDVPTVHAPTLKDALDQWDIVRTDDPAVRTFYQAGPAGIPTQVAFSQD
FT                   TRWPSLDLDRAEGCIRSYEHAFSKEGGLAVLTGNIALDGCVVKTAGVDESILVFEGSAH
FT                   VTESQDEAVENILNDKVKAGDVVIVRYEGPKGGPGMQEMLYPTSYIKSKGLGKACALLT
FT                   DGRFSGGTSGLSIGHCSPEAAAGGAIGLVRDGDKIRIDIPNRTIDVLVSDEELARRREE
FT                   QNAKGWKPAQPRPRKVSAALKAYAKLVMSADKGAVRDLSLLDD"
FT   gene            complement(368810..369832)
FT                   /locus_tag="Bamb_3547"
FT   CDS_pept        complement(368810..369832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3547"
FT                   /product="Malate/L-lactate dehydrogenase"
FT                   /note="PFAM: Malate/L-lactate dehydrogenase; KEGG:
FT                   bur:Bcep18194_B1898 malate/L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3547"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89101"
FT                   /db_xref="GOA:Q0B9S2"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B9S2"
FT                   /protein_id="ABI89101.1"
FT                   /translation="MSESLAEVVLSLDEVHALALRVLTHNGMSAAHAQAIANVITQGQR
FT                   DECHSHGVYRLLVCVRSLKKGKVDPQAVPTLRRLSSSIVAVDAHRGFSLLSFETGLPVL
FT                   VEMAKQHGIAAMAINHCYHFSALWPEVEAIAAEGLVGIAMNPSHSWVAPEGGREPVFGT
FT                   NPIAFAWPRPDGVPFVFDFATSAIARGDIELHAKQGKAIPPHWAIDADGQPTTDPKAAL
FT                   QGAMRTFGGHKGSALAAMVELLGGALIGDMTSRESMAFDEGVGATPCHGELVIAFDPKV
FT                   FLGDELDAGLARGERMFASITGQGARLPSQRRFDARARSIAHGVRIPKALYDEILTLLD
FT                   "
FT   gene            complement(369825..371417)
FT                   /locus_tag="Bamb_3548"
FT   CDS_pept        complement(369825..371417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3548"
FT                   /product="2,5-dioxopentanoate dehydrogenase"
FT                   /EC_number="1.2.1.26"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG:
FT                   bur:Bcep18194_B1897 aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3548"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89102"
FT                   /db_xref="GOA:Q0B9S1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9S1"
FT                   /protein_id="ABI89102.1"
FT                   /translation="MQLTGQLLIGQSAIAGQNGTLHAIAAATGEPLDPAFGGASLHDLE
FT                   TACTLADDAFDTYRETPPEQRAAFLDAIGRNIMALGDDLIERCVTETGLPRARIEGERG
FT                   RTVGQLALFASLVRDGGYVDARIDPARPERKPLPRVDLRLRNVAIGPVAVFGASNFPLA
FT                   FSVAGGDTASALAAGCPVIVKAHSAHPGTSELVGRAIQQAVRECGLPAGVFSLLFDASR
FT                   EIGQALVADPRIKAVGFTGSRRGGVALMNIAAARHEPIPVYAEMSSINPVLLFPAALDA
FT                   RHDTIAPQFAASLALGAGQFCTNPGLVLAVDGPALRAFEAAAASAVQATTAQTMLTPHI
FT                   HASYAQGVAALRAHDAVELLAEGVEGGRYQARAALFATSADAFIAHPELRDEVFGPASL
FT                   IVRCPDADTLHRVLKSLEGQLTIAAHLADDDAALFAALRPTLERKAGRILVNGFGTGVE
FT                   VGHAMVHGGPFPATSDTRTTSVGARAIERFLRPVSYQDVPDALLPDAIRNGNPLNVPQR
FT                   IDGVPAPRDARDV"
FT   gene            complement(371488..373113)
FT                   /locus_tag="Bamb_3549"
FT   CDS_pept        complement(371488..373113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3549"
FT                   /product="aspartate/glutamate:proton symporter, AGT family"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bur:Bcep18194_B1896 amino acid transporter; TC 2.A.3.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3549"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89103"
FT                   /db_xref="GOA:Q0B9S0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9S0"
FT                   /protein_id="ABI89103.1"
FT                   /translation="MPGQGNTHPSVPLSRSVPADGGHGKFKKQLSLTDLTFIGLGAIFG
FT                   SGWLFAASHVSTIAGPAGIFSWLLGGFSVLLLGIVYCELGAALPRAGGVVRYPVFSHGP
FT                   LLGYLMGFITLIAFSSLIAIEVVAARQYAAAWFPGLTKAGSSDPTTLGWLVQAGLLCFF
FT                   FYLNYSSVKTFAKANNVISIFKFIVPLSVIAVLFTFFKPANLTLHGFAPFGMPGIEMAV
FT                   SAGGIIFAYLGLTPIVSVASEVRNPQRTIPIALILSILLSTLIYVLLQLAFIGSIPTDM
FT                   LAAGWHDVSKAFSLPYRDIALALGVGWLAVMVVADAMISPSGCGNIYMNATPRVVYGWA
FT                   KTGTFFKVFTRVDEASGIPRAGLWLTFGLSIFWTMPFPSWEALINIVSAALVLSYAVAP
FT                   VSVAALRRTAPDLPRPFRAVAFGITGPASFVIAALIVYWSGWGTVSWLLGLQIVMFVIY
FT                   LACRRWVPTAHLSIAEQVRSSAWLIAFYAAMIVLSYFGGFGGTGQLAHPYDTVVVAAVA
FT                   LVIFYWGANTGIRSDKLQLEDDED"
FT   gene            373741..374676
FT                   /locus_tag="Bamb_3550"
FT   CDS_pept        373741..374676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3550"
FT                   /product="proline racemase"
FT                   /note="PFAM: proline racemase; KEGG: bur:Bcep18194_B1894
FT                   proline racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3550"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89104"
FT                   /db_xref="GOA:Q0B9R9"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B9R9"
FT                   /protein_id="ABI89104.1"
FT                   /translation="MMKRIQIIDSHTGGEPTRLVVSGFPSLGNGTMAERRDVLAREHNR
FT                   YRTACILEPRGSDVMVGALLCEPVSPEAAAGVIFFNNSGYLGMCGHGTIGVVRTLHHMG
FT                   RIEPGVHRIETPVGTVEATLHDDLSVSVRNVLAYRHAKAVAVDVPGYGPVKGDIAWGGN
FT                   WFFLISDHGQRVAGDNVAALTAYSSAVREGLERAGITGANGGEIDHIELFADDAEHDSR
FT                   SFVLCPGHAYDRSPCGTGTSAKLACLAADGKLEPGVVWRQASVIGSVFQASYAQADGGI
FT                   VPTIRGSAHLSAEATLLIEEDDPFGWGIVS"
FT   gene            374673..375800
FT                   /locus_tag="Bamb_3551"
FT   CDS_pept        374673..375800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3551"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bur:Bcep18194_B1893 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3551"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89105"
FT                   /db_xref="GOA:Q0B9R8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9R8"
FT                   /protein_id="ABI89105.1"
FT                   /translation="MSEARTDVVVIGAGIVGAACAHELAQRGLRVLVVDDASGGATGAG
FT                   MGHLVAMDDNAAELALSHYSIELWRALSGDMPEGCAYRNCGTLWLAADSNEMDLARTKQ
FT                   ATLAAHGVAGELIDAATLARLEPMLRAGLGGALKIPGDAILYAPVAASWLLQRAPGITL
FT                   RRDRAVAVDGPSVTLASGDTLRAERVVVANGVAARTLLPELPLRPKKGHLLITDRYPGQ
FT                   VSHQLVELGYAASAHASDGTSVAFNVQPRPTGQLLIGSSRQFDTEDARIEPPVLARMLR
FT                   RAAGYLPDLADLNGIRAWTGFRSASPDGLPLLGEHPARPGVWLAVGHEGLGVTTAPGSA
FT                   RLVAALMTGERPPIDIEPYLPGRFLTTSPVAGALT"
FT   gene            375901..376134
FT                   /locus_tag="Bamb_3552"
FT   CDS_pept        375901..376134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3552"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: bur:Bcep18194_B1892
FT                   ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3552"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89106"
FT                   /db_xref="GOA:Q0B9R7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9R7"
FT                   /protein_id="ABI89106.1"
FT                   /translation="MIIHLDGRALTVADGATVAAAVAASGDDTTRVSCTGAARAPFCGM
FT                   GICQECRMTIDGRRRLACQTLCRDGMRVERTR"
FT   gene            376131..377399
FT                   /locus_tag="Bamb_3553"
FT   CDS_pept        376131..377399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3553"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bur:Bcep18194_B1891 pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3553"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89107"
FT                   /db_xref="GOA:Q0B9R6"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9R6"
FT                   /protein_id="ABI89107.1"
FT                   /translation="MKQERLSVDVAIVGAGPAGLSAARAAARSGATVAIVDDNPRAGGQ
FT                   IWRQAAAATPVAAAAERLAVLRQRNVTHLAATRIVAETQPGTLLLEDDERGFLLEFRTL
FT                   ILCCGARELLLPFPGWTLPGVTGAGGLQALIKYGLDVRGQRTVIAGSGPLLLASAATAR
FT                   QAGAQVSHVLEQAAWGDVAGFGAGLWRWPSKLAQAAKLVTAAYRPNAYVVEAFGDKRLE
FT                   RVRIRQGEREFDVDCDRLACGFGLVPNTVLPSHLGCRIENGAVVVDAHQRTSRDGYFAA
FT                   GECTGVGGSELAMVEGEIAGCAATGQVAPLAALVARRAHWQAFADAVRERFAIREPIRR
FT                   LARPDTLLCRCEDVRFDAVAPAPGWTAAKLQTRCGMGACQGRVCGAAAQALFGWTPPVP
FT                   RTPLVPARVGTLMLDDTAACDGA"
FT   sig_peptide     376131..376208
FT                   /locus_tag="Bamb_3553"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.681) with cleavage site probability 0.434 at
FT                   residue 26"
FT   gene            377533..377883
FT                   /locus_tag="Bamb_3554"
FT   CDS_pept        377533..377883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3554"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG:
FT                   bur:Bcep18194_B1884 transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3554"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89108"
FT                   /db_xref="GOA:Q0B9R5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9R5"
FT                   /protein_id="ABI89108.1"
FT                   /translation="MNTDPSAGLPEPDQMRAAAESACALLKVLSNPDRLLLLCELSQGE
FT                   RCVSDLEARLDIRQPTLSQQLGVLRDNALVRTRREGKNIHYSLDSPAAIAVMGVLYEQF
FT                   CGPAAKGKRHAA"
FT   gene            377924..378307
FT                   /locus_tag="Bamb_3555"
FT   CDS_pept        377924..378307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3555"
FT                   /product="protein of unknown function DUF395, YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395, YeeE/YedE;
FT                   KEGG: bur:Bcep18194_B1883 YeeE/YedE family membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3555"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89109"
FT                   /db_xref="GOA:Q0B9R4"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9R4"
FT                   /protein_id="ABI89109.1"
FT                   /translation="MLIGLAAAWLIAFNGRIAGISGIVGGLFTAGAAERDWRAAFVAGL
FT                   IAAPLMMRIAGAAVTPQVDAGWGELLAAGLLVGIGTRYAGGCTSGHGVCGLSRGATRSI
FT                   VATAVFMAAGFATVFVRRHVLGG"
FT   gene            378309..378731
FT                   /locus_tag="Bamb_3556"
FT   CDS_pept        378309..378731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3556"
FT                   /product="protein of unknown function DUF395, YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395, YeeE/YedE;
FT                   KEGG: bur:Bcep18194_B1882 YeeE/YedE family membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3556"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89110"
FT                   /db_xref="GOA:Q0B9R3"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9R3"
FT                   /protein_id="ABI89110.1"
FT                   /translation="MQAGFAFVAGLLFSVGLIVSGMANPRKVLGFLDLAGRWDPSLAFV
FT                   MVGAIGVAVVAFAWAKRRTRSWLGLPIQWPATRTITVRLVAGSAVFGIGWGLAGFCPGP
FT                   ALVSIGLGSVKGIAFVVAMLVGMALFEWIERARKVR"
FT   sig_peptide     378309..378380
FT                   /locus_tag="Bamb_3556"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.854) with cleavage site probability 0.782 at
FT                   residue 24"
FT   gene            complement(378856..379206)
FT                   /locus_tag="Bamb_3557"
FT   CDS_pept        complement(378856..379206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3557"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3557"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89111"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9R2"
FT                   /protein_id="ABI89111.1"
FT                   /translation="MRTQDIRLDAGQSHFAWFDKGSQVIVLDGALAVTLRHGGLDWLPD
FT                   APHYVRRVLDQGECLTIEAAGHATLTASGAKPVDATVAEPAARAGVFAAWRAWLHRVAA
FT                   WPFGERHVREQP"
FT   gene            379401..380894
FT                   /locus_tag="Bamb_3558"
FT   CDS_pept        379401..380894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3558"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II; KEGG: bur:Bcep18194_B1880
FT                   transcriptional regulator, GntR family with
FT                   aminotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3558"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89112"
FT                   /db_xref="GOA:Q0B9R1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9R1"
FT                   /protein_id="ABI89112.1"
FT                   /translation="MTRMTSLTDAPRTPLPMAGEPLYERLAEHYRRIIAAGTLSPGDRM
FT                   PSVRGFMAQHGVSLSTAIQAFRRLEDTGLCEARPRSGYFVRRRAVAALDSLPECDGPPL
FT                   SVEPPFAGLHERVSRVIDRANASPDALNLGGASALATLYPAERLQALAIRLLRRKPTLL
FT                   TDAGPVGGSPEFRQTMAKRALSYGVTVSPDDVMSTSGGVDAVNLALRAVARPGDTIAIE
FT                   SPAFFGLIQLLESLGLRALEIPASPTTGLSIEALDVALTAYPDIRAVVVVPNLQNPLGS
FT                   VMPDERKAALVALCSRRGVAVIEDEPYRELVEASHTVKPVKAWDRDGTVIYCPSFNKVL
FT                   APGMRLGWMSAGRWHARVKMLKFAHSRHNAALLQAVAAEFVGSGAFDRHLRRFREQLRV
FT                   QRDVTIDAIARHFPAGTRMNRPPGGMLLWIALPDGVRSEALFDAALARGVRIAPGSIFS
FT                   NSDRFDAYIRLGCTRVFDSAHEAAIETLGQLIRDAAAAA"
FT   gene            complement(381039..381314)
FT                   /locus_tag="Bamb_3559"
FT   CDS_pept        complement(381039..381314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3559"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3559"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89113"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9R0"
FT                   /protein_id="ABI89113.1"
FT                   /translation="MEHLVRIVNDTDRQVLAWLRAQVGDARVERAARQLGATRKPFPSA
FT                   LCRYLGMSAPATLRQAERPRAARDFSVGDRYLSLIRQHLAAHTVGR"
FT   gene            complement(381411..382757)
FT                   /locus_tag="Bamb_3560"
FT   CDS_pept        complement(381411..382757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3560"
FT                   /product="Di-heme cytochrome c peroxidase"
FT                   /note="PFAM: Di-haem cytochrome c peroxidase; KEGG:
FT                   bur:Bcep18194_B1878 di-haem cytochrome c peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3560"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89114"
FT                   /db_xref="GOA:Q0B9Q9"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Q9"
FT                   /protein_id="ABI89114.1"
FT                   /translation="MLAGAALAAHAAPSETVLLPGAPPSRVVDTIGNGTPQVTGKVDAA
FT                   TARFAPDPTLVALGRRIFFDPRLSEPRGMSCAGCHDPGRAFAPTLSAASLAGPGVPEGS
FT                   RHGRFSQRNAPSLLYVRYVPRRHFYQDDDAPAPSPFGGLFSDGRADTLAEQIRGPLFDR
FT                   NEMNNRSPAALLRKVDGTELAGDLAARFGASVRRDPEQLVRALGSAVEAYLQSDDMAPF
FT                   TSRFDAFLRTRKQLAPAEMRGLALFRNPDKGNCMSCHTLSETSSRPERSLFTDFGYDAI
FT                   AVPRNRALPANRDPRHFDNGLCETAARLRWPEPTQWCGYLRTPGLRNVAIKQTFMHNGV
FT                   FTTLRDAVAFYNTRSTDPRHWYHGATTFDDVPAAYRGNINVNSTPMNRRPGTPPALTDA
FT                   EIDDIVAFLGTLTDARYANLVPPAPAASPAAPVAATTGSPAARLAAPAR"
FT   gene            complement(383231..384694)
FT                   /locus_tag="Bamb_3561"
FT   CDS_pept        complement(383231..384694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3561"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG:
FT                   bur:Bcep18194_B1877 metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3561"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89115"
FT                   /db_xref="GOA:Q0B9Q8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR039331"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Q8"
FT                   /protein_id="ABI89115.1"
FT                   /translation="MRRLLSRALFVRCAPLVALAALSACSNHIDTPADPASAAINVQAA
FT                   WVEIGDTNQAIARVITNYSPASASDPLCPQLSVDGKLSRMALRAGAATVAQRPTASDPA
FT                   DSKPSSFPVSVCETTLPADAQTASVAGRALPLPKAQPQRIAIIADTGCRMKKADNAWQA
FT                   CNDATVWPFDTIAASVAKLSPDLVLHVGDYHYRENACPPDIAGCKDSPWGYGWDTWQAD
FT                   LFRPAAPLFAKAPWVVVRGNHEECARAGQGWYRFLDPRPYSAGRSCNDPANDNDANYSD
FT                   PYAVSLGGGTQVIVFDTAKVGRNPLKTTDAQFRIYQKQFQTVASLASKAGITTTIFTNH
FT                   HPILAFAPIAGSTPAPGNLALQSVMSSLNAQAYYPPGVHVALHGHVHDFQAINFSSGHP
FT                   ATIVSGNGGDNLDVALPDPFPAGLTPAPGAVIERLSHNNSFGFLIMERRAAPATGWVFR
FT                   AYSAAGKLLASCDQSGTTLACDKTGFITP"
FT   sig_peptide     complement(384632..384694)
FT                   /locus_tag="Bamb_3561"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.992) with cleavage site probability 0.652 at
FT                   residue 21"
FT   gene            384875..385723
FT                   /locus_tag="Bamb_3562"
FT   CDS_pept        384875..385723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3562"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: methyltransferase small; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG:
FT                   bur:Bcep18194_B1876 methylase involved in
FT                   ubiquinone/menaquinone biosynthesis-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3562"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89116"
FT                   /db_xref="GOA:Q0B9Q7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Q7"
FT                   /protein_id="ABI89116.1"
FT                   /translation="MEENRANEAQSALWNGPSGLAWVDAQRSLDRMFEPFETLLADAAV
FT                   AASARRVLDVGCGTGAVTLAIARRLGAHAHCTGVDISARMIAAAQARAEREGLAASFVP
FT                   ADAQTHAFEPDQFDLVVSRFGVMFFDDPVRAFANLRHAARVNAQLRFVAWRSAADNPFM
FT                   TTAERVAGPLLPNLPARQPGAPGQFAFGDRQRIASVLSDSGWADIAIEPIDVACALPAA
FT                   ALDDYVTRLGPVGLALREVDDATRRRVIDTVRAAFEQYVQGADVRFDAACWLVAARAPS
FT                   A"
FT   gene            complement(385766..386077)
FT                   /locus_tag="Bamb_3563"
FT   CDS_pept        complement(385766..386077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1875 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3563"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89117"
FT                   /db_xref="GOA:Q0B9Q6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Q6"
FT                   /protein_id="ABI89117.1"
FT                   /translation="MSGLVHDRTGDVIALATLALLYFGGVGLALWRIRTAAPRGKLYWI
FT                   ACIALLAGGAIAMTANLSPIPNSGEMPPGFALGVEAVLLGLALVAAGCAWLMLRARRG"
FT   gene            complement(386444..387640)
FT                   /locus_tag="Bamb_3564"
FT   CDS_pept        complement(386444..387640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3564"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG:
FT                   bur:Bcep18194_B1873 outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3564"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89118"
FT                   /db_xref="GOA:Q0B9Q5"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Q5"
FT                   /protein_id="ABI89118.1"
FT                   /translation="MNAPHYPHYRFAILILSAASFGAGAAHAQSSVTLYGVVDDSIAYV
FT                   NNQQGHSNVYLRDGNLYASKFGLRGDEDLGGGTHAIFDLQAGFNLNTGAQAAAGTIFNR
FT                   QAYVGLRNDHYGTVTAGRQYTPYFLLVGPYASSSWLTGATGAHPGDIDGLDTTIRVNNS
FT                   VTYTSPTLSGLTASAMYAFGGIAGATGKGNTFSAALRYANGPVGIAAGYLRINSSGSSA
FT                   GFLNPATAASGSFAVSVLNQGYLSAKAVEQVAAAGNYTLGNLTMGLNYSNVKYLPGNGS
FT                   AFTDTAVFNTYGALAAYRFTPTFSVAGAFAYTLASKANGVSGAARYQQYSLKESYSLSK
FT                   RTTLYALQAYTHASGQTLGAQGAGHIVDAAPIVGDSQQLTPSTTHGQFVGMAGIAVTF"
FT   sig_peptide     complement(387554..387640)
FT                   /locus_tag="Bamb_3564"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.996 at
FT                   residue 29"
FT   gene            complement(387759..390179)
FT                   /locus_tag="Bamb_3565"
FT   CDS_pept        complement(387759..390179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3565"
FT                   /product="Alpha-glucosidase"
FT                   /EC_number="3.2.1.20"
FT                   /note="PFAM: glycoside hydrolase, family 31; KEGG:
FT                   bur:Bcep18194_B1872 alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3565"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89119"
FT                   /db_xref="GOA:Q0B9Q4"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Q4"
FT                   /protein_id="ABI89119.1"
FT                   /translation="MTSLLHPPVFRVADRQANRVLLASDAGATLEIFVLEDDIVRVRIL
FT                   PDATPRNPRTWTIAPGLDDVPLDGRDRLDLSGFALPAYAFAEDDLDARIETAQVRLAVR
FT                   LQGGHCTWSMRGADGAWRVVLADRATQAYNFGWWDDRAYHYVARERGDKVFGLGERAGE
FT                   LDRTGARFEMRNIDAMGYSAKHTDPLYKHIPFTITWSPDACQGFGLFYDTLSDCAFDMG
FT                   RELDNYHGLYRYFVAEHGDLDYYFIASPDTPLTAARRFTWLTGRPARTPKWGLGYSGST
FT                   MSYTDAPDAQRQMNQFVEQCDAHDILCDSFHLSSGYTSIGAKRYVFNWNREKFPDAKGF
FT                   VKHYRDHGIRLCANIKPCLLRDHPAFDDAARRGLLIRSASGEPAWVQFWDEVGAYIDFT
FT                   QPDAYRWWREQVTSALLDYGIESTWNDNNEYEIWSPDAIAHGFGQPFPAREAKVLQTML
FT                   MMRASRDAQRAHAPARRPFLVSRSGGAGMQRYVQTWSGDNYTSWETLRYNLKMGLGLAL
FT                   SGVSNIGHDIGGFSGPAPSPELLLRWVQFGIFMPRFSIHSWNDDGTVNEPWMYPEITAQ
FT                   IASLIKQRYRLLPYLYHLLWLSTTRYEPVLRPTFGDFPGDPRCYDECDDMMLGDALLVA
FT                   PVVDPGRTERTVYLPSGARWTCCASARSFDGGASVTLPAPLDTPVMLLREGRVLPLNVA
FT                   AQRFGARADTRGFIVAPRIEDGVAYGECVEDDGETEAWRDGEYGLWRIETGREASGELG
FT                   VSVRWEGRMHRPAERVEILLPVSLQGALAVRGARVEHDARDGAWRRIVVALVD"
FT   gene            complement(390207..391538)
FT                   /locus_tag="Bamb_3566"
FT   CDS_pept        complement(390207..391538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3566"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B1871 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3566"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89120"
FT                   /db_xref="GOA:Q0B9Q3"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Q3"
FT                   /protein_id="ABI89120.1"
FT                   /translation="MNKTEQGAPAGRICMNQETAVKTVKALRWWIIVLVCLGTILNYLA
FT                   RNSLAVLAPELKHVFAISTQQYSYIVGAFQIGYTIMQPVCGFIVDLIGLRLGFALFAML
FT                   WSVVGVAHGFASGWLSLGILRGLLGLFEAAAIPSGMKAVAEWFPDREKSVAVGYFNAGT
FT                   SLGAAIAPPLVVFLSMRFGWQSAFMVTGALGFAWAVLWYTQYRSPAEHPRISSQERTLI
FT                   SDGQARMPAVSKRRIRDVVTARRFWAIALPRFFAEPAWQTFSFWIPLYLATERHMALTE
FT                   IAIFAWMPFLAADLGGIAGGYLSPYLAKRFSLPLVWSRVAGVALGAVLMLGPATIGLVS
FT                   SPYTAIALFCVGGFAHQMISALVNTLSADVFDSEEVGTASGFAGMAAWIGGLGFSLLVG
FT                   ALADKIGYAPLFACLGLFDIIGVTLLAVLIRGQSKQERLLAQHA"
FT   gene            complement(391555..391848)
FT                   /locus_tag="Bamb_3567"
FT   CDS_pept        complement(391555..391848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3567"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89121"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Q2"
FT                   /protein_id="ABI89121.1"
FT                   /translation="MSRPCRAFLAVSRTTGARLRRAGIPHAAARFVTDAVFACRSGKPR
FT                   VRSFECSFTLTRFEFEHRMFENDQSSDNVAFDYSRMFERTRPFRPGLRQIGS"
FT   gene            391925..392875
FT                   /locus_tag="Bamb_3568"
FT   CDS_pept        391925..392875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3568"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: bur:Bcep18194_B1870 transcriptional regulator,
FT                   RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3568"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89122"
FT                   /db_xref="GOA:Q0B9Q1"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Q1"
FT                   /protein_id="ABI89122.1"
FT                   /translation="MTPLAPHEASQDESAIAERIASAMPRMTPIHRRMGEFVLANPFRA
FT                   ATMRIDELAQAVNASIATANRFAKALGFDGYPAMRAALVRGFEATLGPVERLRSAQEQE
FT                   QEQGVRGAAWIDAVFDQAIENIENTRARLDATDVEAAVEAIVGARRVLILGAGSSAFLT
FT                   GLMEHGLSVCHDNVQSLALLGGPTHAARRLYTADSRDLVIALAFPRYVKDTIELARRAA
FT                   ARGARVLGISDGPGSPLAPVASLNLYVKAQRRFAATSEAAVLTMIEALIDAVALRTHRS
FT                   AKSAAEMTEFLLPWLMQPPAALPAANPSSSGPKKS"
FT   gene            392872..393879
FT                   /locus_tag="Bamb_3569"
FT   CDS_pept        392872..393879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3569"
FT                   /product="peptidase T2, asparaginase 2"
FT                   /note="PFAM: peptidase T2, asparaginase 2; KEGG: ansA;
FT                   asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3569"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89123"
FT                   /db_xref="GOA:Q0B9Q0"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9Q0"
FT                   /protein_id="ABI89123.1"
FT                   /translation="MTSPAIIAIHGGAGTILREAMDTDTERRYRAELTAILQAAQHVLA
FT                   DGGSALDAVTVAVRMLEDCPLFNAGRGAVYTAEGKHELDAAVMDGATLAAGAVCSATRV
FT                   RNPVLAARRVMEASEHVLFAGAGADAFAVEQGLELAEPGYFDTEARHAQWVKARAAAAG
FT                   TMLDHDAASFAFGAGQPGGSAAPAEPLDPDRKLGTVGAVACDLNGHVAAATSTGGITNK
FT                   QPGRVGDSPIIGAGCYADDATCAVSATGTGEMFIRLATAHDVAAQMEYRGASLADAAHD
FT                   AVMNKLPRLAGRGGIIAVDAHGNVAMPFNTEGMYRGYARVGETPVVGIYRDDAA"
FT   gene            393907..395808
FT                   /locus_tag="Bamb_3570"
FT   CDS_pept        393907..395808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3570"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bur:Bcep18194_B1868 ABC
FT                   dipeptide/oligopeptide/nickel family transporter, ATPase
FT                   subunit; TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter, C-terminal domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3570"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89124"
FT                   /db_xref="GOA:Q0B9P9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9P9"
FT                   /protein_id="ABI89124.1"
FT                   /translation="MTSSRTPSALVLPDQRVVAVDDLSVMFRRGAATFDAVRNVSFHVD
FT                   RGETLAIVGESGSGKSVTSLALMRLVEHGGGEITSGRIALRRRGGALVDLAQASAATMR
FT                   GIRGADIAMIFQEPMTSLNPVFTVGDQISEAIALHQSKSATEARAEALRLLDLVRIPEA
FT                   RRVFARYPHQLSGGMRQRVMIAMALSCRPALLIADEPTTALDVTIQAQILQLIRGLQNE
FT                   MNMGVIFITHDMGVVAEVADRVLVMYRGEKVEEGESERIFATPAHRYTRALLAAVPRLG
FT                   SMQGTDIPEKFPLLKVDATGAAAPAPAAHDSADAQPPVDAAAPPILRVRDLVTRFPVKS
FT                   GVFSRVSQYVHAVERVSFELRAGETLALVGESGCGKSTTGRSLLRLVESQSGSIEFDGR
FT                   DISAMKGADLQALRRNIQFIFQDPFASLNPRLTVGFSIMEPLLVHGVASGREAQARVDW
FT                   LLDKVGLPPEAARRYPHEFSGGQRQRIAIARALALNPKVVIADESVSALDVSVQAQIVN
FT                   LMLDLQRELGVAYLFISHDMAVVERISHRVAVMYLGQIVEIGPRRAVFEAPQHPYTRKL
FT                   MSAVPVADPARRHAPRQLAADEIPSPIRAIGDEPTVAPLVAVGPDHFVATHRVGGAY"
FT   gene            395939..397501
FT                   /locus_tag="Bamb_3571"
FT   CDS_pept        395939..397501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3571"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: bur:Bcep18194_B1867 ABC
FT                   dipeptide/oligopeptide/nickel family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3571"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89125"
FT                   /db_xref="GOA:Q0B9P8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9P8"
FT                   /protein_id="ABI89125.1"
FT                   /translation="MNKPHSFPVFRPRALFAAGAGALALSVAAPAFAQQNVVVAVYSTF
FT                   TTMDPYDANDTVSQAVVKSFYEGLFGFDKDMKLVNVLATGYQASPDAKVYTVKLRDGVK
FT                   FQDGTDFNAAAVKANFDRVTDPANKLKRYGLFRVIEKTEVVDPMTVKFTLHEPFSAFIN
FT                   TLAHPSAVMISPAALKKWGRDVSLHPVGTGPFEFVEWKQTDDMKVKKFAGYWKKGYPKV
FT                   DSIDWKPVVDNNTRAALLKTGEADFAFTIPFEQAADLKSNPKVELIERPSIIQRYISLN
FT                   TQKKPFDNPKVREALNYAVNKEALAKVVFAGYATPQTGVAPIGVEYATKLGPWPYDPAK
FT                   ARALLKEAGYPNGFESTLWSAYNHSTAQKLIQFVQQQLAQVGVKVQVQALEAGERVAKV
FT                   ESAQDPAAAPVRMYYSGWSASTGEANWALSPLLASTSAPPKLYNTAYYKNSAVDDALAK
FT                   ALETTDRAKKATLYADAQKQVWADAPWIFLVQEKIVYARNKRLHGMYVMPDGSFNFDEI
FT                   SVK"
FT   sig_peptide     395939..396040
FT                   /locus_tag="Bamb_3571"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.999 at
FT                   residue 34"
FT   gene            397569..398489
FT                   /locus_tag="Bamb_3572"
FT   CDS_pept        397569..398489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3572"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B1866 ABC
FT                   dipeptide/oligopeptide/nickel family transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3572"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89126"
FT                   /db_xref="GOA:Q0B9P7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9P7"
FT                   /protein_id="ABI89126.1"
FT                   /translation="MLNFLVKRLFGLLPTLAMVAVLVFLFVHLLPGDPARLAAGPEADD
FT                   ATVALVRADLGLDRPLPAQFANFFVKIAHGDFGTSTRSKRPVSTEIGERFMPTLLLTLV
FT                   SMVWATAFGMAIGIASAVWRNRWPDRVGMTIAVSGISFPAFALGMLLMEIFSVKLGWLP
FT                   VVPDGTWKSYVLPSLTLGAAVAAVMARFTRASFVEVLNEDFVRTARAKGVHEPMVVLKH
FT                   CLRNAMIPVVTMMGLQFGFLLGGSIVVEAVFNWPGLGRLLVDAVTMRDYPVIQAIVLLF
FT                   SLEFILINLTVDVLYAVINPTIRFK"
FT   sig_peptide     397569..397658
FT                   /locus_tag="Bamb_3572"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.905) with cleavage site probability 0.602 at
FT                   residue 30"
FT   gene            398497..399390
FT                   /locus_tag="Bamb_3573"
FT   CDS_pept        398497..399390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3573"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B1865 ABC
FT                   dipeptide/oligopeptide/nickel family transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3573"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89127"
FT                   /db_xref="GOA:Q0B9P6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9P6"
FT                   /protein_id="ABI89127.1"
FT                   /translation="MNATVQPAAPAASNAVRTPWHEFWRKFRKQTVALVAGGFVLALVV
FT                   LAFVGPHIAPFDPENYFDYDALNAGPSAVHWFGVDSLGRDIFSRIITGTRISLAAGFFS
FT                   VALGALIGTFFGLLAGYYEGWWDRITMRVADVLFAFPGILLAIGVVAILGNGMINVICA
FT                   VAIFSIPAFARLVRGNTLMLKHMTYVEAARSIGASDWTIIMRHILPGTVSSVVVYFTMR
FT                   IGTSIITAASLSFLGLGAQPPTPEWGAMLNEARADMVSAPHVAIFPSLAIFLTVLAFNL
FT                   LGDGLRDALDPKLERR"
FT   gene            399390..400472
FT                   /locus_tag="Bamb_3574"
FT   CDS_pept        399390..400472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3574"
FT                   /product="L-aminopeptidase DmpA, Serine peptidase, MEROPS
FT                   family S58"
FT                   /note="PFAM: peptidase S58, DmpA; KEGG: bur:Bcep18194_B1864
FT                   peptidase S58, DmpA"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3574"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89128"
FT                   /db_xref="GOA:Q0B9P5"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9P5"
FT                   /protein_id="ABI89128.1"
FT                   /translation="MRAVPMWAATLPAGPRGTIADVPGVTVGHATLDAGDVQTGVTVVK
FT                   PHPGDLYRSKVPAGAAVINGFGKSVGLMQVDELGTLDTPIALTNTFGVGAIAQAQIRAA
FT                   IANNPQIGRDWSTVNPLVFECNDGYLNDIQAFAVTAAHYDDACRTAARDFARGAVGAGR
FT                   GMSCFDLKGGIGSASRVAVAAGRPYTVGALVLANFGRLPMLTLGGVPLGRVVAQRHAAA
FT                   AAQAAAPEQGSIILLLAIDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTA
FT                   YTIAHDASTLALPALVADAALDPLFMAAAESVEHAIADALLQAVTVVGRDGHVRQSLRD
FT                   AVPDLERLFNDDNEGRHIPS"
FT   gene            400469..401296
FT                   /locus_tag="Bamb_3575"
FT   CDS_pept        400469..401296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3575"
FT                   /product="D-aminopeptidase DppA, Metallo peptidase, MEROPS
FT                   family M55"
FT                   /note="PFAM: peptidase M55, D-aminopeptidase; KEGG:
FT                   bur:Bcep18194_B1863 peptidase M55, D-aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3575"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89129"
FT                   /db_xref="GOA:Q0B9P4"
FT                   /db_xref="InterPro:IPR007035"
FT                   /db_xref="InterPro:IPR027476"
FT                   /db_xref="InterPro:IPR036177"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9P4"
FT                   /protein_id="ABI89129.1"
FT                   /translation="MKILISTDIEGVAGVFAVEQTRAGNPEYERARRWMTAEANAAIEG
FT                   AFAGGAQTVWVNDSHGSFRNLLPDGLDARARVVLGKPRTLGMMAGLEQQPDLVFMIGFH
FT                   AKSQTHGVLAHTINNFAFTQVWLNGVELGEAGLYGALAREYGAHVALASGDDVFAEETR
FT                   PLFPDARFETVKTARGASSGDTLTPAASCARIATAARETVAHALLSGWRATAHRPAPAA
FT                   CTLRVQTAALADLFCMLPTLERVDAVTLRFDGPSVEHVVRTLNSLSAMSFMLR"
FT   gene            401369..402337
FT                   /locus_tag="Bamb_3576"
FT   CDS_pept        401369..402337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3576"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bur:Bcep18194_B1861 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3576"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89130"
FT                   /db_xref="GOA:Q0B9P3"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9P3"
FT                   /protein_id="ABI89130.1"
FT                   /translation="MGSAPPTMKRSWHLRSDEVAFRPIGPSGRRVVRPSGRTGVERISD
FT                   RSKVTRLRYQIIHDGIPALRNTLPDPYDHIPRSVVVTANDYPAGTTFPEHAHGRGQFAF
FT                   ASRGTISVSTPHGRWLVPPQRACWVPPGVRHEMTMTGAVTMLNTFVSDDAARAAGLPDQ
FT                   CGVYGVSPLLRQLIDDAIELPAMYDVDGRAGKLMALLVAEIATMPRLSLHAPLPADARL
FT                   ASICRHLFASPSIAADLDQVATHAGVSRRTFTRLFRAQTGVSFAAWRQQVCMLAAITRL
FT                   SDGQPVTRVAFELGYASASAFTSAFRRILGDTPSRYLEARR"
FT   gene            complement(402492..402785)
FT                   /locus_tag="Bamb_3577"
FT   CDS_pept        complement(402492..402785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3577"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89131"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9P2"
FT                   /protein_id="ABI89131.1"
FT                   /translation="MTREPAQAGCSHRTAVWRDTDRHRVARRFSFSGIDIRCCAAARAT
FT                   AIAKVHDWRPRTSASNARSKRMLRRHMNRWRHAISFARYAAYALLSAIRRWN"
FT   gene            complement(402782..403375)
FT                   /locus_tag="Bamb_3578"
FT   CDS_pept        complement(402782..403375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3578"
FT                   /product="protocatechuate 3,4-dioxygenase, alpha subunit"
FT                   /EC_number="1.13.11.3"
FT                   /note="KEGG: bur:Bcep18194_B1860 protocatechuate
FT                   3,4-dioxygenase; TIGRFAM: protocatechuate 3,4-dioxygenase,
FT                   alpha subunit; PFAM: intradiol ring-cleavage dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3578"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89132"
FT                   /db_xref="GOA:Q0B9P1"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9P1"
FT                   /protein_id="ABI89132.1"
FT                   /translation="MTTLKQTPSQTVGPYFAYGLCPQQYDYDLKSLFTPAIATPDAEGE
FT                   HVLLVGQVFDGDGNVVGDAVLEFTQVDGAGRYPASRDDIAKSGFTGFARVGTGTDPQNR
FT                   FVVPTIKPGRIAADEAPHINVTVMMRGILTHAFTRVYFDDEAAANAADPVLNLVPAERR
FT                   ATLVAKRDAQPGRPVVYRFDIRMQGPDETVFFDV"
FT   gene            complement(403379..404086)
FT                   /locus_tag="Bamb_3579"
FT   CDS_pept        complement(403379..404086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3579"
FT                   /product="protocatechuate 3,4-dioxygenase, beta subunit"
FT                   /note="TIGRFAM: protocatechuate 3,4-dioxygenase, beta
FT                   subunit; PFAM: intradiol ring-cleavage dioxygenase; KEGG:
FT                   bur:Bcep18194_B1859 intradiol ring-cleavage dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3579"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89133"
FT                   /db_xref="GOA:Q0B9P0"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9P0"
FT                   /protein_id="ABI89133.1"
FT                   /translation="MDSPTILTPRDWPSHPAYVHPEYRSSVKRGPTRPMIPLKEKLRDQ
FT                   YAPVYGAEDLGALDHDLTKNSVKNGEPLGERIVVTGRVLDEGGKPVRNTLVEVWQANAA
FT                   GRYVHKVDQHDAPLDPNFLGAGRCLTDNEGRYRFLTIKPGAYPWGNHPNAWRPNHIHFS
FT                   LFGDYFGSRLVTQMYFPGDPLLAYDPIFQGTPEAARDRLISRFSMDITEEGYALGYEFD
FT                   IVLRGRDATPMER"
FT   gene            complement(404388..404951)
FT                   /locus_tag="Bamb_3580"
FT   CDS_pept        complement(404388..404951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3580"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1858 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3580"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89134"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9N9"
FT                   /protein_id="ABI89134.1"
FT                   /translation="MSTRTDTTAFEPHPTAPRDARDTDRTLPLATVRTLAAGAHVGDLV
FT                   FIRVPARALRDAAGNAGAWADRFGIVVDTSGDEPLIAEPAFARTKLTPLSRFIARADGG
FT                   RVALARRVAAPSADAQRHVHALAEQRIDALLGSRFSLLAHRGFCANYVGDVLGAERTAT
FT                   PAALLRSGTLSLEFDGIVFDPARP"
FT   gene            405072..405809
FT                   /locus_tag="Bamb_3581"
FT   CDS_pept        405072..405809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3581"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   bur:Bcep18194_B1857 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3581"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89135"
FT                   /db_xref="GOA:Q0B9N8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9N8"
FT                   /protein_id="ABI89135.1"
FT                   /translation="MTETAQLIETLKRQLKAQGMTYRDVARALDVSETSVKRLFASGRF
FT                   TLERVAEIAQLLGYTLAELVQEASASAPRLRVLTEQQEALLVSDEKLLLVAVCAVNYWT
FT                   VQDIVSAYCLTQAECVKYLLMLDRMNVIALLPGDRIRVRVARDFDWLPGGPIRRYFHAH
FT                   VLDDFLGSRFDGPGETMTFSQGMLTDAAAAELEQELRRLGAKAAALHAESSSAPLGQKR
FT                   GTGLLIAKRIWEPTGFHALRRHA"
FT   gene            405887..406873
FT                   /locus_tag="Bamb_3582"
FT   CDS_pept        405887..406873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3582"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="TIGRFAM: pca operon transcription factor PcaQ; PFAM:
FT                   regulatory protein, LysR; LysR, substrate-binding; KEGG:
FT                   bur:Bcep18194_B1856 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3582"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89136"
FT                   /db_xref="GOA:Q0B9N7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR012787"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9N7"
FT                   /protein_id="ABI89136.1"
FT                   /translation="MNNRIADGRVKFRHLQCFLAVAQLGGVQKAAESLSITQPAVSKTI
FT                   AELESILGVKLFERGRHGAQPTREAQLFLPHANACVLALRQGVGLLAREGGAAAATLEI
FT                   GMLPTVAASLAPALMKALAARWPRIVVRIATAANAELLERLKAGAIECAIGRLSEPERM
FT                   IGLAFEQLYNEPLVAVVRAGHPLLASAAPAAELARYPVVLPPFGTLIRQSAEQLLGACG
FT                   APPLDSFIEVLSVSVARALTLENDAVWFVPLYAAEYDLSAGALARLALPSAGTDEPVGL
FT                   VLRTDAQPSPVARTLIDAVREIARARFGNARAHRAPPGARKPARRTR"
FT   gene            407007..407366
FT                   /locus_tag="Bamb_3583"
FT   CDS_pept        407007..407366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3583"
FT                   /product="protein of unknown function DUF891"
FT                   /note="PFAM: protein of unknown function DUF891; KEGG:
FT                   bur:Bcep18194_B1855 protein of unknown function DUF891"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3583"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89137"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9N6"
FT                   /protein_id="ABI89137.1"
FT                   /translation="MARQQIQITLGVRFFRTARGNEPVREWLKALGHIERRMIGEEIKT
FT                   VQLGWPLGMPLVRKMSKDLWEIRVILPRRSARVLFTVVGDTMVLLHAFFKQSQATPSDD
FT                   LDVTVARLKALTHAI"
FT   gene            407439..407735
FT                   /locus_tag="Bamb_3584"
FT   CDS_pept        407439..407735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3584"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1854 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3584"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89138"
FT                   /db_xref="GOA:Q0B9N5"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9N5"
FT                   /protein_id="ABI89138.1"
FT                   /translation="MTTTNNPHIGSDFDTFLEEDGNLEAATATAIKRVIAWQIGQEMKA
FT                   QHITKTAMAARMKTSRAALNRLLDETDTSLTLATLASAATALGKRLSFELVPA"
FT   gene            408253..409707
FT                   /locus_tag="Bamb_3585"
FT   CDS_pept        408253..409707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3585"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family"
FT                   /note="TIGRFAM: type I secretion outer membrane protein,
FT                   TolC family; PFAM: outer membrane efflux protein; KEGG:
FT                   reu:Reut_A0749 type I secretion outer membrane protein,
FT                   TolC"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3585"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89139"
FT                   /db_xref="GOA:Q0B9N4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9N4"
FT                   /protein_id="ABI89139.1"
FT                   /translation="MSNCSRHSRTDGGMSREPNLKVGRPRYAARNALKAISSFLAIISA
FT                   THANASSLANLAGEALAQDATFRSAEAAWRAGIERAPQGRAGLLPQVGIQQVIYRNGVR
FT                   IPGQTIPGYSTNGFTLTLNQPLFNWAAWENWQQGQLLAMDADLALAQAKQDLLLRVAQA
FT                   YLAALNAQDDLALAVGHRKAVAEQLALAKRRFALGDATIVDTNEALAGFDAARADEVAA
FT                   QTQRDTSYAALQKIVGHPVDRVDGWRDDAHLPPVATADLQQWMDTAATADYGVRRKMIA
FT                   IQLASRERSKARAGDYPTVSLVGNASNGNAAFINGQTNFYTGASRGSSGYVGIQISLPL
FT                   TDGLMTRSKIREALALEDKAREDLEDAQRSARLTAHDAYLGVTRGLAQTDALASAVRSA
FT                   TIALRSNQTGYRVGVRVNADVLDAGDKLYRAQRDFARARTETLAQALKLKASTADLGEA
FT                   DLAALDTMMVEHTPARIPSSGASGGH"
FT   gene            409707..411503
FT                   /locus_tag="Bamb_3586"
FT   CDS_pept        409707..411503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3586"
FT                   /product="type I secretion system ATPase"
FT                   /note="KEGG: noc:Noc_1818 type I secretion system ATPase,
FT                   PrtD; TIGRFAM: type I secretion system ATPase; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3586"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89140"
FT                   /db_xref="GOA:Q0B9N3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9N3"
FT                   /protein_id="ABI89140.1"
FT                   /translation="MYQLIRRHLVIAAAFGIASNLLLLTPTIYLLQVYDRVLPSQSIQT
FT                   LLMLMAFMAITLGMNICVDIARSRILSDLGVRIGNRLERLALQAQISAHAYRLPSRALA
FT                   SQGDINTLRAFLAGSGVIAFFDAPWLVVYVVVIGLFHWSLALIAVLSALLLVSVALVND
FT                   RLTRKGIESYLARQREGDAFYQHLIRNAEVMTVLGMTENLVGAWDVRKRDYIAAQRDVS
FT                   DRSAFYRDLTKGLRQAIQVIMMAAGAWLVISGHATPGVMLATTILLGKALAPIEQLIGN
FT                   WRQAGELREAWPRLEALLASQTEAEPIALPPPTGEIRVEQIAFSVPSRTPGLGRLLLRG
FT                   INFTLAAGQTLVITGPSASGKSTLLRVIAGLWRPQAGAVRLDGADMAQWPRSSLGRYLG
FT                   YVPQDVELFAGTVAENIARTAKPLPLDSAAIVRAAKRAEVHEMILNLPDGYETLIGDAG
FT                   ELLSGGQRQRIALARALYGEPAVLLLDEPNASLDTMGEAALERVLRHLKADGMTVIAVT
FT                   HRPSLLALADRILRLKDGQMERLDMPPGPEQVDSDSCTANGQTDDTSGLPQGIDFSALQ
FT                   ASRSSLQAARVPTLGPAMEGNR"
FT   gene            411653..412879
FT                   /locus_tag="Bamb_3587"
FT   CDS_pept        411653..412879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3587"
FT                   /product="type I secretion membrane fusion protein, HlyD
FT                   family"
FT                   /note="TIGRFAM: type I secretion membrane fusion protein,
FT                   HlyD family; PFAM: secretion protein HlyD family protein;
FT                   KEGG: rru:Rru_B0040 type I secretion membrane fusion
FT                   protein, HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3587"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89141"
FT                   /db_xref="GOA:Q0B9N2"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9N2"
FT                   /protein_id="ABI89141.1"
FT                   /translation="MGAALAPISGAVVAEGSVRTEGERKTVQHLEGGIVKQILVRDGDR
FT                   VKAGQVLVVLDNVSPAAELSALQAQFDAEQAKIARLSAERELKETLAFPAALEKQRDDP
FT                   RVAELLARESSLFIARRRAFADQSTMLRTELAQTRQEIAISSQLIQTMNRSYDMARQQR
FT                   RTNETLQQEGFVAETKVLDLRRAEADALSRVQSGAADLSRAKQRQTDLELRIAGLRHDY
FT                   VKAADDQLKEATTRAIQIGERLRPARDQSARTRVTAPVAGVIVGLKVHTIGAVIAPREP
FT                   IVDVVPEGAPLIVEANIRPDDVREIAPGSHADVRLTAYNSRTTPMLDGKVTYISADALT
FT                   DSDKRTRFYVVRVEVPAQALERANRLAKEPVALGPGLRTEVYIRTHARSAFDYLLEPVR
FT                   DGIRKSMRD"
FT   gene            414836..415399
FT                   /locus_tag="Bamb_3588"
FT   CDS_pept        414836..415399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3588"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1531 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3588"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89142"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9N1"
FT                   /protein_id="ABI89142.1"
FT                   /translation="MSVITGKEAMFVNVKITQDELDLINRSPTLVDPLLKYNNDVLKEA
FT                   VHPIQVSAGESGMIWDAKIKTIQFGRYDNKAYDQLESRVFVGVLSHEIGHYINDAHDRD
FT                   INRQYGAKMREDFDLAAVIGVNKEREAAYNNWLVAREIFQNNGQQIVVRGDRADYVGAL
FT                   EYIYPHACTLGNRLSARTGQGRDS"
FT   gene            416436..419267
FT                   /locus_tag="Bamb_3589"
FT   CDS_pept        416436..419267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3589"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:bll2373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3589"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89143"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9N0"
FT                   /protein_id="ABI89143.1"
FT                   /translation="MYNAIIIAAEKSPFLAGELNAFGRDPDWEFVKGEANKGIFTDSSK
FT                   KKIAFDPTWSESATLFATTLAHELGHALLPGGTGGSLALNPDQAVANGLSNEGVALLSE
FT                   YIVAIQLGLTGGAAGHMHSDQSDSRLTLQLNQLAQSVGIDVKSVTWGSAAAHALADSDS
FT                   ALVDAAGKYYGTVHPSPALQLTYSQFYADWWIIQHSGMDPNLVDWQKVQADMIKYTNFT
FT                   LDGQPVFTIDTKGIPLLDGGWAVVNGEISLKGVVTKTLFNADGKIQEQAKYDYTGFKFQ
FT                   NMLFGGDGKATHRYDFKLDNSYTKYDFAADGSQTASLYGTTGQMIEYAKFNANGFKTLD
FT                   IFYGADGNATQQYNFNLDKSYTKYDFNANGSQTATLYGVNGKITEYAKFNADGFKTLDI
FT                   FYGANGKAVQQYNFNLDKSYTKYDFAADGSQTASLYGTTGQMTEYAKFNANGFKTLDIF
FT                   YGANGKATQQYNFNLDKSYTKYDFAADGSQTATLYGTTGQLTEYAKFNADGFKTLDIFY
FT                   GANGKAVQQYNFNLDKSYTKYDFAADGSQTATLYGTTGQITEYAKFNANGNKTLDIFYG
FT                   ADGKATQQYNFNLDKSYTKYDFAADGSQTATLYGTTGQLTEYAKFNANGFKTLDIFYGA
FT                   DGKATQQYNFNLDKSYTKYDFAADGSQTATLYGAAGQVTEYAKFNANGNKTLDIFYGAD
FT                   GKATQQYNFNLDKSYTKYDFNADGSQTATFFGVNGQVSEYAKFNAAGVKTQDIVFGADG
FT                   KATKQIDFNIDGSYASHVFNSDGSQFAALFGTNGQMTEYATFNAGGFKTQDIFYSNGRA
FT                   THRYDFALDKSFIAHVFDGSDEMVALFGVNHIVYDYYKYSYGKLFERDIFDGLGRQIEA
FT                   DRFSTSTGKLTGFSKFTYNSDGTYNAKSYDSSGHLTASSNYTGDGHLIQNNTIYIPGSS
FT                   GFPSAQLWWGFQI"
FT   gene            complement(419429..420700)
FT                   /locus_tag="Bamb_3590"
FT   CDS_pept        complement(419429..420700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3590"
FT                   /product="amino acid exporter, AAE family"
FT                   /note="PFAM: Spore germination protein; amino acid
FT                   permease-associated region; KEGG: bur:Bcep18194_B1853
FT                   putative amino acid transporter; TC 2.A.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3590"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89144"
FT                   /db_xref="GOA:Q0B9M9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9M9"
FT                   /protein_id="ABI89144.1"
FT                   /translation="MPSHADSPAVHHAGSLTIFQGAALYIGAVLGTGVIALPALAAEVA
FT                   GPASLLAWAALVVLSGPLAATFAALGARYPDAGGVSTYARRAFGPKAAAIVGWCFYFAV
FT                   PAGAPAAAMFGGAYVAAVTGGGHVTVIVTAAALIATVSAANAFGVTVSGRMQLVLSALL
FT                   VTLLLAAVLASAPHARTANLHPFAPHGWLAVGEAAALLVWSFAGWEAITHLAAEFRRPA
FT                   HDMPRSAAIAVVVVGFLYLSVAAASVTVLGPSAGASGAPLAELIAGGIGGHARVLAATA
FT                   AVLLTLGTMNAYFAGAAKLGAALGRDGALPAWLAQGSQVGGVPRRSLGVIAVLAAVALA
FT                   ATTLSDVGPKPLVLVTSGCFVMVYGLGAAAALKLLPRGGIAYRCAWISLVAVAGLFLTT
FT                   GWYILCPLLLAGGALLYLRLAGRP"
FT   gene            complement(420829..425355)
FT                   /locus_tag="Bamb_3591"
FT   CDS_pept        complement(420829..425355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3591"
FT                   /product="ATP dependent helicase, Lhr family"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; DEAD/H associated domain protein;
FT                   KEGG: bur:Bcep18194_B1852 DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3591"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89145"
FT                   /db_xref="GOA:Q0B9M8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9M8"
FT                   /protein_id="ABI89145.1"
FT                   /translation="MDVTATRPAHALDVFHPAVAAWFRRTFAAPTGVQALAWPHIKAGR
FT                   STLVAAPTGSGKTLTAFLCALDDLVRDALAHDGALPDATLVVYVSPLKALSNDIHVNLD
FT                   APLAGIAESLAQLGLPVPAIRTAVRTGDTPQAERAALRKRAPHILVTTPESLYVLLSST
FT                   SGRQMLSSVRSVIVDEIHALASSKRGSHLALSLERLDALTGRALPRIGLSATQKPIDAV
FT                   SRFLVGGPADAPRDCTIVDTGHTRERDLALELPNVPLGPVMATDVWDQVYDRIAALAAA
FT                   HRTTLVFVNTRRTAERMARHLAERLGKDAIAAHHGSLAKEHRLDAEQRLKRGELKLLVA
FT                   TASLELGIDIGDVDLVCQVGSPRGIAPFLQRVGRSGHQVGGVPKGRLFPLSRDELVECA
FT                   ALLDCVQRGELDALRIPEAPLDVLAQQIVAEVACAEWQEDALYASFTRAAPYARLSRER
FT                   FDEVMKMLAEGFTSRRGVRGAYLHRDVVGGTVRGRRNAMMTATTSGGTIPDMADYAVLL
FT                   EPQGIQVGTVNEDFAVESLAGDVFQLGNQSYRIIRVETGRVRVEDAQGQSPSIPFWLGE
FT                   APGRSDELSAAVGRLRARLDALFAEGDRNTDAGGRKRGASGVNGANGDATGKTATRGKA
FT                   KRAAEASTVADSRSDADGTAIVPAESRLAPALRWLADDLHLAPDAARQIVDYLARTRAA
FT                   LGALPTQDTLVMERFFDESGGTQLVIHSPFGSRINRAWGLALRKRFCRTFDFELQAAAT
FT                   DDAIVLSLSLAHSFALDEVWRYLRSASAEQVLIQALLDAPMFGVRWRWNATTSLALPRF
FT                   TGGRRTAPQLQRMKSDDLLATVFPEQVACLENVVGEREIPHHPLVDQTLDDCLHDAMDT
FT                   DGWLALLRRIESGAIELIARDLPAPSPLAAEILNAKPYAFLDDAPLEERRTQAVQSRRW
FT                   SDPESADDLGALDADAIDAVRDEAWPLVRDADEMHDALLTLACVADSEARAHDGWPERL
FT                   AELTERRRATKLVTPDGATLWVPVERLVCLRALHPDARVAPALKVPAACAQPWDADAAL
FT                   VDVIRARLTGFGPLTLDAIAQPLGLPPAAIATALAALEREGYVMRGRFTPGATTDEWCE
FT                   RHLLARIHRYTVKRLRREIEPVERADFMRFLFHWQRLTPDTRGTGRDALAAVLEQLEGY
FT                   EAAASAWEDALLPARLTDYTAGGLDDLCRSGKLVWTRIGAPARAAGTPVKTTPVVLLPR
FT                   RHLGAWQALRDPDAQPALSARATQVRDALAAHGAMFFDALLDELHMLPVELEQALGELV
FT                   SAGLVNADSFAGLRALLKPAVKRSATYAPRTRRGGALIGGMDDAGRWALVQRVSPTNDD
FT                   APTPAPKRGAPATDPDALEHIVWTLLRRYGVVFWRLLEREADWLPSWRELVRVLQRLEA
FT                   RGEIRGGRFVAGLAGEQFALPEAIPILRELRRQPGDGQYVCVTGADPLNLAGTLLPGDK
FT                   VPALAGNRVLFRDGVPVASLVAGAFHYAPELTPASREDARLRLARRY"
FT   gene            complement(425615..426139)
FT                   /locus_tag="Bamb_3592"
FT   CDS_pept        complement(425615..426139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3592"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3592"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89146"
FT                   /db_xref="GOA:Q0B9M7"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9M7"
FT                   /protein_id="ABI89146.1"
FT                   /translation="MASHNAHHASGFAAGVAAAVLVAQTGATGPWHTGLLAAFVAGVAG
FT                   GTAPDWLEVAWWTRKRRLWITHRTVTHWGIGWIALLALGWHGLTHHPHPLWAAPLFGFA
FT                   CGGVMHLLADWPNPLGVPWIWRRHSLNLWNSGHCDLIIVAAAWGGTLWLVQSLWTRAPF
FT                   LEHWLGWLHRV"
FT   sig_peptide     complement(426068..426139)
FT                   /locus_tag="Bamb_3592"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.966) with cleavage site probability 0.779 at
FT                   residue 24"
FT   gene            426537..428258
FT                   /locus_tag="Bamb_3593"
FT   CDS_pept        426537..428258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3593"
FT                   /product="gamma-glutamyltransferase 1, Threonine peptidase,
FT                   MEROPS family T03"
FT                   /EC_number="2.3.2.2"
FT                   /note="KEGG: bur:Bcep18194_B1850 gamma-glutamyltransferase;
FT                   TIGRFAM: gamma-glutamyltransferase; PFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3593"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89147"
FT                   /db_xref="GOA:Q0B9M6"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9M6"
FT                   /protein_id="ABI89147.1"
FT                   /translation="MTTLNRFKTSAVVLATVAGVGFLPNAPAYAKGPQPAVLTSSAVAV
FT                   ADKYSADAAERIFKEGGNAIDAAVAIAFTLAVTYPEAGNIGGGGFMTIYKDGKPYFIDY
FT                   RERAPLAATKDMYLDKEGNVVKGMSLYGPRAAGVPGTVAGMWEAQKRFGKLKWKQVLAP
FT                   AIHYARDGFMVDEQLAQRGVDASKEFGGKTNFDKYFSGMKAGTNFKQPDLADVLTRIAN
FT                   GGAEGFYKGKTAELIAASMKTGDGNGLITTEDLAQYRAVWRQPVQAKWNGYDVITAPPP
FT                   SSGGIGLVQLLKMKADLKKDFDGVALNSPQYIHLVAEIEKRVFADRAQYLGDPDFYKVP
FT                   IAQLTADSYIAKRAAEVNPKEPSDTKSVQPGLGTSMPEKAETTHFSVVDKWGNAVSNTY
FT                   TINGYFGSGVIADGTGIVLNDEMDDFSAKPGVANMFGVVGSDANAIEPKKRPLSSMSPT
FT                   IMTKDGKVSLVIGTPGGSRIFTSIFQVINNIYDFKMPLKDAVGAMRFHHQLLPPNTIFW
FT                   EPYHPIEGELAKQIEARGYTLKGQDFSGDIQVIKIDGKTPEAMADPRGRGVTRIIR"
FT   sig_peptide     426537..426629
FT                   /locus_tag="Bamb_3593"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 1.000 at
FT                   residue 31"
FT   gene            428522..429472
FT                   /locus_tag="Bamb_3594"
FT   CDS_pept        428522..429472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3594"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   bur:Bcep18194_B1834 protein of unknown function DUF344"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3594"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89148"
FT                   /db_xref="GOA:Q0B9M5"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9M5"
FT                   /protein_id="ABI89148.1"
FT                   /translation="MEDNDTRTETDDLTDMASGESRRHHFEEDLVDAYDEELEMELDDR
FT                   RFDSGEDLLFSPERREARKQYFRELFRLQGELVKLQDWVVSTGHRLVVIFEGRDAAGKG
FT                   GAIKRITQRLNPRVCRVAALPAPNNRERTQWYFQRYVAHLPAGGEIVLFDRSWYNRAGV
FT                   ERVMNFCTDDEYEEFFRSVPEFEKMLARSGIQIVKYWFSITDREQEVRFQNRIQDPLKQ
FT                   WKLSPMDLESRRRWEAYTAAKEEMLQRTHIPEAPWWVVQAVDKKRARLNCISHLLTQVP
FT                   YHEVPRPTIDLPQREHHEDYIRRPVPDSMIVPDVY"
FT   gene            complement(429528..429815)
FT                   /locus_tag="Bamb_3595"
FT   CDS_pept        complement(429528..429815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3595"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: bur:Bcep18194_B1833 histone-like
FT                   nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3595"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89149"
FT                   /db_xref="GOA:Q0B9M4"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9M4"
FT                   /protein_id="ABI89149.1"
FT                   /translation="MQLQELQAQLAELDRRIQTARRRERDAALVQVRQLVKDYALTARE
FT                   IFGQGYSDRAKLFTIGAKYRDPATGATWSGRGREPAWIAGRDRAAFLIRE"
FT   gene            complement(430012..430599)
FT                   /locus_tag="Bamb_3596"
FT   CDS_pept        complement(430012..430599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3596"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; KEGG:
FT                   bur:Bcep18194_B1832 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3596"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89150"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9M3"
FT                   /protein_id="ABI89150.1"
FT                   /translation="MSYSLATEYTRELEIRKSRFIAHAIPVDDRDAAMQALQRLRDAHP
FT                   AATHVCWALLAGGQSGMSDDGEPSGTAGRPILEVLRHHDLDGVLGAVVRYYGGVKLGAG
FT                   GLVRAYTDAIASALLDAERVERIRHTRFAIEIGYPDEARVRRWIEQAGYELADSAYGMT
FT                   VKLVIKLPETAEGAAKAELFDLTQGRSGFPDL"
FT   gene            430904..431599
FT                   /locus_tag="Bamb_3597"
FT   CDS_pept        430904..431599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3597"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS00799 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3597"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89151"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9M2"
FT                   /protein_id="ABI89151.1"
FT                   /translation="MADLHWTMPIARWTSISTAGVPGVEALDPMVRRRLSRLSRLALQA
FT                   AYDCAGAENPLRMVFASRHGELTRTTGILSDIGAAEPVSPTAFSLSVLNAVTGIFGIAR
FT                   RDRSPATAIAAGHETLGYALLEAFSQYDTSPASPVLLVHAHEPADAVYGDIDDDPESVG
FT                   LAVLLGADEPVGYLSCEMAVDGASDTHVADDAANTQSAAVLRCLSARTTASWRGEHAFW
FT                   RWSWHDRAA"
FT   gene            431583..432377
FT                   /locus_tag="Bamb_3598"
FT   CDS_pept        431583..432377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3598"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   rso:RS00796 putative 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase alpha transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3598"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89152"
FT                   /db_xref="GOA:Q0B9M1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9M1"
FT                   /protein_id="ABI89152.1"
FT                   /translation="MIARLDYGWRLFATGMSLAFFAFCGSVFSVLAIVVGALWPHRRSR
FT                   QRCVTLVIHHFFRVLVALLQRMGVMKLELSGVERLANGGPAIVVANHPTWLDVMVLLSL
FT                   TPKACCVVKRGHWGNPCFWGIVRAAEYVSNADAVGLVEAGARQLAAGYTMIVFPEGTRS
FT                   PGDNRLHAFSRGFAHMALQSRSRIQPVLIDCDPPVFTKTLQWYHVPSRAFRMRIDVLEP
FT                   MDPNRLASDVTSPSIAARSIAREVEGHITQSLFQHGYFKTAN"
FT   sig_peptide     431583..431672
FT                   /locus_tag="Bamb_3598"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.988) with cleavage site probability 0.659 at
FT                   residue 30"
FT   gene            432352..432657
FT                   /locus_tag="Bamb_3599"
FT   CDS_pept        432352..432657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3599"
FT                   /product="putative acyl-carrier-protein"
FT                   /note="KEGG: rso:RS00794 putative acyl-carrier-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3599"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89153"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9M0"
FT                   /protein_id="ABI89153.1"
FT                   /translation="MDTLKLQIKQLLIEMLDLSDMTVDDIDDDAPLFSTDGIGLDSVDA
FT                   LEVGIMLRKKFQLTIAANDERTKAHFRSINTLAAFIAEQQSHQASQEAVLEKGSHS"
FT   gene            432654..432902
FT                   /locus_tag="Bamb_3600"
FT   CDS_pept        432654..432902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3600"
FT                   /product="phosphopantetheine-binding protein"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG: rso:RS00792
FT                   putative acyl-carrier-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3600"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89154"
FT                   /db_xref="GOA:Q0B9L9"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9L9"
FT                   /protein_id="ABI89154.1"
FT                   /translation="MTDAEILERIRAIFHENFAIEPERVTPETHLFEELDLDSIDAVDL
FT                   AIKLQEMTGKRIKPEEFKSVRTVGDVIAAVHALLARA"
FT   gene            432899..433540
FT                   /locus_tag="Bamb_3601"
FT   CDS_pept        432899..433540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3601"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS00790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3601"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89155"
FT                   /db_xref="GOA:Q0B9L8"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9L8"
FT                   /protein_id="ABI89155.1"
FT                   /translation="MTMAMTGTRATTGTGLPRWASVAARAVLFVAYPLVILFAWQSMSP
FT                   RYVGCLLFALLWLQRTVGKGTLTKALRRLTTLDWCVAGALTALSVAIAVTDSERLLHLY
FT                   PACVSAGLLVAFGATLRRGPTMIEKFARSTYPEPSPEIVRYTRRVTQVWCVFFIVNGGF
FT                   SVYTALYWSRASWALYNGFVAYLLIGALLAGEWLWRSVVIAPRRKRTGVA"
FT   gene            433537..435228
FT                   /locus_tag="Bamb_3602"
FT   CDS_pept        433537..435228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3602"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase;
FT                   Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase,
FT                   FabA/FabZ; KEGG: rso:RS00787 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3602"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89156"
FT                   /db_xref="GOA:Q0B9L7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9L7"
FT                   /protein_id="ABI89156.1"
FT                   /translation="MIALHEMLCAAADSETTVCRDGADALTLGDWRARVDAIARTLDAS
FT                   GARRVAICTDDPYDFACAFFAVAAVQGEIVIPASNAPGYLGDLAHAYDLVLDAPALAAC
FT                   GHGTEREPAISVRPIDATAPVTLYTSGSSGIAKPVRKSLAQLDAEVRTLQREWADRIGA
FT                   AVTLSSVPHHHIYGLLFRILWPLAAGRAFDRAAVLEPLQLQQRLVEYGGGVVVSTPSQL
FT                   MRWPALSGFPMQAPAPCAFFSSGGPLPADAAAAYANAFGAAPLEIFGSTETGGIAWRRQ
FT                   DVSHAWQPLKGVDVRCDDEGVLCVRSAHLGHDRWHRTDDTARFDALGRFALAGRRDRVI
FT                   KLDGKRVSLPELETRILAHEYVEQAAAVVVDGATRPHVGVVAVLSAAGRDALAEHGRIA
FT                   VATTLRHALGAYFDAAALPRYWRFRHAMPFDVRGKLPAAALAAAFTATPEGFELLASWR
FT                   SDDALHYELRVPPTLAHFDGHFPGLPILPGVVQIDWAARLAGREMPAVREIRSIEHLKF
FT                   KAPVPPGAVLALRLAHDPVRGHTRFAFRCGGRECTSGVLVYGAAAA"
FT   gene            435225..436931
FT                   /locus_tag="Bamb_3603"
FT   CDS_pept        435225..436931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3603"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; lipid A
FT                   biosynthesis acyltransferase; KEGG: rso:RS00785
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3603"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89157"
FT                   /db_xref="GOA:Q0B9L6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9L6"
FT                   /protein_id="ABI89157.1"
FT                   /translation="MSDTCIVIPIYNHRDAIGGTLARLVVHGLPILVVDDGSDEPTRRV
FT                   LATLAAQYADSVTLLRLPVNGGKGAAVMAGMRAARARGYRHAIQIDADGQHDADDVPKF
FT                   VAAAQAEPDAVILGRPRFDDSVPKARLYGRYLTHVWVWIETLSLDIPDAMCGFRLYPVD
FT                   AVCELIDTVSMPTRMAFDSEILVRLHWRGLAFRTIATRVVYPADGVSHFDVWRDNVRIS
FT                   ASHTRLVAGMLVRAPMLLTRRLIGRRAAPPTARTRAWWRMPERGSRIGMALLALSCRWF
FT                   GKDFTSLWLHPIVGYFVLTNRTARTASHAYIARLRDAQAAAVPKPGWRSAYRHMLAFAQ
FT                   AGFDKFVAWSGRLDELDVRFDDSSAFDALAASGRGALVIGAHLGNLEMTRALALRDAHT
FT                   KVTAIVYTEHAKRFTGVLAGANQAFGKQLVEVSDFGPDTAMMMQSRIDAGELLVIVGDR
FT                   VPPHDSGKTVDARFLDAQAPFAQGPYILAHALGCPVYLFFCLKEQRGYRLYFESFADRI
FT                   ELPRRERASHVAQWAQRYAARLEHYCRKAPYQWFNFFDFWARPDGGPRGRA"
FT   gene            436918..438540
FT                   /locus_tag="Bamb_3604"
FT   CDS_pept        436918..438540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3604"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="PFAM: phenylalanine/histidine ammonia-lyase; KEGG:
FT                   rso:RSp0365 probable histidine ammonia-lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3604"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89158"
FT                   /db_xref="GOA:Q0B9L5"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9L5"
FT                   /protein_id="ABI89158.1"
FT                   /translation="MAEHDMKNVPATAAAHASRPAVVIGDRHLTIEDVVAIARDGAPVA
FT                   LNAASAWRSRIERGATWLRDYLANGGTLYGVTTGYGDACVVEVPPSLVEALPLQLTRYH
FT                   GCGMGDWFDATQTLSIIVARLNSLAFGYSGVRFTLLERLADLVNHRILPRIPSEGSVGA
FT                   SGDLTPLSYVAAALVGERTVSFAGDERDARDVWRAIDRAPLTLAPKEGLALMNGTAVMT
FT                   GLACLAFARAEHLTSMAARLTALTTVALDGRAGHFDARLFDAKPHAGQGEAAAWIRADL
FT                   AGRDESPGRRLQDRYSVRCAPHVIGVARDALSWMRRDIENELNSANDNPLIDPDEGCVL
FT                   HGGNFYGGHIAFAMDALKTAVANLADLMDRQLALLVDDKFSNGLPRNLTGATGERAAIN
FT                   HGFKAVQISSSAWTAEALKHTMPASVFSRSTESHNQDKVSMGTIAARDCLRVLALTEQV
FT                   AAAHVLATVQAVRLRLRDDPRTQLSPALRAFIDDVGRHSPLVVEDRPLEAELRALTARL
FT                   AACEPIGEPIGGSFGACRRGEAA"
FT   gene            438537..438965
FT                   /locus_tag="Bamb_3605"
FT   CDS_pept        438537..438965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3605"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   rso:RS00778 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3605"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89159"
FT                   /db_xref="GOA:Q0B9L4"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9L4"
FT                   /protein_id="ABI89159.1"
FT                   /translation="MNENRPPLTATARVEVLFHDVDAMNVCWHGHYLKYFESSRAALLR
FT                   MIDYDYPAMLASGYVWPVVEAHLKYVRPAHYSQQLDVRATLLEFENRLKIGYEIVDAAS
FT                   GERLTKGYTVQLAIDATTRELQFVSPPALIERVRAQWA"
FT   gene            438956..439633
FT                   /locus_tag="Bamb_3606"
FT   CDS_pept        438956..439633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3606"
FT                   /product="conserved hypothetical signal peptide protein"
FT                   /note="KEGG: rso:RS00776 hypothetical signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3606"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89160"
FT                   /db_xref="GOA:Q0B9L3"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9L3"
FT                   /protein_id="ABI89160.1"
FT                   /translation="MGLTLRYRRFAATMLGAWMMLAGGELAAAPTPAAAAAAARPANAA
FT                   LVADVAARLARVGAIRSDFRQTQTLSAMKQPLVSTGSMLFDRRSGVVWRIDTPYKATYV
FT                   ITDGGMREVGADGRLVAPGGGGRGVAQVSRMMRDVLGGDLSALYAQFDVEASGTPERWR
FT                   MVLRPNQPQLAQAIRVLEMSGGAYLGKLDMTFANGNVTVLEFVRPTPVDAPAPIERGWL
FT                   EAR"
FT   sig_peptide     438956..439039
FT                   /locus_tag="Bamb_3606"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.596 at
FT                   residue 28"
FT   gene            439630..442041
FT                   /locus_tag="Bamb_3607"
FT   CDS_pept        439630..442041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3607"
FT                   /product="putative lipoprotein transmembrane"
FT                   /note="KEGG: rso:RS00775 probable lipoprotein
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3607"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89161"
FT                   /db_xref="GOA:Q0B9L2"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9L2"
FT                   /protein_id="ABI89161.1"
FT                   /translation="MMNTARDAIDASGDRGRRRVLCAAWLTVALVAIAFIVWRFSGPAP
FT                   LQTNLLALLPATEANPVAERAVDVLGDVLGNRTVYLVTDRDADRAKSAAKQFGARLAAS
FT                   GAFRSVTVEVPPFDLSQIAATYLPARFGLLTDADRRSLEQGDAALGERLVRRLYAPPVD
FT                   GLQTAVADDPFGWLQHWLGELPLAASNLSLEDGVLVSHRAGATGVLVMTSLAGSAYESG
FT                   VQHAVRVATADAERALAADFRGVRVDRAGAVFYAEAARASAERDVHVIGAVSLAGIALL
FT                   LMSVFRSPRLLVLAFASTAFGIVCALAATLLVFGKLHLLTLVFGVSLIGEAVDYSIQYF
FT                   VAYLSAGRQWDARRGAAAVRPALAVALATSLLGYAILMWVPFPALKQIACFAIVGILSA
FT                   FAAVTGFLPLMLIQPPRSAPSRVFSCAARLLSGWQSLLAGRRAVAAAVLVALVAIPGWV
FT                   VLKSDDDIHLLIQRDAGLARQESNIRAAVGLANTAQFFVVQGASQEEVLERSEALLGAL
FT                   DQQRVGRVQSIATFVPSAKQQARNRAVLGTHVFADAAALRATLAHAGFRDEVADAWLRA
FT                   YSVDAPATLSVDTWLAARWSAPFRHLWLGRVDGATGPVDAALAIPERVDAANAATFAAL
FT                   ARTLPGVSWVDKAASVSSLFGAYRVDSGLWLAGALIVVAALLMWRYGMRGGIATTLPVV
FT                   FAIALTLAAFGYAGVPLTLFNWLALMLVLGVGANYAVFLREGCMRDAAGLGAVWTGVLL
FT                   SAATTLLSFGMLGASAMPALRSFGTTLAMGIVFSVLFAPLATPSTKEGRA"
FT   gene            442038..443225
FT                   /locus_tag="Bamb_3608"
FT   CDS_pept        442038..443225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3608"
FT                   /product="beta-ketoacyl synthase"
FT                   /note="PFAM: beta-ketoacyl synthase; KEGG: rso:RS00773
FT                   3-oxoacyl-(acyl carrier protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3608"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89162"
FT                   /db_xref="GOA:Q0B9L1"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9L1"
FT                   /protein_id="ABI89162.1"
FT                   /translation="MNARLTPVYLSAPGMINALGATTDEIVDALHAGVAPGMAPRTDGV
FT                   AGGWIGSVRAALDVAPPTSLAHFDCRNNRLLLAALAQIGPFVDAAIARYGPRRIGVVIG
FT                   TSTSGIQAAEHALAQRAATGTMPAAFDYRQMEIGTAAPFVRAVLGVAGPAYTLSTACTS
FT                   SAKAFAAARRLLRLKLCDAVVVGGADSLCELTLQGFASLESVSPGRTNPMSRNRNGITI
FT                   GEGAALFVMSRDEAAVRLAGVGESSDAHHISAPDPAGCGAEDALRAALADAGVASSAVG
FT                   YVNLHATATRLNDEMEANVMARVFPHGVPASGTKPLTGHMLGAAGATELGFGWLTLARG
FT                   IALPTHVWDGERDPALPGLDLVDREHRLAGAATGRYVMSNSFAFGGSNASLILGG"
FT   sig_peptide     442038..442100
FT                   /locus_tag="Bamb_3608"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.744) with cleavage site probability 0.715 at
FT                   residue 21"
FT   gene            443227..443730
FT                   /locus_tag="Bamb_3609"
FT   CDS_pept        443227..443730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3609"
FT                   /product="Beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase, FabA/FabZ"
FT                   /note="PFAM: Beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase, FabA/FabZ; KEGG: rso:RS00772 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3609"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89163"
FT                   /db_xref="InterPro:IPR016776"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9L0"
FT                   /protein_id="ABI89163.1"
FT                   /translation="MDAAPLIDALHGGADIPVGDVRDVLPHRGTMLLLDAIERCSETGI
FT                   EVSALARRDAWYVDGNGAMPAWIGIELMAQAIAAHVGLLAAHAGGRAKPGVLLGANRYL
FT                   AHRTAFGADTTLRIVARELLRGDEGHGAYECAIHADGECCAEAVVKVYQPNDFQSFIEG
FT                   SFNS"
FT   gene            443727..444452
FT                   /locus_tag="Bamb_3610"
FT   CDS_pept        443727..444452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3610"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase,
FT                   putative"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) reductase,
FT                   putative; PFAM: short-chain dehydrogenase/reductase SDR;
FT                   KEGG: rso:RSp0359 3-ketoacyl-(acyl-carrier-protein)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3610"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89164"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011285"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9K9"
FT                   /protein_id="ABI89164.1"
FT                   /translation="MTRRVLVTGASRGIGRAVALRAASDGFAVTVHCRTGRDDAEAVAA
FT                   TIRSQGGTASVLQFDVRDRAACRQQLEADVEANGAYYGIVCCAGVTRDGAFPALSEEDW
FT                   DIVIETGLDAFYNVVHPLTMPMVRLRGGGRIVTIASVSGVMGNRGQVNYSAAKAGLIGA
FT                   TKALAIELASRKITVNCVAPGLVDTGMLDEVPLEHALKTVPMGRVGQPDEVAAVVGFLM
FT                   SDAASYVTRQVIGVNGGMV"
FT   gene            444452..445681
FT                   /locus_tag="Bamb_3611"
FT   CDS_pept        444452..445681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3611"
FT                   /product="beta-ketoacyl synthase"
FT                   /note="PFAM: beta-ketoacyl synthase; KEGG: rso:RSp0358
FT                   putative 3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3611"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89165"
FT                   /db_xref="GOA:Q0B9K8"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9K8"
FT                   /protein_id="ABI89165.1"
FT                   /translation="MKRVVVTGMGGVTAFGQRWTEIEARLRDGRNAVRRMPEWDCFEAL
FT                   HTRLACPLPAFELPPTYPRKKTRSMGPVSMYAVRASELALEDAGLSDDASIRDGRMGVA
FT                   YGSSSGSVEPIRAFGTMLETGSMRDVTSNSYVQMMPHTTAVNVSLFWDLKGRIVPTSSA
FT                   CASGSQAIGYAYEAIATGKQALMLAGGAEELSGPAVAVFDTLYATSTRNDAAHLTPRPF
FT                   DADRDGLVVGEGAATLVLEEYEHALARGATIHAEIVGFGCNSDGAHITQPTAETMAVAM
FT                   RLALSDATLDADAIGYVNAHGTSTDRGDVAESHATASVFGERMPISSLKSYVGHTLGAC
FT                   GALEAWWTIEMMKRNWYAPTLNLTKVDPACAPLDYIIGDARRIDAEFVMSNNFAFGGIN
FT                   TSLIFRRIGA"
FT   gene            445678..446916
FT                   /locus_tag="Bamb_3612"
FT   CDS_pept        445678..446916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3612"
FT                   /product="beta-ketoacyl synthase"
FT                   /note="PFAM: beta-ketoacyl synthase; KEGG: rso:RSp0357
FT                   probable 3-oxoacyl-[acyl-carrier-protein] synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3612"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89166"
FT                   /db_xref="GOA:Q0B9K7"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9K7"
FT                   /protein_id="ABI89166.1"
FT                   /translation="MTAGGSAATRVVVTGLGIVSCLGNSLAEVSDALRTGRSGVSRVDA
FT                   WRERGFRSQVAGVASVASAARFARKHERFMGDTARFAAHAAASALDDAGLDAGMLRSPR
FT                   AGAIIGSGIGSIADYDDAMEIARHRGIEKTPPYVVPKAMSSTASACVAQLFGIEGVSYS
FT                   PSSACTSAALAIGQAAHWIRSGYQDIVLAGGSEALHDNMTLMFDAMGALSSGFNDTPER
FT                   ASRPYALGRDGFVIASGAGILVLESLEHARARGARIYAEISGFGQATDNAGMAAPHAPG
FT                   IARAMRGALDGSGRRPDYVNTHAPSTPLGDTEELEALRDVFGGDVPAFSSTKGLTGHPL
FT                   GASGAHEAIYTILMMRDGFVAGTAVGLEPDPAVAGMPLVRTVRECSIERALSVSFGFGG
FT                   SCASVLLDAWKGD"
FT   gene            446949..447374
FT                   /locus_tag="Bamb_3613"
FT   CDS_pept        446949..447374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3613"
FT                   /product="conserved hypothetical signal peptide protein"
FT                   /note="KEGG: rso:RS00762 hypothetical signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3613"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89167"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9K6"
FT                   /protein_id="ABI89167.1"
FT                   /translation="MKHKGHLAGMLVAASLLTGCGTVVRSLPLPAAATTSDTSGVAIYF
FT                   GTQPHPDVKTSIGPRSESVRVSRGTQAEQPTCDQALAEALNRLRIYAKNHGGNAVVNVT
FT                   TRFHEKRSESTSEYTCGVSGSAGAIAVSGDVVQLNAQ"
FT   sig_peptide     446949..447050
FT                   /locus_tag="Bamb_3613"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.996) with cleavage site probability 0.890 at
FT                   residue 34"
FT   gene            447386..447820
FT                   /locus_tag="Bamb_3614"
FT   CDS_pept        447386..447820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3614"
FT                   /product="excinuclease ATPase subunit"
FT                   /note="KEGG: vvu:VV12469 excinuclease ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3614"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89168"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9K5"
FT                   /protein_id="ABI89168.1"
FT                   /translation="MKYRIALALLGATFIASAAHARDTIRDYPIENALKSEEGKLDDGV
FT                   ALYFGDQSHPRVLKSYGTFATNKKTNAFGKSDEAACQHVFLSAVIELQARARKEGGNAV
FT                   VGIKSNYRNVLRSSATEFTCGAGAVVAGAALTGEIVTLKR"
FT   sig_peptide     447386..447451
FT                   /locus_tag="Bamb_3614"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(447865..448584)
FT                   /locus_tag="Bamb_3615"
FT   CDS_pept        complement(447865..448584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3615"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: rso:RS00761 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3615"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89169"
FT                   /db_xref="GOA:Q0B9K4"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9K4"
FT                   /protein_id="ABI89169.1"
FT                   /translation="MTSCRTHAPAYVPETRFGIWFLRTHTWEHHVLRVAIDDLKQLIGA
FT                   PLPKAPVILDAGCGQGKSFRLLGEAFAPGKIIGIDCHDDSLTHASEAARRCATPVELHR
FT                   ADCTQIPLADSSVDIVFCHQTFHHLVDQEHALADFRRVLKPGGLLLFAESTDAYIKSWV
FT                   IRLLFRHPMEVQKSADGYLAMLRDGGFTFDARNVSFPYLWWSRAKDFGLLERIGLYAPK
FT                   PGKRRETLVNVAARKPA"
FT   gene            448695..449942
FT                   /locus_tag="Bamb_3616"
FT   CDS_pept        448695..449942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3616"
FT                   /product="tryptophan halogenase"
FT                   /note="PFAM: monooxygenase, FAD-binding; FAD dependent
FT                   oxidoreductase; tryptophan halogenase; KEGG: rso:RS00759
FT                   putative oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3616"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89170"
FT                   /db_xref="GOA:Q0B9K3"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9K3"
FT                   /protein_id="ABI89170.1"
FT                   /translation="MSEMKSNSVDVAIIGAGPSGAVAAALLRRAGRSVLVLERQHFPRF
FT                   SIGESLLPQSMQYLEEAGMLQAVVEAGFQFKNGAYFVYRDRMSSFDFREKFSDGWGTAY
FT                   QVERAAFDDLLIRCAADQGADVRFGHTVQAFHPGDMQRLEVVDEAGCEYSVHASFVLDA
FT                   SGFARVLPRLLDLEAPTGMPTRAAIFSHVEDSLPAGSTDRDKICIAVHPARRDVWFWMI
FT                   PLTNGRSSVGCVADAGFLDVPQAQQESLLRELLQSEPTLSRLVGSKPFVMLVRRIAGYA
FT                   SNVEHLHGRGYALLGNAGEFLDPIFSSGVTIAMRSAQLAVAVLERQLRGETVDWTHDYD
FT                   IALRKGIDTFRAFVERWYSGALQDIVFHEDKASDVKRMVCSILAGYAWDESNPFVREPA
FT                   RGLDVLAEFCRAGGLG"
FT   sig_peptide     448695..448766
FT                   /locus_tag="Bamb_3616"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.676) with cleavage site probability 0.542 at
FT                   residue 24"
FT   gene            complement(450008..452209)
FT                   /locus_tag="Bamb_3617"
FT   CDS_pept        complement(450008..452209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3617"
FT                   /product="Beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="PFAM: glycoside hydrolase, family 3 domain protein;
FT                   KEGG: bur:Bcep18194_B1822 beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3617"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89171"
FT                   /db_xref="GOA:Q0B9K2"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9K2"
FT                   /protein_id="ABI89171.1"
FT                   /translation="MRDTLWPAAVLAATLCTSVYAGNADFNSPGDAADAFASSAAQRRA
FT                   DLLVRKMTLDEKLQFIHSQYEMSKVPGGGAGYIQGVPRLGIPDLNMVDSATGSGSTSLA
FT                   STTFPATIAVAASWDRRLSYDYGKQVAIQLRAQGFGMGLAGGTNLAREPRGGRLFEYLG
FT                   EDPLLAGDLLAERTLATQRQKVIATIKHYAGNEQEHGRMGGNTQIDERTLRELYLLPFE
FT                   IAAKRGQPGSVMCSYNRLNGTYACENNHLLNDVLKNEWGFQGQVQSDWGAAHSTAASIN
FT                   AGLDEEEDVGPSVYLTPAAVKQAISNGSVSTARLDDMVRRKLAVMIRVGVMDDPAKAGG
FT                   TIDFAAANRFAQGVAEQSIVLLKNDGNQLPLVASALSRIAVIGGHADAAVLSGGGSGNT
FT                   RDPVTGSFAGCGGLTFGSSTGCSWWRNPWLKVDVPIVAAIRALAPAAQVTFAGNSDQQS
FT                   PFRAYTQQEIDQAAALAARSDVAIVVVAQAAGEDFGELQSLSLANPSNQDALVEAVARA
FT                   NPHTVVVVQSGNPVLMPWKDRVSAIVEAWYPGEGGGKAIANVLFGAVNPSGKLPVTFPA
FT                   RDEDSPAWRQGGAFENDPVYSEKLNMGYRWYDARNIKPMYEFGYGLSYTHFAYSGLSVS
FT                   RQRDGSLSVAFTVRNDGRVAGAETPQVYLGVPYKDEPPKRLVGWEKIRLNPGEARHVRV
FT                   TVSPRMQSVWDTSRNGWKFVPGGTVYVGASSRDIRLQGS"
FT   sig_peptide     complement(452144..452209)
FT                   /locus_tag="Bamb_3617"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.936 at
FT                   residue 22"
FT   gene            complement(452666..453925)
FT                   /locus_tag="Bamb_3618"
FT   CDS_pept        complement(452666..453925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3618"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   bur:Bcep18194_B1820 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3618"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89172"
FT                   /db_xref="GOA:Q0B9K1"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9K1"
FT                   /protein_id="ABI89172.1"
FT                   /translation="MSNIKKNFLLLLTLQISMYAVPLLIAPLLTHALGPEGYGQLAFSL
FT                   AVIAYLTNCTSYSFDLTATPRIALARDDRAERSRIFWATLYAQIGIAAICFVVLIALTF
FT                   LVERFGEDRDLLLIGFGMVAGVAFTPGWYFQGMEKLRALSVILFVGRILSLPAMFALVH
FT                   SPADIDRAMIVNAAVPTLSAIVLAAYLYFQREIDFVRVGIADIAESLKGGWQVFLASTS
FT                   IAFYASTNTVLLGFVSGNVAAGYFAAGDKLIRAALSMLQPLKAATYPRISYLMRHARND
FT                   AFSFLRKLFVVQVVMVLGISLAIFFGAPLAVRLLYGPSYEPTVQVLRWMAFIPFMAGMT
FT                   DLFGVQTMLPLGMKSAFTRILMSSGILNIVLVPVLAKYFAELGAAAAVLTAEAAVAAAL
FT                   ATVVYRAGIPLLGSAVARRS"
FT   sig_peptide     complement(453827..453925)
FT                   /locus_tag="Bamb_3618"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.955) with cleavage site probability 0.929 at
FT                   residue 33"
FT   gene            454505..456361
FT                   /locus_tag="Bamb_3619"
FT   CDS_pept        454505..456361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3619"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1819 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3619"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89173"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9K0"
FT                   /protein_id="ABI89173.1"
FT                   /translation="MKPITFGSCVGWLHEGQTTQGVILCESLGHEASWTHKLMRAIAER
FT                   LARDGVTVLRFNYPCTGDSAGDDRDAGRHAACIASIHDAIDLLRDQAGVTALTLVGIRA
FT                   GALFAMLAAAGMGSRESPRVDALVALAPVVRGRAYLRELSFVHRQWLDTTSPAIRAAHR
FT                   DEPCMNVLGHRFPADFVDALKALDLCDVVRDAPTLPGAMLLIQPDQGDGPALRDALLAR
FT                   GVDVTSDPFREWTTTMLDGTRSRLPLAAIDTLANWITERAPHKLAGADTASRVDPAWNG
FT                   ESAVALDMNDMTEQVVAVGPDRLVGVLCRPADTRPAKPVGPAVVIANTSTNPRSGEGRF
FT                   SVRLARTLARAGVTTLRIDVHGVGDSGPAVTDDQSGVVYSTQSSDDVAAAADWLRALGH
FT                   PEVVAAGICSGAYAALHAALKTPSLGGVIAVNLARFVWPAGLTLDAVQKQRNNSVRGYW
FT                   LSVRDWQKWKRLVRERRDLRPIVRAVAANAIARVSVPAKALAARAGWKPRSGTPRGVMH
FT                   ELAQRNVRTTLVYGALDPGIDDVRRHFGAIEHAFRRSRHVRLYLEPEVDHAVYGAAGTD
FT                   IVIDLCMQALGHDSARPVARVADPATQEAAARSYANVSVGRS"
FT   gene            complement(456498..456968)
FT                   /locus_tag="Bamb_3620"
FT   CDS_pept        complement(456498..456968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3620"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1818 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3620"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89174"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9J9"
FT                   /protein_id="ABI89174.1"
FT                   /translation="MAVPRLPLHRTYSVRFVMNCSASLSSLVCIVSASVACAAGAQTLP
FT                   ATQADARGFASSTPLAPVPLQRSAQTAITGAAAEPATAASDVASPGAALPAASTAAAPE
FT                   SRARGALRRLLVPTRPHRPQVTDAPTEDLWHTGTLYTSPYEKTPYAQPGDPD"
FT   sig_peptide     complement(456852..456968)
FT                   /locus_tag="Bamb_3620"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.835 at
FT                   residue 39"
FT   gene            457044..458270
FT                   /locus_tag="Bamb_3621"
FT   CDS_pept        457044..458270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3621"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein; KEGG:
FT                   bur:Bcep18194_B1817 polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3621"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89175"
FT                   /db_xref="GOA:Q0B9J8"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9J8"
FT                   /protein_id="ABI89175.1"
FT                   /translation="MSITTQPESTLGTPRSPTAGIRRAPWLSRMAIVAAACALSACALS
FT                   PGMSYRAPAARDANARVSADASGSGGLDGVQNVSSEDLIEITPAFVAQQHSGQRADVDA
FT                   EIRQLFGKPRPYAIGPGDVLGIVVWDHPELNLPTTQTTGGGDGVGASSVATGYTVDANG
FT                   NVQFAYAGLVHVAGLTEAQARALLTKRLGEYVRKPQIALRVQTYRSKRVYLDGEVRTPG
FT                   LQIVNDMPMTLPEAIDRAGGFTPTADRSQVAVTRGDRTVNVSLPALIAAGVNPSNILLR
FT                   DGDLVRVRAASDAKVFVLGEVSRPATLTLTDGRMSLGEALGDTGGVSQYTSDARQVFVV
FT                   RRGPDNRPRVYHLDGSSPASFALADQFPLQRRDVVFVDASSLVRWSRVVNLLIPSSAQG
FT                   ALTARAISP"
FT   gene            458329..460611
FT                   /locus_tag="Bamb_3622"
FT   CDS_pept        458329..460611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3622"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1816 protein-tyrosine kinase;
FT                   PFAM: lipopolysaccharide biosynthesis; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3622"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89176"
FT                   /db_xref="GOA:Q0B9J7"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9J7"
FT                   /protein_id="ABI89176.1"
FT                   /translation="MTSSTLPDPPSGPALRPSYPVRRYWGMLYGGRRLILCTALAGALV
FT                   GAVYALCAAPVYRTDILFQVEQSPTDSKQTSPPGDPSAVFDLKTDASTEIEVLKSRAVL
FT                   DRAIDSTNLAVDARPHYLPLIGWRFVNAADGLSSPLPGGYVYGTERIDVPTFDVPKRLL
FT                   GKRFALTLGDDGVYTLQRTGWFGRKGPVWQGRIGQPLHVDTPQGPLDIFVRDVAGKPGA
FT                   RFDLTRYSDEEATVWLQKNALISERGKQSNMIGVTLDGIDPVHDSRVLNAIGDAYLAQN
FT                   TQRKSEAADKLIRFMDTQLPQLKAQLEQAENRFNAFRASHGTVNTSDEALALRQQSVDI
FT                   ETRVQTLQQRREELLTRFMPKHPALVAVDAQLADAQHSLDTTRKQIQQLPTVEQGVLQL
FT                   QRDVAVDTALYTNLLNTRQQMILARASKTGTVRIVDTAKVAEEPIGPHRGVAVIALLML
FT                   GLLAGAAIVIVRQRVVGTIGDAEEIEWTTGLPVFATVPHSAVAVQAESRPKAGRRGTRA
FT                   PMPPIDAQDAHDAALEGLRNFRAALQLSMPDASNPVVLISGPTTGVGKSFVAANIASLV
FT                   GAAKRRVLLIDADLRKGSQHERFRHSRAPGLSDVVAGTHGLAETIRRGVAPGLDFIAMG
FT                   SIVPDPGELLLQPALAALIEQVAARYDMVVIDGPPLLPVADALVLGRLAGTVFLVARSG
FT                   VTTLTELEESARRLEHAHIDVCGVVLNDYQGAPGRYDYGYKDANTHQAASGYTEGIASR
FT                   QRVERAS"
FT   gene            460608..462020
FT                   /locus_tag="Bamb_3623"
FT   CDS_pept        460608..462020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3623"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1815 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3623"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89177"
FT                   /db_xref="GOA:Q0B9J6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9J6"
FT                   /protein_id="ABI89177.1"
FT                   /translation="MSRRAGGAGCGPRRRAATTRTAARVRGAAAGDMGGYTGYWWEDPA
FT                   RLVLMFILPLYGMLSLSLLGDPKAIARVYFDGYYAFVGALFLMVVMAAAWLATAEARTR
FT                   RGPPPAAVELSPRVLDFVFALALFGYVLLLSGILMHPALLVAFVRGDANAYDMLELKGR
FT                   ITGLSTLTQATAPFVVLYFYVFRTPVKGLNRYKIYFAVLAVLTLMRSFIFAERLALIEM
FT                   VMPLALMVVRFRLGGRYSRLLTLGPYAAIPLLFGLFIANEYNRSWEAYYVNIYDNLFDF
FT                   ALERLGLYYSTSLNNGAGILSVLGWDHGHPMFTFDWLLRFPLIGATLQPWLDSGDSINL
FT                   FLNGYADPEFNNPSGIFVHFYEWGWFGLLDALVLGWAVGRSYAGWRSGNGFWCCIHAVL
FT                   YVSVMEVMRTPNLFSGRNFVPVVLLIAIFQWFAKAPARAAPAAGGGADGDGNRRGVARG
FT                   NRAADVDPVLSR"
FT   gene            462046..463215
FT                   /locus_tag="Bamb_3624"
FT   CDS_pept        462046..463215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3624"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: bth:BT2367
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3624"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89178"
FT                   /db_xref="GOA:Q0B9J5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9J5"
FT                   /protein_id="ABI89178.1"
FT                   /translation="MATHKQKFEILDGLRGIAAISVMLMHFLQDLPIPILQSAYLSVDV
FT                   FFMLSGFILTYSYGEKLRQASWRGEYVKRRVIRLYPMICIGLTIGVVSLVVMRVNASAA
FT                   FSFGNLAAATGQNYFLVPYLGRFSVSGFVGATNHGLQAVDDPGVFPLNPPAWSLFFELF
FT                   ASVVLIAAVRMKEQSLLRLAYACLGAFVAYGWLVGLDHDKVTVILNQGWAADNFFGGFF
FT                   RVGYGFLLGVAIAKMHDAGLPARPHWFAAGLVRNDWMLFAVFLLVVLFPTSIKGIYALA
FT                   VLSFVAPALVYRGAMLAPSGNAVARISAFLGWISYPLYCVHYPIGRLVFAYAPQGDIHV
FT                   VRTAMLAACLSIVSAAFLAKFVEEPIRSYLGKRLFGNQPAATGSTVNVA"
FT   gene            complement(463246..464322)
FT                   /locus_tag="Bamb_3625"
FT   CDS_pept        complement(463246..464322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3625"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   bps:BPSL0620 glycosyl transferase group 1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3625"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89179"
FT                   /db_xref="GOA:Q0B9J4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9J4"
FT                   /protein_id="ABI89179.1"
FT                   /translation="MIASKSKQLVYNGRFTTQKTTGVQRVARELIAALIKFQPQDPVTV
FT                   LVPPRPGVAVSGAKTVEVGFYKGVVWEQLILPLFARRGRIVNLGNSASIFLGNQIIYMH
FT                   DAAVFDTPAHFSRPFRVWYRIMFWILARTSVCVLTNSRFSRDRLAHHCGVSAEKIRVVP
FT                   LGADHLDALEPDTSVLDKHALTPDRFVLAVSSMNPTKNFGRLIAAFRQIGDPSVDLVIV
FT                   GMQNTTVFGKHDPVGAPEPNIKYVGYISDEQLKALYQNAACFLYPSIYEGFGIPPLEAM
FT                   RYGCPALVGKSAALPEVCADAALYCDPYSQDDIARKLRSLLDSPELRAELKRKGIAHAE
FT                   QYRWSRSAEMMKAIFETL"
FT   gene            complement(464350..465531)
FT                   /locus_tag="Bamb_3626"
FT   CDS_pept        complement(464350..465531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3626"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   bps:BPSL2773 putative glycosyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3626"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89180"
FT                   /db_xref="GOA:Q0B9J3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9J3"
FT                   /protein_id="ABI89180.1"
FT                   /translation="MTDAIGSLDPKMTTEKIVHIAEAFGGGVLSMLTHLANHAAATGAD
FT                   VTVLHSVRAETPADFSTLFRPDVKLVHVDMVREVSVAHDLRSLRALIHNLRDCQPTAIH
FT                   LHSSKAGVLGRVAARIAAPNATVLYSPHGLSFLRCDVSRMKQFAYLSFERIAARIGGTV
FT                   VACSGSELGEIRRKVRPKSAVLVENGVHVAEIPPRRTRDDRKVVIGMSGRASFQKNHEA
FT                   FVRLANTLHGADVEFLWIGGNAAEIADPSQRSAVVCSGWVTRARALALTSELDIYVQTS
FT                   RWEGMPVALIEAQVAGIPAVVTDVVGNRDVVIHGVTGYVASNADEMSAYVAMLRDDRQL
FT                   REQMGAAARQRAIQRFSINAIFRQWNALYGLGADEPRADTRDFEPVAPDHVEA"
FT   gene            complement(465882..467021)
FT                   /locus_tag="Bamb_3627"
FT   CDS_pept        complement(465882..467021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3627"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   bur:Bcep18194_B1821 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3627"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89181"
FT                   /db_xref="GOA:Q0B9J2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9J2"
FT                   /protein_id="ABI89181.1"
FT                   /translation="MATIRRGRAPASPQGTGHPAVRSSLVQNPFMTDLTIAICNYNHGA
FT                   YLRDAIDSALAQTVHGVRVLVVDDGSTDDSRDIIHSYGERVTAVFQENRGQVAAYNRAL
FT                   EHVATRYVILLDADDLLYADAAARVLAAFASGDFVKVHFRLDVIARDGAMTGASVPQQS
FT                   VDTDCGRLLRAGWLYPSPPASGNAYRVDALKRIFPVPVTPDNLHGADFYAIYGIALLGA
FT                   VHMIDATLGGYRVHQQPDSRPVADTPALALTNSEDAATGALKAERRWATLRTLAGTRLH
FT                   EALPIAPLDFAIEKARFASTLYHAPLVRRWRWFLCESGRYWHTVLRNPFWRPAKKVAVA
FT                   GLSLACLLPSSTLSNRAIRYISNPLARVRKSSGQRVGTR"
FT   gene            467259..468533
FT                   /locus_tag="Bamb_3628"
FT   CDS_pept        467259..468533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3628"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1813 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3628"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89182"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9J1"
FT                   /protein_id="ABI89182.1"
FT                   /translation="MRRPQCSFRACALIAGMCMAGALAWPDGAAAASGALHANVPDAYV
FT                   RPAADAADQADMLQHALDALQPGQRLVFAPGRYVVGRSLVVRQPNVVVSGYGATLIATI
FT                   ADDQTVEMRGDGTTLVGFRLAGTGTTRLTTPESTKIEVTGRGVQVLDNVIDGGAGAGIF
FT                   VFGGAEVAIVGNEVLSTLADGIHMTHGSHDVLVRGNVVRGTGDDMIAVVSYQAEGVLTR
FT                   NVLITGNSLEGNPWGRGITVVGGANVTISNNIVRNVQVSAGILVAQEDSNHTYGASDVR
FT                   IENNVIADIQTATGRTDPRPITQQAAIEVSTWSGSVSRVTVIGNRVSNARFDGIRLWGN
FT                   VSGVRLADNQLSGIGGMAVRVGPGKDCASDGPSRPSANAVKEATCATARQSTATGADAL
FT                   GADPSSLPRVRETVRQARWSQRSIE"
FT   sig_peptide     467259..467333
FT                   /locus_tag="Bamb_3628"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.866 at
FT                   residue 25"
FT   gene            complement(468561..470138)
FT                   /locus_tag="Bamb_3629"
FT   CDS_pept        complement(468561..470138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3629"
FT                   /product="mannose-6-phosphate isomerase, type 2"
FT                   /EC_number="5.3.1.8"
FT                   /note="KEGG: bur:Bcep18194_B1812 mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase; TIGRFAM:
FT                   mannose-1-phosphate guanylyltransferase/mannose-6-phosphate
FT                   isomerase; PFAM: mannose-6-phosphate isomerase, type II;
FT                   Nucleotidyl transferase; Cupin 2, conserved barrel domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3629"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89183"
FT                   /db_xref="GOA:Q0B9J0"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9J0"
FT                   /protein_id="ABI89183.1"
FT                   /translation="MTTLRPVPEPELPRILPVILAGGSGTRLWPLSREQYPKQLIELTS
FT                   NESPLSATARRLNGIANASLGDTLLLVCGEQHRIMSAAQVLGRAAPARILLEPAARNTA
FT                   PALTLAALDASVLADDPVLAVMPADHVIGDVGAFHEAIGRAARYAQEGAIVTLGVLPRR
FT                   AETGYGYIQVGEPRAGRLGGQGGYTIGRFVEKPNAALAERYLHSGDYWWNSGIFVTRAS
FT                   IWLKAIRALAPDIHAACDAAWRAGIAEDPFFRIDAAAFDACPADSIDYAVMERLAESPD
FT                   LGIEGIVVPLSAGWSDVGTWDAIWEIMPKDDQGNVARGPIVFEDTQDSFVRSEGRLIAC
FT                   VGMKDVVVIETPDAVLVANKHDVQRVKNIVARLKTEQRPQASEHRKVQRPWGHYDSIDL
FT                   GERFQVKRIVVEPGKQLSLQMHYHRAEHWIVVRGTAKVTRGSDTFLLSENESTYIAVGE
FT                   VHRLENPGRIPLEIIEVQSGDYLGEDDIVRFDDRYGRPVVDSAQPAPRSPCEPDEPQEE
FT                   AAERDAVR"
FT   gene            complement(470135..470719)
FT                   /locus_tag="Bamb_3630"
FT   CDS_pept        complement(470135..470719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3630"
FT                   /product="acyltransferase-like protein"
FT                   /note="KEGG: bur:Bcep18194_B1811 acyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3630"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89184"
FT                   /db_xref="GOA:Q0B9I9"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9I9"
FT                   /protein_id="ABI89184.1"
FT                   /translation="MEWHCCEFEHLSAVDLYAILRSRNAVLVVEDAHTHLDIDGKDAHA
FT                   LHVFARMHTGDMIEVVAYARVLPGDEVDPDVVIDKVLTSEACRDDATLEQLMQRALTAA
FT                   QAAWPDVAVRTHVPAQRQAFYKRFGFRKAYGPYLEQGAPFVGLVRPADRAAGTLRKLLS
FT                   RAAPAPRPRNDDARADGRTHNRLPADTGANR"
FT   gene            complement(470946..471383)
FT                   /locus_tag="Bamb_3631"
FT   CDS_pept        complement(470946..471383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3631"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89185"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9I8"
FT                   /protein_id="ABI89185.1"
FT                   /translation="MSHRIPANRAWSLQRRNEATVHRGSATCRVVRFIAQRSMLGMHGA
FT                   RPGAPAEPTRQATRSSKYARVVPVRRNGGVRMTDLRRARKSMKRQTLVCMRQSIVCARG
FT                   GDVRPAGREQSRCSSTAPGFFNRVRCRRPVLRAEQRPVATG"
FT   gene            472006..473397
FT                   /locus_tag="Bamb_3632"
FT   CDS_pept        472006..473397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3632"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_B1809 sigma54 specific transcriptional
FT                   regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3632"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89186"
FT                   /db_xref="GOA:Q0B9I7"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9I7"
FT                   /protein_id="ABI89186.1"
FT                   /translation="MNMPITRDKSAGAGRTSGQRPLIYWTQSPSVMLRKELARRDWKVT
FT                   IVAHASELRDTSGEITCGILDLSGGHADAIGSIASTCASMRDVVWVALVETGQTASPNV
FT                   RALLRDYCFDYITLPASHQRIADTVGHAYGMECLFARDRERLESQENGIVGTCSAMLRL
FT                   FDTVRRFARTDAPVFVFGETGTGKELTAVAIHRHSERRNGPFVAVNCGAIPPHLLQSEL
FT                   FGYERGAFTGANARKAGYVEAANGGTLLLDEIGDLPHESQASLLRFLQERAIHRLGGSD
FT                   PVPVDVRIVSATHVDLREAMEEGRFRADLFHRLCVMRIDQPPLRARGKDIELLAHHMLE
FT                   RFRGDARHRVRGFSTDAITALYKHDWPGNVRELINRVRRAVVMTEGRLITAQDLELEYC
FT                   LDAASPSVADIRKSIEREAIETALLRTRGRVAASARELGVSRATLYRWMEAYGIERPRG
FT                   TGSSD"
FT   gene            complement(473450..475933)
FT                   /locus_tag="Bamb_3633"
FT   CDS_pept        complement(473450..475933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3633"
FT                   /product="Beta-mannosidase"
FT                   /EC_number="3.2.1.25"
FT                   /note="KEGG: bur:Bcep18194_B1808 beta-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3633"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89187"
FT                   /db_xref="GOA:Q0B9I6"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9I6"
FT                   /protein_id="ABI89187.1"
FT                   /translation="MTRTRAAHAAPAWSMLATAAGIVRGPLDLPADGWIAAAVPGTVAQ
FT                   ALALAGQHDDVASLDERDHWYRVELRGHGPRVLRFHGLATLADAWLDDTPILRSDSMFV
FT                   AHDVRVSLDGTHRLTVCFRALAPHLRDARASRRARWRTRLAEPATLRTVRTSLLGHMPG
FT                   WFPRCVPTGPWRPVDVLDPADGQVLVQCDLHARLDGDTGWLDAELAFAAPLPDAFAARL
FT                   SCGEHHATLERCGADRLRASVAVPNVRRWWPHTHGEPVLYDVALHIGAERRSLGATGFR
FT                   TIEPDAGDDGNGFGLRVNGVRVFARGACWSSADPLALHADDATYGRLLGHARDAGFNMI
FT                   RIGGTMTYEADAFHAWCDRLGLLVWQDFMFANFDYALDDRAFAAAVDREAEQFLTRHRA
FT                   SPSLAVLCGGSEIAQQAAMSGLAPKQRFLELTAERLAGHAAARRPDVLYVPDSPDGGAL
FT                   PFQPRERVSHYYGVGAYLRPLDDSRRADVRFASECLAFANVPCDAMLASLGWPDVHEPR
FT                   WKAAVPRDPGTSWDFDDIRDHYLQTLYDVAPDRLRREDPSRYFELSRAAIADLMRDTFA
FT                   EWRRTGSRCAGALVWQFQDVMPGAGWGLIDATHRPKSVWYALRQVLQPVQVLLVDEGLN
FT                   GLDVHVINERPAPLSAAVELVALRDGRTPVARAGGPVRIAAHDTVRLGSAELLGRFFDW
FT                   TYAYRFGPCEHDTVVATLRADDGTLLSQAFYFPSRTHPAVFARREPGIEACVSRIGDTW
FT                   YVDIDTRHVARHVQIDAPGFVPRDDWFDLAPGTPARVALVPLDDTGDRSAAGAPPTVDI
FT                   RAVNAARTVRAAPAG"
FT   sig_peptide     complement(475874..475933)
FT                   /locus_tag="Bamb_3633"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.724) with cleavage site probability 0.660 at
FT                   residue 20"
FT   gene            complement(475930..476985)
FT                   /locus_tag="Bamb_3634"
FT   CDS_pept        complement(475930..476985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3634"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1807 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3634"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89188"
FT                   /db_xref="InterPro:IPR014989"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9I5"
FT                   /protein_id="ABI89188.1"
FT                   /translation="MKFVSRDGEDASFEDVRHRARHYRPHPLHSQEMVWKQTNCYVDMW
FT                   LEVLRWWGLNPYAALPFTIALDFEGDQFTFFKFPHDELERLYGIVVQEHSIYEPLDQHI
FT                   ETQVARGHLMIVEVDAWFLPDTRGSSYRAQHTKTTIGIDAIDRMHRQIGYFHNSGYYVA
FT                   EDFDYNGLVGGSSPMPLPPYVECAKRRFAPLDERVLCEVSLASLQRHLRRLPVVNPITA
FT                   FRRQLQIDTKSLADSPLERFHAYSFNSVRQLGANFELFGHYTRWLQASGCVGPFAEIRT
FT                   ACDRIASEAMVLEFRLARACARGKEERGDATLDAIEAAYTDLIDCARQIAPPLRHALPV
FT                   RVDAAPVPVMR"
FT   gene            complement(476982..477962)
FT                   /locus_tag="Bamb_3635"
FT   CDS_pept        complement(476982..477962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3635"
FT                   /product="Seryl-tRNA synthetase-like protein"
FT                   /note="KEGG: bur:Bcep18194_B1806 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3635"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89189"
FT                   /db_xref="GOA:Q0B9I4"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9I4"
FT                   /protein_id="ABI89189.1"
FT                   /translation="MNDRLAVPSAASAASASDAPLDRAGVNPLRDELIDAGLLVSTGIQ
FT                   GLFGRSERFERVVEALDAFVTRLGADQQAEVLRFPPAMSRTEFERSEYMKSFPQLAGSV
FT                   HAFCGDEQRHQRVLQCLDRGEDWTESQKPTYVVMTPAACYPVYPVVARAGALPADGRIV
FT                   DVFSYCFRHEPSLDPTRMQLFRMREYVRIGTPEQIVAFRETWMERGTRMIEALRLPNAI
FT                   DLANDPFFGRGGKIVANSQREQNLKFELLIPIEHDDRQTACLSFNYHMDHFGLLWDIRT
FT                   ATGDVAHTGCVGFGLERLTLALFRHHGFDLDAWPQEVRDVLWGTR"
FT   sig_peptide     complement(477912..477962)
FT                   /locus_tag="Bamb_3635"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.984) with cleavage site probability 0.967 at
FT                   residue 17"
FT   gene            complement(477959..479155)
FT                   /locus_tag="Bamb_3636"
FT   CDS_pept        complement(477959..479155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3636"
FT                   /product="Acyl-CoA dehydrogenase, type 2, C-terminal domain
FT                   protein"
FT                   /note="PFAM: Acyl-CoA dehydrogenase, type 2, C-terminal
FT                   domain; KEGG: bur:Bcep18194_B1805 acyl-CoA
FT                   dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3636"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89190"
FT                   /db_xref="GOA:Q0B9I3"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9I3"
FT                   /protein_id="ABI89190.1"
FT                   /translation="MSALLPELAADDEARRLDDAAHAVAHIAAQHADTVDRDARCPVEA
FT                   IEAMRARRLLSAMVPTQLGGMGASLADIASACSILGQACASSAMVFAMHQIQVACIVNH
FT                   AADQGWHKLFLQQLVRHQWLLASATSEDGVGGNLRASQCALETHGGEFRLHKSAPTISY
FT                   GDYADGILATARRDADAPASEQVLVTLLRDGYTLTRRGEWDTLGMRGTCSNGFVLDARG
FT                   ATVQCLPVPFAQIAEQTMVPVSHILWAAVWVGVAGDAFHRAHQFFRAQARQTDGAPSPA
FT                   SRRIAESLALMQAMQARVDNVLRLHSSASTRSWSAGMAWAAEINTLKTYVSSTALEVVQ
FT                   QAMMICGMAGYKHGTPFSIGRHLRDLHAAPLMISNDRIAANTSSLLLALRPATLEKHS"
FT   gene            complement(479152..479403)
FT                   /locus_tag="Bamb_3637"
FT   CDS_pept        complement(479152..479403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3637"
FT                   /product="phosphopantetheine-binding protein"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG:
FT                   bur:Bcep18194_B1804 acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3637"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89191"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9I2"
FT                   /protein_id="ABI89191.1"
FT                   /translation="MKKDIRTILKHVAHLEAAIDSIGDGDDLYEAGLSSLDTIQLMLAI
FT                   EKQFNIEIPDEMLNRNLFRSIDALADTIATLQRSEHSA"
FT   gene            complement(479572..480354)
FT                   /locus_tag="Bamb_3638"
FT   CDS_pept        complement(479572..480354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3638"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; SMART: regulatory
FT                   protein, Crp; KEGG: bur:Bcep18194_B1803 cyclic
FT                   nucleotide-binding domain (cNMP-BD) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3638"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89192"
FT                   /db_xref="GOA:Q0B9I1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9I1"
FT                   /protein_id="ABI89192.1"
FT                   /translation="MTHQANDAVAPASGMIELSHSFDANRFLAAVDRDERATLIANLQL
FT                   VHLKSGQVLCEPGEMLTAVYLPVTTAISLQYVSTGGMTLEVAQIGSESVVCDDVIGGSG
FT                   RMPCRAVACRDGFVYRLDRRIFAAAFDASPVIRHLVFVCVRLLMAQVAQITFCSRHHVL
FT                   KHQLCRWFLLAYDRSRSIEIQVTHSMLAQMLGVRRETVTDAAGEIQRLGLIRQYRSSIV
FT                   LADLAGLEKLSCGCRAIVRDEMKRILSADSGVSAAARA"
FT   gene            481269..482051
FT                   /locus_tag="Bamb_3639"
FT   CDS_pept        481269..482051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3639"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="SMART: regulatory protein, Crp; KEGG:
FT                   bur:Bcep18194_B1802 putative transcriptional regulator,
FT                   Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3639"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89193"
FT                   /db_xref="GOA:Q0B9I0"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9I0"
FT                   /protein_id="ABI89193.1"
FT                   /translation="MLHLYSSYSANAILGALPEDSIRAIAPHLELVRIKAGMLDRVGEP
FT                   MRHLHFPTTAMMSVQHLMEDGAMVEVAMVGREGTVGLATLLGGTAVSNRIEVRIGGMAY
FT                   RVPTCIMRSEFERSPDTYRLLLNYCQAIMAQVSRSALCNRHHSVSEQLSRWLLLAHDRI
FT                   DGDELAVTQQTIANMLGVRREGVTEAAGNLQEAGLIRQRRGRITVLDRDGLERQACECY
FT                   ELIRADYRRLLGARAGARSMPVRQRMQDMHGGFPAHGA"
FT   gene            482084..483472
FT                   /locus_tag="Bamb_3640"
FT   CDS_pept        482084..483472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3640"
FT                   /product="sugar transferase"
FT                   /note="PFAM: sugar transferase; KEGG: bur:Bcep18194_B1801
FT                   sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3640"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89194"
FT                   /db_xref="GOA:Q0B9H9"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9H9"
FT                   /protein_id="ABI89194.1"
FT                   /translation="MRRAAVAAADVALVLAGTLAAQAAMGLAWRDLSDAQRGAIALLCV
FT                   LTVALLPRTVRLSRGGASPHGGGIVLTRTVVTVVCAGALTVVGTMWIMNRGGTVTTRWI
FT                   ARTVLSGDAALLLGRLALGALAMQRGDARARQRRVAIVGATAYGRVAIERMQMEPAGPF
FT                   AAACVFDDDAPAASADGIGGVPVIDDWVALRRMIRAGEIDEVWLTLPMSHESRIRRIVR
FT                   ELRDEFVELRLLPDVRQMAVVERSATDVLGMPAINLATTPRSAPELWAKFAFDRLFAVA
FT                   VLIPLLPLLAVLAIAVKLSSPGPVLFRQRRKGADGREFHILKFRTMRAHRAQPGVVRQA
FT                   SRNDARITPVGAFLRRTSLDELPQFFNVLSGQMSVVGPRPHAIEHDDFYRQLIDCYMYR
FT                   YRVRPGITGWAQVNGYRGETRKVEAMAARVKLDLFYMQNWSFWFDMKIILMTVVRGFVG
FT                   RNAF"
FT   sig_peptide     482084..482155
FT                   /locus_tag="Bamb_3640"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.958 at
FT                   residue 24"
FT   gene            484096..484488
FT                   /locus_tag="Bamb_3641"
FT   CDS_pept        484096..484488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3641"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /note="PFAM: zinc finger, DksA/TraR C4-type; KEGG:
FT                   bur:Bcep18194_B1799 transcriptional regulators, TraR/DksA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3641"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89195"
FT                   /db_xref="GOA:Q0B9H8"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9H8"
FT                   /protein_id="ABI89195.1"
FT                   /translation="MALDREQRQTLQRRLTDSEQTLRADIRTTEDQRASESYAELAGAA
FT                   PDEGDEANADLFVDMDHALIGMKLAELRAIGRAQQRMRDGSYGECIDCDAPVGYERLLA
FT                   RPSAERCTHCQSVYERRYATTPRASL"
FT   gene            484656..486434
FT                   /locus_tag="Bamb_3642"
FT   CDS_pept        484656..486434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3642"
FT                   /product="PHP C-terminal domain protein"
FT                   /note="PFAM: PHP C-terminal domain protein; SMART: DNA
FT                   polymerase X; phosphoesterase PHP domain protein;
FT                   Helix-hairpin-helix DNA-binding, class 1; KEGG:
FT                   bur:Bcep18194_B1798 DNA polymerase IV (family X)"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3642"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89196"
FT                   /db_xref="GOA:Q0B9H7"
FT                   /db_xref="InterPro:IPR002008"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR022311"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9H7"
FT                   /protein_id="ABI89196.1"
FT                   /translation="MPIHNAECAAVFAEIADMLEIQGANPFRVRAYRNAARTIAEYGRD
FT                   IPAMIANGSDLGQIPSIGADLAAKLREIAATGTCELQQTLRHALPGAIVELLDVPGLGA
FT                   KRVKALHDALHVDSLEQLRAEAKSGHVRALPGFGAKTEAHLLDAIDERLQREPQRFLLP
FT                   DAAQSLRPMLERLRQVAGVGEAVPAGSFRRCRETVGDLDILVSAQDAAAVADAFVSCGD
FT                   VARVLANGKTRSSVMLGNGLQVDLRVVDADAFGAALVYFTGSKAHNIALRRIAQAGGLK
FT                   INEYGVFRGDERIAGATEASVYEAIGLHWVPPELREGRGEIDASRAGTLPALVERKHLH
FT                   GDLHAHTDASAGRDSLRAMADAARARGLAYLAVTDRMPDAGGGRTDCDWLVRQIDEIDR
FT                   LNASFDDFVLLKGVEAGIREDGSLDVPDDVLGRLDLVVGAVRDGFDLPGDRQTERILRA
FT                   IDHPYFTILAHPTGRLLGERDACELDVPRVLAAAAARRCFVELDGDPRRLDLPDLWCRE
FT                   AAKAGVAVVIGSDARCADDFDNLDYGIGHARRGWLTRHDVLNTRTLAQLRPLLARTMGG
FT                   AGSASGASKRDRPKGA"
FT   gene            complement(486448..487563)
FT                   /locus_tag="Bamb_3643"
FT   CDS_pept        complement(486448..487563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3643"
FT                   /product="L-alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /note="TIGRFAM: alanine dehydrogenase; PFAM: alanine
FT                   dehydrogenase/PNT domain protein; KEGG: bur:Bcep18194_B1797
FT                   alanine dehydrogenase and pyridine nucleotide
FT                   transhydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3643"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89197"
FT                   /db_xref="GOA:Q0B9H6"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9H6"
FT                   /protein_id="ABI89197.1"
FT                   /translation="MLIGVPKEIKNHEYRVGLTPAGARELTRHGHHVLVQRGAGTAIGL
FT                   LDDDYTAAGAALCDDARELFARADMIIKVKEPQAAECAMLRRGQILYTYLHLAPDPEQA
FT                   AALVKSGAVCIAYETVTGPGGGLPLLAPMSEVAGRMSIQVAATHLESPRGGRGVLMAGV
FT                   PGVPAAHVVVLGAGVVGTGALQMAVGLGARVTVLDTNVGRLRQLDLIFANRIATVCSNA
FT                   HTIDEAVREADVVIGAVLVPGASAPRLVTRDMIATMRTGAVVVDVAIDQGGCFETSHAT
FT                   THAQPTFVVDGVVHYCVANMPGAVARTSTFALNNATLGHALALADKGWKRAMTDDPHLR
FT                   AGLNVCDGHVTYEAVALALGLPYVPAEDVLA"
FT   gene            487930..488346
FT                   /locus_tag="Bamb_3644"
FT   CDS_pept        487930..488346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3644"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3644"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89198"
FT                   /db_xref="GOA:Q0B9H5"
FT                   /db_xref="InterPro:IPR025058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9H5"
FT                   /protein_id="ABI89198.1"
FT                   /translation="MTSAYFSVPTLCAIALVHVYWAFGGSLGKRAAIPEQDGVPLLRPS
FT                   APGTLAIAAALLAGAGAVASRAGWLWPNLYPGAIAFAVVALALIFAVRAIGDFRYVGFF
FT                   KRIRGSRFARMDSLCYSPLCAALALSIASMLWPW"
FT   gene            488913..489719
FT                   /locus_tag="Bamb_3645"
FT   CDS_pept        488913..489719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3645"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1794 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3645"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89199"
FT                   /db_xref="InterPro:IPR027056"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9H4"
FT                   /protein_id="ABI89199.1"
FT                   /translation="MATGRAWRMRNARPRTTLPNDQHPTMSTPPDKPNSRRRFLRTSVA
FT                   LVPIASVAGCDLRSSATTAGNASAASAGAERAPYKPTFFDAKEWAFVQAAVDRLIPADA
FT                   EGPGALETGAPEFIDRQMETPYAHGATWYMQGPFQQGVPELGYQLKLVPRDIYRLGIAA
FT                   VNRYCEKAHGKTFADLDAPTRDTVLGALEKGGAQIDDVPSTVFFGQLLQNTREGYFCDP
FT                   VHGGNHDMAAWKMIGFPGARADFMDFVNQNGKPYPYGPVSINGERS"
FT   gene            489719..491497
FT                   /locus_tag="Bamb_3646"
FT   CDS_pept        489719..491497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3646"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; KEGG:
FT                   bur:Bcep18194_B1793 glucose-methanol-choline
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3646"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89200"
FT                   /db_xref="GOA:Q0B9H3"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9H3"
FT                   /protein_id="ABI89200.1"
FT                   /translation="MAAEKKPHVDAVIVGFGWTGAILAKELTEAGLNVVALERGEYRDT
FT                   YPDGAYPNTIDELTYNVRKKLFLDLSKTTVSIRHGVQDTALPYRQLAAFLPGEGVGGAG
FT                   LHWSGVHFRITPEELRLRSHYEERYGKKFIPEGMTIQDTGVSYDELEPYFDFAEKVFGT
FT                   SGQAYKVGGKVVGDGNVFEANRSDNFPLPAQLNTYSAQRFSDAAKSLGLHPYRLPSANT
FT                   SGPYTNPYGVQMGPCNFCGYCSGYACYMYSKASPNLNILPALKQVPNFELRSKCHVLRV
FT                   DLDDTKKRATGVTYVDPAGREVHQPADLVIVAAFQYHNVHLLLLSGIGKPYDPISGEGV
FT                   VGRNFAYQNLSTIKAFFDKDTYTNPFIGAGGNGVAVDDFNADNFDHGPLGFVGGSPLWV
FT                   NQAGVKPISGIATPPGTPQWGSAWKKAVKDNYAHTISMDAHGTNMSYRDVYLDLDPTYR
FT                   DSYGQPLLRMTFDWKDNDIRMAQYVTGQMKKIAEAMGPKAIGVSTREFGKHFDSRAYQT
FT                   THLVGGAIMGTDPKTSVLNRYLQCWDVHNVFVMGASALPQGIGYNPTGIIAALAYWSAR
FT                   AIREQYLKNPAPLVTV"
FT   gene            491494..492927
FT                   /locus_tag="Bamb_3647"
FT   CDS_pept        491494..492927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3647"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG:
FT                   bur:Bcep18194_B1792 cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3647"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89201"
FT                   /db_xref="GOA:Q0B9H2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9H2"
FT                   /protein_id="ABI89201.1"
FT                   /translation="MKRTVNHPNHHHAARRMSPLRRALAIGTAWAALGLAGGSAFAQPA
FT                   APAAASGPAAAPTAQSADAALVKRGEYLARAGDCIACHTASGGKPFAGGLKFDTPIGAI
FT                   YSTNITPDPKTGLGGWTLEDFTRAVREGVRKNGDTMYPAMPFPSYARLNDDDVKALYAY
FT                   FMHGVAPVERENRAVDIVWPLSMRWPLTFWRKLFAPTPKPFDATPYTNPVIARGAYLVE
FT                   GLGHCGACHTPRAVTMQERALTDAGGLDFLAGGAAIDGWVPTSLRGEPRTGLGAWTETE
FT                   IVQFLKTGRTLRTAAFGGMTDVVAHSMQHMTDDDLTAIARYLKTLPPRVQGEQPHVYDA
FT                   AAAKALQGGDASKPGAAVYRDNCMACHRSDGHGYTRVFPALAGNPVVQGEDPTSLIHVV
FT                   LEGSALAGTRTAPSTFTMPPFGWRLSDQEVADVSNFVRTSWGNTGAAITAAQVAKVRKS
FT                   VPSTRPEPPPGARFPQASR"
FT   sig_peptide     491494..491622
FT                   /locus_tag="Bamb_3647"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.984 at
FT                   residue 43"
FT   gene            493145..494860
FT                   /locus_tag="Bamb_3648"
FT   CDS_pept        493145..494860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3648"
FT                   /product="Kef-type potassium/proton antiporter, CPA2
FT                   family"
FT                   /note="PFAM: TrkA-N domain protein; sodium/hydrogen
FT                   exchanger; KEGG: bur:Bcep18194_B1791 TrkA-N family protein;
FT                   TC 2.A.37.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3648"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89202"
FT                   /db_xref="GOA:Q0B9H1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9H1"
FT                   /protein_id="ABI89202.1"
FT                   /translation="MPHDVSLIALLAAGFGLAMIFGYLASLLKMPPLVGYLLAGIVIGP
FT                   GTPGFVGDLSLAQQLAEVGVMLLMFGVGLHFSLGDLLAVRKIALPGAVVQITVATLLGG
FT                   GLALTWGWSLGAALVFGLALSVASTVVLLRALEGRGLVETVNGRIAVGWLVVEDLVMVL
FT                   VLVLLPPVAGLLGGTPPGDAHAAGGSVWGTLGVTMLKVAAFIVLMLVVGKRVFPRILWL
FT                   VARTGSRELFTLCMIAAAVGIAFGAAKLFDVSFALGAFFAGMMMRESEFSRRAADETLP
FT                   LRDAFSVLFFISVGMLFDPTVLLTEPLHVIEVAAIVLIGKTLAAVALVIAFRYPLNTAL
FT                   TVGAGLAQIGEFSFILAGLGRALGLLSAEGQSLILAVALISIAMNTLLFAMIDPALAWI
FT                   RKHSAFARKLEARDDPLAALPMSTPQTHLTGQVVIVGYGKVGTRIAHALDERGIAYVVV
FT                   EQNRELVEKLRADGVAAVSGDAIEPVVLVQAHIARAGMLVVTLPDVFDVRQIVEISRTL
FT                   NPTLEVVLCTNSGDEADLLASEGVGTVFMGESELARGMTEHVLGRMVKPVAAAH"
FT   sig_peptide     493145..493222
FT                   /locus_tag="Bamb_3648"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.912) with cleavage site probability 0.646 at
FT                   residue 26"
FT   gene            complement(495193..497085)
FT                   /locus_tag="Bamb_3649"
FT   CDS_pept        complement(495193..497085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3649"
FT                   /product="peptidoglycan synthetase FtsI"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   Penicillin-binding protein, dimerisation domain; KEGG:
FT                   bur:Bcep18194_B1788 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3649"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89203"
FT                   /db_xref="GOA:Q0B9H0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9H0"
FT                   /protein_id="ABI89203.1"
FT                   /translation="MSVKKKTHPADPYAAATKHPMLASRLPMWRSKLVVIMVSLGFAAL
FT                   IGRAFWVQVANQDFYVGQGQKRYQRTIELDAMRGRIVDRNGAMLAVSLSTYEIWANPKQ
FT                   VAEIDYPQLAKLLDMPLAEIKRRLRNDRTFVLLKRQVDADTAGRLDKLAIDGITQIADS
FT                   KRFYPEGESAAHVVGFTNVEDKGQEGVELAANARLSGTSGQREVIRDRLGRIVSDTRPL
FT                   VPAQHGATIELTIDRRIQQLAFSQLKAAVLENNAVAGSVVVLDAQNGEILALSNYPTFD
FT                   PNDRFRLTGQQLRNRAVIDTFEPGSTIKPLVVALSIDERKVTPNTIINTSPGTYKIGPA
FT                   VIHDTSNHGSLTVSEALQKSSNVALAKLALNLPAETIWNKYQEYGIGRAPELTFPGVAS
FT                   GRLRGYKRWRPIEQATMAYGYGLSMSLLQIAQTYTAYAGDGTLHPVSLLKSGTDPLTMD
FT                   SRRGHRVTSPQTAAAIRAMLESAVGEGGTGRRARVDGYRIGGKTGTARKQVGATYAKGK
FT                   YRALFAGMAPMSNPRLIVAVMIDEPRGKGYYGGTVAGPVFSSVTSGALQLLGVPPDAPV
FT                   EPTPNAPARGAAPQKPGAAPKAAAQPKTAAAQKAATSVKTAAQSGATVQAKAAG"
FT   gene            complement(497427..497774)
FT                   /locus_tag="Bamb_3650"
FT   CDS_pept        complement(497427..497774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3650"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1787 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3650"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89204"
FT                   /db_xref="InterPro:IPR021947"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9G9"
FT                   /protein_id="ABI89204.1"
FT                   /translation="MRLTIRINGSESATRHAFAVLWVDTDEGLWSREAHQGIDLPTWGK
FT                   VRDVEGAMALCPADGGKAVCQLKGLSSSATQREQGPAVLAGDHPAGAWRLQAVDRSKVD
FT                   SENHEFTSVAR"
FT   gene            498412..499623
FT                   /locus_tag="Bamb_3651"
FT   CDS_pept        498412..499623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3651"
FT                   /product="Male sterility C-terminal domain protein"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility C-terminal domain; KEGG: bur:Bcep18194_B1785
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3651"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89205"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9G8"
FT                   /protein_id="ABI89205.1"
FT                   /translation="MLIWKTALSLNWRTSLVSPASAPVAAANVGHLVLTGATGFIGSTV
FT                   LTALVNAGLLERIVCVVRAENRGHAVARLREAALRAGLAPYWASRLGDANVVVGALGDV
FT                   WQGADAPRLAGATHVIHCAGHASPADGAHLQADIADSLGFAARFAHTPRLQRFVYVGTA
FT                   YAHAGRGGIVHEDATGLAASGAVQGGDGLPGAVLAADYLHAKAQTEQRLRELGLPLVVV
FT                   RPSHVVGHTVLGTRPAPNSFWMFRVAHAARRFTARPMTRIDIVSVDDVARATMLLAVKP
FT                   TLMHDVYHVSAGDDAPQVAQIVRAMDEAAGMTGAPRYAACAPAELPLVVRDVLGRSDPA
FT                   LERVIGRALQRCAEFATVDRVFDNRRVRDEIDFEPLPFIDYVEECMRTSRGVAVTELMR
FT                   GALH"
FT   sig_peptide     498412..498492
FT                   /locus_tag="Bamb_3651"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.986) with cleavage site probability 0.783 at
FT                   residue 27"
FT   gene            complement(499694..500161)
FT                   /locus_tag="Bamb_3652"
FT   CDS_pept        complement(499694..500161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3652"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="TIGRFAM: homoprotocatechuate degradation operon
FT                   regulator, HpaR; PFAM: regulatory protein, MarR; KEGG:
FT                   bur:Bcep18194_B1784 transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3652"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89206"
FT                   /db_xref="GOA:Q0B9G7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR012712"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9G7"
FT                   /protein_id="ABI89206.1"
FT                   /translation="MRPRPFPTPMNRTLDHRNLAMLLLEARETLMGLFRPILKEFALTE
FT                   QQWRIIRVLDGEPAHALEAGQIARRCCILSPSLTGVLERMERDGLITRTRAQEDQRRLL
FT                   VSLTPQSRKLVTEIGPRIDEQYRQLEARFGQDGLDDVYRALDRLIELGNAS"
FT   gene            500287..500976
FT                   /locus_tag="Bamb_3653"
FT   CDS_pept        500287..500976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3653"
FT                   /product="5-carboxy-2-oxohept-3-enedioate decarboxylase
FT                   HpaG1 subunit"
FT                   /EC_number="4.1.1.68"
FT                   /note="KEGG: bur:Bcep18194_B1783
FT                   5-carboxymethyl-2-hydroxymuconate delta-isomerase; TIGRFAM:
FT                   4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase, HpaG1 subunit; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3653"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89207"
FT                   /db_xref="GOA:Q0B9G6"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012686"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9G6"
FT                   /protein_id="ABI89207.1"
FT                   /translation="MELSCRTAAAPPLPVAIGTVYGALLNERAAFDALGDAVHAPPYRR
FT                   PPQAPILYIKPANTHAADGAAVVVPAGVDALEIGASVAVVFSRRATRVPAAQALDYVHG
FT                   FTLASDVSVPHPDYYRPAVRFKCRDGFCPLGPVIVPAAALADVDAIGLTVRIDGATAVS
FT                   ASTATLIRPVRELIADVTAFMSFDAGDVLLLGVTGGAPRARAGSTIEITAAGIGTLRHT
FT                   LIAEDAR"
FT   gene            500973..501737
FT                   /locus_tag="Bamb_3654"
FT   CDS_pept        500973..501737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3654"
FT                   /product="5-carboxy-2-oxohept-3-enedioate decarboxylase
FT                   HpaG2 subunit"
FT                   /EC_number="4.1.1.68"
FT                   /note="KEGG: bur:Bcep18194_B1782
FT                   5-carboxymethyl-2-hydroxymuconate delta-isomerase; TIGRFAM:
FT                   4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase,HpaG2 subunit; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3654"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89208"
FT                   /db_xref="GOA:Q0B9G5"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012684"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9G5"
FT                   /protein_id="ABI89208.1"
FT                   /translation="MKTARVIYNGALHAAEPAGGGAIRLDTGRVLAEHDVTWLPPVAPR
FT                   TTFALGLNYADHAKELAFNAPSEPLIFLKGPNTFIGHRSRTVRPTDATHMHYECELAVV
FT                   IGRPARNVSRAQAIDHVAGYTVANDYAIRDYLENYYRPNLRVKNRDTCTPLGPWFVSRD
FT                   EIGDAGDLMLRTTVNGRETQRGSTRDMIFDVPALIEHISGFMTLSPGDLILTGTPEGLA
FT                   DTQPGDEVVTEIEGIGRLVNTIVGEADYYRAG"
FT   gene            501760..503223
FT                   /locus_tag="Bamb_3655"
FT   CDS_pept        501760..503223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3655"
FT                   /product="5-carboxymethyl-2-hydroxymuconate semialdehyde
FT                   dehydrogenase"
FT                   /EC_number="1.2.1.60"
FT                   /note="KEGG: bur:Bcep18194_B1781
FT                   5-carboxymethyl-2-hydroxymuconate semialdehyde
FT                   dehydrogenase; TIGRFAM: 5-carboxymethyl-2-hydroxymuconate
FT                   semialdehyde dehydrogenase; PFAM: aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3655"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89209"
FT                   /db_xref="GOA:Q0B9G4"
FT                   /db_xref="InterPro:IPR011985"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9G4"
FT                   /protein_id="ABI89209.1"
FT                   /translation="MTIKHWIDGREVESRETFTTLNPATGDVITDVASAGEAEVDAAVR
FT                   AAKAAFPKWANTPAKERAKLMRKLGELIERNVPMLAALETQDTGLPIAQTSKQLIPRAS
FT                   ENFNFFAEVCVQMNGRTYPVDDQMLNYTLYQPVGVCALVSPWNVPFMTATWKTAPCLAL
FT                   GNTAVLKMSELSPLTADQLGRLALEAGIPPGVLNVVQGYGATAGDALVRHPDVRAVSFT
FT                   GGTVTGKRIMERAGLKKYSMELGGKSPVLIFDDADFDRALDASLFTIFSINGERCTAGS
FT                   RIFVQRTIYDRFVQEFARRANNLVVGDPSDPGTQLGAMITRQHWEKVTGYIRIGEQEGA
FT                   RVVAGGADKPAGLASHLRNGNFVRPTVFADVDNRMRIAQEEIFGPVACVIPFDDEEEGL
FT                   RLANDTAYGLASYIWTQDVGKVHRLARGIEAGMVFVNSQNVRDLRQPFGGVKESGTGRE
FT                   GGEYSFEVFAEIKNVCISMGSHHIPRWGV"
FT   gene            503272..504120
FT                   /locus_tag="Bamb_3656"
FT   CDS_pept        503272..504120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3656"
FT                   /product="3,4-dihydroxyphenylacetate 2,3-dioxygenase"
FT                   /EC_number="1.13.11.15"
FT                   /note="KEGG: bur:Bcep18194_B1780 3,4-dihydroxyphenylacetate
FT                   2,3-dioxygenase HpaD_Fe; TIGRFAM:
FT                   3,4-dihydroxyphenylacetate 2,3-dioxygenase; PFAM: Extradiol
FT                   ring-cleavage dioxygenase, class III enzyme, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3656"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89210"
FT                   /db_xref="GOA:Q0B9G3"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR011984"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9G3"
FT                   /protein_id="ABI89210.1"
FT                   /translation="MGKLSLAAKVTHVPSMYLSELPGKHHGCRDAAIRGHRLIGERCRA
FT                   LGVDTIVVSDVHWLVNAGYHVNCNARFAGTYTSNELPHFIRDMQYAYPGNPALGRVIAE
FT                   TASARGIATRAHEIDSLELEYGTLVPMRYMNGDQHFKVVSIAGWCMWHQLDESRRFGEA
FT                   LLEAIEKSDSNVAFLASGSLSHRFNDNDSPEESIHQISREFFRQVDLRVVELWKQGDFK
FT                   TFCAMLPEYNVHCHGEGGMHDTAMLLGLLGWDRYDKPVEIVTDYFASSGTGQINAIFPL
FT                   A"
FT   gene            504150..504542
FT                   /locus_tag="Bamb_3657"
FT   CDS_pept        504150..504542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3657"
FT                   /product="5-carboxymethyl-2-hydroxymuconate delta
FT                   isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="PFAM: 5-carboxymethyl-2-hydroxymuconate isomerase;
FT                   KEGG: bur:Bcep18194_B1779 5-carboxymethyl-2-hydroxymuconate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3657"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89211"
FT                   /db_xref="GOA:Q0B9G2"
FT                   /db_xref="InterPro:IPR004220"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9G2"
FT                   /protein_id="ABI89211.1"
FT                   /translation="MPHIVVEYTANIRDDARIPTLLRTINATLIAQGGVFPTGGIRSRA
FT                   IELQDYCVADGTADDAFVHVTLKIGSGRSDETKKAACDALFDAIKVHFAELYAKRYLAL
FT                   SMELTEFSESGSYKHNNIHARYKRAD"
FT   gene            504562..505365
FT                   /locus_tag="Bamb_3658"
FT   CDS_pept        504562..505365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3658"
FT                   /product="2-oxohept-3-enedioate hydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="KEGG: bur:Bcep18194_B1778 4-oxalocrotonate
FT                   decarboxylase; TIGRFAM: 2-oxo-hepta-3-ene-1,7-dioic acid
FT                   hydratase; PFAM: Hydratase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3658"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89212"
FT                   /db_xref="GOA:Q0B9G1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012690"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9G1"
FT                   /protein_id="ABI89212.1"
FT                   /translation="MLEPALIDQLARRLNDAERERTQIRQISLDHPDITIDDAYAIQRA
FT                   WVAMKLAEGRTLKGHKIGLTSKAMQNTSQIDEPDYGALLDDMFFDDGGTIPTARFIVPR
FT                   VEVELAFVLGKRLTGPNCTIFDVYDAVDYVVPALEIIDARSQSIDPDTKRPRKVFDTIA
FT                   DNAANAGVVIGGRPVRPQDVDLRWVAAIMSRNGVVEETGVAAGVLNHPANGVAWLSNRL
FT                   SRFDVALEPGQIVLGGSFTRPCAARQGDTFSVDYGPLGTIQCYFE"
FT   gene            505378..506181
FT                   /locus_tag="Bamb_3659"
FT   CDS_pept        505378..506181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3659"
FT                   /product="2,4-dihydroxyhept-2-enedioate aldolase"
FT                   /EC_number="4.1.2.-"
FT                   /note="KEGG: bur:Bcep18194_B1777 2-dehydro-3-deoxyglucarate
FT                   aldolase; TIGRFAM: 2,4-dihydroxyhept-2-ene-1,7-dioic acid
FT                   aldolase; PFAM: HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3659"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89213"
FT                   /db_xref="GOA:Q0B9G0"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR012689"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9G0"
FT                   /protein_id="ABI89213.1"
FT                   /translation="MQMPSNVFKAALARGDAQLGLWLGLANPYSAEVVAGAGFDWLLID
FT                   GEHAPNTVPTILAQLQAIAPYPSHPVVRVPWNDPVIVKQVLDLGAQTLLVPMVQSADEA
FT                   RAAVAATRYPPHGIRGVGSALARASRWNRVGDYLHRANDEMAVLVQVETRAGLDAIDAI
FT                   ARVEGVDGVFIGPADLAADLGHLGNPGHPDVQAAIDGAIRTIKAAGNAPGILSADEAAA
FT                   RRYLEAGALFVAVGVDTTLLARSAQALAERFKEKGEAVKTGDGTY"
FT   gene            complement(506326..507114)
FT                   /locus_tag="Bamb_3660"
FT   CDS_pept        complement(506326..507114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3660"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bur:Bcep18194_B1773 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3660"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89214"
FT                   /db_xref="GOA:Q0B9F9"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9F9"
FT                   /protein_id="ABI89214.1"
FT                   /translation="MSDPLLPAHLITSDDGPFVVAAVLTQRDPRVTPSHTHARGQLVGA
FT                   QSGLVTIGLDDQEWVVPAIHAIWIPPHYRHSLHSFGPISGWSAFVAEARCAALPDTPRA
FT                   IRTTPLLREAVQRAASWGDSELDAAQARIADVILDEIVSSKAEALGLVRPQDPRLMKIT
FT                   DALAMDLADNRRLEEWADWAGIGARTMSRRFVAETGLTFAQWRQQARLLRALEKIADGV
FT                   PVTTIALDLGYDNVSAFIDMFRRAMGTTPGKYMEAGRRAG"
FT   gene            507210..507461
FT                   /locus_tag="Bamb_3661"
FT   CDS_pept        507210..507461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3661"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1772 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3661"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89215"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9F8"
FT                   /protein_id="ABI89215.1"
FT                   /translation="MRAEHLLPDHADRIEAGGTTIRKGTVGAFLANARVLTDPHAAPAD
FT                   RSQAEADTIDALPALRALGLFDVLEVRDPALRAWLAAQ"
FT   gene            507508..508473
FT                   /locus_tag="Bamb_3662"
FT   CDS_pept        507508..508473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3662"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bur:Bcep18194_B1771 zinc-containing alcohol dehydrogenase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3662"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89216"
FT                   /db_xref="GOA:Q0B9F7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9F7"
FT                   /protein_id="ABI89216.1"
FT                   /translation="MKAAVVTGAGESPVYMEFEVPHARPGHRAVDMTASALSRLAQGRA
FT                   SGTHYSSGSGYPFVVGVDGVGRLDDGQRVYIFGAPAPFGTMAERTIVPDAQCVPLPDGL
FT                   DDITAAAIAIPGMSSWAALIERARFVTGETVLVNGATGTSGRLAVRIARHLGAAKVIAT
FT                   GRNAVALEALLSDGADAVVSLQQDDADLARALEPHFRAGVDVVLDYLWGTSAHALLITA
FT                   ARSAPDGRRLRFVQIGSIGGADVLLPGAVLRAKAIELMGSGLGSVSPAGLLAAVRGVFA
FT                   AAGPARLTIDTRAVPLSAVGEHWNDTNSLVRTVFTMRDGA"
FT   gene            complement(508545..509636)
FT                   /locus_tag="Bamb_3663"
FT   CDS_pept        complement(508545..509636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3663"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG:
FT                   bur:Bcep18194_B1770 outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3663"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89217"
FT                   /db_xref="GOA:Q0B9F6"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9F6"
FT                   /protein_id="ABI89217.1"
FT                   /translation="MKSRAERSIRTAIVTGSAAVAGLAVGAAHAQSSVTMYGIMDAGIE
FT                   YTNHAAPDGGNSFKLKSGNKNTSRWGLRGTEDLGGGLKAVFRLESGIDLANGASDDGPD
FT                   SIFARRATVGLKGKWGEVSLGRNFTVTYDYMLPFDPMGYAQNYSWATSSMATGGRKDGL
FT                   FTRSSNAVRYDGEFGGFKFGALYGFGNVPGSVKTSSKYDFALGYEAGPFAAVVTFDRQN
FT                   GAADSVTPADTVNYIQGIHAGLSYDFGNLKTMAGYRNYRRTYHTSAANQLSDMYWVGGS
FT                   YQFTPTFSLIAAVYHQNIKGGTDADPTLVSVRANYALSKRTVLYAAGAFAIAQHGQKVG
FT                   VSRDFAGYGTTQVGVTAGIQQRF"
FT   sig_peptide     complement(509544..509636)
FT                   /locus_tag="Bamb_3663"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.997 at
FT                   residue 31"
FT   gene            complement(509819..510886)
FT                   /locus_tag="Bamb_3664"
FT   CDS_pept        complement(509819..510886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3664"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG:
FT                   bur:Bcep18194_B1769 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3664"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89218"
FT                   /db_xref="GOA:Q0B9F5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9F5"
FT                   /protein_id="ABI89218.1"
FT                   /translation="MDKLIVDDLHLSYGANPILKGVSFELNAGEVVCLLGASGSGKTTL
FT                   LRAVAGLEQPSDGRIQLDDRVFFDGARRVDLPVEQRSLGLVFQSYALWPHRTVADNVGY
FT                   GLKLRRVAPAEQKRRVQAALDQLGLGHLAERFPHQLSGGQQQRVAIARALVYNPPVILL
FT                   DEPLSNLDAKLREEARAWLRELIVSLGLSALCVTHDQTEAMAMSDRILLLRNGRIEQEG
FT                   TPAELYGAPRSLYTAEFMGSNNRIDARVAAVDGERVTLAGDGWELQALARDTFTPGQDA
FT                   QAVIRLERVQVADGPGANRLQADLVTSMYLGDRWEYLFHCGEMRLRAFGHVPRAAGTHW
FT                   IEFPANDCWAFAKAG"
FT   gene            complement(510879..512651)
FT                   /locus_tag="Bamb_3665"
FT   CDS_pept        complement(510879..512651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3665"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B1768 ABC
FT                   Fe3+ siderophore transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3665"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89219"
FT                   /db_xref="GOA:Q0B9F4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9F4"
FT                   /protein_id="ABI89219.1"
FT                   /translation="MLSTSTRGPAPAVPPSTGQDDAIPALRASGLQPLAGMLRWIVVAV
FT                   LTVAVALPLGFILFQSLLSAPFFDANKTLGVEGFRFIFTDPDFWLAVKNSFIIAGGMLF
FT                   ISIPLGGILAFLMVRTDLPGRRWLEPLLLTPVFVSPMVLAFGYVVAAGPVGFYSVWFKE
FT                   LFGVHNVPWNIYSIFAITVIVGLTHVPHVYLYSSAALRNLGSDVEEAARVSGARPFRVA
FT                   LDVSLPMTMPALLFAGVLVFFLGFEVFGLPLVLGDPEGHLVLATYLYKLTNKLGVPSYH
FT                   LMAAVAVCIVAITFPLVLLQRRLLKTANRFVTVKGKAGRSTVLPLGVWRWVALAIVALW
FT                   LMLTVIVPISGIVLRAFVTNWGEGVALAEVLTLANFIELFEQDNLVRAMLNTLGIGVIG
FT                   GALAIGFYSLVAFAGHRRNDWATKLLDYLVLLPRAVPGLLAGLAFLWIFLFVPGLRELK
FT                   NSMWSIWIAYTVVWLAYGMRLIQSALLQVGPELEEAGRSVGATRSRVSLDVTLPLVRFG
FT                   LLAAWLLIFMIFEREYSTAVYLLSPGTEVIGALLVSLWATGAVDQVAALSVINIAMVGA
FT                   GLGVALRFGVKLHG"
FT   gene            complement(512760..513860)
FT                   /locus_tag="Bamb_3666"
FT   CDS_pept        complement(512760..513860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3666"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: bur:Bcep18194_B1767 ABC Fe3+ siderophore
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3666"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89220"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9F3"
FT                   /protein_id="ABI89220.1"
FT                   /translation="MPFAPKQLAAALAIVLGTAAGAAVAQVPAGYPGNYQGVIDAAKKE
FT                   GKLIVYSTTDTGLVRPLIKDFESLYGVKVEYNDMNSTELYNRYISENAASSTSADVLWS
FT                   SAMDLQVKLVNDGLMASYDSPESPNVPQWAQYQKQAYGTTFEPLAIVYNKRLIPENEVP
FT                   KTRADLIKLLTTQADKFKGKVTTYDIEKSGVGFNYLTQDAHVNEKVTWELVKAIGATGP
FT                   KLQSSTGAMMERISSGENLIGYNIIGSYAYSKAKKDKSIGYVFPKDYTQVVSRLATISK
FT                   KAKNPNAAKLWVDYLLSKRGQTVIANQVDLYAIRTDVSGETSAASLTKELGDSLKPIQI
FT                   GTGLLVYLDQSKRLAFLKQWQQAIKR"
FT   sig_peptide     complement(513783..513860)
FT                   /locus_tag="Bamb_3666"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.971 at
FT                   residue 26"
FT   gene            complement(514069..515553)
FT                   /locus_tag="Bamb_3667"
FT   CDS_pept        complement(514069..515553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3667"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II; KEGG: bur:Bcep18194_B1766
FT                   transcriptional regulator, GntR family with
FT                   aminotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3667"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89221"
FT                   /db_xref="GOA:Q0B9F2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9F2"
FT                   /protein_id="ABI89221.1"
FT                   /translation="MSRGKAAIPLDLPCPAGLSTGTPQSKQECIADAIRDAILKRLLPG
FT                   DSPLPSSRTLAARWSVARGTVEAAYDRLSSEGYIARTRGSGSRVCAIVPDSYLRASAQP
FT                   RDGAPRRPGTAPEPEPTGAAAPEHAVRPGVPFVARLADPGLLPMQQWKKALGASLLAAT
FT                   PNDLGSTPSQGVEGLRDEIAAYLREYRGIPCEADDIFITTGIRHSIDLVARTVLTPGST
FT                   VLMEDPGYASAWHIFTMAAATVIDVPVDREGIQTATLDLHDDACAAYVTPAHQAPLGVT
FT                   MSVSRRLELLDWAQRNRAWIIEDDYDGEFSYQAAPLPALKSLDACERVIYCGSFNKTLF
FT                   SGLRIGFMVVPAELRPALSVVWHATARSVSVAPQLALARFIGHGDFAKHLRACRHAYRQ
FT                   RRDIVLDQLATHASGQFTVSGEHAGFHFVLGLPPAMDEASYVARARTAGIALQALSGFC
FT                   RSTRCEPGVVVGYSALTAAHARHGGRILGKLLAQSA"
FT   gene            515774..517009
FT                   /locus_tag="Bamb_3668"
FT   CDS_pept        515774..517009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3668"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, Bcr/CflA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B1765 drug resistance transporter Bcr/CflA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3668"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89222"
FT                   /db_xref="GOA:Q0B9F1"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9F1"
FT                   /protein_id="ABI89222.1"
FT                   /translation="MKTRSLPPWGWLFLLMLVVCLPRVTIDAYLPSLPAMADALHGTDA
FT                   QLQLTLTLYMVGYALSMLVSGPLSDRYGRRAVLVGGLCLYLVASVACALSTSIPAIIAA
FT                   RIFQALGGCSGTVIGRVIVRERYPTAMQATMLSRISAGMALSPVIAPLAGSVVAEWLGW
FT                   RGVFGWLAAGGLVATAMVLRYLPETREPDTQPTPATGLLRTYASLLRERRFLRYSLAIS
FT                   FVYCTYFPFIAESSTLFQRQMGVSGPVYAAIFGLTVLGYLIGSSVFRRTSGRWHADSVI
FT                   TVAAGINLVGAGALWGAGAVASTAVAALVVPMFFVMVAVGIAIPACQFAVMQPYTKIAG
FT                   TASGLFFFIQMAITAACGGVLAWLSDGTAHPMIAVTVCSSIAFMVVVVGLRDRSATDGR
FT                   RFAAGNRPAAER"
FT   sig_peptide     515774..515887
FT                   /locus_tag="Bamb_3668"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.740) with cleavage site probability 0.416 at
FT                   residue 38"
FT   gene            517124..517798
FT                   /locus_tag="Bamb_3669"
FT   CDS_pept        517124..517798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3669"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bur:Bcep18194_B1764 two
FT                   component transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3669"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89223"
FT                   /db_xref="GOA:Q0B9F0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9F0"
FT                   /protein_id="ABI89223.1"
FT                   /translation="MRVLLVEDNPNLAQSLNDALTAARFAVDHMADGEAADHVLRTQDY
FT                   ALVILDLGLPKLDGLEVLRRLRARRNPVPVLILTAHGSVEDRVKGLDLGADDYLAKPFE
FT                   LTELEARARALIRRSLGHEHSRVECGPLSYDSIDRSFHLGGEPLSLTPRERSVLEVLIL
FT                   RNGRAINKETLSEKIFGLDESVNADAIEIYVYRLRKKLENTGVAIVTLRGLGYLLEAKA
FT                   VE"
FT   gene            517795..519186
FT                   /locus_tag="Bamb_3670"
FT   CDS_pept        517795..519186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3670"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   Two-component sensor kinase N-terminal domain protein;
FT                   KEGG: bur:Bcep18194_B1763 periplasmic sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3670"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89224"
FT                   /db_xref="GOA:Q0B9E9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9E9"
FT                   /protein_id="ABI89224.1"
FT                   /translation="MTRPNLRTQVALWLLLPLLGLLALDSWLTYQRAMSAAHVAFDRTL
FT                   SSSLKLIREGVRLHEGEIEVDLPYLALEMFESGDGGKIYYLIRADNGHTITGYPDLPLP
FT                   QGDGALFVTRYYDVVYRGDQLRMAALRVPVHDVPTAQTRIVWVMVGETIEARQALAREI
FT                   LVGSLLQEGLLVVLALGIVWLGVGRGLRPLNRLSATVAARSDGDPTPLDTGGMPSELAP
FT                   LVESINQYIGRTQRMQVARRRFFADAAHQLKTPLAAVQAGVELALRPAEQPRVNVHLRR
FT                   VNGAVRQAAKIVQQLLSLSRLDSDSGQAVAHQPVALHRLARSVTLDWSPVARSRDIDLG
FT                   FEHEADVDVLGQPDLLGEMIGNLIDNAIRYSGDRAVITVRVSRDGEHARLDVIDNGPGI
FT                   PASERDAVFERFHRGSKTQTVEGTGLGLSIVREIARVHQGSVTLADAHGGGLVVTVRLP
FT                   AASHR"
FT   sig_peptide     517795..517866
FT                   /locus_tag="Bamb_3670"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.763) with cleavage site probability 0.545 at
FT                   residue 24"
FT   gene            complement(519248..520216)
FT                   /locus_tag="Bamb_3671"
FT   CDS_pept        complement(519248..520216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3671"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   sme:SMa2383 probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3671"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89225"
FT                   /db_xref="GOA:Q0B9E8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9E8"
FT                   /protein_id="ABI89225.1"
FT                   /translation="MKAIVMNGIGGRDMLEQVERTAPVARTGEALVEIAFAGVNFMDIG
FT                   VRQGMAWTGWPNPKILGVEGAGRVLAVGDDVEGIEPGQRVAWVYAPGSYAEQIAIPATS
FT                   LVPVPDTIDDRTAAAVMMQGLTASHFATDFYPVQPGDVAFVHAAAGGLGLLLTQIIKLR
FT                   GGRVIGRVSSEDKVAAATEAGADHVIVDTGGRFAAKALRLTNGEGVHVVYDGSGPKTFQ
FT                   GSLDVLRRSGTFCWYGPVLGGPEPIDLMSLPRSVKIGYATFFDHIDTPELLRAHSARLF
FT                   DWIAEGRLKVRIGGEYPLADAAHAHADMESRKSIGKLLLKP"
FT   gene            complement(520265..520831)
FT                   /locus_tag="Bamb_3672"
FT   CDS_pept        complement(520265..520831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3672"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: sme:SMa2381
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3672"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89226"
FT                   /db_xref="GOA:Q0B9E7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9E7"
FT                   /protein_id="ABI89226.1"
FT                   /translation="MARPREFDTDAALDGAIAVFSEHGFEGSSAQMLVSAMGIGRQSLY
FT                   AAFGDKWQLYLAAVRRYGMGECAAHFDALRSGARAIEGIDALLRRVVETAAQPCLGTIS
FT                   IYEFGASRPELAEIHAVLAHSLIAAIAARVRDAQREGDVAAGLVPEATAQFLIANITGI
FT                   RVAGRGGADHASLTALADMTLRALR"
FT   gene            complement(520947..521813)
FT                   /locus_tag="Bamb_3673"
FT   CDS_pept        complement(520947..521813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3673"
FT                   /product="MOSC domain protein beta barrel domain protein"
FT                   /note="PFAM: MOSC domain containing protein; MOSC domain
FT                   protein beta barrel domain protein; KEGG:
FT                   bur:Bcep18194_B1762 uncharacterized Fe-S protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3673"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89227"
FT                   /db_xref="GOA:Q0B9E6"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9E6"
FT                   /protein_id="ABI89227.1"
FT                   /translation="MPAISELFVYPIKSCAGVALPRAQLLETGLAYDRHWLITTPDGMM
FT                   ITQRTHPRLALIRTALDSDALVLNAPGMPEIRTPLDGDATPATPKMAATVWRDTVDAID
FT                   TGAETAAWLTEFLGVPLKLARFGADARRGCNRKWTGDVDTHTQFADGYPLLVIGQSSLD
FT                   DLNAKLVAKGVPAIPMNRFRPNIVVSDLDAYEEDFLEHLDADGETPVRLRLVKLCTRCP
FT                   VPTIDQVTGAPNPEWPHEPTDTMQTYRANPNYDNALTFGINAIVVEGAGAWLEVGQSVE
FT                   AEIAFGD"
FT   gene            complement(521906..522862)
FT                   /locus_tag="Bamb_3674"
FT   CDS_pept        complement(521906..522862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3674"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplasmic ligand-binding protein"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   aliphatic sulfonates family ABC transporter, periplsmic
FT                   ligand-binding protein; SMART: extracellular solute-binding
FT                   protein, family 3; KEGG: bur:Bcep18194_B1761 ABC
FT                   transporter, substrate-binding protein, aliphatic
FT                   sulphonates"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3674"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89228"
FT                   /db_xref="GOA:Q0B9E5"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9E5"
FT                   /protein_id="ABI89228.1"
FT                   /translation="MNPTRRHFLAQASALATTFTVAPAALHAQSGARPLLRAGDQKGGL
FT                   RALLEAAGELNGLAYDIAWTEFPAAAPLAEALNAGAVDCGPIGDAPVIFALASGARIKV
FT                   IAANRSDPYGTAVLVRPDATLKAAADLKGKRIGTTRGSIGHFVTLKALDAAGLPPDAVS
FT                   FRFLPPADTMLALATGSIDAWATWEPYTALAETSGRARVLVDGRGLWSGLSYVAATDAA
FT                   IASKRDVLRDFLQRVVRAQVWSYRHVDAYSAALARIIGIPPAAAKLQFERRNTRWQPID
FT                   ATVIAAQQRTADFYLKAGLLRQPLDVRTTFDLGFALA"
FT   sig_peptide     complement(522776..522862)
FT                   /locus_tag="Bamb_3674"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.991 at
FT                   residue 29"
FT   gene            complement(522899..524080)
FT                   /locus_tag="Bamb_3675"
FT   CDS_pept        complement(522899..524080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3675"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG:
FT                   bur:Bcep18194_B1760 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3675"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89229"
FT                   /db_xref="GOA:Q0B9E4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9E4"
FT                   /protein_id="ABI89229.1"
FT                   /translation="MSAPPFSDWALLFLQLLYRAQVAFARVLHAAGLSGDADGQAAWPW
FT                   AHRIALETLRIDAALTRQLAFAGAATVLAAALGCVAIASRKWRAASAFAALAVAWFAPW
FT                   PPASLWLAPAVPTSFQRNPAPFSVANVMRGEHLYTQHCAACHGANGRGEGPLAATLAHW
FT                   PPTFAGALLARRLDGELYWRVRHGTHDARGAASMPGFAATLRPADTWAVLDYLKALSAG
FT                   SGAQAEGAWPVPVPLPALDVRCGSAAPQPLARWREGQRVRIVALAPAGTPPPEDPRWQT
FT                   LLVTAGDTPAPPATGMRANCVASTPDAWQAFATIAGVPPDAFSGTQLLADRRGWLRARA
FT                   LPGSTGWSASDLLCRSDVPARAPAAAANVDPLTALLLRVDAEPVRDVQAGLPH"
FT   gene            complement(524131..524931)
FT                   /locus_tag="Bamb_3676"
FT   CDS_pept        complement(524131..524931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3676"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_B1759 ABC nitrate/sulfonate/bicarbonate
FT                   family transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3676"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89230"
FT                   /db_xref="GOA:Q0B9E3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9E3"
FT                   /protein_id="ABI89230.1"
FT                   /translation="MVSAAVLEPSVVTAPRGARIDIRRVSHAFDGPGGPLPVLDDVTLS
FT                   VAAGEFVALLGPSGCGKSTLLRLVAGLDAARHGTIAQDGAPIERPDPSRIVVFQDPTLY
FT                   PWRRVRANVALGLEARGVARTAQHRVDDALARVGLQEFSNVFPHQLSGGMAQRVALARA
FT                   LVNDPRLLILDEPLGKLDSLTRLTMQAELTALWQRDGFSALLVTHDVEEALFLAQRVIV
FT                   FGPRPARIVAELRVDLPYPRHRGDPRLAALRHEALRHLGLDASW"
FT   gene            complement(524925..526016)
FT                   /locus_tag="Bamb_3677"
FT   CDS_pept        complement(524925..526016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3677"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B1758 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3677"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89231"
FT                   /db_xref="GOA:Q0B9E2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9E2"
FT                   /protein_id="ABI89231.1"
FT                   /translation="MSTIEHTSTARTASAPAAAPAAATSRAACTACDATLAAEARRARI
FT                   WPAGVVAAVAWAVLGAITHLWPNRVVGFTDWAYTDTFATAAWTIAALLLIAATLGHRVP
FT                   ATRARLARVRPAGPWLVALPLVLAAWEIVTAKTGWLPTPFFAPPQALIEVYVDDWPRLA
FT                   GSAGNTLKLLALGFAYGVAVGFAVGVSIGWSRRIGYWVHPVLRVLGPVPATALLPLTFY
FT                   FFPTSYSAAAFLIALSTGFPVAVLTWSGVASVNRQYYDVARTLGANARFLVLRVAIPAA
FT                   LPHVFVGIFMGLSASFTVLVVAEMMGVKSGLGWYLSWAQGWASYVNMYAALIVMALLFS
FT                   GLIALLFAVRDRALAWQKGTVKW"
FT   sig_peptide     complement(525921..526016)
FT                   /locus_tag="Bamb_3677"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.982) with cleavage site probability 0.680 at
FT                   residue 32"
FT   gene            complement(526021..527055)
FT                   /locus_tag="Bamb_3678"
FT   CDS_pept        complement(526021..527055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3678"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems periplasmic components"
FT                   /note="KEGG: bur:Bcep18194_B1757 ABC-type
FT                   nitrate/sulfonate/bicarbonate transport systems periplasmic
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3678"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89232"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9E1"
FT                   /protein_id="ABI89232.1"
FT                   /translation="MTDTTAPAPASAHDDKRRRLLRAAGAAALAAPAITLGRKAWSAPP
FT                   LKKLTFAWNQNAFCLTPIVVAQEHGFFEKNGLKVELINYSGSTDQLLESIATGKADAAV
FT                   GMIHRWLKPLEAGFDVKIIGSSHGGCVRLLGAKTAGVTTLQALKGKTVGVSDLAAPGKH
FT                   FFSILLAKNGIDPERDITWRQYPADLLGVAVDKGEIQAIADGDPNLYLLEKRSNGAYAE
FT                   LATNLSGEYARKVCCVIGARGDLVRNDRPTAAALARSIVQATEYTHDNPNEAAKAFAKY
FT                   SPKINPDDLRKLYATLTYTHHPTNVDLQQEIAFYADDFRRINVLKKSTDPQRFAQQVYA
FT                   NVLG"
FT   gene            complement(527092..527937)
FT                   /locus_tag="Bamb_3679"
FT   CDS_pept        complement(527092..527937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3679"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: bur:Bcep18194_B1756 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3679"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89233"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9E0"
FT                   /protein_id="ABI89233.1"
FT                   /translation="MSAVLSSSSPARTASGLVLADTPRQHFWFDPPAPRVDVAAERRHR
FT                   QERLAAAFRLFARFGFASGLAGHITARDPELPDHFWVNPLGVHFSQIKVSDLLLVNARG
FT                   ETAIGNRPLNKAAFAIHAAIHDAHPHLVAAAHTHSTYGKAWSTLGRALDPLTQDACVFY
FT                   EDHALFDDFTGMVVDTSEGARIAAALVKPDGGTHKGVILKNHGILTAGPTVEAAAWWYI
FT                   ALDNAAHTQLLAEAAGTPQPIDHATARHTHSQIGGPDGALHAFDSLFARVVADEPDLLD
FT                   "
FT   sig_peptide     complement(527875..527937)
FT                   /locus_tag="Bamb_3679"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.887) with cleavage site probability 0.885 at
FT                   residue 21"
FT   gene            complement(527958..529130)
FT                   /locus_tag="Bamb_3680"
FT   CDS_pept        complement(527958..529130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3680"
FT                   /product="Alkanesulfonate monooxygenase"
FT                   /EC_number="1.14.14.5"
FT                   /note="PFAM: luciferase family protein; KEGG:
FT                   bur:Bcep18194_B1755 alkanesulfonate monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3680"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89234"
FT                   /db_xref="GOA:Q0B9D9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9D9"
FT                   /protein_id="ABI89234.1"
FT                   /translation="MIPAVICAPFPAVAGRRWPRRAVLAPETQMSVEFIGMIQSQKQSE
FT                   IHPPPGPVVDPDYVRDFARAHETAGFDRILVPHHSTGPSATLTIAFAAAATERIHFMLA
FT                   HRPGFTAPTLAARQIATLDQFSRGRLAVHFISGGSDSEQQRDGDFLDHDARYARTDEYL
FT                   GILRRIWTETQPFDHDGAHYRFTQGFSEVKPFQQPHVPIYFGGASEAALEVAGKHADVY
FT                   ALWGESLDQVRDLTTRVRAEAAKHGRQVRFSVSFRPILAATEDDAWARAHRILDETRRL
FT                   REAAGLGTGGPQQSEGARRLLAAAERGSRVDKRLWTEIAKLTGARSNSTALVGTPEQVA
FT                   DALLDYYDLGVTTFLIRGFDPLDDAIDYGRELIPRVRSAVAARDAARRAA"
FT   gene            529392..530720
FT                   /locus_tag="Bamb_3681"
FT   CDS_pept        529392..530720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3681"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   bur:Bcep18194_B1754 acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3681"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89235"
FT                   /db_xref="GOA:Q0B9D8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9D8"
FT                   /protein_id="ABI89235.1"
FT                   /translation="MSASLAASSPPASPQSSLRHLPADDARVAALLERLTPELAADAAR
FT                   NDVDGRFPHENFARLHRAGLIAQVVPREHGGAGATLAQASRIVAAIARADPATALVLTM
FT                   TYLQHRALGRADHRWPARLRRAVFDSAVDEGALINALRVEPALGSPSRGGLPETVARRD
FT                   GDGWRLSGHKLYCTGIPALRWLAVWARTDEPEPRVGVFLVPRERHAGDDVRIRVIESWN
FT                   HLGLRASGSHEVVFDDVRLPADHAVDVRAPDAWAVSAASHADVDAQADQQAWMVALLGS
FT                   LYDAVARASRDWLLEFATTRAPSGLGAPLATLPRVQEAVGEIEGWLHTNRVLLDAHIAR
FT                   TDAGDAPSVTTSGLVKRTVTEQAIRTVEHALKLSGNHGLSRGNPLERHYRDVLCSRVHT
FT                   PQDDAIAVAAGRTALEAAARSATPNPDAGGTSRSAPASARHNA"
FT   gene            complement(530782..531762)
FT                   /locus_tag="Bamb_3682"
FT   CDS_pept        complement(530782..531762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3682"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B1753
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3682"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89236"
FT                   /db_xref="GOA:Q0B9D7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9D7"
FT                   /protein_id="ABI89236.1"
FT                   /translation="MMPNMMDRHDAPERPCRTNMKISDIDAFAAVVRCQTLSQAATELG
FT                   MTQPAITRRVQNLEEALGVTLLDRNTKPPRPTDIGRQVFEQCRAILREVDALRELTAGQ
FT                   RPPAGEFRVGLTQGLGELMLPGLIARLAAQWPALTTQVTTAWGGTLVERIARRELDAAL
FT                   VFLAREMVLPPQVAGERLLATRLVAVGRKGDWPRRGYRLADCQARGWVLNPDGCGFRAG
FT                   LRRALDAQGLPMPVTLDTYGRDLQLQSVANGFGIGLLPLPLLDGSPLRDALDIVPLADF
FT                   KPQIDLWLLHRQDAARFAAPLAALAAHARTAFALPADAAAHDQAA"
FT   gene            531780..532346
FT                   /locus_tag="Bamb_3683"
FT   CDS_pept        531780..532346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3683"
FT                   /product="cysteine dioxygenase type I"
FT                   /note="PFAM: cysteine dioxygenase type I; KEGG:
FT                   bur:Bcep18194_B1752 metal-dependent enzyme of the
FT                   double-stranded beta helix superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3683"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89237"
FT                   /db_xref="GOA:Q0B9D6"
FT                   /db_xref="InterPro:IPR010300"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9D6"
FT                   /protein_id="ABI89237.1"
FT                   /translation="MSTLSLRQTPLHPFVDGLGALLASGANEARILDEGGALLAALVAH
FT                   DDWLPDAFAQPDPERYRQYLLHLDPDERFSVVSFVWGPGQTTPIHNHTVWGLIGMLRGG
FT                   EFSQPYRFDATGKPVPAGDAMRLQPGEVEAVSPRIGDVHRVTNAFADQVSISIHVYGAN
FT                   IGKVERAVFLDDGTVKPFVSGYSNA"
FT   gene            532406..534073
FT                   /locus_tag="Bamb_3684"
FT   CDS_pept        532406..534073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3684"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG:
FT                   bur:Bcep18194_B1751 rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3684"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89238"
FT                   /db_xref="GOA:Q0B9D5"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9D5"
FT                   /protein_id="ABI89238.1"
FT                   /translation="MLSSTTSTESDRDIVTQTADSTSRFPVASYQDVRARLLARDELAL
FT                   IDVREEDPYAQGHPLWAANFPLSKLELDAWTRIPRRDTPIVVFGEAGGEDLAPRAAATL
FT                   ARLGYTDVRLLDGGLAGWLAAGGELFIDVNVPSKSFGEWVEAERHTPSLSAQEVQALID
FT                   AQADVVIVDARRFDEYQTMNIPTSTSVPGAELVLRVRALAPNPQTRVVVNCAGRTRSII
FT                   GTQSLINAGLPNPVAALRNGTIGWTLAGQTLERGASRRFPDDVDPAQRDEARRAARAVA
FT                   ERAGVPRIALADVAALDEPGRTLYRFDVRTPEEYEAGHLPGFLSTPGGQLVQETDHHAA
FT                   VRGARIVLADDDGVRADMTASWLAQMGWDVRVVEPAGTAAFVERGQPPRDVPATPEVSE
FT                   VSPATLAGWLKEAAAGEIAIVDVTTSANYVKRHIPGAWFVVRAQLRDALAAIPPAKRYV
FT                   FTCGSSLLARFAAHDARALLPASAAISVLTGGTAAWIDAGLPLEHGETHLASPRVDRYR
FT                   RPYEGTDNAAAAMQAYLDWEYGLVDQLKRDGTHHFRVI"
FT   gene            complement(534188..535333)
FT                   /locus_tag="Bamb_3685"
FT   CDS_pept        complement(534188..535333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3685"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: bur:Bcep18194_B1750 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3685"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89239"
FT                   /db_xref="GOA:Q0B9D4"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9D4"
FT                   /protein_id="ABI89239.1"
FT                   /translation="MLFMRPTALRCIPFACAAALLLAACGGDDISASDPTQPISVKVQV
FT                   VGHRGASALRPEHTLASYRKAIEDGADVIEPDLVATRDGVLVARHENEISGTTNVSTLP
FT                   QFASRKATKTIDGTQLTGWFTEDFTLAELKTLRARERIPQIRPANTAYNDQFEIPTFDE
FT                   IVALAKQMAAQTGRTIHLYPETKHPTYFQSIGLPLEDRLVDALLKDPYTARTATVYIQS
FT                   FEVANLKTIRNRIKSSQPNWKLVQLMDEAGQRPYDFVKANDKRTYGDLSTRDGMREIAS
FT                   YANGVGPYKTSIIAVAADGTLQQPTPYVRYAHEAGLVVHPYTFRPENNFLPASLKDGGT
FT                   PATRNTAGSVREIQAYLRAGIDGFFTDDPAVGRTAVDTFKR"
FT   sig_peptide     complement(535253..535333)
FT                   /locus_tag="Bamb_3685"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.982) with cleavage site probability 0.609 at
FT                   residue 27"
FT   gene            535692..536756
FT                   /locus_tag="Bamb_3686"
FT   CDS_pept        535692..536756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3686"
FT                   /product="farnesyl-diphosphate farnesyltransferase"
FT                   /EC_number="2.5.1.21"
FT                   /note="PFAM: Squalene/phytoene synthase; KEGG:
FT                   bur:Bcep18194_B1749 squalene/phytoene synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3686"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89240"
FT                   /db_xref="GOA:Q0B9D3"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9D3"
FT                   /protein_id="ABI89240.1"
FT                   /translation="MTTHTDPAYLLGDLLKNVSRSFYLTLRVLPDGMREPVGLAYLLAR
FT                   AADTIADTALVAPERRAALLTDLRDEIERLGDGAALSRALEDVTRMQTDSHEHMLLASM
FT                   KPMLALLRAQPDADRASIRKVVATLTSGMEFDLRTFPDEQSGQVASLPSRDELDRYTYL
FT                   VAGCVGEFWTDMTGAHTRAARGWDFADMREKGIRFGKALQMTNILRDCAKDLRIGRCYL
FT                   PDDVLAEHRIGVADLMSPDASARARGVLVELLRATLAQYRDACFYTQAIPRRFVRLRLA
FT                   CLWPIMIGLETLELLAGHDAWLDPARPAKVPRKRVYRIMASSLALVGSNAAIRARINAL
FT                   VDAVNARIAAPASH"
FT   gene            537227..538444
FT                   /locus_tag="Bamb_3687"
FT   CDS_pept        537227..538444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3687"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG:
FT                   bur:Bcep18194_B1748 outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3687"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89241"
FT                   /db_xref="GOA:Q0B9D2"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9D2"
FT                   /protein_id="ABI89241.1"
FT                   /translation="MKKRVAFAMTAAGLAAATAAHAQSSVTLYGIVDNAIAYQNNSSAT
FT                   GATTGGHSKVQMATGIWAGSRFGLKGSEDLGGGTKAIFQLEAGFNANNGSSQWTNGIFT
FT                   RQAWVGLSNQTYGTLTAGRQYTAYYTLLSPYSPTTWLTGYYGAHPGDIDSLDTSYRANN
FT                   SLVYMSPKFYGFTVGGSYSFGGVAGSVNRGSTWSAAIQYLNGPAGIAVGFQRINNATLG
FT                   GGVWGANSTAQNGLDTSGNGAEQAVSSINNGYRTAQAQQRLAVTAGYQFTPAWDVSVSY
FT                   SNVQYIPGTLSGFRNTAIFNTAGAVLHWKAAPQWDFAAGYSYTRATQSNGISSAAKYHQ
FT                   VTLSQYYSLSKRTGLYAVEAYQHASGNTLTPTGGVILATTSTGDGVGAGSKQNQIAAGV
FT                   GLIHRF"
FT   sig_peptide     537227..537295
FT                   /locus_tag="Bamb_3687"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            complement(538608..540113)
FT                   /locus_tag="Bamb_3688"
FT   CDS_pept        complement(538608..540113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3688"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bur:Bcep18194_B1747 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3688"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89242"
FT                   /db_xref="GOA:Q0B9D1"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9D1"
FT                   /protein_id="ABI89242.1"
FT                   /translation="MKPASRRTFHVAHAARAAGGGALAAVALLAGCAVGPDFRAPEPPV
FT                   TQQYTRDAAPATTAAAGGPAGDAQTFASSAHTLQRWWTEFGSEPLDRLVDTAWRNSPTL
FT                   AEARARLDEARQNHAAEAGATILPRVDANLSATREKVDVAAFGLPTNMPNPGPFTLYDA
FT                   SVSVSYALDVFGGNRRALEALRAQVDYQAYTLDAARLTLAGNVVATAILRASLAQQVAL
FT                   TRQLVDAQARQLRIVEARFAAGGVSRADVHAQRALLAQTQASLPPLAARHAQAGHRLAI
FT                   LLGAPPSGEALPDLALDALALPRTLPVALPSTLARERPDIRAAEAVLHQASANVGVATA
FT                   NLYPRFSISAGIGSERTRIADIVSGLNVWNVGLGLTQPLFHGGELRARKRAAEAAYDAA
FT                   FASYRETVLLALQQVADAMRAVEHDAAELQARDDAAQQAAASHAIAGDRYAAGGISLID
FT                   LLDAQRQVLQTALERTRAQADRLADTAALFQALAGNWTDDSHR"
FT   sig_peptide     complement(540012..540113)
FT                   /locus_tag="Bamb_3688"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.797) with cleavage site probability 0.339 at
FT                   residue 34"
FT   gene            complement(540124..541278)
FT                   /locus_tag="Bamb_3689"
FT   CDS_pept        complement(540124..541278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3689"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG:
FT                   bur:Bcep18194_B1746 ABC efflux pump, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3689"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89243"
FT                   /db_xref="GOA:Q0B9D0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9D0"
FT                   /protein_id="ABI89243.1"
FT                   /translation="MNAWAGLRESFSVARWWSIVLKEFLQLRRDRVTFAMIVGVPIIQL
FT                   ALFGFAINTDPKHLPTAVIVADSSPFARSFIAAMRNSAYFDIVATLPDEAAGRQALARG
FT                   DVQFVLSVPADFSKRLLRGEHPSLLVEADATDPVATASAIGALTGLVQPVADKDLTGPL
FT                   ARLNGRPAAFDVVLHRLYNPEGITQYNVVPGLMGVILTMTMVMMTGLAITRERERGTME
FT                   NLLATPVRPLEVMTGKIVPYVFIGLIQVSIILVAARFVFEVPFVGGVFAIYLAALLFIA
FT                   ANLTVGITLSSLAQNQLQAMQLAVFYFLPNILLSGFMFPFAGMPKWAQFIGNLLPLTYF
FT                   NRLVRGILLKGNAWADLWPSVWPVALFTLVVMSVALRFYRRTLD"
FT   gene            complement(541275..542246)
FT                   /locus_tag="Bamb_3690"
FT   CDS_pept        complement(541275..542246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3690"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_B1745 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3690"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89244"
FT                   /db_xref="GOA:Q0B9C9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9C9"
FT                   /protein_id="ABI89244.1"
FT                   /translation="MNAPAAPYAIDVNRLNKRFGDKHVVKDVSLRVARGEIFGFLGPNG
FT                   SGKTTSIRMMCGLLTPDSGSGTCLGYDIVRDSAQIKRRVGYMTQRFSYWEDLSIRENLD
FT                   FVARVYGMPDRHATVARALDGLGLASRADQLTGALSGGWKQRLALAACMLHEPELLLLD
FT                   EPTAGVDPAARRDFWEELHRLAAQGISVLVSTHYMDEAERCHKLAYIAAGELLAQGTSA
FT                   EIVASQHLSTRTITGGHLTELSAQLRTMPGVDQTVVFGSALHVSGRDRARLDATLAQVA
FT                   AEAGARTDGRASLQIAPIDTGLEDVFIYMMGRASAPPGGASS"
FT   gene            complement(542243..543205)
FT                   /locus_tag="Bamb_3691"
FT   CDS_pept        complement(542243..543205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3691"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   bur:Bcep18194_B1744 secretion protein, HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3691"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89245"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9C8"
FT                   /protein_id="ABI89245.1"
FT                   /translation="MNTTRALPLALAAAALLGGCGRPADTGTTYQGYVEGEFVYLSSSQ
FT                   AGTLTQLSVERGQAVAAGTPVFALEAVSETAALQQAQHQLAAARAQLADLQTGKRPPEV
FT                   AVTRAQLAQATAQAARAAAQLARDERQYAAGGLSKQQLDDTRTSAQTTAAQMRELQNQV
FT                   DVARLPGRAQQVTAQAAQVDAAQAAVAEAQWKLDQKRIAAPADGRVYDTLYRVGEWVQA
FT                   GNPVVQMLPPQNLKVRFFVPEAAIASLAPGRTIAIHCDGCAADVSARITYVSRAAEYTP
FT                   PVIYSNESRSKLVFMVEARPAPADAPKLHPGQPVAVRVR"
FT   sig_peptide     complement(543125..543205)
FT                   /locus_tag="Bamb_3691"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.997) with cleavage site probability 0.976 at
FT                   residue 27"
FT   gene            complement(543202..543936)
FT                   /locus_tag="Bamb_3692"
FT   CDS_pept        complement(543202..543936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3692"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG:
FT                   bur:Bcep18194_B1743 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3692"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89246"
FT                   /db_xref="GOA:Q0B9C7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9C7"
FT                   /protein_id="ABI89246.1"
FT                   /translation="MKLTNSSISVVCMNAKSTVARPRGRRPSVEDFDLRDHMLDVAIQL
FT                   FAEHGIAATTVAQIAAAAGVTSAMVHYYFTNREQLLDAIVEERLAQVIAFVWRPTAPQI
FT                   ENDPFALVAELVDRFFDVTHRMPWLPSIWLREIVHEGGLLRERMVRRIPLEHVGRFAER
FT                   IRAAQQAGTLNPSLEPAFLFHSIIALVMLPLATAKLWQSARGLPPIDRDVLHRHVRALL
FT                   GSGMQPPVTAPDAHSRAPRRPS"
FT   gene            complement(544244..544681)
FT                   /locus_tag="Bamb_3693"
FT   CDS_pept        complement(544244..544681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3693"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   bur:Bcep18194_B1741 alkylhydroperoxidase AhpD core"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3693"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89247"
FT                   /db_xref="GOA:Q0B9C6"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9C6"
FT                   /protein_id="ABI89247.1"
FT                   /translation="MQPRLNFYTASPNAIKVMRNAEEFIAKSSIEKPLAELVRLRASQI
FT                   NGCAFCVDMHTTDARKGGETDRRLATVVAWRETPFFTERERAALEWTEALTLVADNHVP
FT                   DSVWEAVKPHFSDTELFDLSMLIATINTWNRFAIAFRKMPE"
FT   gene            complement(544776..546260)
FT                   /locus_tag="Bamb_3694"
FT   CDS_pept        complement(544776..546260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3694"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II; KEGG: bur:Bcep18194_B1740
FT                   transcriptional regulator, GntR family with
FT                   aminotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3694"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89248"
FT                   /db_xref="GOA:Q0B9C5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9C5"
FT                   /protein_id="ABI89248.1"
FT                   /translation="MDIAIRIEGRHDLTGQIFRQLRTAIVDGRLEGGARLPSTRDLAKQ
FT                   LGVSRKTTLDAFERLVAEGYLNTRAGDGTFVAGGLARVPHAPVASTPSLVEDTPRVHAV
FT                   DARALWDDLPDALAMPTPQASPAFDFRGGVTDKTLFPFDAWRRCLHHALRQQARGLGQY
FT                   HDPAGDPQLRGAIARYVGFSRAVACGWDDVLVTQGAQQALDLIARVVVRPGDVVAVENP
FT                   GYPPARAAFASLGATVIGVPVDAHGLVTERLPDDARLVYVTPSHQFPLGMPMTLDRRVA
FT                   LLEWAQRRRAVIIEDDYDGEFRFEGRPVESLKSLDRTGLVAYVGTFSKTIFPELRIGYA
FT                   IPPRALRGALAKAKQIVDWHTCTLTQAALARFMLEGDFARHLRRVQKHYDARRKMLLAH
FT                   LRGGLAPWFDTIVPTAGIHLAALLKPGLDEAALVRAAREHDIGLYGISPFHVGSAARAG
FT                   LLFGYGGIDALRIDTALAKLAVLLRSGDFGGPSLVT"
FT   gene            546484..547401
FT                   /locus_tag="Bamb_3695"
FT   CDS_pept        546484..547401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3695"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, MarR; regulatory protein,
FT                   LysR; LysR, substrate-binding; KEGG: bur:Bcep18194_B1739
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3695"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89249"
FT                   /db_xref="GOA:Q0B9C4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9C4"
FT                   /protein_id="ABI89249.1"
FT                   /translation="MLSEDELALLDAIRATGSLSRAAARLGKATSTVSHTARQLETRFD
FT                   ALLFDRRGYRLQLTPAGQLLTDEASRLALDVARLTQRVRQVASGWEDRLTIVSDEVLEF
FT                   DTLLPVVRAFDALDSGVSLRFTHEVLGGTWEALRDGRADLVVGATNEPPAIPGFKWFEL
FT                   GAMEWVFAVSPRHPLAAAGERLTRDAIGAHRAVVVADSSRRSVGRVYGLLGGQPVLAVP
FT                   SMRAKILAQRDGLGVGWVPRRRVASLLARGELVEKETADPREPNVLYVAWRSDRDGRAL
FT                   QWWLEQLREPRLAQRLLDGIDVSG"
FT   gene            547462..548298
FT                   /locus_tag="Bamb_3696"
FT   CDS_pept        547462..548298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3696"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bur:Bcep18194_B1738 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3696"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89250"
FT                   /db_xref="GOA:Q0B9C3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9C3"
FT                   /protein_id="ABI89250.1"
FT                   /translation="MFAAPIARHGRGPSASCVDGQLTGSQENIMQRFEGKTVLVTGGNS
FT                   GIGLAAARAFAAEGARVVITGRDEQTLAAARETLGDGALAIRNEAGSVASARALADALT
FT                   ASGVRLDAVFINAGVAKLAPFADSDEAMWDLVFNTNVKGAYFQIQSLVPLLNRGASIVI
FT                   NGSINAHIGMPGSSVYAASKAAVNSFAKTLSTELLPHGVRVNVVSPGPVQTPLYGKLGL
FT                   DAAALDETADKIRGLVPIGRFGTPDEIASTVLHLSAPESAFIVGAEIIASGGMGLL"
FT   gene            complement(548363..550081)
FT                   /locus_tag="Bamb_3697"
FT   CDS_pept        complement(548363..550081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3697"
FT                   /product="Levanase"
FT                   /EC_number="3.2.1.65"
FT                   /note="KEGG: bte:BTH_II1873 levanase; PFAM: Glycosyl
FT                   hydrolase family 32, N terminal domain protein; Glycosyl
FT                   hydrolase family 32, C-terminal domain protein; SMART:
FT                   glycoside hydrolase, family 32"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3697"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89251"
FT                   /db_xref="GOA:Q0B9C2"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9C2"
FT                   /protein_id="ABI89251.1"
FT                   /translation="MPRVRPPLFLFRRSRMSPPYAACALPSRFAQRSTGPRMKSTFSRF
FT                   SFRFACLLACAGSMHATCAAPPASATPQWRPAIHYTPQRNWMNDPNGLVYENGRYHLFY
FT                   QYNPLGHDWGNMSWGHATSTDLVHWREQPVALHANATEEIFSGSIVADTHNTSGLGAPG
FT                   ETPLVALYTSVYKAGSGHAPGTQAQSLAYSLDHGATWQPYARNPVLTLDPESKQFRDPK
FT                   VSWYAPGRYWVMTTVVADAHVVKLYRSDDLIHWSFLSDFTLPDVPHAGALWEMPDLVPL
FT                   PVDDDPRHIKWVMIVNVNPWSIAGGSGAMYFVGNFDGRTFVPDRVAPAGSDPAQFRWVD
FT                   HGADFYAAGTFSGAPGARPVAIAWMSNWDYAAKAPTAPWRGAMTLPREFALKTIGGEPT
FT                   LFVTPAAAFDAWADGRPAVHEGDLSVESATRALSAATRGVVQRITVTIEPRRAARAGLI
FT                   VRGSADGAIGTRIVYDTAKRTLTLDRSRSGATDFTGNFSREHIVDLPLENGRLQLEIVV
FT                   DRGSVEVFANGGRVALTDLIFPPREADRVAVFAEHGSATFSGLTVTQLDAGHASR"
FT   sig_peptide     complement(549887..550081)
FT                   /locus_tag="Bamb_3697"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.996) with cleavage site probability 0.995 at
FT                   residue 65"
FT   gene            complement(550127..551707)
FT                   /locus_tag="Bamb_3698"
FT   CDS_pept        complement(550127..551707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3698"
FT                   /product="Levansucrase"
FT                   /EC_number="2.4.1.10"
FT                   /note="PFAM: glycoside hydrolase, family 68; KEGG:
FT                   bte:BTH_II1872 levansucrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3698"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89252"
FT                   /db_xref="GOA:Q0B9C1"
FT                   /db_xref="InterPro:IPR003469"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9C1"
FT                   /protein_id="ABI89252.1"
FT                   /translation="MTYFPFCRATAAKRLLFTGAALAAFASAAHAQTAGAPAPTPHTQQ
FT                   AYDPEGNFTMRWTRADIRQIVAQSHTAGADKNSLPQALSMPDIPQDFPLINSNVWVWDT
FT                   WPLADLRANQLSYKGWEVIFSLTADPHAGYTFDDRHVHARIGFFYRRAGIPASQRPANG
FT                   GWTWGGHLFPDGASAKVFGTSPMTNNAEWSGSARLTHGDNVSLYYTATSFNRSAPGGAD
FT                   ITPPQAIITRADGHIQADDKHVWFTGFDDHKALLQPDGNYYQTGQQNTYFSFRDPFVFT
FT                   DPAHPGKTYMVFEGNTGGQRGARTCTEADLGYAPNDPYKEDLNAVMNSGAVYQKANVGL
FT                   AVATNPQLTEWKFLPPILSANCVDDQTERPQIYLKDGKYYLFTISHRTTMAAGVDGPDG
FT                   VYGFVGNGIRSDYLPLNGGSGLVLGNPTDFSAPAGAPYSQDPNQNPREFQSYSHYVMPG
FT                   GLVESFIDAIGPRRGGTLAPTVKVNINGTSTAVDRSYGRGGLGGYGEIPSNLPATGAGH
FT                   NDGGSGTRP"
FT   sig_peptide     complement(551612..551707)
FT                   /locus_tag="Bamb_3698"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.997 at
FT                   residue 32"
FT   gene            551877..552911
FT                   /locus_tag="Bamb_3699"
FT   CDS_pept        551877..552911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3699"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein, LacI;
FT                   KEGG: bps:BPSS0544 LacI family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3699"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89253"
FT                   /db_xref="GOA:Q0B9C0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9C0"
FT                   /protein_id="ABI89253.1"
FT                   /translation="MHNARSDVKVNLKALSDALGLSRTTVSRALNGYDDVSEATRERVM
FT                   KAARELGYVADPTARRLATGRSDAIGIVYPFGAGDLGDPRFGEVVAGITERLAERNLDF
FT                   IIASARPNAELDTYRRLVDGKLVDGLIVARTLVDDPRLAYLRSNAFPYVAYGRTQAVEP
FT                   YAWFDFDNEAGARDAVRRLIGFGHRRIAMISAPLSLNFAMQRRAGYLAALREAGIEPDP
FT                   ALLVECAFTRDGGQQGVQTLLERAEPPTALLVDNNIAGGGAFRALVDSGVRLGRDMSLI
FT                   VYDGVPPDVAHPYRVTAVLQPTGQASGRALADLMLGLLVDGVRGQRLEMPVIEAGDTDG
FT                   PLRG"
FT   gene            553329..554015
FT                   /locus_tag="Bamb_3700"
FT   CDS_pept        553329..554015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3700"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG:
FT                   bur:Bcep18194_B1737 ThiJ/PfpI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3700"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89254"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9B9"
FT                   /protein_id="ABI89254.1"
FT                   /translation="MKILVVLTSHDTLGDTGKKTGFWLEELAAPYYAFKDAGVELTLAS
FT                   PKGGQPPLDPKSSDPTAQTDATRRFDADPAAKAELAATRKLADVSVDDYDAVFYPGGHG
FT                   PLWDLAEDLHSIGLIERALSAGKPVAAVCHAPGVLRHVKDPKTGESVVRGKRVTGFTNS
FT                   EEAAVELTEVVPFLVEDMLTTNGAQFERSADWAPHVVTDGLLITGQNPASSEPAAEALL
FT                   AKLGRQ"
FT   gene            554158..555267
FT                   /locus_tag="Bamb_3701"
FT   CDS_pept        554158..555267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3701"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   bur:Bcep18194_B1736 NADH-flavin oxidoreductase/NADH
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3701"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89255"
FT                   /db_xref="GOA:Q0B9B8"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9B8"
FT                   /protein_id="ABI89255.1"
FT                   /translation="MSALFEPFKLKDVTLRNRIAVPPMCQYVAEDGVVNDWHHVHLASI
FT                   ARGGAGLVIAEATAVSPEGRITPGCAGLWTDAQAEAFAPSVAAIKAAGAVPGIQIAHAG
FT                   RKASANRPWEGDDHIAEGDPRGWQTIAPSAVPFGAHLPKVPRAMTHDDIARVQADFVAS
FT                   AKRARDLGFEWLELHFAHGYLGQSFFSVHANQRDDEYGGSAENRGRFIVDTLKAVRQVW
FT                   PEHLPLTARLGVIEYDGRDEETLAESIALTQRMKQEGLDMLSVSVGFSTPDAQIPWGPA
FT                   FLAPIAERVRREAGLPVSSAWGIDTPQLANRVVAEQQLDLVMVGRAHLADPHWPYYAAK
FT                   QLGVERPSWTLPAPYAHWLERYRVADKVA"
FT   gene            555429..556499
FT                   /locus_tag="Bamb_3702"
FT   CDS_pept        555429..556499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3702"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   bur:Bcep18194_B1735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3702"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89256"
FT                   /db_xref="GOA:Q0B9B7"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9B7"
FT                   /protein_id="ABI89256.1"
FT                   /translation="MRVHVSPSQDSAARPRAQQIARAVLYAALLLLALWVIRDFLPAIA
FT                   WACVIAIALWPLLKRLESERWFRNRPTLIATVITVGVSLLVILPVALALGQAIAQEHDL
FT                   RMWLQSVQDNGIPLPDVIARLPYGAAQVTEWWQANLGHPLHAGAAMHGASGEKFIAFGR
FT                   QFGTKLAHALFEFGFMLVTLFVILRAGHKLSGALLHGARRAFGPGGGELIERMVAAVYG
FT                   TVTGLVVVGLGEGAILGVAYALAGVPHAALLGLVTAVAAMLPFCAPIVFCGAALWLFVQ
FT                   GATVWAVVVLVVGFVVVFVAEHFVRPVLIGSSTRLPFLLVLFGILGGAETFGLIGLFVG
FT                   PALMTVLTMLWAEWVA"
FT   gene            556699..557097
FT                   /locus_tag="Bamb_3703"
FT   CDS_pept        556699..557097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3703"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1734 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3703"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89257"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9B6"
FT                   /protein_id="ABI89257.1"
FT                   /translation="MAQQISPSMRLIPMYRPAATLSLAASCLMLHGCAWFDSWLPFSYS
FT                   RTPLARAASRHGAMRADVVRAGGNPRSVWMVRNGSGVCYNYFIEHGNDHRPYFVVFDKA
FT                   GAVTQYGFDTCMDADRKGTLQSGKTVSR"
FT   sig_peptide     556699..556797
FT                   /locus_tag="Bamb_3703"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.641) with cleavage site probability 0.566 at
FT                   residue 33"
FT   gene            complement(557153..557947)
FT                   /locus_tag="Bamb_3704"
FT   CDS_pept        complement(557153..557947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3704"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bur:Bcep18194_B1733 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3704"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89258"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9B5"
FT                   /protein_id="ABI89258.1"
FT                   /translation="MHIDLTGKTAVVTASTAGIGLAIAEGLAHAGARVVINGRSDESVD
FT                   AALALLRTAVPDADIDGIAADLSDATGVARITQHTPEADILVNNAGIYGLKGFFDIDDD
FT                   EWTHYFQMNVMSGVRLARHYLKGMLERNAGRIVFISSESGLNIPVDMIHYGFTKTAQLA
FT                   IARGLAKIAAGTSVTVNSVLPGPTMSEGVRAMLKATADETGRSIDEVAVDFVRSQRASS
FT                   IIQRPATTEEVANLVVYVCSPQASATTGAALRVDGGVVDTIA"
FT   sig_peptide     complement(557873..557947)
FT                   /locus_tag="Bamb_3704"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.830) with cleavage site probability 0.772 at
FT                   residue 25"
FT   gene            558109..558957
FT                   /locus_tag="Bamb_3705"
FT   CDS_pept        558109..558957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3705"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; AraC protein, arabinose-binding/dimerisation;
FT                   KEGG: bur:Bcep18194_B1732 transcriptional regulator, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3705"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89259"
FT                   /db_xref="GOA:Q0B9B4"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9B4"
FT                   /protein_id="ABI89259.1"
FT                   /translation="MSRSANTVVVPSPFWRDAALPFIEARTVDDGRTICYAKHTHDTFS
FT                   LGAIVGGTSTYLNGATKEHVGRGVLVIIDPEQVHACNPYGPDAWAYRMVYVDVPWLARL
FT                   QHSLGRDPNSDFHGFSPKLTERRDLFAQFGRFYRTLVAPGVDPLGKESAAVEFFTGLHG
FT                   ALDRELPDDARRGADNAKLARAADYIAAHCRQAVTLDAICAAADLSPSYLIRAFNARYG
FT                   MTPHAFLIDRRVQYGRAELRRGRPIADVALDAGFADQAHFQRAFRRIAAATPGQYRSAA
FT                   S"
FT   gene            complement(559053..559658)
FT                   /locus_tag="Bamb_3706"
FT   CDS_pept        complement(559053..559658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3706"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bur:Bcep18194_B1731 lysine exporter family protein
FT                   (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3706"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89260"
FT                   /db_xref="GOA:Q0B9B3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9B3"
FT                   /protein_id="ABI89260.1"
FT                   /translation="MSMLVSMAAFALASSITPGPVNIVALSAGARHGLGASLRYAAGAT
FT                   LGFVALFLLIGLGLHAALARWPMLTTATQWAGIAFLLYLALRLALDDGRLSANPADPDA
FT                   PNVAGPSAAAGAAMQWLNPKAWLACVAAMGAYAADGDRAQVWQFAALYLVICFASIACW
FT                   AYAGASLRHRLANARRMRLFNRAMALLLAGSALYLLDI"
FT   sig_peptide     complement(559581..559658)
FT                   /locus_tag="Bamb_3706"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.901) with cleavage site probability 0.497 at
FT                   residue 26"
FT   gene            complement(559754..561202)
FT                   /locus_tag="Bamb_3707"
FT   CDS_pept        complement(559754..561202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3707"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="TIGRFAM: heavy metal sensor kinase; PFAM:
FT                   ATP-binding region, ATPase domain protein domain protein;
FT                   histidine kinase, HAMP region domain protein; histidine
FT                   kinase A domain protein domain protein; KEGG:
FT                   bur:Bcep18194_B1730 heavy metal sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3707"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89261"
FT                   /db_xref="GOA:Q0B9B2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9B2"
FT                   /protein_id="ABI89261.1"
FT                   /translation="MKRSITLRLSAMFGIVSLLVFTLVGCGLFVMMERQLFAELRATID
FT                   TRAKVAQMIVSHATTAARGRLMQEKLADLEPPDGSTRYQIESPDADFRFGHPVNGVPVG
FT                   EPFGAFQQYALNDSSYDVMTKTVALAGSGERPDLKLIVATSCERTQRMLRRFAWTLAAL
FT                   IATATVITLLLSRAVARFGLAPLERLSQDAAAISATNRRQRLHTDALPTELRDLAASFN
FT                   GALERIQQTYARLEAFNADVAHELRTPISILIGQTQVALTSRDRSVDRMRQTLQSNLEE
FT                   FERLRVIINDMLFLSRSDRGERATDLKHVSLADEVRRMLDFLEIPLDEAQLRAELHGDA
FT                   RAAVDPSLFRRAMTNLLINAIQHSAPGATLNVTITRRDTLVDVSVANPGEPIDPAQRAH
FT                   VFERFYRLEEARANSKENHGLGLSIVKAVAEMHGGSVFVACSDGINTFGFSVSTQPCSG
FT                   DPLPAPDAGNPHPLQPAPAPRALH"
FT   sig_peptide     complement(561125..561202)
FT                   /locus_tag="Bamb_3707"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.947) with cleavage site probability 0.565 at
FT                   residue 26"
FT   gene            complement(561199..561894)
FT                   /locus_tag="Bamb_3708"
FT   CDS_pept        complement(561199..561894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3708"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; KEGG: bur:Bcep18194_B1729 two component
FT                   heavy metal response transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3708"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89262"
FT                   /db_xref="GOA:Q0B9B1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9B1"
FT                   /protein_id="ABI89262.1"
FT                   /translation="MKVLIVEDEPKVVEYLKSGLTEEGWVVDTALDGEDGAWKAIEFDY
FT                   DVVVLDVMLPKLDGFGVLRALRAQKQTPVIMLTARDRVDDRVRGLRGGADDYLTKPFSF
FT                   LELIERLRALTRRARVQESTLISIGDLRVDLIGRRATRDGTRLDLTAQEFQLLGVLARR
FT                   SGEVLSKTTIAELVWDVNFDSNANVVETAIKRLRAKLDGPFAEKLLHTIRGMGYVLEAR
FT                   EEGDAERHA"
FT   gene            complement(561918..563420)
FT                   /locus_tag="Bamb_3709"
FT   CDS_pept        complement(561918..563420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3709"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bur:Bcep18194_B1728 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3709"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89263"
FT                   /db_xref="GOA:Q0B9B0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9B0"
FT                   /protein_id="ABI89263.1"
FT                   /translation="MRAGLRPTAAVAAVTAVALAALAGCTVGPDYRRPAVDTPAAWRLD
FT                   PADAYWHPAAPARAPLDPAWWTAFGDAQLDALEADALRNNQSLKAVAARYDQAKATLAS
FT                   VASAQYPAVGLNASGQRFKISADRPQTNYATKSMSTVQNEIQVGASVSYELDLFGRVRR
FT                   SVESAQAGSEQARDDFANARLVLSADLASSYFALRELDTEIDVVKRSIDLQQKALDYVS
FT                   ARHELGAVSGLDLFQQRSQLDATRTQAQLLIQQRAQVETAIATLVGTPAPAFSLPPRVV
FT                   PINAPALPTGMPSDLLQRRPDVASAERAMAAANAQIGVARAAYFPRIALSPDIGWDATR
FT                   FSGLFTVPALLWSLGASVSQPLFEGGKLKAGVDFAQAGYVAAQASYRQTVLTAFQEVQN
FT                   AVTGLSVLAQAAQQASAAVDDARKLVSLAQDRYTGGLTPFIDVLTAQQQLLTSERQAVQ
FT                   IQGQRAALVVFLAKALGGGWDDGATPTDVATVSPPPAAGVGP"
FT   sig_peptide     complement(563349..563420)
FT                   /locus_tag="Bamb_3709"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.997) with cleavage site probability 0.591 at
FT                   residue 24"
FT   gene            complement(563426..564658)
FT                   /locus_tag="Bamb_3710"
FT   CDS_pept        complement(563426..564658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3710"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bur:Bcep18194_B1727 secretion protein, HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3710"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89264"
FT                   /db_xref="GOA:Q0B9A9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9A9"
FT                   /protein_id="ABI89264.1"
FT                   /translation="MEEKHHSSVGIQVDEHGMHLPTRTSVSRRARVVLIVIGVLLAAGA
FT                   ARTIIVNVLNRGRLDAVAEQNTRQYVSIVHPVDAATGGKLTLPGTLRGFVEAPIYARAS
FT                   GYVLRWQADIGAHVKQGQLLAELDTPELNQELAQATAQRQQAQAALALAKTSFDRAQQL
FT                   RQRDAVSQQELDDRQGAFNQGTANLAAADANMRRLTELKGFQRIVAPIDGVVTQRNVDV
FT                   GDLVNSGNAGRSLFTVVQADRLRLYVQVPQAYAQQVKVGQHVGVAQAELPGKTFDGTVT
FT                   RTSQAIDVATRSLQIEITLPNPDGRLLPGAYVQATLPMTPVGRLQIPANTLLFRAEGPT
FT                   VATVDTNGQVRLKAVTVVRTIGQTLEVDGPLTPSDRLVANPSDALANGDPVVVQAPPVA
FT                   KPASAAAGAKS"
FT   gene            complement(564698..567865)
FT                   /locus_tag="Bamb_3711"
FT   CDS_pept        complement(564698..567865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3711"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   bur:Bcep18194_B1726 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3711"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89265"
FT                   /db_xref="GOA:Q0B9A8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9A8"
FT                   /protein_id="ABI89265.1"
FT                   /translation="MWIVNLALRRPYTFIVMAVMIVLATPLALMRTPVDVLPAVNIPVI
FT                   SVIWNYNGFSASEMTNRITAVHERILTTTVNNIEHIESTSLPGIAVVKVFLQPGANVQT
FT                   AIAQTVSSAQAIVRQMPQGATPPLVITYSASSIPVIQLGLSSKTLSEQSLADIALNFLR
FT                   PQLITVRGAQIPFPYGGRTRVVAIDLDPQVLLAKGLTPADIVNAVNTQNLVLPTGTAKM
FT                   GQSEYRIDTNASADTIADINDLPIQTVNGATTYLREVASVRDGFAPQTNVVRQNGQRGV
FT                   LMSILKTGDASTLKVVSDLKALLPKVIPTLPEGLTITPLFDQSVFVNAAVQGVIHEALI
FT                   AAVLTAMMILLFLGNWRSTLIIAISIPLSIFTSLIALSALGETINIMTLGGLALAVGIL
FT                   VDDATVTIENIERHLHLGTGVHDAILEGAGEIAVPAFVSTLCICIVFVPMFFLTGVARF
FT                   LFVPLAEAVVFAMLASYVLSRTLVPTLAMLLFRPQQAGTGPDRSTSRFARIHHAFNGAF
FT                   ERLRAWYIVLLSMLLVRRRFYAMCFLGFCVLSTGLVFVLGRDFFPNADSGNIRLHLRAP
FT                   TGYRIEETARLTDQVERVIREAVPPDELGAIVDNLGLPVSGINLSYSNSGTIGSLDGEL
FT                   LIALKPGHRATAHYVQTLRTLLPRRFPGVEFFFQPSDIITQILNFGQPAAIDVQVLGND
FT                   LASNMTIASSLMKKIRHIPGAVDVHVLQRNDEPTLVADMDRTRMQQLSLSAQNVAQNML
FT                   ISLSGSSQTTPSFWLNPRTGVQYPLQIQTPQYNISSIDDLLGTPVSASGRTGMPPQLLG
FT                   NLVRVHPVASPAVVTHYNIRPAIDLYVSVEGRDLGSVAGEIDRIVSDAHATLPRGTELS
FT                   VRGQVETMRTSYLGLGAGVAMAIVLVYLLIVVNFQSWLDPLIIISAMPAALAGIAWMLF
FT                   ITGTHLSVPALTGAIMTVGVATANSILVVSFARQRLAAGAPPLTAALEAGATRIRPVLM
FT                   TALAMIIGMVPMALGLGEGAEQNAPLGRAVIGGLLFATVSTLLFVPLVFGGVHARLARR
FT                   RARQAGH"
FT   gene            complement(568093..568872)
FT                   /locus_tag="Bamb_3712"
FT   CDS_pept        complement(568093..568872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3712"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG:
FT                   bur:Bcep18194_B1725 cyclic nucleotide-binding domain
FT                   (cNMP-BD) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3712"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89266"
FT                   /db_xref="GOA:Q0B9A7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9A7"
FT                   /protein_id="ABI89266.1"
FT                   /translation="MHDPLAAPPDAIAISANLPADTPVDTLPEPGPLPALSALFGQCAW
FT                   FRALAPEHQALVLAQSRAEQREAGDVIAQRLAPSEYWIGVHRGLLKLAIFNASGRGCTF
FT                   SGVPSGGWFGEGSVIKRELRKYEVVAVQRSTVLFVPVDTFHALLDTSLPFTRFVIHQLN
FT                   NRMGEFIASIQNSRLLDVDARVAQALAQLFNRDLYPDTGPSLAISQEELGMLVGVSRQR
FT                   INQALQQLEKRGVLRLAYNQIEVVDLAALARVGMEQI"
FT   gene            569089..570741
FT                   /locus_tag="Bamb_3713"
FT   CDS_pept        569089..570741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3713"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bur:Bcep18194_B1724 acyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3713"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89267"
FT                   /db_xref="GOA:Q0B9A6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9A6"
FT                   /protein_id="ABI89267.1"
FT                   /translation="MTQMFEAGLGRRDANYVPLTPIDFLVRAAEVYGERLAVVHGDVRR
FT                   TWGETHKRAKQLASALAQAGVARGDTVAAVLPNIPAMVEAHFGVPMAGAVLNTINTRLD
FT                   ISSVLFMLRHGEAKVLIVDTEYADLAHRAAREVPGLKIVSVADAMPADPARFAGATDYE
FT                   AFVAGGDPDYAWTPPADEWEAIALNYTSGTTGDPKGVVYHHRGAYLAAISNILEWDMPK
FT                   HAVYLWTLPMFHCNGWCFPWAVAARAGVNVCLRKFDAKTVFDLIRSERITHYCGAPIVQ
FT                   SAIANAPAEFRAGIDHTVHAMVAGAAPAPAVIAKMKEIGFDLLHVYGLTEVYGPATVCA
FT                   KQAHWDALPDDERARLNARQGVRYHLEAGATVLDPDTMTPVPADGETLGEIMFRGNICM
FT                   KGYLKNPKATDEAFHGGWFHTGDLGVLTPDGYIRIKDRRKDIIISGGENISSIEVEDAL
FT                   YRHPAVAVAAVVAMPDPKWGEVPCAFVELREGASATEEEIVAHCKQLLAGFKVPKAVRF
FT                   GELPKTSTGKIQKFQLRNEVGSGKAIDLAGDKK"
FT   gene            complement(570785..572767)
FT                   /locus_tag="Bamb_3714"
FT   CDS_pept        complement(570785..572767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3714"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: tar; methyl-accepting
FT                   chemotaxis protein II"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3714"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89268"
FT                   /db_xref="GOA:Q0B9A5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9A5"
FT                   /protein_id="ABI89268.1"
FT                   /translation="MRLTQLGRVSVGARLAALACALVALLFTVFAWTLAHFAGQQLAEE
FT                   AHLRIVDKEQSIRAMVDLFDKALTAEANRSMSLFASFLPADFSLDPARTVDIGGVPAPT
FT                   LFAGGQPLDLDYAIPDQFLKKSGAIATIFARDGDDFVRITTSLKKQDGARAVGTKLDRA
FT                   GPAYAPLVAGRSYTGLAKLFGRPYITQYKPVTDATGRVIGALFVGLDIGTELKLVEDGI
FT                   RSLKIGDNGYYFVLDASQGPSRGTFVVHPDAAGQPADDKRAPYAQMLAAGEGRLAYTST
FT                   DPAAHDSGPTAKFVSFTTIPQWQWLVGGIALDDELLATMRATRNRFLMIGAVLVAAFAT
FT                   LFVIVVRRVVSRPLEAAARASERYAAGDLSVRIRDGAAAHGSAGNDEIGRLVQAVDGIG
FT                   DGLARIVAQVRNSSADIAHGTVGIAAGSGDIAARIATQASSVEQTAASMEQITAAVQQS
FT                   AEHAAQANALVADASAAATNGDAAVQRVVATMDDIGRATRRIAEITGAIEGIAFQTNIL
FT                   ALNAAVEAARAGEHGKGFAVVAAEVRALAQRSAAAVKEIDALSTESSTTVEQGYRIADA
FT                   ARGTMRDIVARVDQVRTLIGEISAASREQSTGIEQVNLAVTQIGEATQQNATLIADAER
FT                   AAVALRDQAAQLSDAVSVFRLERDA"
FT   sig_peptide     complement(572672..572767)
FT                   /locus_tag="Bamb_3714"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.596 at
FT                   residue 32"
FT   gene            complement(572908..573339)
FT                   /locus_tag="Bamb_3715"
FT   CDS_pept        complement(572908..573339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3715"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: bur:Bcep18194_B1716 membrane protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3715"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89269"
FT                   /db_xref="GOA:Q0B9A4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9A4"
FT                   /protein_id="ABI89269.1"
FT                   /translation="MSELLTYGGLFAVSMVAATLLPLQSEAVLAGLLLAGREPVWALLL
FT                   VASVGNVAGSVINWALGRGIEHFRDRRWFPIKPAALARAERWYARYGRWSLLLSWAPVI
FT                   GDPLTMIAGVLREPLPGFLAIVTIAKVGRYLAVAWLVTH"
FT   sig_peptide     complement(573256..573339)
FT                   /locus_tag="Bamb_3715"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.819) with cleavage site probability 0.461 at
FT                   residue 28"
FT   gene            complement(573388..574563)
FT                   /locus_tag="Bamb_3716"
FT   CDS_pept        complement(573388..574563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3716"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; Ion transport protein;
FT                   Ion transport 2 domain protein,; KEGG: bur:Bcep18194_B1715
FT                   TrkA-N, putative potassium channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3716"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89270"
FT                   /db_xref="GOA:Q0B9A3"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9A3"
FT                   /protein_id="ABI89270.1"
FT                   /translation="MKHVTTRLRRLFAPIGLHWYLALLLTLDALMVLRPVVAHAQLGAH
FT                   HAWLTDALNLVDNAGLVVLPQVVVAAGLATMAIGIVLRARVAWVLSILLLVAAAAISLL
FT                   GGYRSNAVIVYTAVLAVALIYYWRHFDRASVAASSLFALLSIVSLLIYATFGVLYLGDE
FT                   FTPPVHDLATAVYFSIVSMSTVGYGDIVPHAPTARLFTASVIVLGITVFATSISAVVGP
FT                   VIGGNLKRIVKGGISNVIRKHHFLIVGATPVAHAVHDGLRKRGYAVTVIVPAGVEHNYA
FT                   GTTDLIVGDATDHAVLESAGAATARAVLALRSDDAENAFIILAIREIAPTVRTVALVNH
FT                   QRNLERLRLLKPDMVFSPQQLAGELLASTLNDEPVDKSMISHLLFGTADAA"
FT   sig_peptide     complement(574441..574563)
FT                   /locus_tag="Bamb_3716"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.792) with cleavage site probability 0.515 at
FT                   residue 41"
FT   gene            complement(574684..575337)
FT                   /locus_tag="Bamb_3717"
FT   CDS_pept        complement(574684..575337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3717"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bur:Bcep18194_B1714 lysine exporter family protein
FT                   (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3717"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89271"
FT                   /db_xref="GOA:Q0B9A2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9A2"
FT                   /protein_id="ABI89271.1"
FT                   /translation="MSFRLYLSFLAASAVLIYAPGPVNLLTMNQALRAGWRRALPCVWG
FT                   GTLAVLLQLALTALCLNSLVHLDEHALTVLRWAGAAYLVWLGCKQWLSRAPATASAAPA
FT                   ASAETGIAAPDTDTGRALFWRGVATSGLNPKTLLFFPSFFPQFIVPNADWSLNAQFLLL
FT                   ATTFALLFAGGVASMALFSHRLSRALRRPARMRAMNRVTGGLLVGMGAIMVGWN"
FT   sig_peptide     complement(575260..575337)
FT                   /locus_tag="Bamb_3717"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.860) with cleavage site probability 0.675 at
FT                   residue 26"
FT   gene            575621..576103
FT                   /locus_tag="Bamb_3718"
FT   CDS_pept        575621..576103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3718"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   bur:Bcep18194_B1713 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3718"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89272"
FT                   /db_xref="GOA:Q0B9A1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9A1"
FT                   /protein_id="ABI89272.1"
FT                   /translation="MATRERTPKTLDNQDRKILGALQKNARLSNAELAEQIGMSTTACW
FT                   NRTRQLELDGYIDGYVALVNQRMLGYADIVILEVTLDRHEDDALARFGAELAALPEVLE
FT                   AYLVSGEYDYWIKVAVDGTAGYERFLREKLYRISSIRHSRSMFALRCMKDVPSIQV"
FT   gene            576156..576737
FT                   /locus_tag="Bamb_3719"
FT   CDS_pept        576156..576737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3719"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3719"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89273"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B9A0"
FT                   /protein_id="ABI89273.1"
FT                   /translation="MRKGGNRAVAANARGPEPDRGGKFEQGGKTDESSVPTHSILAPPL
FT                   KFRLTALTLRERVTHIGAVRLFQRYPSGHRCRTRRPCGARPGKRINRTFLPPAGGHRLR
FT                   SARQACVRLGDDFAVLEVQCPCFCKQFANTCEPASGLGGTIGNVRRLHDEAPYRWRVRD
FT                   NPNHRGASPLCEMRFRYMRITDNLCCCSAT"
FT   gene            complement(576825..578489)
FT                   /locus_tag="Bamb_3720"
FT   CDS_pept        complement(576825..578489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3720"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG:
FT                   bur:Bcep18194_B1712 transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3720"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89274"
FT                   /db_xref="GOA:Q0B999"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B999"
FT                   /protein_id="ABI89274.1"
FT                   /translation="MQNHEVSADDAPPKAQRGIQSVEVGGRLLDALARRRKPLGLSELA
FT                   AAAGLSTAQAHTYLVSLTRLALVKRDALTGNYEPGPLSLRLGLMSIERQPAYRAALPHA
FT                   ARLAEAVGLSVALSVPGVLGPTIVRIEHGGYPLHVNLHVGSVMSLDTTATGRVFRAFGD
FT                   PALLDAMAASQAGAGDTLAGAEGEQPTSDAGAWQAELDAIRARGIERGVDRPSPGVSAM
FT                   CVPVLDADGRLQLALTVIGSTGSIDVGWDGPIATALRDAARQATASLDAGRDAQPGAPA
FT                   AAPSVQRLPPALADDTKAQRGINALDSTGDLLLALVSAGRALPLRDLAAAAGMPAAKAF
FT                   PHLVSLQKIGLLSRDDAGCFGGGPLGQALGLIAMQRVSPTRDAEAEIVALAAATDMSVA
FT                   AATLGPLGPTVIRLEESARPQHVSLQVGTVMSLVNTAIGRIFAAGMPDDVLAGLLADEP
FT                   VRLAGRAMEVDDAFRARLATIRTDELDFAFDAPVPGIGTIAAPVFDHTGSIRLVIAIIG
FT                   SSRGFPRGPDSALAHTLLAATRRLSWRFGWIGESSSP"
FT   gene            578607..579626
FT                   /locus_tag="Bamb_3721"
FT   CDS_pept        578607..579626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3721"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bur:Bcep18194_B1711 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3721"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89275"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B998"
FT                   /protein_id="ABI89275.1"
FT                   /translation="MQVDDPLTPLNTWLEATERNMAKAFASQADLEVKKITWTQLSENA
FT                   YAYTAEGDPNSGVIVGDDSVLIVDTTATPAMAQDLIAKIRSVTDKPIKHVVLSHYHAVR
FT                   VLGASAYFAEGAQHVIASRGTYEMIVERGEADMKSEIERFPRLFAGVETVPGLTWPTLV
FT                   FEREITLFLGKLEVKIMHVGSGHTKGDTIVWLPSQKVLFSGDLVEYDAACYCGDAQLEQ
FT                   WPTTLEALRALGAEKLVPGRGPALLTPADVNKGLDYTKDFVTTLLAQGRKAVERKLDLK
FT                   ASMALTREAMDPKFGNVFIYEHCLPFDVSRAFDEASGITHPRIWTAQRDKEMWDALQD"
FT   gene            579809..581188
FT                   /locus_tag="Bamb_3722"
FT   CDS_pept        579809..581188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3722"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B1710 major facilitator superfamily (MFS_1)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3722"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89276"
FT                   /db_xref="GOA:Q0B997"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B997"
FT                   /protein_id="ABI89276.1"
FT                   /translation="MPQSLPAKATIAHASAAASASVYESAPASDAGDALLFRKIAWRIV
FT                   PFLFLCYVVSFLDRINIGFAQLQMKHDLGFSDAMYGLGAAVFYVGYVFCEVPSNLLLAR
FT                   FGARRTFTRIMLLWGIASTGMMFVSQPSHFYVLRFLLGVFEAGFFPGIVLYLTYWFPAN
FT                   RRAAAISVFFAGVAVAGVLGGLVSGWIMRDMSGVLGLHGWQWMFAIEGAPAIVLAGFAF
FT                   TYLVDRPQDAAWLTSDEKARVAALCGDSRPHGAGHGAHEKRSLLAALANPRVYLFAFIY
FT                   FSLTCASLTLNFWMPLMIRDFGVTDVVAVSLYTVVPNAVGAVGLILIARRSDRTGERRK
FT                   HFACCTIGGGLALAALTLHLHSFAAMLACLSIAATLIFAALPIFWAVPTRYLSGNAAAA
FT                   GIALISSIGITSGIVSPWVIGLIRTRTGSMDLAVYLLAALLALSGAALMLGVKGEGAPR
FT                   A"
FT   gene            complement(581390..582190)
FT                   /locus_tag="Bamb_3723"
FT   CDS_pept        complement(581390..582190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3723"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bur:Bcep18194_B1706 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3723"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89277"
FT                   /db_xref="GOA:Q0B996"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B996"
FT                   /protein_id="ABI89277.1"
FT                   /translation="MTEAHRGTAVITGASSGIGAIYADRLARRGYDLILVARNRDRLTA
FT                   LAERITNDTQRSVEIVGADLNDRAELAAVEAKLKQDASITLLVNNAGVGTHAPLLDSDV
FT                   DAMTRLIDLNVTALTRLTYAAVPGFVARGRGAVINISSIVALSPETLNGVYGGSKAFVL
FT                   AFSQSLHHELADHGVQVQAVLPGATATDFWQTGGLPLEHLPKEIVMSASDLVDAALVGF
FT                   ERGELVTIPSLHAADEWDAYEAARRTMAPHLSTDSPAPRYAAAR"
FT   gene            582298..583290
FT                   /locus_tag="Bamb_3724"
FT   CDS_pept        582298..583290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3724"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; ThiJ/PfpI domain protein; KEGG:
FT                   bur:Bcep18194_B1705 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3724"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89278"
FT                   /db_xref="GOA:Q0B995"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B995"
FT                   /protein_id="ABI89278.1"
FT                   /translation="MTTVTPAAETRMHRIGFLISDGFQIMALAAQSVFEYANMGAGEPF
FT                   YVLDNYSVDGGDVRSSLGLPVATRALSGRIDVDTWIVAGVNDPVASPAPAGVVAFLRHP
FT                   NARARRIAGICTGAFVLAEAGLLAQRRATTHWAYGRDMQKHFPEVRVEEDRIYIVDGPI
FT                   WTSAGMTAGLDLALAMVEKDLGADAARSVAHKLVMHQRRAGGQSQHSEMLDLAPKSDRI
FT                   QNALNYARQHLGRALTVEELADAAHLSPRQFSRVFTLETGQSPAKAIERLRLEAARLMI
FT                   EQSRHSLDVIAKENGFRDRRHLRDAFVRGFGVPPQAVRRDARADERETA"
FT   gene            complement(583301..583792)
FT                   /locus_tag="Bamb_3725"
FT   CDS_pept        complement(583301..583792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3725"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: bur:Bcep18194_B1703 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3725"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89279"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B994"
FT                   /protein_id="ABI89279.1"
FT                   /translation="MTQPSAPLPTDLPPISCLPGDALPWLPMSADLPGLAIKYLHINAA
FT                   EDTLTALLKMPAGGTLPRHRHDGEVFVHTLQGAWRYREYDWIAQAGSTVLEPAGSVHTP
FT                   ETLGAPGDDVITLNVMRGDLVLLDDDGRETARENCRVALLRQRKHARAAPHDATAFVTR
FT                   "
FT   gene            583959..584429
FT                   /locus_tag="Bamb_3726"
FT   CDS_pept        583959..584429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3726"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG:
FT                   bur:Bcep18194_B1702 transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3726"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89280"
FT                   /db_xref="GOA:Q0B993"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B993"
FT                   /protein_id="ABI89280.1"
FT                   /translation="MNTPSSSPETPPLAGLAGELRISVSKLMRRLREQTHPNDLTSSQK
FT                   SVLLRLDRDGPATVSALARAESVRPQSMRVTVATLEARGAVSGAPDPTDGRQTLIALTP
FT                   DFRKRLQANRAAKDDWLFRALHAQLSAHEQAELASAVQLMQRLAEFQDAARP"
FT   gene            584574..585824
FT                   /locus_tag="Bamb_3727"
FT   CDS_pept        584574..585824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3727"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF894, DitE;
FT                   major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B1700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3727"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89281"
FT                   /db_xref="GOA:Q0B992"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B992"
FT                   /protein_id="ABI89281.1"
FT                   /translation="MSVPAAGVFRSLRSFNYRVWAAGALVSNVGTWIQRTAQDWLVLTQ
FT                   LTHHDASAVGIVMSLQFGPQLLLLPWTGYAADRFNQRRLLMATQALMGGLALALGLLTV
FT                   AGVVQLWHVYLFAFLFGCASAFDAPVRQTFVAELVGDRELANAVALNSTSFNAARMIGP
FT                   AVAGFIIASVGTGWAFLLNGVSFVAVLASLSLLRADELRENTRAVHTRGSLLDGFRYVW
FT                   RRPDLKATLAMLFLIGTFGLNFPLFISTMAAGVFHVDARGFGILSSMMAVGTISGALLA
FT                   ARRERPRFRHLWIGAAVFGIGCTLGAIAPSYWLFAAALVLTGIAAMTFTTSTNALMQLS
FT                   TEPAMRGRVMALRLAVAFGGTPIGAPVAGWVANHLGPRWALGVGAASGFAATLVAVVFL
FT                   IQMTRQSLPEGGAGGGA"
FT   gene            complement(585831..586877)
FT                   /locus_tag="Bamb_3728"
FT   CDS_pept        complement(585831..586877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3728"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B1699
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3728"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89282"
FT                   /db_xref="GOA:Q0B991"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B991"
FT                   /protein_id="ABI89282.1"
FT                   /translation="MMLRIVGRPISLLNIAISMFTCSSMQAKKPKSRALLGQLSDMDLR
FT                   LLRVFKGVVQCGGMAAAELELNIGISTISRHVKDLETRLGLVLCRRGRAGFTLTAEGQT
FT                   VYEETLRLLASMEAFRSRIDGIHDKMGGELHIAVFDKTATNPKARLGDAIRQFADDAPD
FT                   VALNLHVASINEVERGIIDGSYQVGIIPAHRNSGSLVYSELFDERMLLYCGRQHPLFDA
FT                   PHGKLTWTTIRNHAFAGLGFHSPNMELSHRAKLTRSATASDQESIATLILSGRYLGFLP
FT                   DHYAESFENKGLMQAIAPHRFNYRCRFVSLLRRSPRPSRAALLFQSCLEAAHAAVRLGG
FT                   DGGDGGDA"
FT   gene            586911..588269
FT                   /locus_tag="Bamb_3729"
FT   CDS_pept        586911..588269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3729"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   bur:Bcep18194_B1698 beta alanine-pyruvate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3729"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89283"
FT                   /db_xref="GOA:Q0B990"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B990"
FT                   /protein_id="ABI89283.1"
FT                   /translation="MTNTITTRQQDETDLRTDAAWLDAHWMPFTANRQFKSDPRMIVAG
FT                   KDAYYTDGEGRKIFDGLSGLWCTGLGHGRAEITEAVSRQVAQLDYAPAFQFGHPKSFEL
FT                   ANKIKDLTPAGLDYVFFTGSGSEAADTSLKMARAYWRAKGKGTKTRLIGREKGYHGVNY
FT                   GGISVGGIGPNRKLFGQGIDADFLPHTQLAENKFSRGMPENGADLADRLLDLIALHDAS
FT                   NIAAVIVEPFSGSAGVVVPPKGYLKRLRDICTAHDILLIFDEVITGFGRAGAMTGADAF
FT                   GVTPDIMNFAKQVTNGVQPLGGVIATKEIYDTFMAVGGPEYMLEFPHGYTYSAHPVACA
FT                   AGVAALDLLVKEDAVARVRDLAPHFEAAVHGLKGQRHITDIRNYGLAAGLTIAALPGEP
FT                   ARRPYEIAMRCWAKGFYVRYGGDTIQLAPPFISEKREIDNLVNALSDALNEVD"
FT   gene            588318..589835
FT                   /locus_tag="Bamb_3730"
FT   CDS_pept        588318..589835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3730"
FT                   /product="methylmalonate-semialdehyde dehydrogenase
FT                   (acylating)"
FT                   /EC_number="1.2.1.27"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: aldehyde dehydrogenase; KEGG: bur:Bcep18194_B1697
FT                   methylmalonate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3730"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89284"
FT                   /db_xref="GOA:Q0B989"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B989"
FT                   /protein_id="ABI89284.1"
FT                   /translation="MKHDSNVTSTVGHLIDGKRVDGGSRVQPVFDPATGESHKSVALAD
FT                   KLTVEAAIASAQAAFPAWRNTPPLKRARVMSRFKTLLEEHADELCALITAEHGKVLADA
FT                   MGELQRGIENVEYATYVPELLKGEHSKNVGPAIDSWSEFQALGVAAGITPFNFPVMVPL
FT                   WMWPMAVACGNTFVLKPSERTPSSTLRMAELALEAGLPPGVLNVVNGDKEAVDTILTDA
FT                   RVKAVSFVGSTPIAEYIYSTGCAHGKRVQALGGAKNFAVVMPDADIGNAVNALMGAAYG
FT                   SCGERCMAIPLVVAIGDETGDKVVQGLKAEIEKMKVGPGNGAGVDMGPLVTKQHFDKVT
FT                   GFVEAGVEAGATLVVDGRGVKVDGHDGGYYLGPCLFDHVKPGMPIYQHEIFGPVLGVIR
FT                   LKSLDDAMALIDAHEYGNGTCLFTRDGEAARYFSDNIQIGMVGINVPLPVPVAYHSFGG
FT                   WKRSLFGDLHAYGPDAVRFYTKRKTITQRWPSAGVREGTVFSFPSNR"
FT   gene            complement(589998..590372)
FT                   /locus_tag="Bamb_3731"
FT   CDS_pept        complement(589998..590372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3731"
FT                   /product="Secreted repeat of unknown function"
FT                   /note="PFAM: Secreted repeat of unknown function; KEGG:
FT                   bur:Bcep18194_B1696 secreted conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3731"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89285"
FT                   /db_xref="InterPro:IPR005297"
FT                   /db_xref="InterPro:IPR014558"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B988"
FT                   /protein_id="ABI89285.1"
FT                   /translation="MKAVLLVSSAVLAMASVSASAQGSITKVENGALVAANGMTVYAFD
FT                   KDKPNAGTSACSGPCETLWPPYKASATDVPAGPYTIVKRDDGSPQWAYKGKPLYFFSKD
FT                   MKQGDRNGDNFKNVWHVVAP"
FT   sig_peptide     complement(590307..590372)
FT                   /locus_tag="Bamb_3731"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.897 at
FT                   residue 22"
FT   gene            complement(590679..591689)
FT                   /locus_tag="Bamb_3732"
FT   CDS_pept        complement(590679..591689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3732"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG:
FT                   bur:Bcep18194_B1694 auxin efflux carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3732"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89286"
FT                   /db_xref="GOA:Q0B987"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B987"
FT                   /protein_id="ABI89286.1"
FT                   /translation="MDPRFAPLLRLPAVPPGPSHPPEGAPMIGPILLALAPVALLVAFG
FT                   HGLRRTGFIGDAFWPHAERLCYYVLLPALFAHGLANARLQSLPVLPLAAALVGSTVLVA
FT                   ALLLLVRRFVQVDGAGFTSVFQGAVRFNNYVGTALAAGLFGAHGIALAAVCVAAIVPTV
FT                   NLMCVLVFARYGETRLGSGALVRQILSNPLVVGCALGIAMQAAGVGFPAAVEPAVRALG
FT                   AASMPLGLLCVGAALKFDAARAWMQPMCIASAFKFLAMPLVTLAAGRLFGLGDAALTIA
FT                   LLFQALPTSSSSYIMARQLGGDAPLMAGITAFQTIIAALAMPAVLTALASAPVFR"
FT   gene            complement(591786..592736)
FT                   /locus_tag="Bamb_3733"
FT   CDS_pept        complement(591786..592736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3733"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B1693
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3733"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89287"
FT                   /db_xref="GOA:Q0B986"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B986"
FT                   /protein_id="ABI89287.1"
FT                   /translation="MRRRRHHRAIRVPAPAAHLTESMSLRAFRTLVAIARYRTFARAGE
FT                   AIGLTQSAVSLQIKALESEYNVQLFDRSRRQPVLTEAGNILVAQAEQVLAMVDRIPDAL
FT                   SDEKKLVGRLRVGAIQTALSGPLPDALLALRDAHPSLRVHVSAGMSAELANRVAAGELD
FT                   AAITTRPVRPHPAELTWTTLYEDRFWLLAPPHYAERDARTLLEALPFIRFDAQAWAGRM
FT                   IAAELRRIGVRVREEMVLDSAETIARMVARGLGAAIVALPDSTLARLPPVTRLPFGQPQ
FT                   MGRAVVLLEHRSRPAERFARALGAEITASSMRISH"
FT   gene            592960..593337
FT                   /locus_tag="Bamb_3734"
FT   CDS_pept        592960..593337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3734"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll7164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3734"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89288"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B985"
FT                   /protein_id="ABI89288.1"
FT                   /translation="MPDDPGDVARASYRAYVDKDRDAIEALIAPDFHFTSPLDNRLDRD
FT                   AYLARCWPNSAMLAGFDFVDVAVHGEYVFVVYEAETSAGRRFRNAERLRVRGGRIVEAE
FT                   VYFGWYVPHQAPDGGFIESGR"
FT   gene            complement(593356..594156)
FT                   /locus_tag="Bamb_3735"
FT   CDS_pept        complement(593356..594156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3735"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein, LuxR; KEGG:
FT                   bur:Bcep18194_B1686 transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3735"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89289"
FT                   /db_xref="GOA:Q0B984"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B984"
FT                   /protein_id="ABI89289.1"
FT                   /translation="MDRLFSEIAMHQALGRAIDHLGQPRFWRFLVLLLNEMAPFDNALA
FT                   TAIGRDGVPLVLDEYDTGGTDSASPVPLYLNGLYLLDPFLQAAHDGLADGCYRLEEVAP
FT                   DLFRQSEYFLSYFRDAVGDDEIQILLRPNPDLLLSLSLGAATRFDVEPLGKLTAAMPWV
FT                   LAAIRQHWRLVGDAARATPDDDLGARVEQALARFGAGVLTDREMSIARMVLRGNSSKAI
FT                   AERLAISPETVKVHRRHLYAKLGISSQPELFSRFIQALGEHAAG"
FT   gene            594340..595746
FT                   /locus_tag="Bamb_3736"
FT   CDS_pept        594340..595746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3736"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bur:Bcep18194_B1685 amino acid transporter; TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3736"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89290"
FT                   /db_xref="GOA:Q0B983"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B983"
FT                   /protein_id="ABI89290.1"
FT                   /translation="MAMMSESTGTLQATPATEDAPRALSQTLSVRDAVMITVSGVTPAS
FT                   SIFVIAPFAIQQAGSGAVLSFLLGGVLALAFALCYAELSAAHRSAGGEYVMAKRVFGTL
FT                   PGYLTFITVLSVSVFIPAVLASGAAPYLNNALGTHFGNQSVALTIVLLSYVLGMLNIKT
FT                   NAWITGAFLVVEIGVLMLIAGLGFGAPHRGAEVLVAPVVASGNALVPATFAAIVPAIGT
FT                   AIFCYNGFGSAAYLAEDLRGGNRNVAKAVIYSLLVILVVELIPLTAIVLGAPSLTELTK
FT                   SADPIGYVVRSLSNPVVSRVVSGGIFLSVFNAIIAIVITMGRLLYSSGRHALWSRTCNR
FT                   AFSTIHPRFESPWLATLALAVPSSGLVFVSSLDELTAFTVDLLLLIYLVVGLAALASRF
FT                   VRRDVEHHYRMPLWPVTPLVAVAGAAYTLYTTLATATKSTDLIIIGALLVAALVMYAVW
FT                   ARHSDAFRAL"
FT   gene            595811..596920
FT                   /locus_tag="Bamb_3737"
FT   CDS_pept        595811..596920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3737"
FT                   /product="L-aminopeptidase DmpA, Serine peptidase, MEROPS
FT                   family S58"
FT                   /note="PFAM: peptidase S58, DmpA; KEGG: bur:Bcep18194_B1684
FT                   peptidase S58, DmpA"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3737"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89291"
FT                   /db_xref="GOA:Q0B982"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B982"
FT                   /protein_id="ABI89291.1"
FT                   /translation="MRTRDLGIRIGLGTPGRFNAITDVPGVRVGHCTLNVENGDASIRT
FT                   GVTVIEPRAGAAHDSPCFAGVHVLNGNGDATGLEWIREAGLLTTPIAYTNTHSVGAVRD
FT                   ALVANEREAAAGRVYWCMPVVMETYDGLLNDIWGQHVNAAHVQRALAAAQSGPVAEGGV
FT                   GGGTGMICHEFKGGIGTASRVVVADAGGWTVGALVQANYGVREMLRVAGYPVGEVLRHV
FT                   HSPFRAPDARGEAGMGSIVVTIATDAPLLPHQCTRLAQRASVGLARVGGGTEDSSGDIF
FT                   LAFATGNDGLPAANYGSKGAPTTAVTMVNNDHISALFAAAAEAVEEAIVNALVAGNDVE
FT                   SRGARVEGLGHARLLDALREVGWRPGRGA"
FT   gene            complement(597080..597292)
FT                   /locus_tag="Bamb_3738"
FT   CDS_pept        complement(597080..597292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3738"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1683 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3738"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89292"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B981"
FT                   /protein_id="ABI89292.1"
FT                   /translation="MKPLHLALVALSLTAAVAHAQPAPADHAQQPANRAEAVQAAGRVD
FT                   RAQSKQEDPNACVGPVSFCNVYFGS"
FT   sig_peptide     complement(597230..597292)
FT                   /locus_tag="Bamb_3738"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            complement(597462..599642)
FT                   /locus_tag="Bamb_3739"
FT   CDS_pept        complement(597462..599642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3739"
FT                   /product="Fusaric acid resistance protein conserved region"
FT                   /note="PFAM: Fusaric acid resistance protein conserved
FT                   region; KEGG: bur:Bcep18194_B1682 fusaric acid resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3739"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89293"
FT                   /db_xref="GOA:Q0B980"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B980"
FT                   /protein_id="ABI89293.1"
FT                   /translation="MKPQPAERPSIEPARWSAWLDPLGGAARDWAVSDGLIWLHLAKTV
FT                   FAALLAMGIAMRLEMSQPRTAMTTVFVLMQPMSGMVFAKSFYRVLGTAAGLVAALALGG
FT                   LFAQQPELYMAGITLWIGACIALAVRNRHFRWYGFVLAGYTAALIGLPAVMTPQTLFQS
FT                   ALTRAAEVALGIACSGAVSALILPLSSAKALMRSLSARHVKFPAFAAGALSGELARGDF
FT                   ERRFADFVDEIVGFEANRAFASFEDPHIRARSRRLARLNSEFMNACTRLHALHQLVKRL
FT                   RANRSDAVLDALAPHVDGLARHITALRDERQRGIASTTGALLELRRFHGALPKAARASR
FT                   RALEDHAAGGLLDFDTAIELTYRFIGEYVGYADTYASLDRDDHAFERSVTRYAVKTNSF
FT                   FVGFAFLRTLVAVGAMSAFWIASEWPSGSLAVIATAIACALSSTSPRASKFVAQMAVGA
FT                   AFATAVGYVFLCYVYPNIDGFPLLCAALAPVLGLGAFLAMRPGLSGYGIGFAVFFCLLA
FT                   GPDNAIAYTPEVLVNNGFAVVIAMLACSIVFAVVFPTHMPWLTSRIAHDLRRQVTLACE
FT                   GSREGLAARFQSSTHDLMAQLRTLLVRRTRQHRDALRWMLSTLEVGHAVIDLRDELHGF
FT                   CESKPPQTTRWTVSVDAVLHELPRFFDDPTPVHHARTLKSVNLAIRAAQHTLHAWYAVP
FT                   AERHRMQRIVGCLHFMRSALLDKDAPFNRHRH"
FT   gene            599834..600781
FT                   /locus_tag="Bamb_3740"
FT   CDS_pept        599834..600781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3740"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_B1681
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3740"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89294"
FT                   /db_xref="GOA:Q0B979"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B979"
FT                   /protein_id="ABI89294.1"
FT                   /translation="MDTLQNMRVFTRVVETGSFTAAAQSLNSTTGAMSRAVSELEARLR
FT                   TRLMNRSTRRLALTSAGESYLRRCRQILADVDRAEEEASCAHERPAGVLRMHSFASVGH
FT                   HYVMPALTRYHTQYPDVSIELSLSQRMPDLFDGTSDMAVVTASSLPDSELVSHLLGSTF
FT                   SILCASPEYVKRHGAPARPQDLGAHACLTLCTPAFPTHEWVLEGAEGVEQIHVAGPVQT
FT                   NTAESLALAIRDGIGIGMLPLYSAIDALRDGTLVRVLPDHILQKMNVYALYPSRRFVDA
FT                   KVRTWVEMLRAQVPGMIARDVEMLNAIDREPQAA"
FT   gene            complement(600927..601313)
FT                   /locus_tag="Bamb_3741"
FT   CDS_pept        complement(600927..601313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3741"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3741"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89295"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B978"
FT                   /protein_id="ABI89295.1"
FT                   /translation="MRCIDWRRWFGSHTDRRTGLTPRLQENIVKSLVVTAAAAVLLAAP
FT                   VLSFAQSARSPVTRAQVLQELYDLESVGYNPALGDVGNYPDDIMAAQERLAAKRLAEHK
FT                   AVQSGYGPAGAGATESGVAAKPAL"
FT   sig_peptide     complement(601161..601313)
FT                   /locus_tag="Bamb_3741"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.982) with cleavage site probability 0.927 at
FT                   residue 51"
FT   gene            complement(601457..602599)
FT                   /locus_tag="Bamb_3742"
FT   CDS_pept        complement(601457..602599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3742"
FT                   /product="porin, Gram-negative type"
FT                   /note="PFAM: porin, Gram-negative type; KEGG:
FT                   bur:Bcep18194_B1679 outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3742"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89296"
FT                   /db_xref="GOA:Q0B977"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B977"
FT                   /protein_id="ABI89296.1"
FT                   /translation="MNKTLIAAASATALFAPLAHAQSSVTLYGLIDAGIAYTNNVNGGS
FT                   QWRMTTGTINGSRFGLRGTEDLGGGLKALFVLENGFNANNGALGQDGKLFGRHAYVGLS
FT                   RSGFGTLTLGRQYDTMVDFVAPLSATAGDFGDTGFAHPFDNDNLNHSVRINNAVKYTSD
FT                   TIAGFKVGALYGFSNSTNFAGNRAYSVAASYTNGPLKLAGAYLQMNGTKGSTSASPGAT
FT                   DVAEAKSVSQGGWSVGADRMRTYGGGVSYGFGPATVGFVYTRSQYDNSGSFGSTGQVAF
FT                   NNYDVNVRYAVTPAVSLGAAYVYTDASVSNPDSKHGTDPKWHQVDLQAVYKLSRRTDLY
FT                   AEAMYQHASGRGYQAFINTSGGASSTANQIVGTIGMRTRF"
FT   sig_peptide     complement(602534..602599)
FT                   /locus_tag="Bamb_3742"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            602719..603771
FT                   /locus_tag="Bamb_3743"
FT   CDS_pept        602719..603771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3743"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase, IS891/IS1136/IS1341 family;
FT                   transposase, IS605 OrfB; KEGG: noc:Noc_1587 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3743"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89297"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B976"
FT                   /protein_id="ABI89297.1"
FT                   /translation="MILVYRYRVKSLNGLLNKQSRAVNYVWNFCNDTQKHALKWNKRWP
FT                   TGFDLNVLTIGSSRELGIHSGTINATCEQYAKSRSQHRRPYLRYRGRKSLGWVPLKGRD
FT                   LKREGDAFRFAGNTFRVFNSRPLPEGKIKDGTNFAQDARGNWFLNIVIEMPDVQARPVR
FT                   SGVGIDLGLKDFAALSTGEKLPNDRFGRRAAEKLAKAQRARKHKRHIAKLHAKVANARA
FT                   DFQHKLALDLVRRFDYMVVGNVSAAKLARTRMAKSVYDASWSSFRNKLRYKAMAHGATF
FT                   EEVDESGSTQSCSACGSKDSTTRPKGIAGLRMREWACDGCGVVHDRDTNAALNILRCGR
FT                   ASPGVGITCL"
FT   gene            604096..604560
FT                   /locus_tag="Bamb_3744"
FT   CDS_pept        604096..604560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3744"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3744"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89298"
FT                   /db_xref="GOA:Q0B975"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B975"
FT                   /protein_id="ABI89298.1"
FT                   /translation="MTAHHRPSFSAALCYRDPKAALAWLERAFGFERSLVVTTPEGDIA
FT                   HAEMKFGDGLVMIGGAWADFIASPEDTGDRNTQHVHVHLPDDADIDAHCERARAAGAEI
FT                   LQAPADAFYGDRMYRARDPGRHVWTFGKHVRDVTNDEMSAATGLKIDDFR"
FT   gene            604634..605875
FT                   /locus_tag="Bamb_3745"
FT   CDS_pept        604634..605875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3745"
FT                   /product="N-isopropylammelide isopropylaminohydrolase"
FT                   /EC_number="3.5.99.4"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: bur:Bcep18194_B0800
FT                   N-isopropylammelide isopropylaminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3745"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89299"
FT                   /db_xref="GOA:Q0B974"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B974"
FT                   /protein_id="ABI89299.1"
FT                   /translation="MNLFNARLRGRDGLFTIGIDGDRIARIDAQTAPVVPAGADDIDAG
FT                   GRVAIPPLVEPHIHLDAVLTAGEPAWNMSGTLFEGIERWSERKATITHEDTKTRAHAAI
FT                   GMLRDHGIQHVRTHVDVTDPTLAALKAMLEVKDEARGLIDLQIVAFPQEGIESFDGGRA
FT                   LMEQAIDLGADVVGGIPHFENTREQGVSSIRFLMELAERTGCLVDVHCDETDDPHSRFL
FT                   EVLAEEARVRGMGARVTASHTTAMGSYDNAYCSKLFRLLKRAGLNFVSCPTESIHLQGR
FT                   FDTFPKRRGVTRVAELDRAGLNVCFGQDSIKDPWYPLGNGNILRVLDAGLHICHMMGYE
FT                   DLQRCLDFVTDHSATTMHLGDGYGIAVGRPANLVVLDADSDYEAVRRQAKATLSIRLGK
FT                   VIMRREPERVTYPE"
FT   gene            606054..607391
FT                   /locus_tag="Bamb_3746"
FT   CDS_pept        606054..607391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3746"
FT                   /product="Cl-channel, voltage-gated family protein"
FT                   /note="PFAM: Cl- channel, voltage-gated family protein;
FT                   KEGG: bur:Bcep18194_B1678 Cl-channel, voltage gated"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3746"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89300"
FT                   /db_xref="GOA:Q0B973"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B973"
FT                   /protein_id="ABI89300.1"
FT                   /translation="MRLDFPSAPASSSPSASPFARMAVVTVLTGIGAGFGGMLLALLLH
FT                   AIQHVAYGYSLSHVVGTQSFLTGVTQADPLRRLAVLVVCGLVAGGGWWALYRYGRPLVS
FT                   IRRAVRAADPRMPVVSTTVHALLQIVTVALGSPLGREVAPREIGSLLAGQLAHRAGLTS
FT                   ADCRLMVACGAGAGLAAVYNVPLGGAVFVLEVLLGTFELRALVAAVVTSAIAAAVAWIG
FT                   LGNEHQYTVPAFVLSTPLVAWSIVCGPLFGFAAYGFVRLTTRARADAPKGRLLPVLALV
FT                   NFAVIGVLAMRFPQLLGNGKGPASLGFDGTLTIGVAATLLVLKVLIEAGSLRAGAEGGL
FT                   LTPGLANGALLGVVLGGLWGLVWPGASIGGCALIGATAFLAASMQMPITAVVLLLEFTR
FT                   VNHDSLVPMLLAVAGSLVAYRFAQQRAERRANAIATVGTPETAAVR"
FT   sig_peptide     606054..606125
FT                   /locus_tag="Bamb_3746"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.876) with cleavage site probability 0.800 at
FT                   residue 24"
FT   gene            607586..608938
FT                   /locus_tag="Bamb_3747"
FT   CDS_pept        607586..608938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3747"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; PFAM: short
FT                   chain fatty acid transporter; KEGG: bur:Bcep18194_B1677
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3747"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89301"
FT                   /db_xref="GOA:Q0B972"
FT                   /db_xref="InterPro:IPR006160"
FT                   /db_xref="InterPro:IPR006161"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B972"
FT                   /protein_id="ABI89301.1"
FT                   /translation="MSVSGNEELKLVQRISRFFTQVVHRVLPDPLIFAILLTIVTFALA
FT                   FGLTPTTPVQLTTMWGSGFWNLLAFSMQMVMILVTGHALASSPPVRRLLVALASTARTP
FT                   GQGVMLVAFVGALACAINWGFGLVLGAMLAREVARRVAGSDYRLLVASAYMGFLSWHGG
FT                   LSGSVPLVAATKGNPMEKTIGLIPVSDTIFTGYNAFITIGLIVMLPFLARMMMPKPGDV
FT                   VSVDPALLAEPPSVERQLGPDATFAERMEESRALSVVVAALCAAFLVLRFMQKGFALDI
FT                   DTVNLAFLAAGILLHRTPMAYARAVAGAARGASGIMIQFPFYAGIQALMDHSGLAGVIT
FT                   KWFVDIANVHTFPLLAFLSSAVINFAVPSGGGHWVVQGPFVMPAAQALGADLGKAAMAI
FT                   AYGEAWTNMAQPFWALPALAIAGLGVRDIMGYCVTTLLFSGVVFVAGMYLF"
FT   gene            complement(609003..610331)
FT                   /locus_tag="Bamb_3748"
FT   CDS_pept        complement(609003..610331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3748"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3748"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89302"
FT                   /db_xref="GOA:Q0B971"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B971"
FT                   /protein_id="ABI89302.1"
FT                   /translation="MSTQHAQILPSATGDASASLNRLLFRKLMPLLIAAYVISFLDRTN
FT                   IAFAKHSMGVDLGISSAAYGLGAGLFFLTYALFEIPSNLIMHRVGARFWITRIMITWGA
FT                   LSVAMAFVSGPTSFYVMRLLLGAAEAGLFPGVMLYLTYWFGREQRARATGYFLLGVCIA
FT                   NIVGGPLAGALIELDGTLGFHGWQWLFVVEGIPAILLAFVVWTRLPDRPSRAPWLAPET
FT                   GRALERALAAEQDAGVAAHGGHRFGAALRDPQIWLAIFVYFCHQLTIYTVIFFLPGIIG
FT                   ASGHFSPFAVGLLTALPWLAAALGAATLPRFARESHHARRILCGGLIVMAAGMVGAANA
FT                   SPVAGLACVCIAASMFFVVQSIVFTFPASRLAGSALAGGLGLVNTCGLLGGFVGPTVVG
FT                   AIEQATGNAKNGLTLLTAALVAAAFASLALRHGHERPAVRSQG"
FT   gene            complement(610565..611497)
FT                   /locus_tag="Bamb_3749"
FT   CDS_pept        complement(610565..611497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3749"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   bps:BPSS0763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3749"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89303"
FT                   /db_xref="GOA:Q0B970"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B970"
FT                   /protein_id="ABI89303.1"
FT                   /translation="MANARKVIITCAPTGAIHTPSMSPYLPVTPHQIETAAVAAAQAGA
FT                   AILHLHARNPSDGKPTQDPAVFAEFLPRIKAQTDAVINLTSGGSPHMTVDERLQPALHF
FT                   QPEIASLNMGSMNFGLYPMLERFRELKHPWEREHLEKSRDLVFKNTFADIETILTRCGA
FT                   NGTRFEFECYDISHLYNLAHFVDRGLAKPPFFVQSVFGLLGGIGAHPEDLMHMRRTADR
FT                   LFGQDYVWSILGAGRNQIPLATIGAAQGANVRVGLEDSLWIAPGQLAESSAAQVLKMRQ
FT                   VLEGLSLEIATPAEARAMLDLKGGDAVRF"
FT   gene            complement(611533..612330)
FT                   /locus_tag="Bamb_3750"
FT   CDS_pept        complement(611533..612330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3750"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG:
FT                   oxidoreductase, short-chain dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3750"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89304"
FT                   /db_xref="GOA:Q0B969"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B969"
FT                   /protein_id="ABI89304.1"
FT                   /translation="MTASDLLKPYDGLRVLVTGGASGIGLEIADAFAECGARVHVCDAS
FT                   QAAIAALADRPSRAAITATLADVSDPVAVERVFADIATTLGGLDVLVNNAGIAGPTGGI
FT                   DEIDPVQWEQTIAINLNAQFQFARRAVPLLRDAKHGGAIIALSSVAGRLGYAFRTPYAA
FT                   TKWAVVGLVKSLAIELGPLGIRVNAIQPGIVRGPRMRRVIEARAQQLGIGYDEMEKRYL
FT                   EKISLRRMTDPAEIAATALFLCSPGGHGITGQAISVCGNVEVL"
FT   gene            complement(612405..613115)
FT                   /locus_tag="Bamb_3751"
FT   CDS_pept        complement(612405..613115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3751"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: atrA; transcriptional regulator, GntR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3751"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89305"
FT                   /db_xref="GOA:Q0B968"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B968"
FT                   /protein_id="ABI89305.1"
FT                   /translation="MAPRIVPPALKVIESETMADKVYQQLREALMSGRFAPGQALSLRS
FT                   VAEAVGSSTMPVRAALTRLRAERALVDGPNRALVVPPMTLDMLDELRDVRIALEGCIAE
FT                   RACARMTDAQIAAVRKTCETMQAQVEAGRSRAYLQSNFAFHSAIYAHGASESTLAIVEN
FT                   LWMRVGPFLNMVALDIPHMRRSMDAHRAIVDALERRDGTGVRAGIALDIGGAAHDLAET
FT                   LRAEQTPRRANAKP"
FT   gene            613413..613757
FT                   /locus_tag="Bamb_3752"
FT   CDS_pept        613413..613757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3752"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   psb:Psyr_2925 helix-turn-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3752"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89306"
FT                   /db_xref="GOA:Q0B967"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B967"
FT                   /protein_id="ABI89306.1"
FT                   /translation="MPYGATRHIMLELSFRKPAEIVTLLCERLRTERLALQLTQADVAA
FT                   RAGVGANTVSNLEAGRNVSLETVIRVAMVLGRSKELEALFLPKLDSLEDVHRYEKSAKR
FT                   QRVKRTTNND"
FT   gene            613750..615009
FT                   /locus_tag="Bamb_3753"
FT   CDS_pept        613750..615009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3753"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein; KEGG: psb:Psyr_2924
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3753"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89307"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B966"
FT                   /protein_id="ABI89307.1"
FT                   /translation="MIERVDVYYDGWGEHWLWGSLVSTTAITGRPLIVFEYSDDARKRG
FT                   LELSSYALPVHGSRLRKDFPAHQLGLPGPVYDALPDGWGMLLMDRLFKRRGLNAARIGP
FT                   LERLAYIGSHAMGAMSFEPVAPEIQEPQPNIPLDRLAAEVQEVLDGEGGAFLHQLLQVG
FT                   GSPQGARPKALVYRDPRSGVFTTAPAADFDAWLVKFPARQEHPEVCAIEMVYAECLRMC
FT                   GIETPDTLHFDLPGGMAAFASRRFDRRDGLRVPMQSVAAFTGADYKTPGALDYVNFLRA
FT                   THMCTNDVREKARAFERAVFNVAFNNRDDHPKNFAYIMARSGEWKLAPAYDVTFCEGPG
FT                   GYHQMDVMGEALQIDRAALLGLAKEAEISAAAAGDMIDRMCSVASRWSAIATRDYQGGI
FT                   TDDTLMHIQHRIDENVALLS"
FT   gene            complement(615025..616443)
FT                   /locus_tag="Bamb_3754"
FT   CDS_pept        complement(615025..616443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3754"
FT                   /product="Di-heme cytochrome c peroxidase"
FT                   /note="PFAM: Di-haem cytochrome c peroxidase; KEGG:
FT                   bur:Bcep18194_B1675 di-haem cytochrome c peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3754"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89308"
FT                   /db_xref="GOA:Q0B965"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B965"
FT                   /protein_id="ABI89308.1"
FT                   /translation="MTARPAFPSPDASGAAAPRSPARVLRRAAFVLGAAVLGYGAFAIA
FT                   FPARTPAAIGDVVADWTGANPHPVVLQRPAAQPLSAVAQLGRALFADPSLSASGKQSCA
FT                   SCHSPDHAYGPPNGLDVQPGGLAMTQQGYRPPPSLMYLYRQPNFSIGPDAGENDAAPSV
FT                   AQQAAAAAGVVKAQKVAGTSAAPQLVPQGGMFWDGRADTLQQQAFGPLLNPVEMANASI
FT                   DDVARKLAQSSHRAQLEQLFGARVFSSPQLLVSEAMFAIARYQVEDPSFHPYNSKYDRW
FT                   LEGRARLTQAELRGLRLFNDPDKANCAGCHLSKPGKDGLPPMFTDYQYEALGAPRNQAL
FT                   AQNRNPAFHDLGVCGPFREDLKDQTQYCGMFLTPTLRNAATRQVFFHNGVFHTLDQVMA
FT                   FYNERSISPQKFYSRGADGKVDEYDDIPPKYRANVDVTDAPFDRKPGDKPAMTEQDIKD
FT                   IVAFLGTLTDEPAR"
FT   gene            complement(616552..618225)
FT                   /locus_tag="Bamb_3755"
FT   CDS_pept        complement(616552..618225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3755"
FT                   /product="Phospholipase C"
FT                   /EC_number="3.1.4.3"
FT                   /note="PFAM: phosphoesterase; KEGG: bur:Bcep18194_B1674
FT                   phospholipase C"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3755"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89309"
FT                   /db_xref="GOA:Q0B964"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B964"
FT                   /protein_id="ABI89309.1"
FT                   /translation="MFRQALLVTACAAAALALFACGGSDDPTSTPAVSSQDALQTATPI
FT                   KHVVVIYGENVSFDHYFGTYPNASNPSGEPAFTAKPGTPTINGLTGTLLTANPNFTNTA
FT                   NGTDAANPFRLDRTQAATADQNHAYTAEQQAEDNGLADLFPKYTGKGSSGGAGAFGTKG
FT                   QVMGYFDGNTVTALWNYAQRFAMSDNAYTTVYGPSTPGALNVVSGQTNGMQIVKTSKQP
FT                   STLAATSYYINDGQGGFTMINDVDPGFDVCSSTTDQAMMSGKNIGDLLNAAKITWGGFM
FT                   GGFNLSTTNGNGTTGCNRSTVATAVNAATADYIPHHNWFQYYASTANPQHTRPSSIAAI
FT                   GSSVQADGKTAEPANHQYDSDDFFAAVKAGNFPSVSFLKAPAAQDAHAGYSDPLDEQAF
FT                   VTKVVNFLQQQPDWQNTAVIVTYDDSDGWYDHAYTAPTHASSDAVDQVNGNGACGTGGT
FT                   TGVNGGTVNGSCGPGVRIPLVVISPYAKQNYVDHTMIDQASVVRFIEDNWLGGQRIGGG
FT                   SFDATAGDLRGLFDFASKPNTAPLYLDPTQGTVLSAAPSI"
FT   sig_peptide     complement(618163..618225)
FT                   /locus_tag="Bamb_3755"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.641 at
FT                   residue 21"
FT   gene            618625..619482
FT                   /locus_tag="Bamb_3756"
FT   CDS_pept        618625..619482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3756"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: bur:Bcep18194_B1673 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3756"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89310"
FT                   /db_xref="GOA:Q0B963"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B963"
FT                   /protein_id="ABI89310.1"
FT                   /translation="MPIPVLLAVLCAAFLHASWNALVRSSGDRLRSATVLQIAIGLFAL
FT                   LFLPGAAPITPASWACVVASAVIHVVYTLLLVRAYEHGDLSVAYPVARGTAPLLVTLGA
FT                   AVFAGERLSVGAQCGLVLICAGILAIGLERRRGAPHRMTPVLLTAFATGVSIAAYSVVD
FT                   GIGVRESGSTVGYTGWMFVLTGLLMAAYYRLRAGPLRLTHDIGETAKAAGGGMFAALAY
FT                   GIVIWAMDRAPMGPVSALRETSVVFAALIARVYLGERLTPRRAGGCLVIACGALLISAF
FT                   EAVR"
FT   sig_peptide     618625..618678
FT                   /locus_tag="Bamb_3756"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.988) with cleavage site probability 0.666 at
FT                   residue 18"
FT   gene            complement(619531..620004)
FT                   /locus_tag="Bamb_3757"
FT   CDS_pept        complement(619531..620004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3757"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   bur:Bcep18194_B1672 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3757"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89311"
FT                   /db_xref="GOA:Q0B962"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B962"
FT                   /protein_id="ABI89311.1"
FT                   /translation="MPEPVLDRIDRHLLSVLQENGRASNLDLAKAVGLSPAQTLRRHRR
FT                   LEEIGAIRRYETRLCPDTLGFGVTAFVHVTMERGHIRDLSKFQKLVSDLAQIQECFSVT
FT                   GDIDYVLKVVAHDLKGLSTFLLETLMRIPGVSGVHSSVCLDEIKCTSAMPLES"
FT   gene            620324..621709
FT                   /locus_tag="Bamb_3758"
FT   CDS_pept        620324..621709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3758"
FT                   /product="aromatic amino acid:proton symporter, AAT family"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bur:Bcep18194_B1671 amino acid transporter; TC 2.A.3.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3758"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89312"
FT                   /db_xref="GOA:Q0B961"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B961"
FT                   /protein_id="ABI89312.1"
FT                   /translation="MVSGNEKDGLKRGLKNRHIQLIALGGALGTGLFLGIAQTIKMAGP
FT                   SVLLGYAVAGIVAFFIMRQLGEMVVDEPVAGSFSYFADKYVGHFTGFLSGWNYWVLYIL
FT                   VSMAELSAVGIYVQYWWPGVPTWVSALVFFVAINLLNLASVKSYGETEFWFSIIKVAAI
FT                   VGMIGFGGWLLASGHAGPEASIANLWQHGGFFPNGVSGLVMSMAAIMFSFGGLELIGIT
FT                   AAEADDPKHSIPRATNQVIYRILIFYIGALAVLLSLYPWEKVVTGGSPFVLIFHALSSN
FT                   LVANVLNVVVLTAALSVYNSGVYSNSRMLFGLAKQGNAPKVLCSVNKRGIPLAALGASA
FT                   LATGACVLVNYFMPGKAFEVLMGLVVSALIINWAMITLIHLKFRQAKRIAGEQTSFRSL
FT                   AYPFTNYLCLVFMAGILVVMYLTPDLRLSVYLIPVWLAVLAIGYRFRQKNAGYAMRDGA
FT                   SAR"
FT   gene            621753..622955
FT                   /locus_tag="Bamb_3759"
FT   CDS_pept        621753..622955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3759"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   bur:Bcep18194_B1670 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3759"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89313"
FT                   /db_xref="GOA:Q0B960"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B960"
FT                   /protein_id="ABI89313.1"
FT                   /translation="MFEHIDAYPGDPILTLNENFQKDPRDQKVNLSIGIYFDAEGRIPV
FT                   MGAVREAETALQRDLGPKPYLPMVGLAAYRDAVQALVFGADHPARAAGRIATVQTLGGS
FT                   GALKVGADFLKRYFPDAQVWLSDPSWENHRFIFERAGFTVNTYPYYDEATGGLKFDAML
FT                   AAIDALPARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEARGLLPFVDMAYQGFGAGLD
FT                   ADAFAVRELARRGVPALVANSFSKNFSLYGERVGGLSVVCEDAAAAERVLGQLAGAVRS
FT                   NYSNPQTYGAKVVATVLNTPALRKQWEEELAAMCRRIARMRQSIHDGLRDHVSGEALTR
FT                   YVKQRGMFTYTGLTEAQVDALREVHGVYILRSGRMCVAGLNDSNVGIVAESIGKVLKSG
FT                   V"
FT   gene            623085..623483
FT                   /locus_tag="Bamb_3760"
FT   CDS_pept        623085..623483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3760"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3760"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89314"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B959"
FT                   /protein_id="ABI89314.1"
FT                   /translation="MAIRIVRLGTPRAAGEGLRIGTVRRPPRGVPKAEFASRNYYDVWL
FT                   PTLSPSPELVAQALAAETDAEWRAFTRRFRAEMAHGDAPKVLDLLAALSATSAFSIGCY
FT                   CEDERRCHRGVLRELLAERGAAIDADAG"
FT   gene            623601..623894
FT                   /locus_tag="Bamb_3761"
FT   CDS_pept        623601..623894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3761"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1668 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3761"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89315"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B958"
FT                   /protein_id="ABI89315.1"
FT                   /translation="MTGGQMQIAFPPEPPEYCGRDLVVAFSALVDGRCVQCAITAEALE
FT                   DHFGAPSLLERDLLAAFEAHRSAIDAMARRMLEEIGGRPVLLHSGHFRLEDD"
FT   gene            623911..624150
FT                   /locus_tag="Bamb_3762"
FT   CDS_pept        623911..624150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3762"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1667 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3762"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89316"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B957"
FT                   /protein_id="ABI89316.1"
FT                   /translation="MTLQGTIHERDWSVEIETRPCESGEFRCRVSVEHGTGAARFHHTF
FT                   EHSHAYPTEHEAAIEGLRAGMTWIEMKASQTFSV"
FT   gene            624293..624646
FT                   /locus_tag="Bamb_3763"
FT   CDS_pept        624293..624646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3763"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1666 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3763"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89317"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B956"
FT                   /protein_id="ABI89317.1"
FT                   /translation="MGVGMQIVCVGFTGYAALEAEAGAQLVRLERFRARLADCRLTIES
FT                   RTTDDGDRTYDVRLELLMHDRAPASLPSSTGHDVNDTMRRAFAHAEQALSAWHADESEA
FT                   VALRQVKTGAAAQ"
FT   gene            complement(624671..625450)
FT                   /locus_tag="Bamb_3764"
FT   CDS_pept        complement(624671..625450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3764"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein,
FT                   Crp; KEGG: bur:Bcep18194_B1665 transcriptional regulator,
FT                   Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3764"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89318"
FT                   /db_xref="GOA:Q0B955"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B955"
FT                   /protein_id="ABI89318.1"
FT                   /translation="MSTATAFATAPPAAARPPMPLHAVARTDTAKHPAARCSVCAMRSM
FT                   CLPPDLTADEYGRLDAIICSTRHVRQGDSLFRTDDPFQSIYAVRAGSFKTVMMHRDGRE
FT                   HVNGFQIAGETLGMDGIGTGRHCCDAIALEDSVVCIIPFVALEAACREMKSMQHFLYQM
FT                   LSSEIVRESSQMLLLGTMSAEQRVAHFLLNLSSRFEARGYSASEFNLRMTREEIGCYLG
FT                   MKLETVSRMFSRFHRESLVETRGKRVRIIDAQALAQV"
FT   sig_peptide     complement(625379..625450)
FT                   /locus_tag="Bamb_3764"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.841) with cleavage site probability 0.541 at
FT                   residue 24"
FT   gene            complement(625468..625875)
FT                   /locus_tag="Bamb_3765"
FT   CDS_pept        complement(625468..625875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3765"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bur:Bcep18194_B1664 response regulator receiver domain
FT                   protein (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3765"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89319"
FT                   /db_xref="GOA:Q0B954"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B954"
FT                   /protein_id="ABI89319.1"
FT                   /translation="MNASLSPAVALRVFLVDHAVAVRQRIALLVGAIGGVVVVGEAEDG
FT                   QDAWTHIRSSRADVVIVDLRLADGGGLELIGMLSKAAPPVVTIVLTNHSALAFRDACAA
FT                   AGADYFFDKTAEFDAACRVIESLVHARAHQP"
FT   gene            complement(626064..626999)
FT                   /locus_tag="Bamb_3766"
FT   CDS_pept        complement(626064..626999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3766"
FT                   /product="ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin; KEGG:
FT                   bur:Bcep18194_B1663 ornithine cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3766"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89320"
FT                   /db_xref="GOA:Q0B953"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B953"
FT                   /protein_id="ABI89320.1"
FT                   /translation="MTALSRIPAFDAAETAALLDYPALLATLTHTVAEYAAGEIVSPER
FT                   LVVPLQGGGVMLSMPSSARDLASHKLVNVCPGNAARGLPTILGQVSAYDATTGEMRFVL
FT                   DGPTVTGRRTAAITALGIQALHGAAPRDILLIGTGKQAANHAEALAAIFPDARLHVRGS
FT                   RAGSAAAFCAAHRAQAPQLAPLDGDAIPDAIDVVVTLTTSRTPVYREAAREGRLVVGVG
FT                   AFTADAAEIDADTVRHSRLVVDDPAGARHEAGDLIVAQVDWQRVASLADVLRGAFERSG
FT                   PLLFKTVGCAAWDLAACRTARDALDARRGG"
FT   gene            627215..628000
FT                   /locus_tag="Bamb_3767"
FT   CDS_pept        627215..628000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3767"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: bur:Bcep18194_B1662 transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3767"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89321"
FT                   /db_xref="GOA:Q0B952"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B952"
FT                   /protein_id="ABI89321.1"
FT                   /translation="MRTIPEPRPPTWQEPQMMSARPESLEAGFRPLQIYEQVAEKIRDE
FT                   IRAGRYPADSRLPSERELAALFQVGRPAVREALGALQNEGLVFTKRNSGTYVVPAPLDV
FT                   LAQRGDTRSAPDADFSPTSTLDVRLILEPAIARLAAAHGRADPIAEGYLAQMETITDVD
FT                   DPRQRALWNESDRLFHRQLALMTGDALIVKIADEVAKTMDQPLWKRLKDDGIYDAGRIR
FT                   LYVSEHRLIYEAIVSGDADAAAFYVEQHILRVRRDITPK"
FT   gene            628122..629243
FT                   /locus_tag="Bamb_3768"
FT   CDS_pept        628122..629243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3768"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bur:Bcep18194_B1661 ABC branched chain amino acid family
FT                   transporter, periplasmic ligand binding protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3768"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89322"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B951"
FT                   /protein_id="ABI89322.1"
FT                   /translation="MRYLITALSVAVAAGALTSAHAQEVVTIGHSAPLTGPQAANGKDN
FT                   ENGARLAVDELNKAGVKVAGKTVTFKLVSDDDQADPKAGVQVAQSLVDKGVVAVLGPYN
FT                   SGVAIPASRVYANAGVPMLPVASNPALTRQGFKNIFRIGASDEQLGGTMATFAAKTLNA
FT                   KTAVVIDDRTAYGQGVAEQFANVAKANGIKIVDQEYTSSSATDFLGILTKIKASNPDVI
FT                   FFGGYAAQGAPMAKQMKQRGLRAKLLGGDGICSADMGKVAGEAASIVYCAQGGVALEKT
FT                   SAGRAFLKKYHDTYHTETQVYGVNYYDGMKLLADAMVKAGTTTDKAKLIAQLAKSNYAG
FT                   VAGTYSFDEHGDLKGAPTTVYVIRNGLPEPYAK"
FT   sig_peptide     628122..628190
FT                   /locus_tag="Bamb_3768"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            629298..630305
FT                   /locus_tag="Bamb_3769"
FT   CDS_pept        629298..630305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3769"
FT                   /product="proline racemase"
FT                   /EC_number="5.1.1.4"
FT                   /note="PFAM: proline racemase; KEGG: bur:Bcep18194_B1660
FT                   proline racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3769"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89323"
FT                   /db_xref="GOA:Q0B950"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0B950"
FT                   /protein_id="ABI89323.1"
FT                   /translation="MKISRSLSTVEVHTGGEAFRIVTSGLPRLPGDTIVQRRAWLKENA
FT                   DEIRRALMFEPRGHADMYGGYLTEPVSPTADFGVIFLHNEGYSDHCGHGVIALSTAAVE
FT                   LGWVQRTVPETRVGIDAPCGFIEAFVQWDGEHAGPVRFVNVPSFIWRRDVSVDTPSFGT
FT                   VTGDIAYGGAFYFYVDGAPFDLPVREAAVEKLIRFGAEVKAAANAKYPVVHPEIPEINH
FT                   IYGTIIANAPRHPGSTQANCCVFADREVDRSPTGSGTGGRVAQLYQRGVLAAGDTLVNE
FT                   SIVGTVFKGRVLRETMVGDIPAVIPEVEGSAHICGFANWIVDERDPLTYGFLVR"
FT   gene            630503..633115
FT                   /locus_tag="Bamb_3770"
FT   CDS_pept        630503..633115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3770"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: glycosyl transferase, family 51;
FT                   penicillin-binding protein, transpeptidase; KEGG:
FT                   bur:Bcep18194_B1659 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3770"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89324"
FT                   /db_xref="GOA:Q0B949"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B949"
FT                   /protein_id="ABI89324.1"
FT                   /translation="MSSVRDLCAKWVARAQPVAAAAAVPVKRVLATAWRRLRHPTRRGV
FT                   LLAAAAVPVLFLLYVLALIPFTPGIGDIRKARVDQPAQVLSADGKLLAEFKPSNREWVP
FT                   LKQISPHMVDALIATEDHRFYEHHGLDWKRTASAALHTFSGNRQGGSTITQQLARNLYP
FT                   DEIGRAPTLTRKVKEAITALKIEAIYSKPQILETYLNTVPFLYNAYGVEMAARTYFDKS
FT                   ADQLDVLDSATLVGMLKGNSYYNPVLNPERALQRRNTVLGQMVKYGKLSPAQFAQLQRR
FT                   PLRVDFERQKEPPGPAPHFAQQLRKWLIGWADRNDYNIYSDGLIVRTTIDARLQQMATQ
FT                   ALTQQANQLQGIANNAWSGRDGCGTDNEVFRTFMRESPEYKAAQDAGKDDAAAMKQLAA
FT                   DRGFMRALCKAKTDVQAGFVAIDPRDGQIRAWVGSRDFTNEPFDHVSQARRQPGSTFKP
FT                   FVYGAAFANGMKPEDTFVDQAIEIPLKGGEIWRPNDDAPPTGKPMTLRDAVALSRNRIT
FT                   AQVMEKVGPAAVARLARDMGVRESPLERVPSLALGTSPVTLKEMVASYATIANGGLYVE
FT                   PQMVTRIETRQGDVLAEYAPTPPERALDAETDKTLLDVMRDVVTRGTGGSIRTRFGIRG
FT                   DVAGKTGTTQDNADGWFILMQPGLVAGAWVGFDDGRVTLRSDYWGQGAHSALPIVGDFF
FT                   QRAQRARIVDTKLKFDTEPSPGWFASARERVTDLFDGWFGPESKQEPAPVRTQRIERQP
FT                   DEDTDEASAASAASAPVPASGGVVEEWIPASEVAASAAALSAGASQSQPVQPPAAGGGS
FT                   AASSGNTGGGGLGSAPATAPSTVPAPSPSPAPAPSPTPAPSPTPAPAPASPDATSGSE"
FT   gene            633195..634070
FT                   /locus_tag="Bamb_3771"
FT   CDS_pept        633195..634070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3771"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   bur:Bcep18194_B1658 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3771"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89325"
FT                   /db_xref="GOA:Q0B948"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B948"
FT                   /protein_id="ABI89325.1"
FT                   /translation="MPLITDYVALARDDVAAGVPLGFDLYDAGGAALLPAGATLRDPAQ
FT                   HDFLFDHFRPVRRRDDAGPAASDGDTVPAAAHMGLSAGAAIGIRRRVGAARVLQRCRLI
FT                   GIGASGVLFVEPRPSAVFDFARGDDVEAVAIGRSAVSRFGATVETVQTVGGAPFMVLSP
FT                   PGFVDRLRTRVEPRVPVRIAACCTGGPAQADGIGIVHDLSLNGLSIAVDRPLAAAGEPL
FT                   RVQLPYMDGDRIALLALDATVRAVHAEPATPGWTLHHAAFSEIAAADRIRLKALLFDLS
FT                   VESTEADPVR"
FT   gene            634355..634684
FT                   /locus_tag="Bamb_3772"
FT   CDS_pept        634355..634684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3772"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3772"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89326"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B947"
FT                   /protein_id="ABI89326.1"
FT                   /translation="MKSLIKAVALAALVAAPIVSFAQSNQQPLTRAQVRAELVQLEKAG
FT                   YNPNDWMNYPENIQAAQAKIAAAQNTGAQADATGYGSNPVATSQSGQRVTVPAAADRSS
FT                   VYFGH"
FT   sig_peptide     634355..634423
FT                   /locus_tag="Bamb_3772"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.849 at
FT                   residue 23"
FT   gene            634954..635358
FT                   /locus_tag="Bamb_3773"
FT   CDS_pept        634954..635358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3773"
FT                   /product="protein of unknown function DUF1311"
FT                   /note="PFAM: protein of unknown function DUF1311; KEGG:
FT                   bur:Bcep18194_B1653 protein of unknown function DUF1311"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3773"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89327"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B946"
FT                   /protein_id="ABI89327.1"
FT                   /translation="MRVLTGLLCALALTANLAHAQANCAETTDQAAMTACADRAYKKSD
FT                   AELNRTYQAVTARLRDAKPLAEKLVNAQRTWIAYRDAECNFSSANAEGGSAYSMVVSTC
FT                   LDDLTKIRNETLKGYLSCEEGDLACPVPAK"
FT   sig_peptide     634954..635016
FT                   /locus_tag="Bamb_3773"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.982 at
FT                   residue 21"
FT   gene            complement(635436..636083)
FT                   /locus_tag="Bamb_3774"
FT   CDS_pept        complement(635436..636083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3774"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; KEGG: bur:Bcep18194_B1652 two component
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3774"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89328"
FT                   /db_xref="GOA:Q0B945"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B945"
FT                   /protein_id="ABI89328.1"
FT                   /translation="MIKVLIADDHTLVRDGLRHILQNATGFEVAGEACDGPSTIALVRS
FT                   TPAQVLVLDLSMPGRNGVELIKQIKDEKPALRVLVLTMHAEQQYAVRAFRAGASGYLTK
FT                   ESASAELVGAVTKVASGGVYVSLAMAEQFAQSLNEPAETLPHQRLSDREFDVFRRIAAG
FT                   QTLTEIAQALCVSAKTVSTYKTRILEKMQMPHEAALVRYAMRHKLLDETDDV"
FT   gene            complement(636080..638203)
FT                   /locus_tag="Bamb_3775"
FT   CDS_pept        complement(636080..638203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3775"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: bur:Bcep18194_B1651 multi-sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region, ATPase domain protein domain
FT                   protein; histidine kinase, dimerisation and phosphoacceptor
FT                   region; PAS fold-4 domain protein; PAS fold domain protein;
FT                   SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3775"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89329"
FT                   /db_xref="GOA:Q0B944"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B944"
FT                   /protein_id="ABI89329.1"
FT                   /translation="MANRMTASGTPSRDARGPTRLPTMLRQPLVAGVAALFAGAALSLG
FT                   VALLVREQWQGTVHTRFERRTSHVTAMLRHELQTGAAVLESARGAFLLAPQMTPEQWRR
FT                   YADTLELDSGRSPVRQLGYAPLSPATRSALAGDAPLPAGPFAVATLSAPLSSAAGARFG
FT                   APDQAPLARALRTGNVALGIHPADDDTSRDTRILMLFVPATPSSRTPVTPAGAHDTGAG
FT                   GVLFAELSPNRVVERALDAERGLDLRMSAGDDPHPIASAETTTDEASTSPDLMRRTDQL
FT                   NFGGTVLTLAYSADGRPSATGAQRAAGTVLAAGLIASFAFAALIHALLRGRAGTADTGA
FT                   SSRGILNEARMMGIIRSSMEAIITIDEKQTVVIFNPMAEQVFGVSAMEAIGAPLSRFIP
FT                   ERFRAAHAKHVDQFGVTGVSERQMGRQRVLFGLRGNGEEFPIEASISQIRDASGKLYTV
FT                   MLRDITERQRAENALKQSREELRELSANLQNVREEEKTRIARELHDDLGQQLTALKMDL
FT                   SVIEQQLRAPGRAQPNDDVLSHLQGMRRLIDATVASVRRIAADLRPVMLDDLGLVPAIE
FT                   WLANDFTNRYGIDVERHIETGGLTFTSAGATTLFRIVQEALTNVARHADATRVALRLDI
FT                   EEGFCVLRVADNGRGAAPGGSAHEDKSFGLIGIRERAHMLGGNVTIDTALARGFSITVA
FT                   FPLGTVQQETTLT"
FT   gene            638512..638985
FT                   /locus_tag="Bamb_3776"
FT   CDS_pept        638512..638985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3776"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: bur:Bcep18194_B1650
FT                   universal stress protein, UspA family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3776"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89330"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B943"
FT                   /protein_id="ABI89330.1"
FT                   /translation="MYKRIFVGLDGGPSARLALNEAIRIALASGGEVTCAYVVEHRPQL
FT                   VDVDAGFAAERDRDAAATAAATPVLDDARAVLAQQHVPGTVRALDAYGEDVAAVLMRTA
FT                   AEVGADLIVMGTSGRHGLRRLLLGSVAESLLRSADRPVLLVRHDEPAAVATAR"
FT   gene            639344..639850
FT                   /locus_tag="Bamb_3777"
FT   CDS_pept        639344..639850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3777"
FT                   /product="protein of unknown function DUF985"
FT                   /note="PFAM: protein of unknown function DUF985; KEGG:
FT                   bur:Bcep18194_B1649 protein of unknown function DUF985"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3777"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89331"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B942"
FT                   /protein_id="ABI89331.1"
FT                   /translation="MPISAADLIHQFDLQPHPEGGYFRETYRAADTVVRPADGAPRAAS
FT                   TAIYYLLCDGAYSSWHRIRSDEVWHFYAGDPLEVWVLDEHDGLTIHRLGNPLTHPGTVF
FT                   QAVVPAGRWFGARCASPEHVALVGCTVAPGFEFAEFELADATALAAAFPEYAEYVAGLA
FT                   QRPDA"
FT   gene            639996..641045
FT                   /locus_tag="Bamb_3778"
FT   CDS_pept        639996..641045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3778"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG:
FT                   bur:Bcep18194_B1648 uncharacterized membrane-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3778"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89332"
FT                   /db_xref="GOA:Q0B941"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B941"
FT                   /protein_id="ABI89332.1"
FT                   /translation="MSSRSAPVWHFPITIPSSLGPWAVFASVLITQLGVPVPAVPMLIL
FT                   GGTMAAMGQASWTSMFAAAIGATMLADSLWFFMGRTRGRRLLNGLVRFSLSLDTTLRFA
FT                   RNVFERYGAPLLVISKFLPGLGLVSAPLLGTTAIGVGVFLFWDLAGASLWAAVWLVGGA
FT                   AVHDQIVQFVLWVRASGGTILDAFLAIFITFVLYRWVRRVQFRRYLAQLRISPPQLVEM
FT                   MTSNEPPLIFDARPRAIREREPYRIAGAVPIDLDSPDLLDPELLKRPIVVYCVCPNEAT
FT                   AKRLIAKMQRKKMLHNIRALKGGLDAWEKHGYPVEPMPADADASRYFVRPAHAAPLEGE
FT                   YTVRATLSK"
FT   gene            641708..650794
FT                   /locus_tag="Bamb_3779"
FT   CDS_pept        641708..650794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3779"
FT                   /product="filamentous hemagglutinin family outer membrane
FT                   protein"
FT                   /note="TIGRFAM: filamentous haemagglutinin family outer
FT                   membrane protein; adhesin HecA family; PFAM: Haemagluttinin
FT                   repeat-containing protein; filamentous haemagglutinin
FT                   domain protein; KEGG: rso:RSc0887 probable
FT                   hemagglutinin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3779"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89333"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR008619"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR010069"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B940"
FT                   /protein_id="ABI89333.1"
FT                   /translation="MNQNRYRVVFNRARGAMMVIQENGSSTWTAGNSQGASAPLNLPWL
FT                   HSAWQPIAMAAALLFGVPSFSFAQIVPIPGTSTHVIQTQSGIPQVNIAAPSSAGVSVNT
FT                   YNQFDVQRPGAILNNSPTIVNTQQAGMINGNPNFGAGQSARIIVNQVNSNAPSQLRGYV
FT                   EVGGNRAEVILSNSAGIQVDGGGFINTSRAVLTTGTPYYGADGSLGGFNVSRGLISVSG
FT                   AGLNASNVDQVDLISRAVQANAAIYAKNLNVVAGANQVSHDTLAATPIAGDGAAPAIAI
FT                   DVSQLGGMYANRVFLVSNEFGVGVANAGTIAAQAGDLTLQSNGQLVLTGKTTASGNLAA
FT                   TANSVQNSGTTYAQQSANVSAAGALSNSGTLAAQQNTTINAGTINSTGTLGAGVNNDGS
FT                   VGHNGDLNLSSTGQLTATGQNVAGGNASISGAAVNLAGSQTAASGNVSVNANAGDLNLS
FT                   NATTSAQGALNANVAGALINDHGTLSSQSNATLTAGSISNQGGKVSAQGTLNVQSNGAI
FT                   ANQSGTLVSASSMQVHGAAISNNQGTIQSAAGMTISGSSLDNSAGRVTSLNSDGLSITT
FT                   TGQLTNAAGTTALGAQGGIIGGNGGVAIQSGSVANHGTVSAQTNLQVGTQSLDNGSGVL
FT                   SAAQNAVIDAGAQLTNGSGSITAGQSATVNAASLSNDAGSVQAAQLSLGATNLSNHGGT
FT                   ITQTGTGAMNVAVSNTLDNSGNGVIQTNSADLNLAPATLINDHGKITHAGNGTLSIATG
FT                   AMSNQGGTIATNGALNVKAAAVSNSAGTLAAQRQAALDLQSLDNHAGGYIGADSITLKA
FT                   QGVVDNRAGTLEANNGVSVTADSLANDGGSVKNIGTSTLSVTTKNALRNAAGGTIGGNG
FT                   DVSLSAGSVDNSGGSMLAGQALSVQSNSAITNTAGLVQANGNLALQAQGAINNNAGQIE
FT                   ANGTNSTLALSGSSIDNSDGRVANIGVGATTIDGGASITNTNASGKAGAGTIGGNGDVT
FT                   LTAQTLTNAQGGQALAGHDLTLNVANSANNSSGVLSAANNLKLIAANAALSNQAGSIRA
FT                   NGALSLNTASIDNTSGKIGNDAGTGGSVSIQTGTLANQNGAIGSGQDLSLNAATLTGDG
FT                   SIVAGRNGAVTLGSDYTQTATNKLHANGDLNFTTSGKFTNQGVLDANGALTVNATNVEN
FT                   QAGADLNSATTTVNANGGTIDNAGRIEGDTVLTNSATLNNAATIIGREVTANASTITNT
FT                   GAAAVIAAAERVNLYASNRLSNTGGANIFSVGDINIAANGQRDANGFLANRTENVVNDQ
FT                   STIEAQGSVELAAGTFTNTRPAPIVSTETTSTTSKHEIKRQKYIVCATMNADPNGGCSQ
FT                   AMWVDGYKTPLTSTYGASQVVSQTSGPDATDKVLVVNVNGKQQTIYYNTLTTNADGTIT
FT                   VNYWDAYDPHVNYVPDTEYTTRSDGHNGYQRVEIWRDTTTTVQQDKITSQAQQAQLVAG
FT                   NNIVMKNVGTINNEYSAITAGGSIKIGDSDVSGSAGSGSYGGTVVNNVGRTLYQYQTDK
FT                   IVSTYAWNEDTTQDRGTIVQPSKVYTPVAIGGAGGTIIANASVIIDAKDVNNQNVAAQN
FT                   SSTGATGGTLGNNSANGGVSGGKLTPVGAAGGSSIPVGAQQSVANASGALPITLPTSGL
FT                   YSIHDAPGQPYLIVTDPRLTSYTKFISSDYMLGQLDLNPASIEKRLGDGMYEQQMVRNQ
FT                   ITQLTGRTFLPGYASAEDEYRALMTNGVNYAKEFGLMPGMALTAAQMDALTSDIVWLVD
FT                   QTVKLPDGSTTHVLAPVVYMAQTHANDLQPTGALIAADDVEIHATGSTTNSGVIKGGTK
FT                   TVITATDILNRGGSISSSSANGTTVVSASNDVVNASGMITGNRVAVSAGRDIVNTTLVD
FT                   TVGATGASGASKVNTSLIGQQGTIAATGDLSVQAARDLSIHGANLSAGGDALVTAGRDI
FT                   NVDTVQSTTNQSMYLNDQHHWEESTTKNVTSGITAGGSLGMQSGNDMTLKGATVSAGKD
FT                   LSALAGGNLTATTVMDSAKLDNVAADNKTRKEVDHNYDEHAVGTQFTAGGNATLGAASA
FT                   DTSKGNITLTGSSLTAGMTNGIENGTGAASIVATGNVTVNEAREEHDKYQSVQVQRGSF
FT                   VSSTKTDSMTDTHANVGVGSTISGNTVNIQSGHDLTVQGSTIVGTNDVSLAAANNVNIT
FT                   TSKDTITQDSYYHETHSGIGTSGLSVSIGTQTKKDTDHASSVTNNASTVGSLNGDLTIK
FT                   AGDTLHVTGSDLIAGKNLTGVASNVVIDSATDTSNKTHSETTSSSGVTLGLSGSIGDAI
FT                   NGAYQQAQAAKSGSGDSRATALHAIAAAGNAAMGVAGLTGGALAGGGTPSIGVQVSVGS
FT                   SHSRLDTSENQTTQRGSSVSAGGATSLIATGNGTPGSGNITVAGSNVSGNDVLLAAKNQ
FT                   IDLQNTTNTDSTRSSNSSSSASVGVSIGTNGIGVSAAMSRAHGDGNSDAAMQNNSHVTG
FT                   ANSVTLVSGGDTNIVGSDVSGRAVTADVGGNLNIRSVQDTTVSSAHQSSAGGGISVSTM
FT                   GGGSASFSSSHGNANGNYAGVNEQAGIQAGEGGFNVNVKGNTDLTGAAIASTADPSKNT
FT                   LTTGTLTYRDIDNHSTYNADSSGFSAGAGVGVTGKSIGPGSVSGAGGVTPMISQSDSGS
FT                   ENATTRSGVSAGTINITNPTGQTQDLANLNRDTSNLNGTVSKTPDVQNLLDKQADTMNA
FT                   AQAAGQVVAQGIGAYADMKQKEAQHAADAAKLAGDTTAQAAYQAEADSWDEGGTNRLYL
FT                   HIAGGALIGGLGGGGIGSAAQGAAGAGLAALLADQTAQAAKEVAGATDSTLAGKVSGNL
FT                   LIGALGGLVGGAAGAATASNVNLYNQWNHTDTDTLEEASGQGTVRKKTTALDLVLQGIA
FT                   NGLNAVIGAGGGKPPAASPGVVLVGEAGAGVQQVIPGVAGYGLDTATLAKSGHSPAGAN
FT                   DSNTPMLGADGAQFPSKTIWKGDGKERIDVENPNPGQRPGQIHYQDNQGNKYLYDPNTN
FT                   SFPDAPNSVNKLLNNPDFNSAIQKGLSKYLGGK"
FT   gene            651502..651759
FT                   /locus_tag="Bamb_3780"
FT   CDS_pept        651502..651759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3780"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_I2721 outer membrane hemolysin
FT                   activator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3780"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89334"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B939"
FT                   /protein_id="ABI89334.1"
FT                   /translation="MTIGSRYTVRGFDGETILAAARGLYWRNELQMPNGVIVQADLSNA
FT                   DMASIAARIWGKPNRQNFNAISFQNSGGQIFKFNRLIGGK"
FT   gene            651762..652031
FT                   /locus_tag="Bamb_3781"
FT   CDS_pept        651762..652031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3781"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc3187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3781"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89335"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B938"
FT                   /protein_id="ABI89335.1"
FT                   /translation="MAKFACKCGYVINLIASPRGDEWRLIPEKTLKDIVDLLDGGEAVD
FT                   GERFYETLRGKEITVYRCPSCGRLHLEEAGRNKFVTYVKECGEL"
FT   gene            652105..653865
FT                   /locus_tag="Bamb_3782"
FT   CDS_pept        652105..653865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3782"
FT                   /product="Polypeptide-transport-associated domain protein,
FT                   ShlB-type"
FT                   /note="PFAM: Hemolysin activator HlyB domain protein;
FT                   Polypeptide-transport-associated domain protein, ShlB-type;
FT                   KEGG: bpm:BURPS1710b_1278 outer membrane hemolysin
FT                   activator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3782"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89336"
FT                   /db_xref="GOA:Q0B937"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B937"
FT                   /protein_id="ABI89336.1"
FT                   /translation="MKIIKRLVAVPLTAFVSLAAQAQQAPTPADQAAAARANAEQDRQA
FT                   QQQRDAQQRDATVRAPSVRSEVPQVEMYPVIPSEQPCFRIDRFALDVPDSLPDSAKVKG
FT                   ASALPMDRFAFAREWLAHYAGQCVGKQGVDTIVKGLSRAILARGYITTRVLLPEQDLST
FT                   GTLKVALIPGVIRHVRFADEKLRGTWKTAFPTRDGEVLNLRDLEQGLEQMKRVTSQDVS
FT                   MQIVPADVPGESDVVLDVKRSKPWTAVASIDNSGTRATGKLQGNLSIGVDNPLGLNDIF
FT                   NIGVSQDLELGDKRLGSHGWNGFYSIPWGYWTATLSAYTNTYYQQIAGVNQTFVASGNS
FT                   KTIDFKLARVLARSQNDVLGGYFRLSRRFGQSFIEDTEIPQQRRNNTFVEIGLTDRHYF
FT                   DGAQFDGTLAYRQGVGGLGAQDDILATGGGPTYRFKMAVLDANLSVPFAIAAQPFRYVT
FT                   SIHGQYTGNSLYYIDDLTIGSRYTVRGFDGETMLAAARGLYWRNELQMPIGQTGQIVYA
FT                   GLDYGRVWGPQPVALVGTQLAGAVIGVKGSVATRFGGYGYDLFAGTPVYKPSGFPTARV
FT                   TVGFQVTAQF"
FT   sig_peptide     652105..652173
FT                   /locus_tag="Bamb_3782"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.972 at
FT                   residue 23"
FT   gene            653901..654251
FT                   /locus_tag="Bamb_3783"
FT   CDS_pept        653901..654251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3783"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A2843 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3783"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89337"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B936"
FT                   /protein_id="ABI89337.1"
FT                   /translation="MKSLGLSMLVIPPTHHVTTEQPTYDPTTSTRIRVLPGNGTGGAAF
FT                   RPGESCYRIGFRSDDTTIVVGDGFLSTVKYSSRSVVIGMPQSPRPTRTVEGLVRDHQCV
FT                   EHLSNNFSFSNP"
FT   gene            654362..654835
FT                   /locus_tag="Bamb_3784"
FT   CDS_pept        654362..654835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3784"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plu:plu0224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3784"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89338"
FT                   /db_xref="InterPro:IPR028958"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B935"
FT                   /protein_id="ABI89338.1"
FT                   /translation="MLIGNPDVFAIWCDSVESWSTDCFKNGCFSYFIGGNLIWSLKSTL
FT                   GADINLLSSVNCLSNDVEGKELFDLPASTSDAKLVEKAFPGMDSDAEFSDYTHLVSVGS
FT                   LLDAGFQVFLVELGDRAKLIWGDEEDASVVHEFILTRGEFQRVVRDAICQFYG"
FT   gene            654981..655334
FT                   /locus_tag="Bamb_3785"
FT   CDS_pept        654981..655334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3785"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS02100 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3785"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89339"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B934"
FT                   /protein_id="ABI89339.1"
FT                   /translation="MNSSRQKRERAIRHQLTQRSDDLLLDDNPDTLGMALRGFFPDLTR
FT                   AFVIHWIPDQAEDIYWVLVSPTGIAQIEIVRGQKVRSYPPKLRMIELAAYQSKRHSRDV
FT                   RERLAIALELIKS"
FT   gene            655755..656690
FT                   /locus_tag="Bamb_3786"
FT   CDS_pept        655755..656690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3786"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: bur:Bcep18194_B1645
FT                   universal stress protein UspA family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3786"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89340"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B933"
FT                   /protein_id="ABI89340.1"
FT                   /translation="MQTTPTIPPLARIALAVDLTPESLSAARYTRTLLRPGMQVRIVCA
FT                   IDNPRLVLPDIPRVDALLTSAREEMMHEAQATLERTAALFAGSGVAVEQVILDTSVTGG
FT                   TVADALANETSGWHADVLVVGANPHHGLLRLVEGAMSDTLAARARCALLIVPADYARPA
FT                   DGPLQRLMFAVDGSEPSLHAVRVGLGFAAPTTLLYAAYVVDRAVRLTDLVPVRALEDAY
FT                   RAEGEDALARIGPLFHAAGNPAKRGIVETRPTSDDVAHALMRDAVHWHAELLVVGTHGR
FT                   RGIAAWLIGSVARRVAHLAQVPVLLVRGDA"
FT   gene            complement(657222..657632)
FT                   /locus_tag="Bamb_3787"
FT   CDS_pept        complement(657222..657632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3787"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1644 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3787"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89341"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B932"
FT                   /protein_id="ABI89341.1"
FT                   /translation="MGHRNFPARDVRRHTLSAPAAPAGIQPPDDLDALLAIAREAGLLV
FT                   MLDGQIGREKYQSVAGSVLALQRFAAALRARADADTPAVAVAEPRRKGRPGWPRLCNRT
FT                   PGGRGHPHGVRRGACVCRMTRRGHDQRTMRYV"
FT   gene            complement(657726..658124)
FT                   /locus_tag="Bamb_3788"
FT   CDS_pept        complement(657726..658124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3788"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3788"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89342"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B931"
FT                   /protein_id="ABI89342.1"
FT                   /translation="MRAINGTLRAAAPIDCRIGPRGIRGAHGPRTTGRIATPPRGAAPP
FT                   VARTMEPSRDADAVSNLDRSKSCVKQSAPAAIRLFLCTASPRARGVPRAAHRAAAVERR
FT                   CRLSADSDRPHVMSDNEFSARRLAARYR"
FT   gene            658223..658480
FT                   /locus_tag="Bamb_3789"
FT   CDS_pept        658223..658480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3789"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1643 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3789"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89343"
FT                   /db_xref="InterPro:IPR021945"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B930"
FT                   /protein_id="ABI89343.1"
FT                   /translation="MSQQDTMLEALKAVAEQREIGDDQLRTMLDDEVRALSSDARVHDY
FT                   IHVFAIRHLRERMRRQDDLERDTSSGTQHKEPDTRADRRL"
FT   gene            658724..660523
FT                   /locus_tag="Bamb_3790"
FT   CDS_pept        658724..660523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3790"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   Cache domain protein; chemotaxis sensory transducer; KEGG:
FT                   bur:Bcep18194_B1642 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3790"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89344"
FT                   /db_xref="GOA:Q0B929"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B929"
FT                   /protein_id="ABI89344.1"
FT                   /translation="MFSSIRTRILAACVAIVVFALVATTLINYFIARSYNEDAIDRNLT
FT                   SVASGHVVGIGDWVATRSRMIASLQDAALSPDPLPAFKQMAAAGGFTNVYAGYADKVFH
FT                   FSDPTGIPPDYDPTGRPWYKQAAQAGKPVVTPPYVDAGTGNLVVTFAVPILRDGALKGV
FT                   VAADVAMDSVIANVKSIHPTPASFGMLIDSNGHVVAHPDAKLTLKPVADVSPDLGGMSA
FT                   ASLAAATAPVEVHVGGDAKLARAQAVPGTDWYALVLLDKSEATAGMRSLLTASLVTLVV
FT                   IVGVASLIIGAITTTAFRRLSQVRQAMASIGSGTGDLTQRLPAEGRDEVADIARSFNSF
FT                   VDKLNDVMRQIRDASESVRTAANEIAAGNQDLSSRTESAAASLEETAASMEEITATVGQ
FT                   SAAAAGQADERAAAASRIASHGGVVVSDVVATMGKIEEASGRIGDIIGVIDGIAFQTNI
FT                   LALNAAVEAARAGEQGRGFAVVAQEVRSLAQRSAQAAREVKVLVESTVASVSAGSGQVR
FT                   QAGDTMREIVSNVANVTTIISEITHAANEQTRGIQEVNRAVTQLDEMVQQNAALVEQST
FT                   AAATALQTQANALATTVGQFKVA"
FT   sig_peptide     658724..658795
FT                   /locus_tag="Bamb_3790"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.998) with cleavage site probability 0.651 at
FT                   residue 24"
FT   gene            complement(660566..661603)
FT                   /locus_tag="Bamb_3791"
FT   CDS_pept        complement(660566..661603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3791"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_B1641 sigma54 specific transcriptional
FT                   regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3791"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89345"
FT                   /db_xref="GOA:Q0B928"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B928"
FT                   /protein_id="ABI89345.1"
FT                   /translation="MINIATRKTGDADFQNGSLTPMAETANRPKQRADARQLSGRSAVM
FT                   RTLLDRIEKIAPTRASVMIAGESGVGKDIVARRLHDLSARRDGPFVPVNCGAIPADIAE
FT                   AQLFGHEKGSFTGAIAQREGFFEAACGGTLLLDEIAEMPAALQVKLLRALESNTIVRVG
FT                   GTESIPLDVRIVSATRHNPADAVRDGRLREDLFYRLAAFALYVPPLRQRNGDVETIAHE
FT                   FVDALNERHRSHKQLTDAAIAALRAYSWPGNVRELHNTIERAYILADDGIDVALPKPTL
FT                   LPDQTSDDAMALPLGATLHYAQQRFIAATLDHFDGNKPQAAKALGISLKTLYNRLALMR
FT                   DGGPA"
FT   gene            661649..661894
FT                   /locus_tag="Bamb_3792"
FT   CDS_pept        661649..661894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3792"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3792"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89346"
FT                   /db_xref="GOA:Q0B927"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B927"
FT                   /protein_id="ABI89346.1"
FT                   /translation="MSGAIPEEIGDCSIAMPVCGLAPAIGAFLHLLNEKAKGTCKRAFG
FT                   MTKGRTRPSATTGGPHADYAVMARNVAIGHACCCAK"
FT   gene            661977..663971
FT                   /locus_tag="Bamb_3793"
FT   CDS_pept        661977..663971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3793"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: bur:Bcep18194_B1640 multi-sensor hybrid
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   response regulator receiver; ATP-binding region, ATPase
FT                   domain protein domain protein; histidine kinase A domain
FT                   protein domain protein; PAS fold domain protein; SMART: PAS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3793"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89347"
FT                   /db_xref="GOA:Q0B926"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B926"
FT                   /protein_id="ABI89347.1"
FT                   /translation="MRTFTRELFRQGIWVVLAVGVAAVLQAWAIHVIGMHEPFAPLPFY
FT                   AGVAAAAWLTSFAGGVAASALSLAVIGALWWRNAPLPDLLSQAGAFVAISFVECVLVMA
FT                   VKPLLANDRLRGAEDAEEDGARSPRREPEPGTLARSVDDTVLRRVVDASPDAIVGVDVA
FT                   RRITSWNLAARRLFGIDAAAAIGHDVTMLIAPRWLRLHPVPASFADAGAPAGPLDILCL
FT                   RRDGSRFRATFTASPIVDAQGNCTGLSMTLREARERRRCEQRDLRMLRGARDARVQADE
FT                   SNRMKDELLATVSHELRTPLNVIYGWVEVLRSGEGQGFAHQAIDAIDRSARSLSRMVGD
FT                   LLDASSLATGRVRLERTPVDLVRIVQEAVREIGDTAQANGLELSTECAMPSCVIAADAE
FT                   RLRQLLSNLLSNAIKFTPPGGRIKVSLNPAGARVRLSVADTGQGISAERLPHLFDTFSR
FT                   PEGAPALPKRGLGLGLSIVRNIARLHGGEVAAASEGAGRGTTVTVMLPADLGADDTTTG
FT                   HPVRPSGASTAVALDGRRVLVVDDDATSRASLAAALETLGAEVSTAQSGHDALDVVAQQ
FT                   HPSVVLSDLAMPDGDGFWLLDHIRDLPDGGGRLPVVAVTAHAGTADRSRVMAAGFDAYL
FT                   CKPVDVPTLASVIVDVSPADATGGTGRRH"
FT   sig_peptide     661977..662066
FT                   /locus_tag="Bamb_3793"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.895) with cleavage site probability 0.469 at
FT                   residue 30"
FT   gene            664097..664741
FT                   /locus_tag="Bamb_3794"
FT   CDS_pept        664097..664741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3794"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1639 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3794"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89348"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B925"
FT                   /protein_id="ABI89348.1"
FT                   /translation="MNVNDSNPHRAVVLAVTACMLVSAMLAALGPPALTPVHAQAPPAS
FT                   SIHVAPGVVRPGETPDEAEMTRRPSGIDAEFVDKAGIIGKTASQASELALDRSSNPHVK
FT                   AFARRMIDDHDHMATQLRRLGAQKGVPVQARMVVDPEVTALRTKNGHAFDKSYVALVGP
FT                   NAHEAAIKLYEAEARNGRDPQIRAFAAGSLPTLKAHLNAARQLENSIAAAH"
FT   sig_peptide     664097..664216
FT                   /locus_tag="Bamb_3794"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.948 at
FT                   residue 40"
FT   gene            complement(664770..665267)
FT                   /locus_tag="Bamb_3795"
FT   CDS_pept        complement(664770..665267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3795"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG:
FT                   bur:Bcep18194_B1638 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3795"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89349"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B924"
FT                   /protein_id="ABI89349.1"
FT                   /translation="MTTDRPSPTHARIVGDSGRSAGGPGPDVMAAGTLEGDHVLTIDGD
FT                   DIGKVTNIMLDVRSGRIAYAVVSSGGFLGIGGKLLAVPWNVLTLDAERHCFVLAVSTER
FT                   VREAPGFDKDHWPTMADSIWAEALHTYYGASPYWLIEEGETPLDAPPYEASPGGPESGT
FT                   RH"
FT   gene            complement(665335..665766)
FT                   /locus_tag="Bamb_3796"
FT   CDS_pept        complement(665335..665766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3796"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   bur:Bcep18194_B1637 CBS domain containing membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3796"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89350"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B923"
FT                   /protein_id="ABI89350.1"
FT                   /translation="MYRVNEIMSRDVVCVAPTDTIRHAAQLMQRFDIGVLPVCDGNELV
FT                   AVVTDRDLAVRALSHGHSPDTPVKAVASGPVQWCIEDDGVGDVQQRMADLQLHRMPVLD
FT                   AKHQIVGIVSLGDIATRAGGPARDELANTLEDVSLPRRR"
FT   gene            complement(666108..666356)
FT                   /locus_tag="Bamb_3797"
FT   CDS_pept        complement(666108..666356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3797"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1636 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3797"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89351"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B922"
FT                   /protein_id="ABI89351.1"
FT                   /translation="MIAHAPGRRDAVSPAAGLVSLAASRKPSNDKTEKRIDEGLEESFP
FT                   ASDPPAVGGATRIDPAKPSGPRERRAPDAPPPPRDHG"
FT   gene            666928..667239
FT                   /locus_tag="Bamb_3798"
FT   CDS_pept        666928..667239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3798"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1633 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3798"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89352"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B921"
FT                   /protein_id="ABI89352.1"
FT                   /translation="MDIHVQSPDKRAIAQVLGRYFESRSLRYHIEELPGGVLHIGFRAS
FT                   GRPVAVTVSFDDSAYDTYTHWDASQKQLALGRLADGFSRMMSKRSPAALAGDYHVERF"
FT   gene            667447..668325
FT                   /locus_tag="Bamb_3799"
FT   CDS_pept        667447..668325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3799"
FT                   /product="MltA-interacting MipA family protein"
FT                   /note="PFAM: MltA-interacting MipA family protein; KEGG:
FT                   bur:Bcep18194_B1632 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3799"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89353"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B920"
FT                   /protein_id="ABI89353.1"
FT                   /translation="MTVARPLLSPATRRFVSGLSAFAALAAAGARDASAQTPSPLGEWQ
FT                   YSAGVPLQKLFNPTVPTWQVSVGAAMTLQPRYAGSDRYRVMGGPNFDVRYRDLFFLSTG
FT                   DGLGANVLRGPNWRVSLSVGYDLGRRSADDLDHLNGLDNINAAPVMKLAADYVISKEFP
FT                   LVLRADVRRSIGGSNGWVGDFSAYMPMPGSNEHFFWFAGPTVSFADSRYMNGWFGVNQG
FT                   ASARSGLRTYSPGAGMKSFGAGMTMVWFVNKHWFVTVDGAIEQLVGRARRSPITQQSTN
FT                   GVFDMSVNYQF"
FT   sig_peptide     667447..667554
FT                   /locus_tag="Bamb_3799"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability0.999) with cleavage site probability 0.786 at
FT                   residue 36"
FT   gene            668431..670125
FT                   /locus_tag="Bamb_3800"
FT   CDS_pept        668431..670125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3800"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1631 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3800"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89354"
FT                   /db_xref="GOA:Q0B919"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="InterPro:IPR033315"
FT                   /db_xref="InterPro:IPR040603"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B919"
FT                   /protein_id="ABI89354.1"
FT                   /translation="MTPASPTPPAFYYLTNFERALAWLGERYDDLLDAHEHAFLRQFAQ
FT                   LPKASRALLVRMLMRSGSDFRASKLVYDEIGSTLDAAAPLVALGWIDPAPALTLDELFA
FT                   LSTKADLLKAFPSLAAHAGERKPDWLERLRLVHDVAQPLHAWCAQADDCVLRVTVGALC
FT                   DRLRLMFFGNLHQDWSEFVLADLGVFQYESVPFAPSSRAFQQRADVDAYLALQACREAL
FT                   DAWPEDLPFDDLLHAIDAIGCAQPWLATRRSKLLFSLGQACERRADWDAALDAYARSAW
FT                   PGSRHRRIRVLERCGRDDDALALALDARGGFESDEERQRVERMLPRLQRRLGQRVERAG
FT                   RAHDVPRETLVLARPDAFVSVEFAVRDHLAQPHAPVHYVENTLINSLFGLLCWEPVFAA
FT                   VPGAFFHPFQRGPADLHAPDFAVRRTDAFAGCFAQLDSDAYRDTIRRHHATKAGLQSPF
FT                   VFWGVLTDELLDDALACLPPEHLRLWFTRLLADIRSNRSGLPDLVRFWPGERRYELIEV
FT                   KGPGDRLQDNQTRWLAYCVAHGIPVRVVDVEWAGADVAQAEAAGLSA"
FT   gene            670122..672422
FT                   /locus_tag="Bamb_3801"
FT   CDS_pept        670122..672422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3801"
FT                   /product="helicase c2"
FT                   /note="SMART: DEXDc2; helicase c2; KEGG:
FT                   bur:Bcep18194_B1630 Rad3-related DNA helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3801"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89355"
FT                   /db_xref="GOA:Q0B918"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B918"
FT                   /protein_id="ABI89355.1"
FT                   /translation="MSYVVAVRAMCEFTARRGDLDLRFTPAPTALEGIAGHGAVTSKRG
FT                   ARYETEIALSGTWGTLTVRGRADGYDPVANRLEEIKTYRGSLDAMPANHRALHWAQAKV
FT                   YAHLMCDARGLTEINVALVYFDIVSERETVLTETLSADVLAAFFAEQCACFVGWAERET
FT                   AHRAARDAALRALAFPHGQFRSGQRELAVSVYRAARDEHCLMAQAPTGIGKTLGTVFPL
FT                   LKACGEGELDHVFFLTAKTPGRALALEAATTLGAGTPALPLRVLELVARDKACEHPDRA
FT                   CHGESCPLAQGFYDRLPAARDAAIGAGLLDRATVREAALAHDVCPYYLSQELARWSDMV
FT                   IGDYNYYYDGSAMLHTLAQQNQWRVGVLVDEAHNLLDRARRMYSASLDPFAFAAAREAA
FT                   PAALRKAFDRLARAWGTVNRAQAERYAAYPEIPGPIVSAVQNLVATIGEHLTDAPRAND
FT                   DALLRFHFEAIQFGVLADAFDSASIFDATLHGEPLPRQSGLDGVAPAGRQRRIQSTLCV
FT                   RNVIPAAFLAPRYEAARATVLFSGTLSPFHFYRDTLGLPADTGWLDVDGPFRAEQLTVR
FT                   VASHVSTRWRDRDRSLEPIADLIAAQYATRPGNYLGFLSSFDYLGRVVALMQTRHPDVP
FT                   VWAQAPGMAESERDAFLARFDAGGRGVGFAVLGGAFSEGVDLVGERLIGAFIATLGLPQ
FT                   VNDVNEQMRRAMEARFGNGYDYMYLYPGLQKVVQAAGRVIRTEHDEGVVHLIDDRYRRR
FT                   EVRDLLPRWWRIG"
FT   gene            complement(672478..673248)
FT                   /locus_tag="Bamb_3802"
FT   CDS_pept        complement(672478..673248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3802"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG:
FT                   bur:Bcep18194_B1629 transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3802"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89356"
FT                   /db_xref="GOA:Q0B917"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B917"
FT                   /protein_id="ABI89356.1"
FT                   /translation="MKKTDLDRRDWIAGLEKGLAILEAFDSQHARMTPTQAAARTGLTR
FT                   TAARRYLLTLESLGYVYTDGKLYGLTPRVLRVGWSYFDSARLPRTVQPYLQQLSASLNE
FT                   SAYVSVLDGWQLVFIARNGVSRVMTTGFVLGARVPAPLTSPGVVLLAHHPDREAVRAWL
FT                   ADAELAPFTPHTITNKARLLEQVDHARDAGFAVIEQQLQVGVRGIAVPLKNRHGEVVAA
FT                   LSTNMPIGTEATDAAVRRVLPHLQEAALAMLNVL"
FT   gene            673500..674111
FT                   /locus_tag="Bamb_3803"
FT   CDS_pept        673500..674111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3803"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1628 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3803"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89357"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B916"
FT                   /protein_id="ABI89357.1"
FT                   /translation="MKIRESALAVLVAAVPLLAAANPSTGATLPKPTVDVRAWPRMTSP
FT                   KFGCYVETAFGYRDRHFNCTLKKYRNTGDACRNTKAYYEGPAFPDRLATSVHPLATKVD
FT                   LDWEHGDLQMVTVTLKGTWNEADVRNAFGLPRAEGRKLTEAELRTQPDNLMDTSVQYPS
FT                   SPLDESLAKRPSNPARGTTAVMLYGFDHMGAGDGDCGGGE"
FT   sig_peptide     673500..673565
FT                   /locus_tag="Bamb_3803"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability1.000) with cleavage site probability 0.552 at
FT                   residue 22"
FT   gene            complement(674197..675534)
FT                   /locus_tag="Bamb_3804"
FT   CDS_pept        complement(674197..675534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3804"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="KEGG: bur:Bcep18194_B1627 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3804"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89358"
FT                   /db_xref="GOA:Q0B915"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B915"
FT                   /protein_id="ABI89358.1"
FT                   /translation="MGLRQSPIRPHIMSNLIVHGGTPLRGDIQPSANKNAVLPILCASL
FT                   LTDQPLRLVGVPDITDVRKILDIFRTLGSDVSVDFTTGILELHHRNTTFDPAVHRLPEA
FT                   MRSSIMLIPPLLARFGVARLENDVKGCTLGVREIDPHVEVFERFGAHIERTPDSLIVRA
FT                   DGPLTANHHWFDYASVTTTENFALCATAASGTSTLMNAASEPHVQEFCQFLAMIGVSIE
FT                   GIGTSRLCVTGGGKLGGGEFRFAEDFHEIATFLALGAITGGDITVRNSSPEHFPLIDRT
FT                   FAKFGVTVTHRDGWSRAERDGPLRVRRPFTQNILTKVEAAPWPYVPVDLLPIFIALGVR
FT                   AEGSAMFWNKVYDGALGWSGELSKFGAHVLLSDPHRLITFGGLQLTPARVESPYIIRVA
FT                   IALLMVAASIEGRSEIMNALPIRRAHPHFVENLRSVGANVEWTSSE"
FT   gene            complement(675709..677016)
FT                   /locus_tag="Bamb_3805"
FT   CDS_pept        complement(675709..677016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3805"
FT                   /product="metabolite/H+ symporter, major facilitator
FT                   superfamily (MFS)"
FT                   /note="TIGRFAM: metabolite/H+ symporter, major facilitator
FT                   superfamily (MFS); PFAM: General substrate transporter;
FT                   major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B1626 citrate-proton symport"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3805"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89359"
FT                   /db_xref="GOA:Q0B914"
FT                   /db_xref="InterPro:IPR004736"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B914"
FT                   /protein_id="ABI89359.1"
FT                   /translation="MTPTFDTLDAAAGARARSQARKAAIGSFVGAVVDWYDFLLYGIVA
FT                   ALVFNSEFFPKISPTMGTLAAFATFGVGFLFRPLGGVVFGHFGDRLGRKRMLVLTVMLM
FT                   GLSTVAIGLLPGFATIGWWAPVLLVLMRAIQGFAVGGEWGGAALMAVESAPKQKKAFYS
FT                   SGVQVGYGVGLVLATGIVSILSHTLGEAAFKSWGWRLPFVFSIVLVLIGLWVRKSMDES
FT                   QEFVEKVEHGNRKLRLPVLEALTRHPKAFLLIVALRLAELFTMYIVTAFALSYSTSNLG
FT                   LSRDLFLNIGLLVGAVSCVTIPCFAWLADRFGLRRIYLIGAVIGLVSAVPFFVALESRS
FT                   IAWIVVFSILLANAAHDMVVSVQQPLFTELFGAEYRYSGAGVGYQFASVVGGGFTPFIA
FT                   VALVSMAGGSWHFVAAYLAVGCLISLVVAARMRAAQ"
FT   gene            677372..678499
FT                   /locus_tag="Bamb_3806"
FT   CDS_pept        677372..678499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3806"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bur:Bcep18194_B1625
FT                   4-hydroxyphenylpyruvate dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3806"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89360"
FT                   /db_xref="GOA:Q0B913"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B913"
FT                   /protein_id="ABI89360.1"
FT                   /translation="MPGTSHPLSSDTPPVADPAANPLGMAGLEFVEFAAPVPDALAQRF
FT                   EQLGFKAIARHVSKNVTLYRQGQMQFLINAEPESFAARYAEEYGMGVCAIGLRVASARR
FT                   AFERAIELGAWAFEGERIGVGELKIPAIQGIGDSHLYFVDRWRGRDGQRGGVGDISIFD
FT                   IDFRPIDIATAHTDHDCVGTGLKQVDHFTQTVGAGRMREWLDFYHDLLHFREIHEIDAH
FT                   WHVSEESRVMVSPCGAVRIPVYEEGTRRTELMHAYLPDHPGEGVQHVALSTDDILASVD
FT                   ALRANGVEFIEPPARYYDEVDARLPGHGVDLDALRRRAVLVDGEIGSDGVPRLFFQTFV
FT                   KRRPGEIFFEIVQRKGHHGFGEGNLAALARARDAG"
FT   gene            complement(678680..680014)
FT                   /locus_tag="Bamb_3807"
FT   CDS_pept        complement(678680..680014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3807"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein; KEGG: bur:Bcep18194_B1623
FT                   uncharacterized protein related to capsule biosynthesis
FT                   enzymes-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3807"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89361"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B912"
FT                   /protein_id="ABI89361.1"
FT                   /translation="MARRPRHDRLDLWMNGIPVGYWEVRRGVERLVYLPAWIDDPQGRP
FT                   LSLSLPFTPGNQPHQGAIVADYFDNLLPDSQPIRRRIAQRYRLGSTAPFELLASIGRDC
FT                   VGALQLLPPDETPVDLQAIDGTALDDAAVADVLRHATAAPLPGHAEPDGELRLSIAGAQ
FT                   EKTALLRHRNRWLLPAGSTPTTHIFKLPLGRVGNMQADMRTSVENEWLCSKIVAAYGLP
FT                   VAACDIGRFDDQKALIVERFDRRPSRDGTWILRLPQEDMCQATGTPSGAKYESDGGPGI
FT                   ATIMGILANSAEAAQDRNNFFVTQLVFWVLAAIDGHAKNFSIAHLPGNTYRSTPLYDVL
FT                   SAHPIIGTRRNQLPPRRARLAMAVCGKNRHYVIADIQPRHWIAQGARVGLTEDEVRAAM
FT                   AAVAARTEPAIADVASRIPADFPADVADAIFDGMRRQARKLGAAD"
FT   gene            complement(680017..680454)
FT                   /locus_tag="Bamb_3808"
FT   CDS_pept        complement(680017..680454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bamb_3808"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   bur:Bcep18194_B1622 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bamb_3808"
FT                   /db_xref="EnsemblGenomes-Tr:ABI89362"
FT                   /db_xref="GOA:Q0B911"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q0B911